4X6AH

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription/dna
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x6aH00
3CP0A 4JOIC 5C4XH 4LF7L 4OONA 4KLKA 1E24A 5H1SE 2ZJRA 1OXVA 3KF6A 1CKMA 1VQCA 3JC66 4GLXA 1Q7YC 4LF7Q 4JI5L 3GTOH 4DR7Q 1BVSA 1EOVA 5GAHC 3HKZG 5GAGC 4A3EG 1K9MC 5JJKA 1MJCA 1CKNB 4GKKQ 1N36Q 2VW9A 4R1JA 2HIXA 4KHZA 3FKIH 3I4MG 4BXXH 1KC8C 4A3JH 1L1OC 3M4OH 4DR4L 1WCMH 4A3LH 3K7AH 3G71A 4IFDG 1VQFA 4A3BG 3HKZE 3PUXA 4R4TA 1SMXA 1R9TH 1KL9A 2VQEQ 1B8AA 3L2PA 4C3JH 4QY7A 4X65Q 1KIXA 1HNXQ 4BY7G 4UY8C 3CC7A 3H3VH 1GO3E 3TQYA 3S16H 4LFCL 4X62L 3KDFB 2R92H 2RHSB 2OTJA 4DK6C 5LMNL 3KLWA 2F4VL 3NENA 4DUZL 2MO0A 2Z0SA 4KI0A 4A3DG 4LFCQ 1VQAA 3UDFA 4DPGA 3CCVA 4IOCA 1K73C 3J81i 2F4VQ 4JYAL 4EX5A 4LNQA 1FJGQ 1E1TA 5C0XG 1J6QA 4JBWA 1XMQQ 4X66L 3RLNA 4A75A 1A8VA 4IPGA 3EBEA 2NN6G 4DUYL 1Y14B 3LGJA 4HJ9A 1Q86C 1C9OA 2BH8A 4X66Q 1VQEA 2NVXH 4HJAA 4IJHA 4L5RC 1VQHA 2HQLA 1VQOA 4DUYQ 4A3EH 3HOWG 1WJJA 1I94Q 2IT1A 1EIYB 3KYHC 3ULLA 5LMNW 3I4MH 4B3ML 1PH9A 3JAMc 3TRZA 4IPDA 2NVYH 5FJ8G 1E22A 4LF6L 4JV5L 1IBML 4A3BH 1I3QH 4B3MQ 3W1BA 1X3FA 4JI8Q 1YEZA 4GKJQ 3S1NH 4PMWA 4HIDA 3DM3A 5IY0A 4BY7H 1EWIA 1TWCH 1N33L 3S1RH 1H95A 2NVTH 4LF4L 1VQGA 4HIMA 3S2DH 4NXNL 3M9BA 4BA2I 4OX9Q 4P75A 3CCSA 5EAYA 4A3DH 4GLAC 4LF4Q 2B63H 2Y0SG 4NXNQ 1BBUA 4JI0L 2IY5B 1PHJA 4DV5L 4A3CG 1IBKL 1GVPA 1Y1WG 3RZDH 1X55A 2AHOB 1EFWA 1NE3A 1PH6A 3BZKA 3RNUA 1PYBA 2YU9H 3U58A 3KF6B 4HJ7A 2UUCL 2ES2A 2K5HA 4LFAL 1VQPA 3PF5A 3S15H 2Y0SE 4LF9L 4JI3L 2Q2TA 1GM5A 4LF5Q 4LFBQ 2CWPA 2VQFL 2HT1A 2Q2HA 1K8GA 3ULJA 3HOWH 3E9HA 1XNRQ 2LXKA 3I55A 3ZJYC 1XPRA 1N9WA 1KAWA 1RL2A 1LM0A 1PV4A 2BA1A 1JE5A 1NMFA 2JQOA 2PQAB 1HZCA 5FJ8H 2N3SA 4DR2Q 2K50A 4BA1I 4B3RL 2Z6KA 3DLLA 1N34L 1M90C 3S2HH 4YHHL 2B3GA 3UDIA 4BBSG 1Z47A 2ALYB 1NJIC 3WWVA 4B3RQ 4X64Q 4DR1L 4OWWB 2JA6G 3ER0A 1YZ6A 1IXRA 2WFWA 2RCNA 1G291 1MJEA 1HH2P 3A74A 2H5XA 4GN4B 4IOAA 5JJIA 2OQ0A 4NPSA 1XPUA 3CPWA 3CCLA 1N8RC 4BY1G 5IYBG 2QA4A 5IE8A 3CCMA 5BR8L 3JAMi 4RG1A 1VQKA 4DR6L 4A3CH 1A62A 2IHFA 2MFIA 4POFA 4Y7NH 1Y1WH 2OQKA 1NBWA 4GS3A 4PZ7A 4BBRG 3TS0A 2WAQG 2WB1G 5BR8Q 2K4KA 4JI7Q 3S1MH 3HOVG 3BJUA 1PFSA 2KCMA 1QZGA 2EQSA 1CSQA 2IX1A 3NELA 1OXTA 1HZBA 1K0RA 3G6EA 4JCVE 5IWAL 3TS2A 2WB1E 2NVQH 1EUJA 2ID0A 1C0AA 1EYGA 4YWLA 1VQIA 2E2JH 1L0WA 5IP9G 2R93G 1WYDA 4A3GG 2CFMA 3MXNB 2XGTA 4ME3A 2UUBL 4P71A 1NY4A 2HIVA 2EIFA 4DR7L 4BBSH 4PG3A 1X54A 2UUBQ 4DNIA 3W1GA 5IYDG 5C0XI 3L0OA 4A3MG 3KJPA 2JA6H 4O0AA 4GKKL 1Z9FA 2PI2E 3I4OA 1N36L 4OO1G 2NN6I 3G4SA 1S40A 2MO1A 1QZHA 1LTLA 4DK3C 4BY1H 5IYBH 1A0IA 2Z6KC 1KHIA 2R7FA 1G51A 2VQEL 4QL5A 1YHQA 3F2CA 2K5VA 2UXBL 1X6OA 1CSPA 1HZAA 4X65L 1HNXL 3CC4A 4BBRH 2JA7G 1NTGA 4XTCS 3PUZA 2UXBQ 4YWMA 3HOVH 4WJ4A 1YVCA 1Q1BA 3CXCA 3PIOA 1WOCA 1CKOA 3RLOA 4P73A 4HJ8A 2JE6I 1UWVA 2E2HH 1Q1EA 2ZTDA 3M85A 2BH2A 3S1QH 1D8LA 2XTIA 1FJGL 1XMQL 2R7ZG 5ELNA 3UE1A 1HNZL 3T1YL 1TWFH 2R6GA 5IP9H 3CC2A 4H02A 4A3GH 1QUQB 4FDBA 2R93H 4GN5A 1L1OB 2BA0A 2NZOA 1Q12A 4OWXB 4AYBE 1OXXK 1SN8A 5M5WH 3CCJA 1HNZQ 3T1YQ 3I4NG 1YBYA 3RR5A 4HJ5A 1VQ8A 4GLVB 5LMUL 1I94L 3Q8DA 5IYDH 4A3MH 2I0QA 1AE3A 3F8TA 1JMCA 1Y1VG 5LMUQ 3PV0A 1OTCA 3BZCA 1K3RA 3CCRA 1VQBA 4JI6L 4TVAB 1DGSA 3GTKH 1D7QA 2YTXA 4UP9A 4DAYB 2YV5A 4RMFA 1X3GA 1J5EL 1Q8KA 2D0OA 2D0PA 4JI8L 1X3EA 3UDXA 2A19A 1PH7A 4JI6Q 5HY6A 1B7YB 1GKHA 4GKJL 1EIFA 2QEXA 3GTLH 3PO2G 2JA7H 1J5EQ 1FL0A 2CQOA 3GO5A 1Q81C 4AQYQ 5M5YH 5DLQE 2HHHL 4R4QA 2UU9L 2Q2UA 4OX9L 3GTPH 2CWAA 1I6HH 3J80c 5JEAJ 3KOJA 1UE6A 1W3SA 2HHHQ 2UU9Q 3IRBA 2A8VA 2R7ZH 4IPCA 3D31A 3FP9A 1XTDA 3SGIA 3M3YH 1PH5A 3CMAA 2JA8G 3VDYA 1C7YA 3H0GG 2I5MX 4GOPC 4XIGS 4LF5L 1ASYA 3S24A 4MNOA 3HOYG 4LFBL 1K83H 2OWOA 3GD7A 3BU2A 1P8LA 3H15A 2JJQA 4A3IG 1XNRL 3PCOB 4YCVA 2E5LQ 1KRSA 1Y1VH 4YCUA 2N8NA 1LYLA 2QGQA 2VZAA 4IFDJ 1UE5A 1V43A 5C4JH 4DR2L 3M7NA 3H3VI 3CPFA 1CKNA 5M3MG 4GNXC 1UE7A 1GD7A 4JI2Q 4A4IA 3U50C 2NZHA 2CCZA 1QVCA 1E3PA 4R4IA 4X64L 1OXUA 2LXJA 3PO2H 2N49A 3J81j 4R4OA 4WJ3M 2UXDQ 2VNUD 2RF4A 3D0FA 4JG2A 3K81C 2I5LX 3T1HQ 5M5XH 1YJ9A 3K80C 2A1AA 4DV3Q 4JI1Q 1YHBA 1K8AC 4KHPQ 5K36G 5AJ3Q 1PH1A 3M4QA 5GROA 3U4VA 4DKAC 5C0XJ 4LF8Q 4OO1I 3HFZB 1OXSC 3PGZA 4QQBX 3GTJH 1FVIA 1VQ7A 2VL6A 3FHWA 4DV0Q 3RLFA 4ALPA 4JI7L 2JA8H 5JJLA 3H0GH 1VQ6A 3HOYH 1TWAH 2IX0A 5C4XG 4IFDI 1PH4A 4DV7Q 2UUAQ 4A3IH 2YTYA 3B6YA 1HNWL 1B70B 3J80i 1Q82C 3EIVA 1SRUA 4UP7A 1PA6A 1S72A 1HNWQ 5M3MH 4DV1Q 2KBNA 1IBLL 2ATWA 4UP8A 1XMOL 1QVGA 3K8AA 4TQUS 1VQMA 1HR0Q 2AWOA 1A63A 1I50H 2JEBI 5FLXc 3CCQA 3CCUA 1IBLQ 3UE0A 1XMOQ 3L7ZC 1T9HA 3GTQH 4A93G 1BKBA 1FGUA 3TEHB 1XJVA 3PUWA 5HGQA 2I5HA 3KFUA 2WP8J 2LSSA 3M4PA 1YHAA 3PSIA 4JI4Q 3PO3G 1TWHH 4C2MH 2DUDA 4DV6Q 4A76A 1IL2A 2ASBA 2DGYA 4IO9A 1HR0W 1N32Q 4MTNA 3K7UC 1JJ2A 1VCIA 3STBC 3RN2A 3U4ZA 4X6AH 1VQLA 1U0LA 4LUVA 3AYHB 4GOPA 4JBJA 4EQ5A 2ZJPA 2C35B 3AFQA 2UXCL 2GVBA 2AMCB 1PVOA 4AYBG 1VS0A 2VUMG 1AH9A 3F1ZA 3OW2A 2OCEA 4K0KL 2UXCQ 2E2IH 3STBD 1RIPA 4JI5Q 4J15A 3CMEA 4K0KQ 3ICEA 4A3FG 3PF4A 1Q46A 3PUVA 4PZ6A 3ULPA 2PQAA 2K5NA 1PYSB 4APVA 3I56A 2F52A 1SE8A 4DR4Q 3E0EA 4A93H 4B3TL 4QJFA 1EQQA 1EQRA 2K52A 1JB7A 3KJOA 5GADC 1SR3A 1UEBA 3K0XA 3NEMA 2E8GA 1AE2A 5J3BA 1KQSA 2ZJQA 4B3TQ 3J7ZC 3PO3H 2KHJA 1PH8A 3AEVA 2N78A 3F2DA 5IP7G 2JA5G 2KHIA 2B63G 2PMZE 4X62Q 1XNQL 3J7A5 5LMNQ 4AQYL 1QVFA 4DUZQ 1YIJA 1IZ6A 4IJLA 5E7NA 1E7ZA 1SFOH 1O7IA 1XNQQ 2PNHA 1VQ5A 2VS1A 4JYAQ 3W5OA 1V9PA 3CW2C 2VUMH 3RZOH 2R7DA 5IYCG 3OYYA 3AFPA 4DR5L 4GNXA 4O2DA 4JBMA 3GTGH 2JEAI 1X9NA 4DR5Q 3RN5A 1VQ9A 5GAEC 4A3FH 1SLJA 1ASZA 4HIOA 1IYJB 4NB3A 3HOXG 2D62A 3I4NH 1KXLA 2E5LL 4PZ8A 2GVAA 1G6PA 4LF6Q 3GTMH 4JV5Q 3AQQA 4HIKA 1IBMQ 3CD6A 1MKHA 4A3KG 1WI5A 3OTOL 1M1KC 5IT9c 5C44G 2MNAA 4JI2L 5C3EG 3A5UA 1LUZA 3KF8B 1YJWA 1TXYA 4IPHA 3UDGA 4OWTB 4YCWA 3OTOQ 3S14H 1N33Q 4C3IH 5IP7H 2JA5H 2UXDL 4B3SL 5FLMG 1BBWA 3T1HL 1VQJA 1YITA 1KRTA 2K75A 5M3FG 4B3SQ 3HOZG 1S3OA 2AKWB 4LUZA 4JI1L 2JA9A 4DV3L 4JOIA 4GOPB 4JI0Q 4KHPL 3I2ZA 2FXQA 3I7FA 5AJ3L 4DV5Q 1IBKQ 4LF8L 1HJPA 4L5QA 3HOUG 4NXML 5IYCH 1PH2A 1W2BA 5GQOA 4AH6A 2ZM6L 4L5SA 2YYZA 4DV0L 2UUCQ 4LFAQ 4OXPA 3KDFA 4P72A 2CKZB 4NXMQ 4JI3Q 1L2FA 4QGUA 1PH3A 2ZM6Q 2MQHA 4AIMA 2VQFQ 3MEFA 2IHEA 3CCEA 1HZ9A 1VQNA 4GNXB 4Y52H 3CAMA 4DV7L 2UUAL 2V1CC 3HOXH 1QUQA 2PI2A 4DV2L 3A0JA 1L1OA 1X56A 4P74A 4DV4L 4L5TA 2F3IA 1UE1A 2GN5A 1JT8A 4LWCA 4DV2Q 2ZTCA 4A3KH 1N34Q 4YHHQ 4R4CA 4DV1L 3CQZH 5C44H 4DV4Q 1VQ4A 5C3EH 2K14A 4LUOA 1HR0L 1U5KA 4LW1A 3PIPA 4DR1Q 1I5FA 1WFQA 1KD1C 2OTLA 1JJGA 3FKIG 4BXXG 2EXDA 4A3JG 5FLMH 3GDEA 3ERSX 3G48A 4GN3B 1WCMG 3J81c 1YI2A 4A3LG 1SROA 1E1OA 2JK8A 3PUYA 1YNXA 5M3FH 1MIUA 1P16A 4DAMA 2KCTA 4YWKA 4JBKA 2B29A 1CUKA 2YTVA 3NBHB 3HOZH 4DR6Q 4DR3L 2Q2IA 4POGA 4JI4L 3HOUH 3E9IA 3A5ZB 2VY3A 4UPAA 4DV6L 3F2BA 3CF5A 1YJNA 4LF9Q 1VQDA 4QIWE 2ZTEA 3EN2A 1V1QA 4YY3L 4DR3Q 1N32L 2R92G 1XPOA 2L15A 1JJCB 1NMGA 2RHQB 1TWGH 2WAQE 3S17H 4YY3Q 2AWNA 2KENA 1X65A 5ELOA 5JEAG 4JC0A 4MZ9A 4C3HH 5IWAQ 3TREA 3HKSA
chains in the Genus database with same CATH superfamily
4JOIC 4LF7L 4KLKA 1K3BC 1OXVA 5JJZA 3GTOB 1QWYA 4JI5L 1TU2B 3EA6A 1MJCA 3ITPA 1V8QA 1K8MA 4JVZA 4KHZA 3FKIH 3I4MG 2IPKD 2F0EA 4QIWB 1WCMH 4IFDG 2OEOA 2VQEQ 3L2PA 1HNXQ 3BDCA 3VYSA 1V1PB 4UY8C 1CQVA 5JAVA 3TQYA 3K59A 3S16B 5I9PA 2D2CC 3T53B 2R92H 2B2VC 2RHSB 3T51B 3KLWA 2MO0A 1QOHA 5A2QE 5JEAH 3SR1A 4A3GB 3J81i 4JYAL 4EX5A 3H09A 5C0XG 4X3UA 5ELFA 4X66L 1XMQQ 4IPGA 3EBEA 2NN6G 4DUYL 1Y14B 2NVXB 3KLSX 4RKBA 4IJHA 1KLGD 2AUKA 3ND9A 2HQLA 4A3EH 1I94Q 1TIID 2IT1A 2HD3A 1O7YA 4I65A 4G57A 3KYHC 1PH9A 1FNWA 4LF6L 4JV5L 1RD9D 1YNNC 4KK7A 2RVLA 2JA7B 1X3FA 4GZYC 1V1OA 4GKJQ 2NTTA 4HIDA 2SNMA 1N33L 5KYLA 3K0YA 2O5IC 5CV4A 5FLXE 3CCSA 1S5FD 5C5LA 2A6EC 4NXNQ 1BBUA 1F9SA 4IZ8A 2IY5B 4DV5L 4N8X1 1EFID 1X55A 1NE3A 3F2UA 3MXUA 3BZKA 4ME5A 4RH6A 3RNUA 2YU9B 3KF6B 2EYLA 1YNJD 5C4ZA 2Q2TA 1GM5A 1SYFA 1JOOA 1STGA 1F9QA 3P1HA 3E9HA 5DAUA 3I55A 1XPRA 1FGBD 1PV4A 1JE5A 1NMFA 2JQOA 2K50A 1GOZA 1II3A 3S2HH 4ZUIA 3PO2B 2B3GA 4BBSG 3HZXA 1Z47A 4DXFA 2FMMA 4FNFA 4DR1L 3QO2A 1B9NA 2J7ZA 1LT4D 3ER0A 2JA6G 1IXRA 2RCNA 1MJEA 4GN4B 5JJIA 3CHBD 2B2VA 1XPUA 1BQQT 2FMCA 1N8RC 3A7LA 4BY1G 2QA4A 5IE8A 1U4MA 4DR6L 4RG1A 4A3CH 1PRTB 2MFIA 3AB9A 4FXDA 3S1MH 1PFSA 3J80L 1HA5A 2EQSA 1K0RA 3VYRA 4JCVE 5IWAL 2ID0A 3VR2A 2E2JB 3MXNB 4EQOA 4RWSC 1NY4A 1I50B 2XIWA 4DR7L 4KJOA 4BBSB 2UUBQ 2JXMB 1UUPA 1Z9FA 1HUNA 1HFGA 1N36L 1CQFA 1S40A 4QMGA 4F8MA 1QZHA 1LTLA 3P75A 4DK3C 4BY1B 1A0IA 1I4GA 3PQIA 2R7FA 1VMCA 4CJ2C 1YHQA 2UXBL 4ODGA 1CSPA 4X65L 1I4PA 5IT9E 1EEID 1KDCA 3HP3A 3PUZA 1DZ1A 4YWMA 1B44D 5LL6S 4TRDA 3PIO3 1SSOA 1CKOA 4O1NA 4P73A 4X3SA 2E2HB 1IKMA 2ZTDA 3S1QB 1PZKD 2X69A 4JPBW 1HNZL 3J7AF 2R6GA 4A3GH 1QUQB 4GN5A 4U68A 4X3KA 4OWXB 4AYBE 1IHZA 5M5WH 4GNXA 4G7ZC 1ENFA 1DYQA 4CJ1B 2DY8A 1LTBD 1EOTA 3DMUA 2I0QA 2A68D 4OO1H 4MIUA 2B2YC 1K0SA 1FD7D 3PV0A 1OTCA 4FXGC 1K3RA 3PO3B 1F2LA 1DGSA 2EY1A 4EGVA 2D0OA 1X3EA 1B7YB 1Y8PB 1TT2A 3GTLH 2AQ3B 2JA7H 1A3UA 2CQOA 4PV1C 5DM73 1B9MA 2CWAA 3L9AX 5JEAJ 1TY2A 5KRUA 3J81E 1W3SA 2L4NA 2HHHQ 2UU9Q 2F0HA 3MFGA 3WOEA 4IPCA 2R7ZH 3D31A 4RKLA 1PTOD 3H0GG 4LF5L 1AP0A 1DOMA 3L3OC 1K83B 3GD7A 3V96A 2A74C 1NSNS 3PCOB 1QE6A 2OT2A 2NZ1D 1PTOB 4YCUA 2K5QA 3ONAB 2EY5A 1PFBA 2F0KA 1UE5A 4DR2L 3A55A 3H3VI 1CKNA 3DEPA 