4X6AH

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x6aH00
3PO3H 1XPOA 4JI7Q 1O7IA 1GD7A 2WP8J 2YTVA 1IBKL 1HNXQ 2UUCQ 5BR8L 1MJEA 1KIXA 2QA4A 4POGA 5LMUQ 3S1RH 2VUMG 1EYGA 3WWVA 1PHJA 3S16H 1HNWL 4DR5L 1WFQA 3KF8B 3I4NH 2B63H 5IY0A 5DLQE 4C2MH 2E2IH 5LMNL 1BBWA 2Z0SA 2NVQH 1U5KA 4BY7H 4JOIC 1NY4A 1VQ8A 3PO2G 2CWPA 3CD6A 4JYAQ 2D0PA 4DV0L 1WCMG 1AH9A 4P74A 2IX0A 1YJ9A 3M3YH 2PQAB 1XPRA 3PIPA 2JA5H 1YI2A 1KXLA 1RL2A 3FP9A 1KAWA 3ULPA 5FJ8G 2NZOA 2VW9A 3RZDH 1QZGA 3M4QA 1MJCA 2JA8H 4LF5Q 1D7QA 4JI2Q 2UXCQ 3W1GA 2ZJPA 2VQEL 3S17H 5IYDH 2YTXA 1K0RA 5IYBH 2QEXA 4HJ9A 4JI2L 3TS2A 2YV5A 2JQOA 1X9NA 4DAMA 3TRZA 1HZBA 4DV3Q 4DUYL 4LFBQ 1IYJB 1BKBA 3UDFA 1YHQA 3W5OA 4P75A 4B3RL 1JJGA 4DKAC 2WB1E 4A3FH 4GN4B 2JA6G 4X6AH 5JJLA 4AQYL 4NB3A 3AFPA 1N33Q 4LW1A 4R4OA 3EBEA 3HOYG 4A76A 2K5NA 2KCMA 3UE1A 1EQQA 3VDYA 2RHQB 1G291 3ER0A 2I5LX 5M3MH 3IRBA 3M9BA 3JC66 2K52A 3CAMA 5LMNQ 4DV1L 2UUBQ 1VQKA 1UEBA 1RIPA 3F1ZA 3H0GG 1SFOH 3ZJYC 1CSPA 3F2DA 3CCVA 3KJOA 2R7FA 4GLXA 1KQSA 1YZ6A 2AHOB 2HQLA 4DK3C 2N49A 1WOCA 4B3TQ 1VQCA 4DV2Q 4GKJL 3PF4A 2GVBA 2ZTEA 3CCLA 3T1HQ 3KFUA 2C35B 2R7DA 5JEAG 4HIKA 1XNRL 2F4VQ 2AMCB 4KHPL 3PO3G 3L7ZC 4K0KL 4OX9L 4B3TL 1LM0A 1VQNA 4A3IH 1WJJA 1EQRA 1EIYB 3I4OA 4DV5Q 4LF9L 1FGUA 2ES2A 2K5HA 2YYZA 1VQLA 2UUCL 2E5LL 4OWTB 3I4NG 2UUBL 4JI7L 1UWVA 1W3SA 2JA7G 3H3VH 3EN2A 4ALPA 4A3CH 1XMQQ 5IWAQ 4A3BG 4LFCQ 4A3EG 2I5MX 5M3FH 3A5ZB 2HIXA 3GD7A 5AJ3Q 4GN5A 3K8AA 1I94L 2UUAQ 5JJIA 1YVCA 1PH6A 2XGTA 1KHIA 1C7YA 3M4OH 1Q8KA 1TXYA 2Z6KA 4J15A 4OXPA 5IWAL 3PGZA 4OWWB 3OYYA 4DUYQ 1UE6A 4DV4L 1FVIA 3GTLH 5H1SE 4X65L 4IOAA 2ZTDA 4LF9Q 1DGSA 3W1BA 2VNUD 4HIMA 1L2FA 1QVGA 3U4VA 3UE0A 1YBYA 5IYCH 3NEMA 2L15A 1PFSA 4LFCL 5IP7H 5M5YH 3CCSA 4YWLA 2K5VA 5IYBG 3CPWA 1B8AA 2PI2A 4DR3L 2VQFQ 4LF8L 1EOVA 1UE1A