1UE7A 4JI2Q 2X6GA 2B2TC 4A4IA 2HCIA 4C1NI 4B08A 4WJ3M 3PO2H 1SMYC 5EKIA 1Y8OB 2QF7A 4JG2A 4RA8A 4KY5A 3K81C 3K80C 1KDBA 1YHBA 2KEEA 1PH1A 5GROA 1SMYD 3HFZB 1OXSC 3GTJB 1VQ7A 1PYWD 1B1ZA 1EL0A 3H0GB 1TWAB 1TKWB 5C4XG 2YTYA 3J80i 2ICIA 4RHSA 1PA6A 2A69C 2B2YA 1LTSD 4DV1Q 1IBLL 1EY5A 4UP8A 3K8AA 4KD4A 5J39A 2AWOA 1I50H 2JEBI 5ISRA 2Z4IA 2J4XA 3UE0A 1XMOQ 4S3SA 4IUVA 3L7ZC 3E6ZX 4C3JG 2I5HA 1QNKA 3KFUA 2WP8J 5EPKA 1TWHH 3Q22A 4C2MB 4A76A 2ASBA 1ZYRC 3I8ZA 1SE3A 2XSCA 1DM0B 4MTNA 3K7UC 5KEEA 4X6AH 1STEA 5C4XB 1A3TA 1GXDC 2A73B 3VA7A 3AYHB 3I4LA 1GUGA 2UXCL 4B9WA 4XT1B 3NXWA 2JP1A 2O5JC 3H3VC 1VS0A 3HEJA 3GV3A 1QCBD 3A56A 1U4LA 2XVSA 4K0KQ 4A3FG 3MHBA 2O2LD 4HCEA 2F03A 1HFNA 3K7AB 2F0JA 3SK5A 2PPBC 4C3JB 1JB7A 1S4ZA 1UEBA 2ZJQA 2K5WA 3PO3H 2BE5C 5IP7G 2KHIA 1EYDA 4X62Q 1PTOF 5LMNQ 1I6VC 4AQYL 3NTKA 3T16A 5C3WA 1E7ZA 5KNCA 1XNQQ 2BDNA 2PNHA 1VQ5A 1NCVA 3CW2C 1JWMD 3OYYA 4OHJA 2IL8A 4JBMA 2PW5A 2JEAI 5EGTA 4A3FB 1NNXA 1TS2A 1ASZA 1IYJB 3OMCA 1KXLA 2EYOA 4PZ8A 4OELB 1G6PA 3GTMB 1IBMQ 5FOBB 2QDLA 1PTOH 1MKHA 1TWCB 1WI5A 2N55A 4RCNA 2HCCA 5C44G 2MNAA 1LUZA 3NBIA 3S14B 1M8AA 2E74C 4C3IH 2JA5H 5FLMG 3BVZA 1WD0A 1VQJA 2F0QA 4B3SQ 5M3FG 3DUZA 2EXZA 2RSNA 4JI0Q 3I2ZA 5AJ3L 4RGTA 3HOUG 1HJPA 4YIJA 1EQVA 3HS0C 1RTOA 2C5CA 2VB3X 2UUCQ 4FXKC 4OXPA 4QGUA 1PH3A 2ZM6Q 3MEFA 1DONA 3TDQA 4DV7L 2UUAL 3HOXH 4C3HG 2PI2A 1BO0A 2AUJD 1B3QA 4DAVA 3NUCA 4HSPA 4L5TA 1UE1A 2EPBA 3NWTA 3MXPA 1RKNA 4YHHQ 4R4CA 1AEXA 5C44B 1HR0L 3PIPA 1I5FA 1JJGA 3D4WA 3FKIG 4CDDC 2EXDA 4DAYA 3JAML 1YI2A 1WCMG 1XTCD 5ELEA 2JN4A 1SROA 1E2ZA 2JK8A 5M3FB 4FF2A 2B29A 2RBMA 4DR3L 2O4XA 4JI4L 3HOUB 4QUCA 3F2BA 1Q90A 2R92G 2EYFA 1HHVA 1XPOA 2L15A 3KUPA 2CW0D 2RHQB 3S17H 1X65A 5JEAG 4K8JA 4C3HB 1G8ZD 3GTQH 1DD2A 3J80E 5C4XH 4OONA 3MFYA 1E24A 4J1MA 5FO7B 1HRJA 1CKMA 1CTMA 1VQCA 3D3RA 3JC66 4GLXA 1BVSA 1EOVA 5GAHC 3V2TA 4NW2A 3HKZG 4A3EG 1K9MC 5JJKA 5JPNC 2L55A 3FEWX 5IODA 4R1JA 3FKIB 4BXXH 4A3JH 1L1OC 1MHWC 4DR4L 1WCMB 3K7AH 3G71A 3PUXA 2HUGA 2RKSA 2WAQB 1KL9A 1EEFD 1B8AA 1TS4A 4C3JH 5LHY1 4I7ZC 1EY7A 4QY7A 3H3VH 1KABA 4QB4A 3KDFB 2R92B 3GV6A 2OTJA 3NENA 4LFCQ 1TQOA 4LNQA 1J6QA 4JBWA 3MXGA 2DJFC 4HJ9A 1EQTA 2BH8A 3MZ5A 1VQEA 4A3MB 1KTKA 4L5RC 1VQHA 3HKZB 4A3EB 1TVXA 3X3MA 2GA4B 4XYQA 2L5TA 3BG3A 3ULLA 5LMNW 2NWGA 3TRZA 4IPDA 3ZYYX 1PFNA 1WTOA 4B3MQ 4JI8Q 5D3DA 4PMWA 3DM3A 5IY0A 1EWIA 1TWCH 3WDNA 1H95A 3A7AB 1VQGA 4QF4A 4NXNL 1CHQD 2K5DA 5EAYA 2A5HA 2Y0SG 5FKAC 1BXTA 1DOKA 4A3CG 4I7AA 1H9RA 5T1GA 1JICA 2G5DA 2D5DA 3BDLA 3GQBA 2C9OA 3U58A 4HJ7A 3Q23A 4KJNA 3S15H 1HQRD 1RDPD 4NDXA 4LFBQ 1MBYA 2HT1A 1K8GA 4V190 4LMQD 5C4HA 4K5VA 1XNRQ 3ZJYC 1ET6A 3EVQA 1N9WA 1KAWA 1LM0A 1HZCA 1ESRA 2N3SA 2CH4A 2F0OA 4BA1I 2BCOA 2MP1A 1N34L 1M90C 3E3XA 3UDIA 4DFAA 3U9OA 1LTAD 2XRQD 4H7BA 4CGYB 5CV6A 1MGSA 2H5XA 2F0FA 4ZKCB 3FDTA 3CPWA 3JAMi 4POFA 4Y7NH 2OQKA 1NBWA 4PZ7A 2KA7A 3TS0A 1IW7D 1HA6A 2WB1G 4JI7Q 3S1MB 2KCMA 1QZGA 3KLRA 3NELA 2RDHA 4IQZA 2NVQH 1C0AA 1EYGA 4M1UB 1VQIA 5M3MB 4M8AA 4A3GG 2K03A 1MSGA 2UUBL 4P71A 5ELBA 2H1EA 1NUCA 1VMPA 1CHPD 3W1GA 4DNIA 3KBXA 5C0XI 4GKKL 2RSOA 4OGQC 2PI2E 3I4OA 4OO1G 1O80A 2G9HD 2NN6I 3RD4A 4FYDA 1XWEA 2XRSD 3F2CA 1HZAA 2PQEA 2A6HC 3CC4A 2JA7G 2WB1B 3HOVH 2F0WA 2LKVA 3CXCA 4DK1A 2B8FA 1WOCA 5ELDA 4KMUC 2BH2A 4WRDA 1D8LA 2WACA 1FJGL 2R7ZG 5ELNA 3IKJA 1D5XC 4H02A 5M5WB 1Q12A 3NSWA 4DNTB 1OXXK 2CHBD 3I4NG 1A6XA 1SE4A 3KBGA 5ELCA 3R2IA 3RR5A 1VQ8A 5EKLA 4A3MH 3I3CA 3F8TA 2F0SA 5LMUQ 3BZCA 3CCRA 1WTRA 2YTXA 4UP9A 4RMFA 1Q8KA 1PH7A 1GKHA 2CVRA 3NQTA 4F88A 3GTLB 3PO2G 1WTWA 1FL0A 5CV8A 1Q81C 1SFOB 1M4VA 3NBHA 5M5YH 2HHHL 2UU9L 4OX9L 5JVH3 2Q2UA 1I6HH 4ULLA 3DWAA 3KOJA 1YNND 3IRBA 2A8VA 4XXEA 2XN9C 2R7ZB 3FP9A 1E2VA 3SGIA 3M3YH 1R4QB 3I4NB 4GOPC 4XIGS 3S24A 5IGCA 2OWOA 1P8LA 1SYCA 2A6ED 2E2DC 4K14A 1H9KA 2N8NA 1LYLA 1V43A 5C4JH 4GNXC 1GD7A 5F2DA 3URYA 1W6KA 2MPMA 1E3PA 4X64L 5BN5A 1LABA 4H13C 2UXDQ 1QG7A 2VNUD 1HPCA 5M5XH 1YJ9A 4DV3Q 4JI1Q 5CV5A 1HCZA 5FO9B 2EJGC 4P2CB 3FHWA 4DV0Q 5D14A 2JA8H 1HTLD 1VQ6A 3T13A 3QWNA 1KNEA 2QDBA 4UDUC 3B6YA 2HDLA 1B2TA 3G6JB 3Q0AA 4UP7A 1S72A 3MEHA 5M3MH 1XMOL 3FVQA 1F2YA 5FLXc 3CCQA 5FK9C 3Q24A 1EYCA 1L0XB 1TY0A 1K8OA 1FGUA 1XJVA 1WD1A 3JAME 1S5CD 3M4PA 1BCPC 5EBDA 3PO3G 1TWHB 1ILPA 1IL2A 4DV6Q 1U4RA 3NK9A 2DGYA 1TWGB 4PMBA 1C48A 1HR0W 1N32Q 2F0NA 2EE1A 3RZOB 3RN2A 2CH4W 1I4XA 1D1IA 4GOPA 4JBJA 2C35B 3AFQA 5CBEE 2OCEA 2EOTA 4K0KL 5EJWA 2RA4A 5KNBA 3NHHA 4JI5Q 2EJFC 1Y8NB 4UHVA 3EROA 3ICEA 1QNUA 3PUVA 3M4OB 2E75C 1A3VA 2F52A 1SE8A 1R9TB 1ZKOA 2XNAC 4QJFA 1EQQA 1SXTA 4RGOS 3KJOA 2QEJC 4B3TQ 3K5NA 3AEVA 1U4PA 1U9RA 4C3IG 2JA5G 3M7GA 2PMZE 1XNQL 4LJZC 1QVFA 3CRKC 5E7NA 1SFOH 1EU4A 3TMEA 1CT1D 4HEDA 1XYIA 2VS1A 4JYAQ 3AU7A 1EWHA 3D4DA 2L9HA 2F0VA 2KHSA 3AFPA 1E2WA 3DWQA 3OIQA 3GTGH 1JCKB 3O13A 4DR5Q 1GHJA 1VQ9A 3CU7A 1SLJA 3HOXG 4NB3A 2NVYB 3MXNA 3I4NH 1SYDA 1RTNA 2E5LL 1ONLA 2F0DA 1EIHA 4LF6Q 4JV5Q 4MHEA 3CD6A 4JK1C 5JVG3 4BY7B 1RCVD 3QOLA 5IT9c 3S1RB 3A5UA 3KF8B 1YJWA 2WKCA 1DJRD 1TXYA 4IPHA 1IYUA 2D9UA 2WKDA 3OTOQ 1N33Q 4C3IB 3MTSA 4Q5VA 2JA5B 4B3SL 2KECA 5KYIA 1BBWA 3T1HL 3OMGA 1YITA 2K75A 4KY7A 4KHPL 3I7FA 5TSSA 2F0PA 4DV5Q 4LF8L 4FVMA 5IYCH 2ZM6L 4L5SA 5E1FA 2YYZA 1AN8A 4P72A 2OF1A 1L2FA 2MQHA 3CCEA 3NTIA 1HZ9A 4ZYSA 3HOXB 1QUQA 3NP8A 1LTGD 1X56A 4NKLA 3LX0A 4K2LA 2FINB 3P7JA 4CJ0B 3SK4A 2GN5A 1JT8A 4LWCA 5CC4A 4H44C 2ZTCA 4K6DA 1PZID 3E0JA 5T1IA 4LUOA 4LW1A 4TSSA 2EYJA 4DR1Q 2VB2X 2BDOA 4CDFC 4IALA 4BXXG 4A3JG 3G48A 4GN3B 3J81c 1E1OA 2HQEA 1C8CA 4JBKA 2A69D 2KCTA 4YWKA 2YTVA 1IKLA 4DR6Q 4POGA 3E9IA 1YJNA 2VY3A 1GUTA 4QIWE 2ZTEA 1PDQA 5I2XA 2H4OA 1TWGH 3TN2A 1PFMA 3S17B 3QG1A 2AWNA 2KENA 2LY7A 4ZRZA 3SK6A 2AQ2B 5G3LF 4JC0A 3RZOH 4MZ9A 3GTQB 5IWAQ 2LS01 4G7OC 3FRPB 3NWSA 2NBFA 3H6MA 5H1SE 1B3AA 1ZYRD 1JORA 2EVBA 4DR7Q 1EIGA 1AW7A 5AFWA 4LAAA 2WIIB 2QILA 1N36Q 2Z6BA 1KC8C 4A3JB 4K8IA 3DHQA 2B8GA 3M4OH 3GP7A 4R4TA 1R9TH 5A2QL 3A54A 4X65Q 4Q0FA 3T4AC 2SNSA 4LFCL 5DNFA 4DK6C 4DUZL 2Z0SA 3MAQA 3S9WA 2R93B 4IOCA 4DPGA 3CCVA 2F4VQ 3RLNA 3VR3A 2KEDA 5BN3A 1HQMC 2BE5D 3LGJA 2DJGC 2ZT9C 1C9OA 4HJAA 1C4QA 1WJJA 3N52A 2F0IA 1S5DD 4B3ML 2NVYH 3R3OA 1E22A 4A3BH 1I3QH 5FLXL 1O7ZA 3DWPA 1CA5A 4JW0A 1CFMA 2K1BA 3S1NH 1G91A 4MN3A 1A15A 4BY7H 3S1RH 3S2DH 4KKTA 4BA2I 4P75A 1ML0D 4A3DH 1LO5D 4LF4Q 1TR5A 5E3FA 3DXJC 4CKBA 1IBKL 3RZDH 4EQNA 5EPJA 1PYBA 1ZEQX 4R8NA 4LFAL 1UNSA 3PF5A 3S15B 4JI3L 4LF5Q 2VQFL 1G2TA 3ULJA 3HOWH 2LXKA 1ICWA 1GUNA 2RQXA 2PQAB 3CKIB 1LTID 5FJ8H 4DR2Q 1IL8A 2Z6KA 3I73A 3ERQA 2LMCB 4KTAA 2ALYB 2IJ0A 2QKIC 1NJIC 4B3RQ 2F3VA 4OWWB 1YZ6A 2WFWA 4IOAA 1HH2P 5LL6X 4QUFA 2OQ0A 4NPSA 2EYHA 1QILA 4HAEA 1WTPA 3CCMA 1VQKA 4WJWA 1A62A 1Y1WH 4K6LA 4Y7NB 4LF9L 4GS3A 2WAQG 5BR8Q 4ZQ3A 2K4KA 3HOVG 4ZCKA 2EZVA 1CSQA 2IX1A 1HZBA 4B9XA 1ZXTA 3G6EA 3TS2A 2NVQB 1EUJA 4YWLA 1L0WA 1T5XD 2CFMA 3FPUB 4ID6A 2HIVA 2EIFA 5I2YA 1IYVA 4PG3A 2F0UA 3L0OA 4A3MG 2XWJB 3T56B 3X3NA 2MO1A 5DEHA 3K58A 2Z1CA 5IYBH 2Q8IB 1ICFB 2VQEL 2K5VA 1HNXL 3C3LA 2DNEA 1MI2A 4BBRH 5E4WC 4FF1A 1NTGA 3HOVB 2KCNA 4WJ4A 3PIOA 3RLOA 4HJ8A 2JE6I 1UWVA 4RFBA 3M85A 2PO4A 1XMQL 1TWFH 5IP9H 3CC2A 2R93H 5C6AA 4FDBA 1L1OB 2BA0A 3CCJA 4HSVA 1GJXA 3T1YQ 1B50A 1YBYA 4HJ5A 2F0LA 4GLVB 5K5PA 4KV6A 3Q8DA 5LMUL 1I94L 5IYDH 1AE3A 4DA2A 1HTPA 1L0YB 4FP5D 1JMCA 1D5MC 1E0BA 5IGGA 1JC7A 1VQBA 4TVAB 3KLSA 2L12A 4KN4C 1GUOA 2D0PA 4X3TA 4IUUA 3IAYA 4GKJL 4JI6Q 5HY6A 3J81L 1EIFA 5I6YA 4HN7A 1J5EQ 1TS3A 4KY6A 4AQYQ 5M5YB 1JWSD 5DLQE 4R4QA 2KVMA 1I6HB 5CR3A 4AYBB 3J80c 3DEOA 2LFNA 3TP7A 1SE2A 2K33A 4H0LC 4KD3A 3M3YB 2WV6D 3P20A 2JA8G 3VDYA 1C7YA 1ILQA 2I5MX 1ASYA 4MNOA 1X3QA 4J8QA 3BU2A 5IIFA 2JJQA 1LT6D 1JR0D 4RCOA 1Y69U 3SEBA 4DK0A 1KRSA 1Y1VH 1LV9A 3C46A 2QGQA 2VZAA 5C4JB 2QW7A 4PNYA 5M3MG 3U50C 1WTHA 2NZHA 2CCZA 3HRZC 2LXJA 2N49A 3EFXD 2RF4A 3D0FA 1FNVA 2I5LX 5M5XB 1SYEA 5C5MA 5IOCA 2PCFB 1KNAA 5IGDA 5AJ3Q 4OO1I 3LWUA 1BF4A 1FVIA 2PZWA 3RLFA 5JJLA 2JA8B 2SDFA 4DGZA 3HOYH 4IFDI 4DV7Q 2UUAQ 1EY8A 4A3IH 3Q6SA 1B70B 1Q82C 1EZ6A 1PXUA 3EIVA 1SRUA 5C3EB 4XDXA 1I4QA 1HNWQ 3OHXC 2KBNA 2ATWA 1F9PA 1H9SA 1VQMA 1HR0Q 4FO2A 3D6CA 2KUMA 3CRLC 1D2BA 2KQ3A 3U9SA 2F3WA 3PUWA 5J22A 5IGBA 2LSSA 1YHAA 4JI4Q 4IO9A 1NR2A 3IFTA 3R93A 1JJ2A 3U4ZA 1X3PA 1VQLA 4LUVA 1AZQA 1A2UA 3OSOA 2ZJPA 4TKOB 2OXPA 3HGBA 3H94A 1AH9A 3OW2A 1Q8IA 2E2IH 2K28A 5CMDA 1RIPA 2A6HD 3G7LA 2EY2A 4CDCC 4J15A 1D6EC 5IGFA 1F2MA 1BBXC 2KCCA 1Q46A 4BS9A 4PZ6A 3TZDA 2ENBA 2B2WA 2K5NA 1ENCA 1PYSB 5HGTA 4APVA 4RGNA 3M4YA 3ND8A 4OIJA 4DR4Q 3E0EA 4A93H 4B3TL 3MC0B 1EQRA 3H91A 1SR3A 3K0XA 2E8GA 1SYGA 4J6HA 4N9PA 1PH8A 1EYAA 5L37A 3OWEB 2Z4HA 2B63G 2B2UA 1QB5D 3E5SA 1YIJA 4RHRA 1IZ6A 1F2ZA 4IJLA 2P5ZX 4R8IA 1O7IA 2X6LA 1Z6HA 1BOSA 1SYBA 3R8BA 3V05A 3SDZA 2VUMH 2R7DA 2RDFA 5IYCG 3I90A 4DR5L 4EVOA 3TP6A 3GTGB 4MTKA 3RN5A 3I4MB 3D8GA 2D62A 1SNCA 3J7YW 1EY9A 1JWUD 2FJ2A 1SBBB 1LTRD 3AQQA 4FF3A 3OTOL 1KDAA 1M1KC 4JI2L 4PQXA 2NVTB 3BVMA 2M2LA 4ABNA 4QCLA 5E4XA 3VR6A 4BWGB 1NAPA 1YNJC 2B63B 4PMCA 1CA6A 1KRTA 1GUWA 3I72A 4GOPB 2JA9A 4JOIA 2ICEC 4L5QA 5I9OA 2R61A 1V1PA 2DN8A 3NPPA 5GQOA 4HR7B 2CKZB 4NXMQ 2J0TD 4Y52H 1VQNA 4GNXB 1PRTC 2V1CC 2XWBB 3A0JA 4ZK9B 1AFPA 2ZXOA 4P74A 1JB3A 1ENAA 3BDOA 4DV2Q 3VR4A 5EBCA 3NE5B 4A3KH 1N34Q 4DV1L 4DV4Q 2Z9HA 4N9TA 5C3EH 1PRTD 2K14A 1PZJD 1HUMA 1U5KA 4KHVA 3PIP3 1WFQA 1KD1C 3BYTB 5D65A 1SNPA 4HTHA 3K57A 1LACA 3PUYA 3SVMA 4LK1C 4HCSA 3HOZH 1O7LA 1EZ8A 1KAAA 3VA5A 3TBIB 4XQNA 3A5ZB 4UPAA 3TP8A 1RHPA 1BDOA 1VQDA 4DXGA 1DXMA 1V1QA 5CBAE 1JJCB 1NMGA 2WAQE 4YY3Q 5ELOA 2MUYA 3LNNA 3TREA 3CP0A 1B4OA 3PMFA 4K2KA 1BCPD 2ZJRA 2MJ8A 4U673 3KF6A 5D3IB 3GTOH 1Q7YC 4LF7Q 4RAUC 2JA6B 1NR4A 1D1KA 2MGSA 5GAGC 1RF2D 4K5XA 1BCPB 1CKNB 4GKKQ 4WORA 2VW9A 2HIXA 5G3LD 1LT5D 1J8IA 4A3LH 3W2DA 1VQFA 4A3BG 3HKZE 1MD2D 1SMXA 4CKCA 5JOBA 1KIXA 4BY7G 4C56C 3CC7A 2F0TA 1GO3E 3S16H 1CZWA 3C1EA 4IUPA 1WTVA 4X62L 2K7VA 5LMNL 2F4VL 4KI0A 4A3DG 2A68C 1VQAA 3UDFA 1K73C 3VYUA 4G7HC 1FJGQ 1E1TA 4A75A 1A8VA 1VDZA 2DNCA 5CORA 3SE0A 1Q86C 3FMCA 4X66Q 2NVXH 1VQOA 5COYA 5KNDA 4DUYQ 3HOWG 2RDGA 1H9JA 3GTKB 1EIYB 3I4MH 3JAMc 5FJ8G 1VF5C 4IFDH 2K6AA 1IBML 4A3BB 1I3QB 3OOCA 1JOQA 3W1BA 3SXHA 1EY0A 1YEZA 3S1NB 1PTOC 1SEBD 3GTPB 4KN7C 4XQQA 3A8JE 3J7AV 2NVTH 4LF4L 2QCPX 4HIMA 3S2DB 3M9BA 4OX9Q 4L6TB 4A3DB 4GLAC 1EWCA 2B63H 3SK8A 2IWHA 4JI0L 1PHJA 1GVPA 5C0XH 3RZDB 1Y1WG 2AHOB 4R9WA 1EFWA 1PH6A 2YU9H 3NTHA 1CK1A 1K28A 2NN6H 3OW7A 2ES2A 2K5HA 2UUCL 1VQPA 2Y0SE 4ZLTF 2CWPA 4C1NK 4HMIA 2Q2HA 3HOWB 4DN4M 1SDFA 3MWYW 1PRTF 1O78A 1PMRA 4ZAIA 3NQIA 1SNOA 1G6ZA 1RL2A 3VYTA 2BA1A 3D4RA 5J1ZA 4OL7A 2IX3A 4B3RL 3DLLA 5IGEA 4YHHL 4WFN3 1F9RA 4F87A 3WWVA 2EYMA 4Z9CB 4X64Q 5EPLA 1G291 3A74A 4XQJA 3A8KE 3CCLA 5IYBG 5BR8L 1XX8A 2PNRC 2Z8LA 3QOJA 5JPMC 2IHFA 1Y1WB 4O42A 1ESFA 4BBRG 1BCPF 3IFDA 3BJUA 3DM1A 5CYUA 1OXTA 2F0GA 4DF7A 3W3AA 2WB1E 3I91A 2E2JH 1EY4A 2Q8TA 5IP9G 2R93G 1WYDA 1UAPA 2XGTA 5CV9A 4ME3A 4IUQA 4BBSH 3IL8A 1D5ZC 1X54A 5IYDG 1XXGA 2VXWA 1CI3M 3KJPA 2JA6H 4O0AA 5NUCA 4KKSA 3G4SA 3BVGA 3KF8A 4BY1H 2Z6KC 1KHIA 1SNDA 1G51A 4QL5A 4DU9A 4F7XA 1X6OA 1Z7TA 1RODA 3R2TA 2KOLA 4BBRB 2DY7A 4XTCS 2UXBQ 1J9OA 4CBVA 1YVCA 1Q1BA 2K04A 1EU3A 1JE4A 2ZXPA 2E2HH 1A2TA 1FYCA 1Q1EA 1S5BD 3S1QH 1DCZA 2NYZD 2XTIA 3UE1A 3T1YL 1TWFB 2BOSA 2NZOA 1SN8A 4E6IA 1HNZQ 2B2TA 4V0BA 2Q8RE 1CZGA 3MA2B 1Y1VG 4CDEC 1DOLA 4JI6L 3GTKH 1D7QA 4K5WA 4DAYB 2YV5A 1X3GA 2TMPA 4JI8L 3FPPA 3TSSA 3UDXA 1WTXA 1J5EL 2A19A 1F77A 2M00A 2QEXA 5EKKA 3GO5A 1B53A 3GTPH 4CKEA 3EQLC 4EQPA 1UE6A 3QB3A 5I6WA 1STHA 1HXYD 1JQYD 2FFKB 1XTDA 1T5EA 5KGUA 2EY6A 3CMAA 1PH5A 3HOYG 4LFBL 4XYOA 1K83H 3H15A 1SJHD 4A3IG 3RUZA 1WTQA 1XNRL 2EYPA 4YCVA 2E5LQ 4IN3A 1Y1VB 4IUNA 4ZKBB 4IFDJ 1TS5A 3M7NA 2RCFA 3CPFA 1QVCA 1JOKA 4R4IA 1OXUA 3J81j 4R4OA 3HG9A 3LWEA 2K05A 3VR5A 3T1HQ 2A1AA 1K8AC 4KHPQ 5K36G 3M4QA 3U4VA 1EY6A 2MHVA 4DKAC 2FHTA 5C0XJ 2HDMA 3PGZA 4LF8Q 4QQBX 3GTJH 4HMJA 2VL6A 2WINB 1CM9A 4ALPA 4JI7L 3K6OA 4L63B 5EQ0A 3H0GH 3HOYB 1TWAH 2IX0A 5BN4A 1PH4A 4A3IB 2L1BA 1HNWL 3C2PA 1BR9A 3CQZB 1BNZA 1GUSA 1GHKA 3RMHA 4NP5A 1QVGA 4TQUS 1A63A 3CCUA 3OWFA 1IBLQ 1KLUD 5CGKA 2L11A 5I4DA 1I4RA 1T9HA 2CW0C 3N6RA 1OO9B 4A93G 2F0MA 1BKBA 3TEHB 2NUCA 5HGQA 5IT9L 1WVLA 2PZUA 3PSIA 4OEMB 2IW3A 4C2MH 2DUDA 2JYOA 3K5OA 3I70A 3WOFA 1MSHA 1VCIA 3STBC 4FF4A 3BZDB 2B39A 1U0LA 4EQ5A 2GVBA 2AMCB 1PVOA 4AYBG 2M9VA 1BUVT 2VUMG 3F1ZA 1W6JA 2UXCQ 2E2IB 1SAPA 3EJIA 4ZUJA 3STBD 2G9DA 3CMEA 1ET9A 1X32A 2SOBA 3PF4A 3ULPA 2PQAA 2CQAA 3I56A 3A8IE 1RJTA 3MVVA 3K5LA 4A93B 2EJMA 4KKUA 4L8JA 2K52A 5GADC 3NEMA 5J3BA 1AE2A 4RGMA 1KQSA 3J7ZC 2KHJA 3KK7A 2I46A 5DM63 2N78A 1VF7A 3F2DA 3AMUA 1LLRD 1STAA 5C3XA 3J7A5 4DUZQ 5KIXA 2I07B 5CV7A 3QIAA 3W5OA 1V9PA 2VUMB 2AQ1B 4O2DA 2JSOA 2SEBD 4XT3B 1FNUA 4DNRB 1X9NA 1H9SB 5GAEC 3C1FA 3TP5A 4A3FH 4HIOA 4ILWA 2N88A 1SNQA 4NMZA 1LT3D 2GVAA 2PZTA 1STNA 2L0CA 3QJYA 3GTMH 4HIKA 1H9MA 2PMZB 4A3KG 2NTSA 3D6WA 1STBA 5C3EG 2PW7A 1STYA 3UDGA 4OWTB 4YCWA 3S14H 2B2WC 3UI2A 5IP7H 2UXDL 4IURA 4CHTB 5HURA 2NB0A 3HOZG 1S3OA 2AKWB 4LUZA 4JI1L 4DV3L 2PYKA 2EDGA 2V4DA 2FXQA 1IBKQ 1UEAB 4NXML 1AZPA 5A35A 3BS1A 1W2BA 5FO8B 4AH6A 1PH2A 1LTTD 4DV0L 3BYYB 4LFAQ 1G2SA 3KDFA 2R3ZA 2B2UC 4JI3Q 2VQFQ 4AIMA 2K01A 2IHEA 4UAIA 1FR3A 2E76C 3CAMA 4G4KA 4DV2L 1L1OA 3S2HB 4DV4L 2F3IA 4A3KB 1S5ED 1VQ4A 3CQZH 5C44H 1IW7C 1QJOA 2OTLA 2ZXRA 1R4PB 2F4IA 1SJED 3QR8A 2Y0SB 5FLMH 2F1MA 3GDEA 3ERSX 3OPOA 2KJXA 4A3LG 4DAPA 5M9OA 1I4HA 3K5MA 1YNXA 5M3FH 1MIUA 1P16A 4N8FA 4DAMA 3HOZB 3NBHB 1CUKA 2Q2IA 3HOUH 1Q3LA 3TZUA 4DV6L 4LF9Q 3CF5A 4OIKA 3EN2A 1SNMA 5K36H 4YY3L 4DR3Q 1N32L 2K32A 2TSSA 1PLFA 3SHLA 3OIPA 4C3HH 4IUTA 3HKSA
chains in the Genus database with same CATH topology
3CP0A 4JOIC 5C4XH 4LF7L 4OONA 4KLKA 1E24A 5H1SE 2ZJRA 1OXVA 3KF6A 1CKMA 1VQCA 3JC66 4GLXA 1Q7YC 4LF7Q 4JI5L 3GTOH 4DR7Q 1BVSA 1EOVA 5GAHC 3HKZG 5GAGC 4A3EG 1K9MC 5JJKA 1MJCA 1CKNB 4GKKQ 1N36Q 2VW9A 4R1JA 2HIXA 4KHZA 3FKIH 3I4MG 4BXXH 1KC8C 4A3JH 1L1OC 3M4OH 4DR4L 1WCMH 4A3LH 3K7AH 3G71A 4IFDG 1VQFA 4A3BG 3HKZE 3PUXA 4R4TA 1SMXA 1R9TH 1KL9A 2VQEQ 1B8AA 3L2PA 4C3JH 4QY7A 4X65Q 1KIXA 1HNXQ 4BY7G 4UY8C 3CC7A 3H3VH 1GO3E 3TQYA 3S16H 4LFCL 4X62L 3KDFB 2R92H 2RHSB 2OTJA 4DK6C 5LMNL 3KLWA 2F4VL 3NENA 4DUZL 2MO0A 2Z0SA 4KI0A 4A3DG 4LFCQ 1VQAA 3UDFA 4DPGA 3CCVA 4IOCA 1K73C 3J81i 2F4VQ 4JYAL 4EX5A 4LNQA 1FJGQ 1E1TA 5C0XG 1J6QA 4JBWA 1XMQQ 4X66L 3RLNA 4A75A 1A8VA 4IPGA 3EBEA 2NN6G 4DUYL 1Y14B 3LGJA 4HJ9A 1Q86C 1C9OA 2BH8A 4X66Q 1VQEA 2NVXH 4HJAA 4IJHA 4L5RC 1VQHA 2HQLA 1VQOA 4DUYQ 4A3EH 3HOWG 1WJJA 1I94Q 2IT1A 1EIYB 3KYHC 3ULLA 5LMNW 3I4MH 4B3ML 1PH9A 3JAMc 3TRZA 4IPDA 2NVYH 5FJ8G 1E22A 4LF6L 4JV5L 1IBML 4A3BH 1I3QH 4B3MQ 3W1BA 1X3FA 4JI8Q 1YEZA 4GKJQ 3S1NH 4PMWA 4HIDA 3DM3A 5IY0A 4BY7H 1EWIA 1TWCH 1N33L 3S1RH 1H95A 2NVTH 4LF4L 1VQGA 4HIMA 3S2DH 4NXNL 3M9BA 4BA2I 4OX9Q 4P75A 3CCSA 5EAYA 4A3DH 4GLAC 4LF4Q 2B63H 2Y0SG 4NXNQ 1BBUA 4JI0L 2IY5B 1PHJA 4DV5L 4A3CG 1IBKL 1GVPA 1Y1WG 3RZDH 1X55A 2AHOB 1EFWA 1NE3A 1PH6A 3BZKA 3RNUA 1PYBA 2YU9H 3U58A 3KF6B 4HJ7A 2UUCL 2ES2A 2K5HA 4LFAL 1VQPA 3PF5A 3S15H 2Y0SE 4LF9L 4JI3L 2Q2TA 1GM5A 4LF5Q 4LFBQ 2CWPA 2VQFL 2HT1A 2Q2HA 1K8GA 3ULJA 3HOWH 3E9HA 1XNRQ 2LXKA 3I55A 3ZJYC 1XPRA 1N9WA 1KAWA 1RL2A 1LM0A 1PV4A 2BA1A 1JE5A 1NMFA 2JQOA 2PQAB 1HZCA 5FJ8H 2N3SA 4DR2Q 2K50A 4BA1I 4B3RL 2Z6KA 3DLLA 1N34L 1M90C 3S2HH 4YHHL 2B3GA 3UDIA 4BBSG 1Z47A 2ALYB 1NJIC 3WWVA 4B3RQ 4X64Q 4DR1L 4OWWB 2JA6G 3ER0A 1YZ6A 1IXRA 2WFWA 2RCNA 1G291 1MJEA 1HH2P 3A74A 2H5XA 4GN4B 4IOAA 5JJIA 2OQ0A 4NPSA 1XPUA 3CPWA 3CCLA 1N8RC 4BY1G 5IYBG 2QA4A 5IE8A 3CCMA 5BR8L 3JAMi 4RG1A 1VQKA 4DR6L 4A3CH 1A62A 2IHFA 2MFIA 4POFA 4Y7NH 1Y1WH 2OQKA 1NBWA 4GS3A 4PZ7A 4BBRG 3TS0A 2WAQG 2WB1G 5BR8Q 2K4KA 4JI7Q 3S1MH 3HOVG 3BJUA 1PFSA 2KCMA 1QZGA 2EQSA 1CSQA 2IX1A 3NELA 1OXTA 1HZBA 1K0RA 3G6EA 4JCVE 5IWAL 3TS2A 2WB1E 2NVQH 1EUJA 2ID0A 1C0AA 1EYGA 4YWLA 1VQIA 2E2JH 1L0WA 5IP9G 2R93G 1WYDA 4A3GG 2CFMA 3MXNB 2XGTA 4ME3A 2UUBL 4P71A 1NY4A 2HIVA 2EIFA 4DR7L 4BBSH 4PG3A 1X54A 2UUBQ 4DNIA 3W1GA 5IYDG 5C0XI 3L0OA 4A3MG 3KJPA 2JA6H 4O0AA 4GKKL 1Z9FA 2PI2E 3I4OA 1N36L 4OO1G 2NN6I 3G4SA 1S40A 2MO1A 1QZHA 1LTLA 4DK3C 4BY1H 5IYBH 1A0IA 2Z6KC 1KHIA 2R7FA 1G51A 2VQEL 4QL5A 1YHQA 3F2CA 2K5VA 2UXBL 1X6OA 1CSPA 1HZAA 4X65L 1HNXL 3CC4A 4BBRH 2JA7G 1NTGA 4XTCS 3PUZA 2UXBQ 4YWMA 3HOVH 4WJ4A 1YVCA 1Q1BA 3CXCA 3PIOA 1WOCA 1CKOA 3RLOA 4P73A 4HJ8A 2JE6I 1UWVA 2E2HH 1Q1EA 2ZTDA 3M85A 2BH2A 3S1QH 1D8LA 2XTIA 1FJGL 1XMQL 2R7ZG 5ELNA 3UE1A 1HNZL 3T1YL 1TWFH 2R6GA 5IP9H 3CC2A 4H02A 4A3GH 1QUQB 4FDBA 2R93H 4GN5A 1L1OB 2BA0A 2NZOA 1Q12A 4OWXB 4AYBE 1OXXK 1SN8A 5M5WH 3CCJA 1HNZQ 3T1YQ 3I4NG 1YBYA 3RR5A 4HJ5A 1VQ8A 4GLVB 5LMUL 1I94L 3Q8DA 5IYDH 4A3MH 2I0QA 1AE3A 3F8TA 1JMCA 1Y1VG 5LMUQ 3PV0A 1OTCA 3BZCA 1K3RA 3CCRA 1VQBA 4JI6L 4TVAB 1DGSA 3GTKH 1D7QA 2YTXA 4UP9A 4DAYB 2YV5A 4RMFA 1X3GA 1J5EL 1Q8KA 2D0OA 2D0PA 4JI8L 1X3EA 3UDXA 2A19A 1PH7A 4JI6Q 5HY6A 1B7YB 1GKHA 4GKJL 1EIFA 2QEXA 3GTLH 3PO2G 2JA7H 1J5EQ 1FL0A 2CQOA 3GO5A 1Q81C 4AQYQ 5M5YH 5DLQE 2HHHL 4R4QA 2UU9L 2Q2UA 4OX9L 3GTPH 2CWAA 1I6HH 3J80c 5JEAJ 3KOJA 1UE6A 1W3SA 2HHHQ 2UU9Q 3IRBA 2A8VA 2R7ZH 4IPCA 3D31A 3FP9A 1XTDA 3SGIA 3M3YH 1PH5A 3CMAA 2JA8G 3VDYA 1C7YA 3H0GG 2I5MX 4GOPC 4XIGS 4LF5L 1ASYA 3S24A 4MNOA 3HOYG 4LFBL 1K83H 2OWOA 3GD7A 3BU2A 1P8LA 3H15A 2JJQA 4A3IG 1XNRL 3PCOB 4YCVA 2E5LQ 1KRSA 1Y1VH 4YCUA 2N8NA 1LYLA 2QGQA 2VZAA 4IFDJ 1UE5A 1V43A 5C4JH 4DR2L 3M7NA 3H3VI 3CPFA 1CKNA 5M3MG 4GNXC 1UE7A 1GD7A 4JI2Q 4A4IA 3U50C 2NZHA 2CCZA 1QVCA 1E3PA 4R4IA 4X64L 1OXUA 2LXJA 3PO2H 2N49A 3J81j 4R4OA 4WJ3M 2UXDQ 2VNUD 2RF4A 3D0FA 4JG2A 3K81C 2I5LX 3T1HQ 5M5XH 1YJ9A 3K80C 2A1AA 4DV3Q 4JI1Q 1YHBA 1K8AC 4KHPQ 5K36G 5AJ3Q 1PH1A 3M4QA 5GROA 3U4VA 4DKAC 5C0XJ 4LF8Q 4OO1I 3HFZB 1OXSC 3PGZA 4QQBX 3GTJH 1FVIA 1VQ7A 2VL6A 3FHWA 4DV0Q 3RLFA 4ALPA 4JI7L 2JA8H 5JJLA 3H0GH 1VQ6A 3HOYH 1TWAH 2IX0A 5C4XG 4IFDI 1PH4A 4DV7Q 2UUAQ 4A3IH 2YTYA 3B6YA 1HNWL 1B70B 3J80i 1Q82C 3EIVA 1SRUA 4UP7A 1PA6A 1S72A 1HNWQ 5M3MH 4DV1Q 2KBNA 1IBLL 2ATWA 4UP8A 1XMOL 1QVGA 3K8AA 4TQUS 1VQMA 1HR0Q 2AWOA 1A63A 1I50H 2JEBI 5FLXc 3CCQA 3CCUA 1IBLQ 3UE0A 1XMOQ 3L7ZC 1T9HA 3GTQH 4A93G 1BKBA 1FGUA 3TEHB 1XJVA 3PUWA 5HGQA 2I5HA 3KFUA 2WP8J 2LSSA 3M4PA 1YHAA 3PSIA 4JI4Q 3PO3G 1TWHH 4C2MH 2DUDA 4DV6Q 4A76A 1IL2A 2ASBA 2DGYA 4IO9A 1HR0W 1N32Q 4MTNA 3K7UC 1JJ2A 1VCIA 3STBC 3RN2A 3U4ZA 4X6AH 1VQLA 1U0LA 4LUVA 3AYHB 4GOPA 4JBJA 4EQ5A 2ZJPA 2C35B 3AFQA 2UXCL 2GVBA 2AMCB 1PVOA 4AYBG 1VS0A 2VUMG 1AH9A 3F1ZA 3OW2A 2OCEA 4K0KL 2UXCQ 2E2IH 3STBD 1RIPA 4JI5Q 4J15A 3CMEA 4K0KQ 3ICEA 4A3FG 3PF4A 1Q46A 3PUVA 4PZ6A 3ULPA 2PQAA 2K5NA 1PYSB 4APVA 3I56A 2F52A 1SE8A 4DR4Q 3E0EA 4A93H 4B3TL 4QJFA 1EQQA 1EQRA 2K52A 1JB7A 3KJOA 5GADC 1SR3A 1UEBA 3K0XA 3NEMA 2E8GA 1AE2A 5J3BA 1KQSA 2ZJQA 4B3TQ 3J7ZC 3PO3H 2KHJA 1PH8A 3AEVA 2N78A 3F2DA 5IP7G 2JA5G 2KHIA 2B63G 2PMZE 4X62Q 1XNQL 3J7A5 5LMNQ 4AQYL 1QVFA 4DUZQ 1YIJA 1IZ6A 4IJLA 5E7NA 1E7ZA 1SFOH 1O7IA 1XNQQ 2PNHA 1VQ5A 2VS1A 4JYAQ 3W5OA 1V9PA 3CW2C 2VUMH 3RZOH 2R7DA 5IYCG 3OYYA 3AFPA 4DR5L 4GNXA 4O2DA 4JBMA 3GTGH 2JEAI 1X9NA 4DR5Q 3RN5A 1VQ9A 5GAEC 4A3FH 1SLJA 1ASZA 4HIOA 1IYJB 4NB3A 3HOXG 2D62A 3I4NH 1KXLA 2E5LL 4PZ8A 2GVAA 1G6PA 4LF6Q 3GTMH 4JV5Q 3AQQA 4HIKA 1IBMQ 3CD6A 1MKHA 4A3KG 1WI5A 3OTOL 1M1KC 5IT9c 5C44G 2MNAA 4JI2L 5C3EG 3A5UA 1LUZA 3KF8B 1YJWA 1TXYA 4IPHA 3UDGA 4OWTB 4YCWA 3OTOQ 3S14H 1N33Q 4C3IH 5IP7H 2JA5H 2UXDL 4B3SL 5FLMG 1BBWA 3T1HL 1VQJA 1YITA 1KRTA 2K75A 5M3FG 4B3SQ 3HOZG 1S3OA 2AKWB 4LUZA 4JI1L 2JA9A 4DV3L 4JOIA 4GOPB 4JI0Q 4KHPL 3I2ZA 2FXQA 3I7FA 5AJ3L 4DV5Q 1IBKQ 4LF8L 1HJPA 4L5QA 3HOUG 4NXML 5IYCH 1PH2A 1W2BA 5GQOA 4AH6A 2ZM6L 4L5SA 2YYZA 4DV0L 2UUCQ 4LFAQ 4OXPA 3KDFA 4P72A 2CKZB 4NXMQ 4JI3Q 1L2FA 4QGUA 1PH3A 2ZM6Q 2MQHA 4AIMA 2VQFQ 3MEFA 2IHEA 3CCEA 1HZ9A 1VQNA 4GNXB 4Y52H 3CAMA 4DV7L 2UUAL 2V1CC 3HOXH 1QUQA 2PI2A 4DV2L 3A0JA 1L1OA 1X56A 4P74A 4DV4L 4L5TA 2F3IA 1UE1A 2GN5A 1JT8A 4LWCA 4DV2Q 2ZTCA 4A3KH 1N34Q 4YHHQ 4R4CA 4DV1L 3CQZH 5C44H 4DV4Q 1VQ4A 5C3EH 2K14A 4LUOA 1HR0L 1U5KA 4LW1A 3PIPA 4DR1Q 1I5FA 1WFQA 1KD1C 2OTLA 1JJGA 3FKIG 4BXXG 2EXDA 4A3JG 5FLMH 3GDEA 3ERSX 3G48A 4GN3B 1WCMG 3J81c 1YI2A 4A3LG 1SROA 1E1OA 2JK8A 3PUYA 1YNXA 5M3FH 1MIUA 1P16A 4DAMA 2KCTA 4YWKA 4JBKA 2B29A 1CUKA 2YTVA 3NBHB 3HOZH 4DR6Q 4DR3L 2Q2IA 4POGA 4JI4L 3HOUH 3E9IA 3A5ZB 2VY3A 4UPAA 4DV6L 3F2BA 3CF5A 1YJNA 4LF9Q 1VQDA 4QIWE 2ZTEA 3EN2A 1V1QA 4YY3L 4DR3Q 1N32L 2R92G 1XPOA 2L15A 1JJCB 1NMGA 2RHQB 1TWGH 2WAQE 3S17H 4YY3Q 2AWNA 2KENA 1X65A 5ELOA 5JEAG 4JC0A 4MZ9A 4C3HH 5IWAQ 3TREA 3HKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CP0 A;  4JOI C;  5C4X H;  4LF7 L;  4OON A;  4KLK A;  1E24 A;  5H1S E;  2ZJR A;  1OXV A;  3KF6 A;  1CKM A;  1VQC A;  3JC6 6;  4GLX A;  1Q7Y C;  4LF7 Q;  4JI5 L;  3GTO H;  4DR7 Q;  1BVS A;  1EOV A;  5GAH C;  3HKZ G;  5GAG C;  4A3E G;  1K9M C;  5JJK A;  1MJC A;  1CKN B;  4GKK Q;  1N36 Q;  2VW9 A;  4R1J A;  2HIX A;  4KHZ A;  3FKI H;  3I4M G;  4BXX H;  1KC8 C;  4A3J H;  1L1O C;  3M4O H;  4DR4 L;  1WCM H;  4A3L H;  3K7A H;  3G71 A;  4IFD G;  1VQF A;  4A3B G;  3HKZ E;  3PUX A;  4R4T A;  1SMX A;  1R9T H;  1KL9 A;  2VQE Q;  1B8A A;  3L2P A;  4C3J H;  4QY7 A;  4X65 Q;  1KIX A;  1HNX Q;  4BY7 G;  4UY8 C;  3CC7 A;  3H3V H;  1GO3 E;  3TQY A;  3S16 H;  4LFC L;  4X62 L;  3KDF B;  2R92 H;  2RHS B;  2OTJ A;  4DK6 C;  5LMN L;  3KLW A;  2F4V L;  3NEN A;  4DUZ L;  2MO0 A;  2Z0S A;  4KI0 A;  4A3D G;  4LFC Q;  1VQA A;  3UDF A;  4DPG A;  3CCV A;  4IOC A;  1K73 C;  3J81 i;  2F4V Q;  4JYA L;  4EX5 A;  4LNQ A;  1FJG Q;  1E1T A;  5C0X G;  1J6Q A;  4JBW A;  1XMQ Q;  4X66 L;  3RLN A;  4A75 A;  1A8V A;  4IPG A;  3EBE A;  2NN6 G;  4DUY L;  1Y14 B;  3LGJ A;  4HJ9 A;  1Q86 C;  1C9O A;  2BH8 A;  4X66 Q;  1VQE A;  2NVX H;  4HJA A;  4IJH A;  4L5R C;  1VQH A;  2HQL A;  1VQO A;  4DUY Q;  4A3E H;  3HOW G;  1WJJ A;  1I94 Q;  2IT1 A;  1EIY B;  3KYH C;  3ULL A;  5LMN W;  3I4M H;  4B3M L;  1PH9 A;  3JAM c;  3TRZ A;  4IPD A;  2NVY H;  5FJ8 G;  1E22 A;  4LF6 L;  4JV5 L;  1IBM L;  4A3B H;  1I3Q H;  4B3M Q;  3W1B A;  1X3F A;  4JI8 Q;  1YEZ A;  4GKJ Q;  3S1N H;  4PMW A;  4HID A;  3DM3 A;  5IY0 A;  4BY7 H;  1EWI A;  1TWC H;  1N33 L;  3S1R H;  1H95 A;  2NVT H;  4LF4 L;  1VQG A;  4HIM A;  3S2D H;  4NXN L;  3M9B A;  4BA2 I;  4OX9 Q;  4P75 A;  3CCS A;  5EAY A;  4A3D H;  4GLA C;  4LF4 Q;  2B63 H;  2Y0S G;  4NXN Q;  1BBU A;  4JI0 L;  2IY5 B;  1PHJ A;  4DV5 L;  4A3C G;  1IBK L;  1GVP A;  1Y1W G;  3RZD H;  1X55 A;  2AHO B;  1EFW A;  1NE3 A;  1PH6 A;  3BZK A;  3RNU A;  1PYB A;  2YU9 H;  3U58 A;  3KF6 B;  4HJ7 A;  2UUC L;  2ES2 A;  2K5H A;  4LFA L;  1VQP A;  3PF5 A;  3S15 H;  2Y0S E;  4LF9 L;  4JI3 L;  2Q2T A;  1GM5 A;  4LF5 Q;  4LFB Q;  2CWP A;  2VQF L;  2HT1 A;  2Q2H A;  1K8G A;  3ULJ A;  3HOW H;  3E9H A;  1XNR Q;  2LXK A;  3I55 A;  3ZJY C;  1XPR A;  1N9W A;  1KAW A;  1RL2 A;  1LM0 A;  1PV4 A;  2BA1 A;  1JE5 A;  1NMF A;  2JQO A;  2PQA B;  1HZC A;  5FJ8 H;  2N3S A;  4DR2 Q;  2K50 A;  4BA1 I;  4B3R L;  2Z6K A;  3DLL A;  1N34 L;  1M90 C;  3S2H H;  4YHH L;  2B3G A;  3UDI A;  4BBS G;  1Z47 A;  2ALY B;  1NJI C;  3WWV A;  4B3R Q;  4X64 Q;  4DR1 L;  4OWW B;  2JA6 G;  3ER0 A;  1YZ6 A;  1IXR A;  2WFW A;  2RCN A;  1G29 1;  1MJE A;  1HH2 P;  3A74 A;  2H5X A;  4GN4 B;  4IOA A;  5JJI A;  2OQ0 A;  4NPS A;  1XPU A;  3CPW A;  3CCL A;  1N8R C;  4BY1 G;  5IYB G;  2QA4 A;  5IE8 A;  3CCM A;  5BR8 L;  3JAM i;  4RG1 A;  1VQK A;  4DR6 L;  4A3C H;  1A62 A;  2IHF A;  2MFI A;  4POF A;  4Y7N H;  1Y1W H;  2OQK A;  1NBW A;  4GS3 A;  4PZ7 A;  4BBR G;  3TS0 A;  2WAQ G;  2WB1 G;  5BR8 Q;  2K4K A;  4JI7 Q;  3S1M H;  3HOV G;  3BJU A;  1PFS A;  2KCM A;  1QZG A;  2EQS A;  1CSQ A;  2IX1 A;  3NEL A;  1OXT A;  1HZB A;  1K0R A;  3G6E A;  4JCV E;  5IWA L;  3TS2 A;  2WB1 E;  2NVQ H;  1EUJ A;  2ID0 A;  1C0A A;  1EYG A;  4YWL A;  1VQI A;  2E2J H;  1L0W A;  5IP9 G;  2R93 G;  1WYD A;  4A3G G;  2CFM A;  3MXN B;  2XGT A;  4ME3 A;  2UUB L;  4P71 A;  1NY4 A;  2HIV A;  2EIF A;  4DR7 L;  4BBS H;  4PG3 A;  1X54 A;  2UUB Q;  4DNI A;  3W1G A;  5IYD G;  5C0X I;  3L0O A;  4A3M G;  3KJP A;  2JA6 H;  4O0A A;  4GKK L;  1Z9F A;  2PI2 E;  3I4O A;  1N36 L;  4OO1 G;  2NN6 I;  3G4S A;  1S40 A;  2MO1 A;  1QZH A;  1LTL A;  4DK3 C;  4BY1 H;  5IYB H;  1A0I A;  2Z6K C;  1KHI A;  2R7F A;  1G51 A;  2VQE L;  4QL5 A;  1YHQ A;  3F2C A;  2K5V A;  2UXB L;  1X6O A;  1CSP A;  1HZA A;  4X65 L;  1HNX L;  3CC4 A;  4BBR H;  2JA7 G;  1NTG A;  4XTC S;  3PUZ A;  2UXB Q;  4YWM A;  3HOV H;  4WJ4 A;  1YVC A;  1Q1B A;  3CXC A;  3PIO A;  1WOC A;  1CKO A;  3RLO A;  4P73 A;  4HJ8 A;  2JE6 I;  1UWV A;  2E2H H;  1Q1E A;  2ZTD A;  3M85 A;  2BH2 A;  3S1Q H;  1D8L A;  2XTI A;  1FJG L;  1XMQ L;  2R7Z G;  5ELN A;  3UE1 A;  1HNZ L;  3T1Y L;  1TWF H;  2R6G A;  5IP9 H;  3CC2 A;  4H02 A;  4A3G H;  1QUQ B;  4FDB A;  2R93 H;  4GN5 A;  1L1O B;  2BA0 A;  2NZO A;  1Q12 A;  4OWX B;  4AYB E;  1OXX K;  1SN8 A;  5M5W H;  3CCJ A;  1HNZ Q;  3T1Y Q;  3I4N G;  1YBY A;  3RR5 A;  4HJ5 A;  1VQ8 A;  4GLV B;  5LMU L;  1I94 L;  3Q8D A;  5IYD H;  4A3M H;  2I0Q A;  1AE3 A;  3F8T A;  1JMC A;  1Y1V G;  5LMU Q;  3PV0 A;  1OTC A;  3BZC A;  1K3R A;  3CCR A;  1VQB A;  4JI6 L;  4TVA B;  1DGS A;  3GTK H;  1D7Q A;  2YTX A;  4UP9 A;  4DAY B;  2YV5 A;  4RMF A;  1X3G A;  1J5E L;  1Q8K A;  2D0O A;  2D0P A;  4JI8 L;  1X3E A;  3UDX A;  2A19 A;  1PH7 A;  4JI6 Q;  5HY6 A;  1B7Y B;  1GKH A;  4GKJ L;  1EIF A;  2QEX A;  3GTL H;  3PO2 G;  2JA7 H;  1J5E Q;  1FL0 A;  2CQO A;  3GO5 A;  1Q81 C;  4AQY Q;  5M5Y H;  5DLQ E;  2HHH L;  4R4Q A;  2UU9 L;  2Q2U A;  4OX9 L;  3GTP H;  2CWA A;  1I6H H;  3J80 c;  5JEA J;  3KOJ A;  1UE6 A;  1W3S A;  2HHH Q;  2UU9 Q;  3IRB A;  2A8V A;  2R7Z H;  4IPC A;  3D31 A;  3FP9 A;  1XTD A;  3SGI A;  3M3Y H;  1PH5 A;  3CMA A;  2JA8 G;  3VDY A;  1C7Y A;  3H0G G;  2I5M X;  4GOP C;  4XIG S;  4LF5 L;  1ASY A;  3S24 A;  4MNO A;  3HOY G;  4LFB L;  1K83 H;  2OWO A;  3GD7 A;  3BU2 A;  1P8L A;  3H15 A;  2JJQ A;  4A3I G;  1XNR L;  3PCO B;  4YCV A;  2E5L Q;  1KRS A;  1Y1V H;  4YCU A;  2N8N A;  1LYL A;  2QGQ A;  2VZA A;  4IFD J;  1UE5 A;  1V43 A;  5C4J H;  4DR2 L;  3M7N A;  3H3V I;  3CPF A;  1CKN A;  5M3M G;  4GNX C;  1UE7 A;  1GD7 A;  4JI2 Q;  4A4I A;  3U50 C;  2NZH A;  2CCZ A;  1QVC A;  1E3P A;  4R4I A;  4X64 L;  1OXU A;  2LXJ A;  3PO2 H;  2N49 A;  3J81 j;  4R4O A;  4WJ3 M;  2UXD Q;  2VNU D;  2RF4 A;  3D0F A;  4JG2 A;  3K81 C;  2I5L X;  3T1H Q;  5M5X H;  1YJ9 A;  3K80 C;  2A1A A;  4DV3 Q;  4JI1 Q;  1YHB A;  1K8A C;  4KHP Q;  5K36 G;  5AJ3 Q;  1PH1 A;  3M4Q A;  5GRO A;  3U4V A;  4DKA C;  5C0X J;  4LF8 Q;  4OO1 I;  3HFZ B;  1OXS C;  3PGZ A;  4QQB X;  3GTJ H;  1FVI A;  1VQ7 A;  2VL6 A;  3FHW A;  4DV0 Q;  3RLF A;  4ALP A;  4JI7 L;  2JA8 H;  5JJL A;  3H0G H;  1VQ6 A;  3HOY H;  1TWA H;  2IX0 A;  5C4X G;  4IFD I;  1PH4 A;  4DV7 Q;  2UUA Q;  4A3I H;  2YTY A;  3B6Y A;  1HNW L;  1B70 B;  3J80 i;  1Q82 C;  3EIV A;  1SRU A;  4UP7 A;  1PA6 A;  1S72 A;  1HNW Q;  5M3M H;  4DV1 Q;  2KBN A;  1IBL L;  2ATW A;  4UP8 A;  1XMO L;  1QVG A;  3K8A A;  4TQU S;  1VQM A;  1HR0 Q;  2AWO A;  1A63 A;  1I50 H;  2JEB I;  5FLX c;  3CCQ A;  3CCU A;  1IBL Q;  3UE0 A;  1XMO Q;  3L7Z C;  1T9H A;  3GTQ H;  4A93 G;  1BKB A;  1FGU A;  3TEH B;  1XJV A;  3PUW A;  5HGQ A;  2I5H A;  3KFU A;  2WP8 J;  2LSS A;  3M4P A;  1YHA A;  3PSI A;  4JI4 Q;  3PO3 G;  1TWH H;  4C2M H;  2DUD A;  4DV6 Q;  4A76 A;  1IL2 A;  2ASB A;  2DGY A;  4IO9 A;  1HR0 W;  1N32 Q;  4MTN A;  3K7U C;  1JJ2 A;  1VCI A;  3STB C;  3RN2 A;  3U4Z A;  4X6A H;  1VQL A;  1U0L A;  4LUV A;  3AYH B;  4GOP A;  4JBJ A;  4EQ5 A;  2ZJP A;  2C35 B;  3AFQ A;  2UXC L;  2GVB A;  2AMC B;  1PVO A;  4AYB G;  1VS0 A;  2VUM G;  1AH9 A;  3F1Z A;  3OW2 A;  2OCE A;  4K0K L;  2UXC Q;  2E2I H;  3STB D;  1RIP A;  4JI5 Q;  4J15 A;  3CME A;  4K0K Q;  3ICE A;  4A3F G;  3PF4 A;  1Q46 A;  3PUV A;  4PZ6 A;  3ULP A;  2PQA A;  2K5N A;  1PYS B;  4APV A;  3I56 A;  2F52 A;  1SE8 A;  4DR4 Q;  3E0E A;  4A93 H;  4B3T L;  4QJF A;  1EQQ A;  1EQR A;  2K52 A;  1JB7 A;  3KJO A;  5GAD C;  1SR3 A;  1UEB A;  3K0X A;  3NEM A;  2E8G A;  1AE2 A;  5J3B A;  1KQS A;  2ZJQ A;  4B3T Q;  3J7Z C;  3PO3 H;  2KHJ A;  1PH8 A;  3AEV A;  2N78 A;  3F2D A;  5IP7 G;  2JA5 G;  2KHI A;  2B63 G;  2PMZ E;  4X62 Q;  1XNQ L;  3J7A 5;  5LMN Q;  4AQY L;  1QVF A;  4DUZ Q;  1YIJ A;  1IZ6 A;  4IJL A;  5E7N A;  1E7Z A;  1SFO H;  1O7I A;  1XNQ Q;  2PNH A;  1VQ5 A;  2VS1 A;  4JYA Q;  3W5O A;  1V9P A;  3CW2 C;  2VUM H;  3RZO H;  2R7D A;  5IYC G;  3OYY A;  3AFP A;  4DR5 L;  4GNX A;  4O2D A;  4JBM A;  3GTG H;  2JEA I;  1X9N A;  4DR5 Q;  3RN5 A;  1VQ9 A;  5GAE C;  4A3F H;  1SLJ A;  1ASZ A;  4HIO A;  1IYJ B;  4NB3 A;  3HOX G;  2D62 A;  3I4N H;  1KXL A;  2E5L L;  4PZ8 A;  2GVA A;  1G6P A;  4LF6 Q;  3GTM H;  4JV5 Q;  3AQQ A;  4HIK A;  1IBM Q;  3CD6 A;  1MKH A;  4A3K G;  1WI5 A;  3OTO L;  1M1K C;  5IT9 c;  5C44 G;  2MNA A;  4JI2 L;  5C3E G;  3A5U A;  1LUZ A;  3KF8 B;  1YJW A;  1TXY A;  4IPH A;  3UDG A;  4OWT B;  4YCW A;  3OTO Q;  3S14 H;  1N33 Q;  4C3I H;  5IP7 H;  2JA5 H;  2UXD L;  4B3S L;  5FLM G;  1BBW A;  3T1H L;  1VQJ A;  1YIT A;  1KRT A;  2K75 A;  5M3F G;  4B3S Q;  3HOZ G;  1S3O A;  2AKW B;  4LUZ A;  4JI1 L;  2JA9 A;  4DV3 L;  4JOI A;  4GOP B;  4JI0 Q;  4KHP L;  3I2Z A;  2FXQ A;  3I7F A;  5AJ3 L;  4DV5 Q;  1IBK Q;  4LF8 L;  1HJP A;  4L5Q A;  3HOU G;  4NXM L;  5IYC H;  1PH2 A;  1W2B A;  5GQO A;  4AH6 A;  2ZM6 L;  4L5S A;  2YYZ A;  4DV0 L;  2UUC Q;  4LFA Q;  4OXP A;  3KDF A;  4P72 A;  2CKZ B;  4NXM Q;  4JI3 Q;  1L2F A;  4QGU A;  1PH3 A;  2ZM6 Q;  2MQH A;  4AIM A;  2VQF Q;  3MEF A;  2IHE A;  3CCE A;  1HZ9 A;  1VQN A;  4GNX B;  4Y52 H;  3CAM A;  4DV7 L;  2UUA L;  2V1C C;  3HOX H;  1QUQ A;  2PI2 A;  4DV2 L;  3A0J A;  1L1O A;  1X56 A;  4P74 A;  4DV4 L;  4L5T A;  2F3I A;  1UE1 A;  2GN5 A;  1JT8 A;  4LWC A;  4DV2 Q;  2ZTC A;  4A3K H;  1N34 Q;  4YHH Q;  4R4C A;  4DV1 L;  3CQZ H;  5C44 H;  4DV4 Q;  1VQ4 A;  5C3E H;  2K14 A;  4LUO A;  1HR0 L;  1U5K A;  4LW1 A;  3PIP A;  4DR1 Q;  1I5F A;  1WFQ A;  1KD1 C;  2OTL A;  1JJG A;  3FKI G;  4BXX G;  2EXD A;  4A3J G;  5FLM H;  3GDE A;  3ERS X;  3G48 A;  4GN3 B;  1WCM G;  3J81 c;  1YI2 A;  4A3L G;  1SRO A;  1E1O A;  2JK8 A;  3PUY A;  1YNX A;  5M3F H;  1MIU A;  1P16 A;  4DAM A;  2KCT A;  4YWK A;  4JBK A;  2B29 A;  1CUK A;  2YTV A;  3NBH B;  3HOZ H;  4DR6 Q;  4DR3 L;  2Q2I A;  4POG A;  4JI4 L;  3HOU H;  3E9I A;  3A5Z B;  2VY3 A;  4UPA A;  4DV6 L;  3F2B A;  3CF5 A;  1YJN A;  4LF9 Q;  1VQD A;  4QIW E;  2ZTE A;  3EN2 A;  1V1Q A;  4YY3 L;  4DR3 Q;  1N32 L;  2R92 G;  1XPO A;  2L15 A;  1JJC B;  1NMG A;  2RHQ B;  1TWG H;  2WAQ E;  3S17 H;  4YY3 Q;  2AWN A;  2KEN A;  1X65 A;  5ELO A;  5JEA G;  4JC0 A;  4MZ9 A;  4C3H H;  5IWA Q;  3TRE A;  3HKS A; 
#chains in the Genus database with same CATH topology
 4JOI C;  4LF7 L;  4KLK A;  1K3B C;  1OXV A;  5JJZ A;  3GTO B;  1QWY A;  4JI5 L;  1TU2 B;  3EA6 A;  1MJC A;  3ITP A;  1V8Q A;  1K8M A;  4JVZ A;  4KHZ A;  3FKI H;  3I4M G;  2IPK D;  2F0E A;  4QIW B;  1WCM H;  4IFD G;  2OEO A;  2VQE Q;  3L2P A;  1HNX Q;  3BDC A;  3VYS A;  1V1P B;  4UY8 C;  1CQV A;  5JAV A;  3TQY A;  3K59 A;  3S16 B;  5I9P A;  2D2C C;  3T53 B;  2R92 H;  2B2V C;  2RHS B;  3T51 B;  3KLW A;  2MO0 A;  1QOH A;  5A2Q E;  5JEA H;  3SR1 A;  4A3G B;  3J81 i;  4JYA L;  4EX5 A;  3H09 A;  5C0X G;  4X3U A;  5ELF A;  4X66 L;  1XMQ Q;  4IPG A;  3EBE A;  2NN6 G;  4DUY L;  1Y14 B;  2NVX B;  3KLS X;  4RKB A;  4IJH A;  1KLG D;  2AUK A;  3ND9 A;  2HQL A;  4A3E H;  1I94 Q;  1TII D;  2IT1 A;  2HD3 A;  1O7Y A;  4I65 A;  4G57 A;  3KYH C;  1PH9 A;  1FNW A;  4LF6 L;  4JV5 L;  1RD9 D;  1YNN C;  4KK7 A;  2RVL A;  2JA7 B;  1X3F A;  4GZY C;  1V1O A;  4GKJ Q;  2NTT A;  4HID A;  2SNM A;  1N33 L;  5KYL A;  3K0Y A;  2O5I C;  5CV4 A;  5FLX E;  3CCS A;  1S5F D;  5C5L A;  2A6E C;  4NXN Q;  1BBU A;  1F9S A;  4IZ8 A;  2IY5 B;  4DV5 L;  4N8X 1;  1EFI D;  1X55 A;  1NE3 A;  3F2U A;  3MXU A;  3BZK A;  4ME5 A;  4RH6 A;  3RNU A;  2YU9 B;  3KF6 B;  2EYL A;  1YNJ D;  5C4Z A;  2Q2T A;  1GM5 A;  1SYF A;  1JOO A;  1STG A;  1F9Q A;  3P1H A;  3E9H A;  5DAU A;  3I55 A;  1XPR A;  1FGB D;  1PV4 A;  1JE5 A;  1NMF A;  2JQO A;  2K50 A;  1GOZ A;  1II3 A;  3S2H H;  4ZUI A;  3PO2 B;  2B3G A;  4BBS G;  3HZX A;  1Z47 A;  4DXF A;  2FMM A;  4FNF A;  4DR1 L;  3QO2 A;  1B9N A;  2J7Z A;  1LT4 D;  3ER0 A;  2JA6 G;  1IXR A;  2RCN A;  1MJE A;  4GN4 B;  5JJI A;  3CHB D;  2B2V A;  1XPU A;  1BQQ T;  2FMC A;  1N8R C;  3A7L A;  4BY1 G;  2QA4 A;  5IE8 A;  1U4M A;  4DR6 L;  4RG1 A;  4A3C H;  1PRT B;  2MFI A;  3AB9 A;  4FXD A;  3S1M H;  1PFS A;  3J80 L;  1HA5 A;  2EQS A;  1K0R A;  3VYR A;  4JCV E;  5IWA L;  2ID0 A;  3VR2 A;  2E2J B;  3MXN B;  4EQO A;  4RWS C;  1NY4 A;  1I50 B;  2XIW A;  4DR7 L;  4KJO A;  4BBS B;  2UUB Q;  2JXM B;  1UUP A;  1Z9F A;  1HUN A;  1HFG A;  1N36 L;  1CQF A;  1S40 A;  4QMG A;  4F8M A;  1QZH A;  1LTL A;  3P75 A;  4DK3 C;  4BY1 B;  1A0I A;  1I4G A;  3PQI A;  2R7F A;  1VMC A;  4CJ2 C;  1YHQ A;  2UXB L;  4ODG A;  1CSP A;  4X65 L;  1I4P A;  5IT9 E;  1EEI D;  1KDC A;  3HP3 A;  3PUZ A;  1DZ1 A;  4YWM A;  1B44 D;  5LL6 S;  4TRD A;  3PIO 3;  1SSO A;  1CKO A;  4O1N A;  4P73 A;  4X3S A;  2E2H B;  1IKM A;  2ZTD A;  3S1Q B;  1PZK D;  2X69 A;  4JPB W;  1HNZ L;  3J7A F;  2R6G A;  4A3G H;  1QUQ B;  4GN5 A;  4U68 A;  4X3K A;  4OWX B;  4AYB E;  1IHZ A;  5M5W H;  4GNX A;  4G7Z C;  1ENF A;  1DYQ A;  4CJ1 B;  2DY8 A;  1LTB D;  1EOT A;  3DMU A;  2I0Q A;  2A68 D;  4OO1 H;  4MIU A;  2B2Y C;  1K0S A;  1FD7 D;  3PV0 A;  1OTC A;  4FXG C;  1K3R A;  3PO3 B;  1F2L A;  1DGS A;  2EY1 A;  4EGV A;  2D0O A;  1X3E A;  1B7Y B;  1Y8P B;  1TT2 A;  3GTL H;  2AQ3 B;  2JA7 H;  1A3U A;  2CQO A;  4PV1 C;  5DM7 3;  1B9M A;  2CWA A;  3L9A X;  5JEA J;  1TY2 A;  5KRU A;  3J81 E;  1W3S A;  2L4N A;  2HHH Q;  2UU9 Q;  2F0H A;  3MFG A;  3WOE A;  4IPC A;  2R7Z H;  3D31 A;  4RKL A;  1PTO D;  3H0G G;  4LF5 L;  1AP0 A;  1DOM A;  3L3O C;  1K83 B;  3GD7 A;  3V96 A;  2A74 C;  1NSN S;  3PCO B;  1QE6 A;  2OT2 A;  2NZ1 D;  1PTO B;  4YCU A;  2K5Q A;  3ONA B;  2EY5 A;  1PFB A;  2F0K A;  1UE5 A;  4DR2 L;  3A55 A;  3H3V I;  1CKN A;  3DEP A;  1UE7 A;  4JI2 Q;  2X6G A;  2B2T C;  4A4I A;  2HCI A;  4C1N I;  4B08 A;  4WJ3 M;  3PO2 H;  1SMY C;  5EKI A;  1Y8O B;  2QF7 A;  4JG2 A;  4RA8 A;  4KY5 A;  3K81 C;  3K80 C;  1KDB A;  1YHB A;  2KEE A;  1PH1 A;  5GRO A;  1SMY D;  3HFZ B;  1OXS C;  3GTJ B;  1VQ7 A;  1PYW D;  1B1Z A;  1EL0 A;  3H0G B;  1TWA B;  1TKW B;  5C4X G;  2YTY A;  3J80 i;  2ICI A;  4RHS A;  1PA6 A;  2A69 C;  2B2Y A;  1LTS D;  4DV1 Q;  1IBL L;  1EY5 A;  4UP8 A;  3K8A A;  4KD4 A;  5J39 A;  2AWO A;  1I50 H;  2JEB I;  5ISR A;  2Z4I A;  2J4X A;  3UE0 A;  1XMO Q;  4S3S A;  4IUV A;  3L7Z C;  3E6Z X;  4C3J G;  2I5H A;  1QNK A;  3KFU A;  2WP8 J;  5EPK A;  1TWH H;  3Q22 A;  4C2M B;  4A76 A;  2ASB A;  1ZYR C;  3I8Z A;  1SE3 A;  2XSC A;  1DM0 B;  4MTN A;  3K7U C;  5KEE A;  4X6A H;  1STE A;  5C4X B;  1A3T A;  1GXD C;  2A73 B;  3VA7 A;  3AYH B;  3I4L A;  1GUG A;  2UXC L;  4B9W A;  4XT1 B;  3NXW A;  2JP1 A;  2O5J C;  3H3V C;  1VS0 A;  3HEJ A;  3GV3 A;  1QCB D;  3A56 A;  1U4L A;  2XVS A;  4K0K Q;  4A3F G;  3MHB A;  2O2L D;  4HCE A;  2F03 A;  1HFN A;  3K7A B;  2F0J A;  3SK5 A;  2PPB C;  4C3J B;  1JB7 A;  1S4Z A;  1UEB A;  2ZJQ A;  2K5W A;  3PO3 H;  2BE5 C;  5IP7 G;  2KHI A;  1EYD A;  4X62 Q;  1PTO F;  5LMN Q;  1I6V C;  4AQY L;  3NTK A;  3T16 A;  5C3W A;  1E7Z A;  5KNC A;  1XNQ Q;  2BDN A;  2PNH A;  1VQ5 A;  1NCV A;  3CW2 C;  1JWM D;  3OYY A;  4OHJ A;  2IL8 A;  4JBM A;  2PW5 A;  2JEA I;  5EGT A;  4A3F B;  1NNX A;  1TS2 A;  1ASZ A;  1IYJ B;  3OMC A;  1KXL A;  2EYO A;  4PZ8 A;  4OEL B;  1G6P A;  3GTM B;  1IBM Q;  5FOB B;  2QDL A;  1PTO H;  1MKH A;  1TWC B;  1WI5 A;  2N55 A;  4RCN A;  2HCC A;  5C44 G;  2MNA A;  1LUZ A;  3NBI A;  3S14 B;  1M8A A;  2E74 C;  4C3I H;  2JA5 H;  5FLM G;  3BVZ A;  1WD0 A;  1VQJ A;  2F0Q A;  4B3S Q;  5M3F G;  3DUZ A;  2EXZ A;  2RSN A;  4JI0 Q;  3I2Z A;  5AJ3 L;  4RGT A;  3HOU G;  1HJP A;  4YIJ A;  1EQV A;  3HS0 C;  1RTO A;  2C5C A;  2VB3 X;  2UUC Q;  4FXK C;  4OXP A;  4QGU A;  1PH3 A;  2ZM6 Q;  3MEF A;  1DON A;  3TDQ A;  4DV7 L;  2UUA L;  3HOX H;  4C3H G;  2PI2 A;  1BO0 A;  2AUJ D;  1B3Q A;  4DAV A;  3NUC A;  4HSP A;  4L5T A;  1UE1 A;  2EPB A;  3NWT A;  3MXP A;  1RKN A;  4YHH Q;  4R4C A;  1AEX A;  5C44 B;  1HR0 L;  3PIP A;  1I5F A;  1JJG A;  3D4W A;  3FKI G;  4CDD C;  2EXD A;  4DAY A;  3JAM L;  1YI2 A;  1WCM G;  1XTC D;  5ELE A;  2JN4 A;  1SRO A;  1E2Z A;  2JK8 A;  5M3F B;  4FF2 A;  2B29 A;  2RBM A;  4DR3 L;  2O4X A;  4JI4 L;  3HOU B;  4QUC A;  3F2B A;  1Q90 A;  2R92 G;  2EYF A;  1HHV A;  1XPO A;  2L15 A;  3KUP A;  2CW0 D;  2RHQ B;  3S17 H;  1X65 A;  5JEA G;  4K8J A;  4C3H B;  1G8Z D;  3GTQ H;  1DD2 A;  3J80 E;  5C4X H;  4OON A;  3MFY A;  1E24 A;  4J1M A;  5FO7 B;  1HRJ A;  1CKM A;  1CTM A;  1VQC A;  3D3R A;  3JC6 6;  4GLX A;  1BVS A;  1EOV A;  5GAH C;  3V2T A;  4NW2 A;  3HKZ G;  4A3E G;  1K9M C;  5JJK A;  5JPN C;  2L55 A;  3FEW X;  5IOD A;  4R1J A;  3FKI B;  4BXX H;  4A3J H;  1L1O C;  1MHW C;  4DR4 L;  1WCM B;  3K7A H;  3G71 A;  3PUX A;  2HUG A;  2RKS A;  2WAQ B;  1KL9 A;  1EEF D;  1B8A A;  1TS4 A;  4C3J H;  5LHY 1;  4I7Z C;  1EY7 A;  4QY7 A;  3H3V H;  1KAB A;  4QB4 A;  3KDF B;  2R92 B;  3GV6 A;  2OTJ A;  3NEN A;  4LFC Q;  1TQO A;  4LNQ A;  1J6Q A;  4JBW A;  3MXG A;  2DJF C;  4HJ9 A;  1EQT A;  2BH8 A;  3MZ5 A;  1VQE A;  4A3M B;  1KTK A;  4L5R C;  1VQH A;  3HKZ B;  4A3E B;  1TVX A;  3X3M A;  2GA4 B;  4XYQ A;  2L5T A;  3BG3 A;  3ULL A;  5LMN W;  2NWG A;  3TRZ A;  4IPD A;  3ZYY X;  1PFN A;  1WTO A;  4B3M Q;  4JI8 Q;  5D3D A;  4PMW A;  3DM3 A;  5IY0 A;  1EWI A;  1TWC H;  3WDN A;  1H95 A;  3A7A B;  1VQG A;  4QF4 A;  4NXN L;  1CHQ D;  2K5D A;  5EAY A;  2A5H A;  2Y0S G;  5FKA C;  1BXT A;  1DOK A;  4A3C G;  4I7A A;  1H9R A;  5T1G A;  1JIC A;  2G5D A;  2D5D A;  3BDL A;  3GQB A;  2C9O A;  3U58 A;  4HJ7 A;  3Q23 A;  4KJN A;  3S15 H;  1HQR D;  1RDP D;  4NDX A;  4LFB Q;  1MBY A;  2HT1 A;  1K8G A;  4V19 0;  4LMQ D;  5C4H A;  4K5V A;  1XNR Q;  3ZJY C;  1ET6 A;  3EVQ A;  1N9W A;  1KAW A;  1LM0 A;  1HZC A;  1ESR A;  2N3S A;  2CH4 A;  2F0O A;  4BA1 I;  2BCO A;  2MP1 A;  1N34 L;  1M90 C;  3E3X A;  3UDI A;  4DFA A;  3U9O A;  1LTA D;  2XRQ D;  4H7B A;  4CGY B;  5CV6 A;  1MGS A;  2H5X A;  2F0F A;  4ZKC B;  3FDT A;  3CPW A;  3JAM i;  4POF A;  4Y7N H;  2OQK A;  1NBW A;  4PZ7 A;  2KA7 A;  3TS0 A;  1IW7 D;  1HA6 A;  2WB1 G;  4JI7 Q;  3S1M B;  2KCM A;  1QZG A;  3KLR A;  3NEL A;  2RDH A;  4IQZ A;  2NVQ H;  1C0A A;  1EYG A;  4M1U B;  1VQI A;  5M3M B;  4M8A A;  4A3G G;  2K03 A;  1MSG A;  2UUB L;  4P71 A;  5ELB A;  2H1E A;  1NUC A;  1VMP A;  1CHP D;  3W1G A;  4DNI A;  3KBX A;  5C0X I;  4GKK L;  2RSO A;  4OGQ C;  2PI2 E;  3I4O A;  4OO1 G;  1O80 A;  2G9H D;  2NN6 I;  3RD4 A;  4FYD A;  1XWE A;  2XRS D;  3F2C A;  1HZA A;  2PQE A;  2A6H C;  3CC4 A;  2JA7 G;  2WB1 B;  3HOV H;  2F0W A;  2LKV A;  3CXC A;  4DK1 A;  2B8F A;  1WOC A;  5ELD A;  4KMU C;  2BH2 A;  4WRD A;  1D8L A;  2WAC A;  1FJG L;  2R7Z G;  5ELN A;  3IKJ A;  1D5X C;  4H02 A;  5M5W B;  1Q12 A;  3NSW A;  4DNT B;  1OXX K;  2CHB D;  3I4N G;  1A6X A;  1SE4 A;  3KBG A;  5ELC A;  3R2I A;  3RR5 A;  1VQ8 A;  5EKL A;  4A3M H;  3I3C A;  3F8T A;  2F0S A;  5LMU Q;  3BZC A;  3CCR A;  1WTR A;  2YTX A;  4UP9 A;  4RMF A;  1Q8K A;  1PH7 A;  1GKH A;  2CVR A;  3NQT A;  4F88 A;  3GTL B;  3PO2 G;  1WTW A;  1FL0 A;  5CV8 A;  1Q81 C;  1SFO B;  1M4V A;  3NBH A;  5M5Y H;  2HHH L;  2UU9 L;  4OX9 L;  5JVH 3;  2Q2U A;  1I6H H;  4ULL A;  3DWA A;  3KOJ A;  1YNN D;  3IRB A;  2A8V A;  4XXE A;  2XN9 C;  2R7Z B;  3FP9 A;  1E2V A;  3SGI A;  3M3Y H;  1R4Q B;  3I4N B;  4GOP C;  4XIG S;  3S24 A;  5IGC A;  2OWO A;  1P8L A;  1SYC A;  2A6E D;  2E2D C;  4K14 A;  1H9K A;  2N8N A;  1LYL A;  1V43 A;  5C4J H;  4GNX C;  1GD7 A;  5F2D A;  3URY A;  1W6K A;  2MPM A;  1E3P A;  4X64 L;  5BN5 A;  1LAB A;  4H13 C;  2UXD Q;  1QG7 A;  2VNU D;  1HPC A;  5M5X H;  1YJ9 A;  4DV3 Q;  4JI1 Q;  5CV5 A;  1HCZ A;  5FO9 B;  2EJG C;  4P2C B;  3FHW A;  4DV0 Q;  5D14 A;  2JA8 H;  1HTL D;  1VQ6 A;  3T13 A;  3QWN A;  1KNE A;  2QDB A;  4UDU C;  3B6Y A;  2HDL A;  1B2T A;  3G6J B;  3Q0A A;  4UP7 A;  1S72 A;  3MEH A;  5M3M H;  1XMO L;  3FVQ A;  1F2Y A;  5FLX c;  3CCQ A;  5FK9 C;  3Q24 A;  1EYC A;  1L0X B;  1TY0 A;  1K8O A;  1FGU A;  1XJV A;  1WD1 A;  3JAM E;  1S5C D;  3M4P A;  1BCP C;  5EBD A;  3PO3 G;  1TWH B;  1ILP A;  1IL2 A;  4DV6 Q;  1U4R A;  3NK9 A;  2DGY A;  1TWG B;  4PMB A;  1C48 A;  1HR0 W;  1N32 Q;  2F0N A;  2EE1 A;  3RZO B;  3RN2 A;  2CH4 W;  1I4X A;  1D1I A;  4GOP A;  4JBJ A;  2C35 B;  3AFQ A;  5CBE E;  2OCE A;  2EOT A;  4K0K L;  5EJW A;  2RA4 A;  5KNB A;  3NHH A;  4JI5 Q;  2EJF C;  1Y8N B;  4UHV A;  3ERO A;  3ICE A;  1QNU A;  3PUV A;  3M4O B;  2E75 C;  1A3V A;  2F52 A;  1SE8 A;  1R9T B;  1ZKO A;  2XNA C;  4QJF A;  1EQQ A;  1SXT A;  4RGO S;  3KJO A;  2QEJ C;  4B3T Q;  3K5N A;  3AEV A;  1U4P A;  1U9R A;  4C3I G;  2JA5 G;  3M7G A;  2PMZ E;  1XNQ L;  4LJZ C;  1QVF A;  3CRK C;  5E7N A;  1SFO H;  1EU4 A;  3TME A;  1CT1 D;  4HED A;  1XYI A;  2VS1 A;  4JYA Q;  3AU7 A;  1EWH A;  3D4D A;  2L9H A;  2F0V A;  2KHS A;  3AFP A;  1E2W A;  3DWQ A;  3OIQ A;  3GTG H;  1JCK B;  3O13 A;  4DR5 Q;  1GHJ A;  1VQ9 A;  3CU7 A;  1SLJ A;  3HOX G;  4NB3 A;  2NVY B;  3MXN A;  3I4N H;  1SYD A;  1RTN A;  2E5L L;  1ONL A;  2F0D A;  1EIH A;  4LF6 Q;  4JV5 Q;  4MHE A;  3CD6 A;  4JK1 C;  5JVG 3;  4BY7 B;  1RCV D;  3QOL A;  5IT9 c;  3S1R B;  3A5U A;  3KF8 B;  1YJW A;  2WKC A;  1DJR D;  1TXY A;  4IPH A;  1IYU A;  2D9U A;  2WKD A;  3OTO Q;  1N33 Q;  4C3I B;  3MTS A;  4Q5V A;  2JA5 B;  4B3S L;  2KEC A;  5KYI A;  1BBW A;  3T1H L;  3OMG A;  1YIT A;  2K75 A;  4KY7 A;  4KHP L;  3I7F A;  5TSS A;  2F0P A;  4DV5 Q;  4LF8 L;  4FVM A;  5IYC H;  2ZM6 L;  4L5S A;  5E1F A;  2YYZ A;  1AN8 A;  4P72 A;  2OF1 A;  1L2F A;  2MQH A;  3CCE A;  3NTI A;  1HZ9 A;  4ZYS A;  3HOX B;  1QUQ A;  3NP8 A;  1LTG D;  1X56 A;  4NKL A;  3LX0 A;  4K2L A;  2FIN B;  3P7J A;  4CJ0 B;  3SK4 A;  2GN5 A;  1JT8 A;  4LWC A;  5CC4 A;  4H44 C;  2ZTC A;  4K6D A;  1PZI D;  3E0J A;  5T1I A;  4LUO A;  4LW1 A;  4TSS A;  2EYJ A;  4DR1 Q;  2VB2 X;  2BDO A;  4CDF C;  4IAL A;  4BXX G;  4A3J G;  3G48 A;  4GN3 B;  3J81 c;  1E1O A;  2HQE A;  1C8C A;  4JBK A;  2A69 D;  2KCT A;  4YWK A;  2YTV A;  1IKL A;  4DR6 Q;  4POG A;  3E9I A;  1YJN A;  2VY3 A;  1GUT A;  4QIW E;  2ZTE A;  1PDQ A;  5I2X A;  2H4O A;  1TWG H;  3TN2 A;  1PFM A;  3S17 B;  3QG1 A;  2AWN A;  2KEN A;  2LY7 A;  4ZRZ A;  3SK6 A;  2AQ2 B;  5G3L F;  4JC0 A;  3RZO H;  4MZ9 A;  3GTQ B;  5IWA Q;  2LS0 1;  4G7O C;  3FRP B;  3NWS A;  2NBF A;  3H6M A;  5H1S E;  1B3A A;  1ZYR D;  1JOR A;  2EVB A;  4DR7 Q;  1EIG A;  1AW7 A;  5AFW A;  4LAA A;  2WII B;  2QIL A;  1N36 Q;  2Z6B A;  1KC8 C;  4A3J B;  4K8I A;  3DHQ A;  2B8G A;  3M4O H;  3GP7 A;  4R4T A;  1R9T H;  5A2Q L;  3A54 A;  4X65 Q;  4Q0F A;  3T4A C;  2SNS A;  4LFC L;  5DNF A;  4DK6 C;  4DUZ L;  2Z0S A;  3MAQ A;  3S9W A;  2R93 B;  4IOC A;  4DPG A;  3CCV A;  2F4V Q;  3RLN A;  3VR3 A;  2KED A;  5BN3 A;  1HQM C;  2BE5 D;  3LGJ A;  2DJG C;  2ZT9 C;  1C9O A;  4HJA A;  1C4Q A;  1WJJ A;  3N52 A;  2F0I A;  1S5D D;  4B3M L;  2NVY H;  3R3O A;  1E22 A;  4A3B H;  1I3Q H;  5FLX L;  1O7Z A;  3DWP A;  1CA5 A;  4JW0 A;  1CFM A;  2K1B A;  3S1N H;  1G91 A;  4MN3 A;  1A15 A;  4BY7 H;  3S1R H;  3S2D H;  4KKT A;  4BA2 I;  4P75 A;  1ML0 D;  4A3D H;  1LO5 D;  4LF4 Q;  1TR5 A;  5E3F A;  3DXJ C;  4CKB A;  1IBK L;  3RZD H;  4EQN A;  5EPJ A;  1PYB A;  1ZEQ X;  4R8N A;  4LFA L;  1UNS A;  3PF5 A;  3S15 B;  4JI3 L;  4LF5 Q;  2VQF L;  1G2T A;  3ULJ A;  3HOW H;  2LXK A;  1ICW A;  1GUN A;  2RQX A;  2PQA B;  3CKI B;  1LTI D;  5FJ8 H;  4DR2 Q;  1IL8 A;  2Z6K A;  3I73 A;  3ERQ A;  2LMC B;  4KTA A;  2ALY B;  2IJ0 A;  2QKI C;  1NJI C;  4B3R Q;  2F3V A;  4OWW B;  1YZ6 A;  2WFW A;  4IOA A;  1HH2 P;  5LL6 X;  4QUF A;  2OQ0 A;  4NPS A;  2EYH A;  1QIL A;  4HAE A;  1WTP A;  3CCM A;  1VQK A;  4WJW A;  1A62 A;  1Y1W H;  4K6L A;  4Y7N B;  4LF9 L;  4GS3 A;  2WAQ G;  5BR8 Q;  4ZQ3 A;  2K4K A;  3HOV G;  4ZCK A;  2EZV A;  1CSQ A;  2IX1 A;  1HZB A;  4B9X A;  1ZXT A;  3G6E A;  3TS2 A;  2NVQ B;  1EUJ A;  4YWL A;  1L0W A;  1T5X D;  2CFM A;  3FPU B;  4ID6 A;  2HIV A;  2EIF A;  5I2Y A;  1IYV A;  4PG3 A;  2F0U A;  3L0O A;  4A3M G;  2XWJ B;  3T56 B;  3X3N A;  2MO1 A;  5DEH A;  3K58 A;  2Z1C A;  5IYB H;  2Q8I B;  1ICF B;  2VQE L;  2K5V A;  1HNX L;  3C3L A;  2DNE A;  1MI2 A;  4BBR H;  5E4W C;  4FF1 A;  1NTG A;  3HOV B;  2KCN A;  4WJ4 A;  3PIO A;  3RLO A;  4HJ8 A;  2JE6 I;  1UWV A;  4RFB A;  3M85 A;  2PO4 A;  1XMQ L;  1TWF H;  5IP9 H;  3CC2 A;  2R93 H;  5C6A A;  4FDB A;  1L1O B;  2BA0 A;  3CCJ A;  4HSV A;  1GJX A;  3T1Y Q;  1B50 A;  1YBY A;  4HJ5 A;  2F0L A;  4GLV B;  5K5P A;  4KV6 A;  3Q8D A;  5LMU L;  1I94 L;  5IYD H;  1AE3 A;  4DA2 A;  1HTP A;  1L0Y B;  4FP5 D;  1JMC A;  1D5M C;  1E0B A;  5IGG A;  1JC7 A;  1VQB A;  4TVA B;  3KLS A;  2L12 A;  4KN4 C;  1GUO A;  2D0P A;  4X3T A;  4IUU A;  3IAY A;  4GKJ L;  4JI6 Q;  5HY6 A;  3J81 L;  1EIF A;  5I6Y A;  4HN7 A;  1J5E Q;  1TS3 A;  4KY6 A;  4AQY Q;  5M5Y B;  1JWS D;  5DLQ E;  4R4Q A;  2KVM A;  1I6H B;  5CR3 A;  4AYB B;  3J80 c;  3DEO A;  2LFN A;  3TP7 A;  1SE2 A;  2K33 A;  4H0L C;  4KD3 A;  3M3Y B;  2WV6 D;  3P20 A;  2JA8 G;  3VDY A;  1C7Y A;  1ILQ A;  2I5M X;  1ASY A;  4MNO A;  1X3Q A;  4J8Q A;  3BU2 A;  5IIF A;  2JJQ A;  1LT6 D;  1JR0 D;  4RCO A;  1Y69 U;  3SEB A;  4DK0 A;  1KRS A;  1Y1V H;  1LV9 A;  3C46 A;  2QGQ A;  2VZA A;  5C4J B;  2QW7 A;  4PNY A;  5M3M G;  3U50 C;  1WTH A;  2NZH A;  2CCZ A;  3HRZ C;  2LXJ A;  2N49 A;  3EFX D;  2RF4 A;  3D0F A;  1FNV A;  2I5L X;  5M5X B;  1SYE A;  5C5M A;  5IOC A;  2PCF B;  1KNA A;  5IGD A;  5AJ3 Q;  4OO1 I;  3LWU A;  1BF4 A;  1FVI A;  2PZW A;  3RLF A;  5JJL A;  2JA8 B;  2SDF A;  4DGZ A;  3HOY H;  4IFD I;  4DV7 Q;  2UUA Q;  1EY8 A;  4A3I H;  3Q6S A;  1B70 B;  1Q82 C;  1EZ6 A;  1PXU A;  3EIV A;  1SRU A;  5C3E B;  4XDX A;  1I4Q A;  1HNW Q;  3OHX C;  2KBN A;  2ATW A;  1F9P A;  1H9S A;  1VQM A;  1HR0 Q;  4FO2 A;  3D6C A;  2KUM A;  3CRL C;  1D2B A;  2KQ3 A;  3U9S A;  2F3W A;  3PUW A;  5J22 A;  5IGB A;  2LSS A;  1YHA A;  4JI4 Q;  4IO9 A;  1NR2 A;  3IFT A;  3R93 A;  1JJ2 A;  3U4Z A;  1X3P A;  1VQL A;  4LUV A;  1AZQ A;  1A2U A;  3OSO A;  2ZJP A;  4TKO B;  2OXP A;  3HGB A;  3H94 A;  1AH9 A;  3OW2 A;  1Q8I A;  2E2I H;  2K28 A;  5CMD A;  1RIP A;  2A6H D;  3G7L A;  2EY2 A;  4CDC C;  4J15 A;  1D6E C;  5IGF A;  1F2M A;  1BBX C;  2KCC A;  1Q46 A;  4BS9 A;  4PZ6 A;  3TZD A;  2ENB A;  2B2W A;  2K5N A;  1ENC A;  1PYS B;  5HGT A;  4APV A;  4RGN A;  3M4Y A;  3ND8 A;  4OIJ A;  4DR4 Q;  3E0E A;  4A93 H;  4B3T L;  3MC0 B;  1EQR A;  3H91 A;  1SR3 A;  3K0X A;  2E8G A;  1SYG A;  4J6H A;  4N9P A;  1PH8 A;  1EYA A;  5L37 A;  3OWE B;  2Z4H A;  2B63 G;  2B2U A;  1QB5 D;  3E5S A;  1YIJ A;  4RHR A;  1IZ6 A;  1F2Z A;  4IJL A;  2P5Z X;  4R8I A;  1O7I A;  2X6L A;  1Z6H A;  1BOS A;  1SYB A;  3R8B A;  3V05 A;  3SDZ A;  2VUM H;  2R7D A;  2RDF A;  5IYC G;  3I90 A;  4DR5 L;  4EVO A;  3TP6 A;  3GTG B;  4MTK A;  3RN5 A;  3I4M B;  3D8G A;  2D62 A;  1SNC A;  3J7Y W;  1EY9 A;  1JWU D;  2FJ2 A;  1SBB B;  1LTR D;  3AQQ A;  4FF3 A;  3OTO L;  1KDA A;  1M1K C;  4JI2 L;  4PQX A;  2NVT B;  3BVM A;  2M2L A;  4ABN A;  4QCL A;  5E4X A;  3VR6 A;  4BWG B;  1NAP A;  1YNJ C;  2B63 B;  4PMC A;  1CA6 A;  1KRT A;  1GUW A;  3I72 A;  4GOP B;  2JA9 A;  4JOI A;  2ICE C;  4L5Q A;  5I9O A;  2R61 A;  1V1P A;  2DN8 A;  3NPP A;  5GQO A;  4HR7 B;  2CKZ B;  4NXM Q;  2J0T D;  4Y52 H;  1VQN A;  4GNX B;  1PRT C;  2V1C C;  2XWB B;  3A0J A;  4ZK9 B;  1AFP A;  2ZXO A;  4P74 A;  1JB3 A;  1ENA A;  3BDO A;  4DV2 Q;  3VR4 A;  5EBC A;  3NE5 B;  4A3K H;  1N34 Q;  4DV1 L;  4DV4 Q;  2Z9H A;  4N9T A;  5C3E H;  1PRT D;  2K14 A;  1PZJ D;  1HUM A;  1U5K A;  4KHV A;  3PIP 3;  1WFQ A;  1KD1 C;  3BYT B;  5D65 A;  1SNP A;  4HTH A;  3K57 A;  1LAC A;  3PUY A;  3SVM A;  4LK1 C;  4HCS A;  3HOZ H;  1O7L A;  1EZ8 A;  1KAA A;  3VA5 A;  3TBI B;  4XQN A;  3A5Z B;  4UPA A;  3TP8 A;  1RHP A;  1BDO A;  1VQD A;  4DXG A;  1DXM A;  1V1Q A;  5CBA E;  1JJC B;  1NMG A;  2WAQ E;  4YY3 Q;  5ELO A;  2MUY A;  3LNN A;  3TRE A;  3CP0 A;  1B4O A;  3PMF A;  4K2K A;  1BCP D;  2ZJR A;  2MJ8 A;  4U67 3;  3KF6 A;  5D3I B;  3GTO H;  1Q7Y C;  4LF7 Q;  4RAU C;  2JA6 B;  1NR4 A;  1D1K A;  2MGS A;  5GAG C;  1RF2 D;  4K5X A;  1BCP B;  1CKN B;  4GKK Q;  4WOR A;  2VW9 A;  2HIX A;  5G3L D;  1LT5 D;  1J8I A;  4A3L H;  3W2D A;  1VQF A;  4A3B G;  3HKZ E;  1MD2 D;  1SMX A;  4CKC A;  5JOB A;  1KIX A;  4BY7 G;  4C56 C;  3CC7 A;  2F0T A;  1GO3 E;  3S16 H;  1CZW A;  3C1E A;  4IUP A;  1WTV A;  4X62 L;  2K7V A;  5LMN L;  2F4V L;  4KI0 A;  4A3D G;  2A68 C;  1VQA A;  3UDF A;  1K73 C;  3VYU A;  4G7H C;  1FJG Q;  1E1T A;  4A75 A;  1A8V A;  1VDZ A;  2DNC A;  5COR A;  3SE0 A;  1Q86 C;  3FMC A;  4X66 Q;  2NVX H;  1VQO A;  5COY A;  5KND A;  4DUY Q;  3HOW G;  2RDG A;  1H9J A;  3GTK B;  1EIY B;  3I4M H;  3JAM c;  5FJ8 G;  1VF5 C;  4IFD H;  2K6A A;  1IBM L;  4A3B B;  1I3Q B;  3OOC A;  1JOQ A;  3W1B A;  3SXH A;  1EY0 A;  1YEZ A;  3S1N B;  1PTO C;  1SEB D;  3GTP B;  4KN7 C;  4XQQ A;  3A8J E;  3J7A V;  2NVT H;  4LF4 L;  2QCP X;  4HIM A;  3S2D B;  3M9B A;  4OX9 Q;  4L6T B;  4A3D B;  4GLA C;  1EWC A;  2B63 H;  3SK8 A;  2IWH A;  4JI0 L;  1PHJ A;  1GVP A;  5C0X H;  3RZD B;  1Y1W G;  2AHO B;  4R9W A;  1EFW A;  1PH6 A;  2YU9 H;  3NTH A;  1CK1 A;  1K28 A;  2NN6 H;  3OW7 A;  2ES2 A;  2K5H A;  2UUC L;  1VQP A;  2Y0S E;  4ZLT F;  2CWP A;  4C1N K;  4HMI A;  2Q2H A;  3HOW B;  4DN4 M;  1SDF A;  3MWY W;  1PRT F;  1O78 A;  1PMR A;  4ZAI A;  3NQI A;  1SNO A;  1G6Z A;  1RL2 A;  3VYT A;  2BA1 A;  3D4R A;  5J1Z A;  4OL7 A;  2IX3 A;  4B3R L;  3DLL A;  5IGE A;  4YHH L;  4WFN 3;  1F9R A;  4F87 A;  3WWV A;  2EYM A;  4Z9C B;  4X64 Q;  5EPL A;  1G29 1;  3A74 A;  4XQJ A;  3A8K E;  3CCL A;  5IYB G;  5BR8 L;  1XX8 A;  2PNR C;  2Z8L A;  3QOJ A;  5JPM C;  2IHF A;  1Y1W B;  4O42 A;  1ESF A;  4BBR G;  1BCP F;  3IFD A;  3BJU A;  3DM1 A;  5CYU A;  1OXT A;  2F0G A;  4DF7 A;  3W3A A;  2WB1 E;  3I91 A;  2E2J H;  1EY4 A;  2Q8T A;  5IP9 G;  2R93 G;  1WYD A;  1UAP A;  2XGT A;  5CV9 A;  4ME3 A;  4IUQ A;  4BBS H;  3IL8 A;  1D5Z C;  1X54 A;  5IYD G;  1XXG A;  2VXW A;  1CI3 M;  3KJP A;  2JA6 H;  4O0A A;  5NUC A;  4KKS A;  3G4S A;  3BVG A;  3KF8 A;  4BY1 H;  2Z6K C;  1KHI A;  1SND A;  1G51 A;  4QL5 A;  4DU9 A;  4F7X A;  1X6O A;  1Z7T A;  1ROD A;  3R2T A;  2KOL A;  4BBR B;  2DY7 A;  4XTC S;  2UXB Q;  1J9O A;  4CBV A;  1YVC A;  1Q1B A;  2K04 A;  1EU3 A;  1JE4 A;  2ZXP A;  2E2H H;  1A2T A;  1FYC A;  1Q1E A;  1S5B D;  3S1Q H;  1DCZ A;  2NYZ D;  2XTI A;  3UE1 A;  3T1Y L;  1TWF B;  2BOS A;  2NZO A;  1SN8 A;  4E6I A;  1HNZ Q;  2B2T A;  4V0B A;  2Q8R E;  1CZG A;  3MA2 B;  1Y1V G;  4CDE C;  1DOL A;  4JI6 L;  3GTK H;  1D7Q A;  4K5W A;  4DAY B;  2YV5 A;  1X3G A;  2TMP A;  4JI8 L;  3FPP A;  3TSS A;  3UDX A;  1WTX A;  1J5E L;  2A19 A;  1F77 A;  2M00 A;  2QEX A;  5EKK A;  3GO5 A;  1B53 A;  3GTP H;  4CKE A;  3EQL C;  4EQP A;  1UE6 A;  3QB3 A;  5I6W A;  1STH A;  1HXY D;  1JQY D;  2FFK B;  1XTD A;  1T5E A;  5KGU A;  2EY6 A;  3CMA A;  1PH5 A;  3HOY G;  4LFB L;  4XYO A;  1K83 H;  3H15 A;  1SJH D;  4A3I G;  3RUZ A;  1WTQ A;  1XNR L;  2EYP A;  4YCV A;  2E5L Q;  4IN3 A;  1Y1V B;  4IUN A;  4ZKB B;  4IFD J;  1TS5 A;  3M7N A;  2RCF A;  3CPF A;  1QVC A;  1JOK A;  4R4I A;  1OXU A;  3J81 j;  4R4O A;  3HG9 A;  3LWE A;  2K05 A;  3VR5 A;  3T1H Q;  2A1A A;  1K8A C;  4KHP Q;  5K36 G;  3M4Q A;  3U4V A;  1EY6 A;  2MHV A;  4DKA C;  2FHT A;  5C0X J;  2HDM A;  3PGZ A;  4LF8 Q;  4QQB X;  3GTJ H;  4HMJ A;  2VL6 A;  2WIN B;  1CM9 A;  4ALP A;  4JI7 L;  3K6O A;  4L63 B;  5EQ0 A;  3H0G H;  3HOY B;  1TWA H;  2IX0 A;  5BN4 A;  1PH4 A;  4A3I B;  2L1B A;  1HNW L;  3C2P A;  1BR9 A;  3CQZ B;  1BNZ A;  1GUS A;  1GHK A;  3RMH A;  4NP5 A;  1QVG A;  4TQU S;  1A63 A;  3CCU A;  3OWF A;  1IBL Q;  1KLU D;  5CGK A;  2L11 A;  5I4D A;  1I4R A;  1T9H A;  2CW0 C;  3N6R A;  1OO9 B;  4A93 G;  2F0M A;  1BKB A;  3TEH B;  2NUC A;  5HGQ A;  5IT9 L;  1WVL A;  2PZU A;  3PSI A;  4OEM B;  2IW3 A;  4C2M H;  2DUD A;  2JYO A;  3K5O A;  3I70 A;  3WOF A;  1MSH A;  1VCI A;  3STB C;  4FF4 A;  3BZD B;  2B39 A;  1U0L A;  4EQ5 A;  2GVB A;  2AMC B;  1PVO A;  4AYB G;  2M9V A;  1BUV T;  2VUM G;  3F1Z A;  1W6J A;  2UXC Q;  2E2I B;  1SAP A;  3EJI A;  4ZUJ A;  3STB D;  2G9D A;  3CME A;  1ET9 A;  1X32 A;  2SOB A;  3PF4 A;  3ULP A;  2PQA A;  2CQA A;  3I56 A;  3A8I E;  1RJT A;  3MVV A;  3K5L A;  4A93 B;  2EJM A;  4KKU A;  4L8J A;  2K52 A;  5GAD C;  3NEM A;  5J3B A;  1AE2 A;  4RGM A;  1KQS A;  3J7Z C;  2KHJ A;  3KK7 A;  2I46 A;  5DM6 3;  2N78 A;  1VF7 A;  3F2D A;  3AMU A;  1LLR D;  1STA A;  5C3X A;  3J7A 5;  4DUZ Q;  5KIX A;  2I07 B;  5CV7 A;  3QIA A;  3W5O A;  1V9P A;  2VUM B;  2AQ1 B;  4O2D A;  2JSO A;  2SEB D;  4XT3 B;  1FNU A;  4DNR B;  1X9N A;  1H9S B;  5GAE C;  3C1F A;  3TP5 A;  4A3F H;  4HIO A;  4ILW A;  2N88 A;  1SNQ A;  4NMZ A;  1LT3 D;  2GVA A;  2PZT A;  1STN A;  2L0C A;  3QJY A;  3GTM H;  4HIK A;  1H9M A;  2PMZ B;  4A3K G;  2NTS A;  3D6W A;  1STB A;  5C3E G;  2PW7 A;  1STY A;  3UDG A;  4OWT B;  4YCW A;  3S14 H;  2B2W C;  3UI2 A;  5IP7 H;  2UXD L;  4IUR A;  4CHT B;  5HUR A;  2NB0 A;  3HOZ G;  1S3O A;  2AKW B;  4LUZ A;  4JI1 L;  4DV3 L;  2PYK A;  2EDG A;  2V4D A;  2FXQ A;  1IBK Q;  1UEA B;  4NXM L;  1AZP A;  5A35 A;  3BS1 A;  1W2B A;  5FO8 B;  4AH6 A;  1PH2 A;  1LTT D;  4DV0 L;  3BYY B;  4LFA Q;  1G2S A;  3KDF A;  2R3Z A;  2B2U C;  4JI3 Q;  2VQF Q;  4AIM A;  2K01 A;  2IHE A;  4UAI A;  1FR3 A;  2E76 C;  3CAM A;  4G4K A;  4DV2 L;  1L1O A;  3S2H B;  4DV4 L;  2F3I A;  4A3K B;  1S5E D;  1VQ4 A;  3CQZ H;  5C44 H;  1IW7 C;  1QJO A;  2OTL A;  2ZXR A;  1R4P B;  2F4I A;  1SJE D;  3QR8 A;  2Y0S B;  5FLM H;  2F1M A;  3GDE A;  3ERS X;  3OPO A;  2KJX A;  4A3L G;  4DAP A;  5M9O A;  1I4H A;  3K5M A;  1YNX A;  5M3F H;  1MIU A;  1P16 A;  4N8F A;  4DAM A;  3HOZ B;  3NBH B;  1CUK A;  2Q2I A;  3HOU H;  1Q3L A;  3TZU A;  4DV6 L;  4LF9 Q;  3CF5 A;  4OIK A;  3EN2 A;  1SNM A;  5K36 H;  4YY3 L;  4DR3 Q;  1N32 L;  2K32 A;  2TSS A;  1PLF A;  3SHL A;  3OIP A;  4C3H H;  4IUT A;  3HKS A; 
#chains in the Genus database with same CATH homology
 3CP0 A;  4JOI C;  5C4X H;  4LF7 L;  4OON A;  4KLK A;  1E24 A;  5H1S E;  2ZJR A;  1OXV A;  3KF6 A;  1CKM A;  1VQC A;  3JC6 6;  4GLX A;  1Q7Y C;  4LF7 Q;  4JI5 L;  3GTO H;  4DR7 Q;  1BVS A;  1EOV A;  5GAH C;  3HKZ G;  5GAG C;  4A3E G;  1K9M C;  5JJK A;  1MJC A;  1CKN B;  4GKK Q;  1N36 Q;  2VW9 A;  4R1J A;  2HIX A;  4KHZ A;  3FKI H;  3I4M G;  4BXX H;  1KC8 C;  4A3J H;  1L1O C;  3M4O H;  4DR4 L;  1WCM H;  4A3L H;  3K7A H;  3G71 A;  4IFD G;  1VQF A;  4A3B G;  3HKZ E;  3PUX A;  4R4T A;  1SMX A;  1R9T H;  1KL9 A;  2VQE Q;  1B8A A;  3L2P A;  4C3J H;  4QY7 A;  4X65 Q;  1KIX A;  1HNX Q;  4BY7 G;  4UY8 C;  3CC7 A;  3H3V H;  1GO3 E;  3TQY A;  3S16 H;  4LFC L;  4X62 L;  3KDF B;  2R92 H;  2RHS B;  2OTJ A;  4DK6 C;  5LMN L;  3KLW A;  2F4V L;  3NEN A;  4DUZ L;  2MO0 A;  2Z0S A;  4KI0 A;  4A3D G;  4LFC Q;  1VQA A;  3UDF A;  4DPG A;  3CCV A;  4IOC A;  1K73 C;  3J81 i;  2F4V Q;  4JYA L;  4EX5 A;  4LNQ A;  1FJG Q;  1E1T A;  5C0X G;  1J6Q A;  4JBW A;  1XMQ Q;  4X66 L;  3RLN A;  4A75 A;  1A8V A;  4IPG A;  3EBE A;  2NN6 G;  4DUY L;  1Y14 B;  3LGJ A;  4HJ9 A;  1Q86 C;  1C9O A;  2BH8 A;  4X66 Q;  1VQE A;  2NVX H;  4HJA A;  4IJH A;  4L5R C;  1VQH A;  2HQL A;  1VQO A;  4DUY Q;  4A3E H;  3HOW G;  1WJJ A;  1I94 Q;  2IT1 A;  1EIY B;  3KYH C;  3ULL A;  5LMN W;  3I4M H;  4B3M L;  1PH9 A;  3JAM c;  3TRZ A;  4IPD A;  2NVY H;  5FJ8 G;  1E22 A;  4LF6 L;  4JV5 L;  1IBM L;  4A3B H;  1I3Q H;  4B3M Q;  3W1B A;  1X3F A;  4JI8 Q;  1YEZ A;  4GKJ Q;  3S1N H;  4PMW A;  4HID A;  3DM3 A;  5IY0 A;  4BY7 H;  1EWI A;  1TWC H;  1N33 L;  3S1R H;  1H95 A;  2NVT H;  4LF4 L;  1VQG A;  4HIM A;  3S2D H;  4NXN L;  3M9B A;  4BA2 I;  4OX9 Q;  4P75 A;  3CCS A;  5EAY A;  4A3D H;  4GLA C;  4LF4 Q;  2B63 H;  2Y0S G;  4NXN Q;  1BBU A;  4JI0 L;  2IY5 B;  1PHJ A;  4DV5 L;  4A3C G;  1IBK L;  1GVP A;  1Y1W G;  3RZD H;  1X55 A;  2AHO B;  1EFW A;  1NE3 A;  1PH6 A;  3BZK A;  3RNU A;  1PYB A;  2YU9 H;  3U58 A;  3KF6 B;  4HJ7 A;  2UUC L;  2ES2 A;  2K5H A;  4LFA L;  1VQP A;  3PF5 A;  3S15 H;  2Y0S E;  4LF9 L;  4JI3 L;  2Q2T A;  1GM5 A;  4LF5 Q;  4LFB Q;  2CWP A;  2VQF L;  2HT1 A;  2Q2H A;  1K8G A;  3ULJ A;  3HOW H;  3E9H A;  1XNR Q;  2LXK A;  3I55 A;  3ZJY C;  1XPR A;  1N9W A;  1KAW A;  1RL2 A;  1LM0 A;  1PV4 A;  2BA1 A;  1JE5 A;  1NMF A;  2JQO A;  2PQA B;  1HZC A;  5FJ8 H;  2N3S A;  4DR2 Q;  2K50 A;  4BA1 I;  4B3R L;  2Z6K A;  3DLL A;  1N34 L;  1M90 C;  3S2H H;  4YHH L;  2B3G A;  3UDI A;  4BBS G;  1Z47 A;  2ALY B;  1NJI C;  3WWV A;  4B3R Q;  4X64 Q;  4DR1 L;  4OWW B;  2JA6 G;  3ER0 A;  1YZ6 A;  1IXR A;  2WFW A;  2RCN A;  1G29 1;  1MJE A;  1HH2 P;  3A74 A;  2H5X A;  4GN4 B;  4IOA A;  5JJI A;  2OQ0 A;  4NPS A;  1XPU A;  3CPW A;  3CCL A;  1N8R C;  4BY1 G;  5IYB G;  2QA4 A;  5IE8 A;  3CCM A;  5BR8 L;  3JAM i;  4RG1 A;  1VQK A;  4DR6 L;  4A3C H;  1A62 A;  2IHF A;  2MFI A;  4POF A;  4Y7N H;  1Y1W H;  2OQK A;  1NBW A;  4GS3 A;  4PZ7 A;  4BBR G;  3TS0 A;  2WAQ G;  2WB1 G;  5BR8 Q;  2K4K A;  4JI7 Q;  3S1M H;  3HOV G;  3BJU A;  1PFS A;  2KCM A;  1QZG A;  2EQS A;  1CSQ A;  2IX1 A;  3NEL A;  1OXT A;  1HZB A;  1K0R A;  3G6E A;  4JCV E;  5IWA L;  3TS2 A;  2WB1 E;  2NVQ H;  1EUJ A;  2ID0 A;  1C0A A;  1EYG A;  4YWL A;  1VQI A;  2E2J H;  1L0W A;  5IP9 G;  2R93 G;  1WYD A;  4A3G G;  2CFM A;  3MXN B;  2XGT A;  4ME3 A;  2UUB L;  4P71 A;  1NY4 A;  2HIV A;  2EIF A;  4DR7 L;  4BBS H;  4PG3 A;  1X54 A;  2UUB Q;  4DNI A;  3W1G A;  5IYD G;  5C0X I;  3L0O A;  4A3M G;  3KJP A;  2JA6 H;  4O0A A;  4GKK L;  1Z9F A;  2PI2 E;  3I4O A;  1N36 L;  4OO1 G;  2NN6 I;  3G4S A;  1S40 A;  2MO1 A;  1QZH A;  1LTL A;  4DK3 C;  4BY1 H;  5IYB H;  1A0I A;  2Z6K C;  1KHI A;  2R7F A;  1G51 A;  2VQE L;  4QL5 A;  1YHQ A;  3F2C A;  2K5V A;  2UXB L;  1X6O A;  1CSP A;  1HZA A;  4X65 L;  1HNX L;  3CC4 A;  4BBR H;  2JA7 G;  1NTG A;  4XTC S;  3PUZ A;  2UXB Q;  4YWM A;  3HOV H;  4WJ4 A;  1YVC A;  1Q1B A;  3CXC A;  3PIO A;  1WOC A;  1CKO A;  3RLO A;  4P73 A;  4HJ8 A;  2JE6 I;  1UWV A;  2E2H H;  1Q1E A;  2ZTD A;  3M85 A;  2BH2 A;  3S1Q H;  1D8L A;  2XTI A;  1FJG L;  1XMQ L;  2R7Z G;  5ELN A;  3UE1 A;  1HNZ L;  3T1Y L;  1TWF H;  2R6G A;  5IP9 H;  3CC2 A;  4H02 A;  4A3G H;  1QUQ B;  4FDB A;  2R93 H;  4GN5 A;  1L1O B;  2BA0 A;  2NZO A;  1Q12 A;  4OWX B;  4AYB E;  1OXX K;  1SN8 A;  5M5W H;  3CCJ A;  1HNZ Q;  3T1Y Q;  3I4N G;  1YBY A;  3RR5 A;  4HJ5 A;  1VQ8 A;  4GLV B;  5LMU L;  1I94 L;  3Q8D A;  5IYD H;  4A3M H;  2I0Q A;  1AE3 A;  3F8T A;  1JMC A;  1Y1V G;  5LMU Q;  3PV0 A;  1OTC A;  3BZC A;  1K3R A;  3CCR A;  1VQB A;  4JI6 L;  4TVA B;  1DGS A;  3GTK H;  1D7Q A;  2YTX A;  4UP9 A;  4DAY B;  2YV5 A;  4RMF A;  1X3G A;  1J5E L;  1Q8K A;  2D0O A;  2D0P A;  4JI8 L;  1X3E A;  3UDX A;  2A19 A;  1PH7 A;  4JI6 Q;  5HY6 A;  1B7Y B;  1GKH A;  4GKJ L;  1EIF A;  2QEX A;  3GTL H;  3PO2 G;  2JA7 H;  1J5E Q;  1FL0 A;  2CQO A;  3GO5 A;  1Q81 C;  4AQY Q;  5M5Y H;  5DLQ E;  2HHH L;  4R4Q A;  2UU9 L;  2Q2U A;  4OX9 L;  3GTP H;  2CWA A;  1I6H H;  3J80 c;  5JEA J;  3KOJ A;  1UE6 A;  1W3S A;  2HHH Q;  2UU9 Q;  3IRB A;  2A8V A;  2R7Z H;  4IPC A;  3D31 A;  3FP9 A;  1XTD A;  3SGI A;  3M3Y H;  1PH5 A;  3CMA A;  2JA8 G;  3VDY A;  1C7Y A;  3H0G G;  2I5M X;  4GOP C;  4XIG S;  4LF5 L;  1ASY A;  3S24 A;  4MNO A;  3HOY G;  4LFB L;  1K83 H;  2OWO A;  3GD7 A;  3BU2 A;  1P8L A;  3H15 A;  2JJQ A;  4A3I G;  1XNR L;  3PCO B;  4YCV A;  2E5L Q;  1KRS A;  1Y1V H;  4YCU A;  2N8N A;  1LYL A;  2QGQ A;  2VZA A;  4IFD J;  1UE5 A;  1V43 A;  5C4J H;  4DR2 L;  3M7N A;  3H3V I;  3CPF A;  1CKN A;  5M3M G;  4GNX C;  1UE7 A;  1GD7 A;  4JI2 Q;  4A4I A;  3U50 C;  2NZH A;  2CCZ A;  1QVC A;  1E3P A;  4R4I A;  4X64 L;  1OXU A;  2LXJ A;  3PO2 H;  2N49 A;  3J81 j;  4R4O A;  4WJ3 M;  2UXD Q;  2VNU D;  2RF4 A;  3D0F A;  4JG2 A;  3K81 C;  2I5L X;  3T1H Q;  5M5X H;  1YJ9 A;  3K80 C;  2A1A A;  4DV3 Q;  4JI1 Q;  1YHB A;  1K8A C;  4KHP Q;  5K36 G;  5AJ3 Q;  1PH1 A;  3M4Q A;  5GRO A;  3U4V A;  4DKA C;  5C0X J;  4LF8 Q;  4OO1 I;  3HFZ B;  1OXS C;  3PGZ A;  4QQB X;  3GTJ H;  1FVI A;  1VQ7 A;  2VL6 A;  3FHW A;  4DV0 Q;  3RLF A;  4ALP A;  4JI7 L;  2JA8 H;  5JJL A;  3H0G H;  1VQ6 A;  3HOY H;  1TWA H;  2IX0 A;  5C4X G;  4IFD I;  1PH4 A;  4DV7 Q;  2UUA Q;  4A3I H;  2YTY A;  3B6Y A;  1HNW L;  1B70 B;  3J80 i;  1Q82 C;  3EIV A;  1SRU A;  4UP7 A;  1PA6 A;  1S72 A;  1HNW Q;  5M3M H;  4DV1 Q;  2KBN A;  1IBL L;  2ATW A;  4UP8 A;  1XMO L;  1QVG A;  3K8A A;  4TQU S;  1VQM A;  1HR0 Q;  2AWO A;  1A63 A;  1I50 H;  2JEB I;  5FLX c;  3CCQ A;  3CCU A;  1IBL Q;  3UE0 A;  1XMO Q;  3L7Z C;  1T9H A;  3GTQ H;  4A93 G;  1BKB A;  1FGU A;  3TEH B;  1XJV A;  3PUW A;  5HGQ A;  2I5H A;  3KFU A;  2WP8 J;  2LSS A;  3M4P A;  1YHA A;  3PSI A;  4JI4 Q;  3PO3 G;  1TWH H;  4C2M H;  2DUD A;  4DV6 Q;  4A76 A;  1IL2 A;  2ASB A;  2DGY A;  4IO9 A;  1HR0 W;  1N32 Q;  4MTN A;  3K7U C;  1JJ2 A;  1VCI A;  3STB C;  3RN2 A;  3U4Z A;  4X6A H;  1VQL A;  1U0L A;  4LUV A;  3AYH B;  4GOP A;  4JBJ A;  4EQ5 A;  2ZJP A;  2C35 B;  3AFQ A;  2UXC L;  2GVB A;  2AMC B;  1PVO A;  4AYB G;  1VS0 A;  2VUM G;  1AH9 A;  3F1Z A;  3OW2 A;  2OCE A;  4K0K L;  2UXC Q;  2E2I H;  3STB D;  1RIP A;  4JI5 Q;  4J15 A;  3CME A;  4K0K Q;  3ICE A;  4A3F G;  3PF4 A;  1Q46 A;  3PUV A;  4PZ6 A;  3ULP A;  2PQA A;  2K5N A;  1PYS B;  4APV A;  3I56 A;  2F52 A;  1SE8 A;  4DR4 Q;  3E0E A;  4A93 H;  4B3T L;  4QJF A;  1EQQ A;  1EQR A;  2K52 A;  1JB7 A;  3KJO A;  5GAD C;  1SR3 A;  1UEB A;  3K0X A;  3NEM A;  2E8G A;  1AE2 A;  5J3B A;  1KQS A;  2ZJQ A;  4B3T Q;  3J7Z C;  3PO3 H;  2KHJ A;  1PH8 A;  3AEV A;  2N78 A;  3F2D A;  5IP7 G;  2JA5 G;  2KHI A;  2B63 G;  2PMZ E;  4X62 Q;  1XNQ L;  3J7A 5;  5LMN Q;  4AQY L;  1QVF A;  4DUZ Q;  1YIJ A;  1IZ6 A;  4IJL A;  5E7N A;  1E7Z A;  1SFO H;  1O7I A;  1XNQ Q;  2PNH A;  1VQ5 A;  2VS1 A;  4JYA Q;  3W5O A;  1V9P A;  3CW2 C;  2VUM H;  3RZO H;  2R7D A;  5IYC G;  3OYY A;  3AFP A;  4DR5 L;  4GNX A;  4O2D A;  4JBM A;  3GTG H;  2JEA I;  1X9N A;  4DR5 Q;  3RN5 A;  1VQ9 A;  5GAE C;  4A3F H;  1SLJ A;  1ASZ A;  4HIO A;  1IYJ B;  4NB3 A;  3HOX G;  2D62 A;  3I4N H;  1KXL A;  2E5L L;  4PZ8 A;  2GVA A;  1G6P A;  4LF6 Q;  3GTM H;  4JV5 Q;  3AQQ A;  4HIK A;  1IBM Q;  3CD6 A;  1MKH A;  4A3K G;  1WI5 A;  3OTO L;  1M1K C;  5IT9 c;  5C44 G;  2MNA A;  4JI2 L;  5C3E G;  3A5U A;  1LUZ A;  3KF8 B;  1YJW A;  1TXY A;  4IPH A;  3UDG A;  4OWT B;  4YCW A;  3OTO Q;  3S14 H;  1N33 Q;  4C3I H;  5IP7 H;  2JA5 H;  2UXD L;  4B3S L;  5FLM G;  1BBW A;  3T1H L;  1VQJ A;  1YIT A;  1KRT A;  2K75 A;  5M3F G;  4B3S Q;  3HOZ G;  1S3O A;  2AKW B;  4LUZ A;  4JI1 L;  2JA9 A;  4DV3 L;  4JOI A;  4GOP B;  4JI0 Q;  4KHP L;  3I2Z A;  2FXQ A;  3I7F A;  5AJ3 L;  4DV5 Q;  1IBK Q;  4LF8 L;  1HJP A;  4L5Q A;  3HOU G;  4NXM L;  5IYC H;  1PH2 A;  1W2B A;  5GQO A;  4AH6 A;  2ZM6 L;  4L5S A;  2YYZ A;  4DV0 L;  2UUC Q;  4LFA Q;  4OXP A;  3KDF A;  4P72 A;  2CKZ B;  4NXM Q;  4JI3 Q;  1L2F A;  4QGU A;  1PH3 A;  2ZM6 Q;  2MQH A;  4AIM A;  2VQF Q;  3MEF A;  2IHE A;  3CCE A;  1HZ9 A;  1VQN A;  4GNX B;  4Y52 H;  3CAM A;  4DV7 L;  2UUA L;  2V1C C;  3HOX H;  1QUQ A;  2PI2 A;  4DV2 L;  3A0J A;  1L1O A;  1X56 A;  4P74 A;  4DV4 L;  4L5T A;  2F3I A;  1UE1 A;  2GN5 A;  1JT8 A;  4LWC A;  4DV2 Q;  2ZTC A;  4A3K H;  1N34 Q;  4YHH Q;  4R4C A;  4DV1 L;  3CQZ H;  5C44 H;  4DV4 Q;  1VQ4 A;  5C3E H;  2K14 A;  4LUO A;  1HR0 L;  1U5K A;  4LW1 A;  3PIP A;  4DR1 Q;  1I5F A;  1WFQ A;  1KD1 C;  2OTL A;  1JJG A;  3FKI G;  4BXX G;  2EXD A;  4A3J G;  5FLM H;  3GDE A;  3ERS X;  3G48 A;  4GN3 B;  1WCM G;  3J81 c;  1YI2 A;  4A3L G;  1SRO A;  1E1O A;  2JK8 A;  3PUY A;  1YNX A;  5M3F H;  1MIU A;  1P16 A;  4DAM A;  2KCT A;  4YWK A;  4JBK A;  2B29 A;  1CUK A;  2YTV A;  3NBH B;  3HOZ H;  4DR6 Q;  4DR3 L;  2Q2I A;  4POG A;  4JI4 L;  3HOU H;  3E9I A;  3A5Z B;  2VY3 A;  4UPA A;  4DV6 L;  3F2B A;  3CF5 A;  1YJN A;  4LF9 Q;  1VQD A;  4QIW E;  2ZTE A;  3EN2 A;  1V1Q A;  4YY3 L;  4DR3 Q;  1N32 L;  2R92 G;  1XPO A;  2L15 A;  1JJC B;  1NMG A;  2RHQ B;  1TWG H;  2WAQ E;  3S17 H;  4YY3 Q;  2AWN A;  2KEN A;  1X65 A;  5ELO A;  5JEA G;  4JC0 A;  4MZ9 A;  4C3H H;  5IWA Q;  3TRE A;  3HKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...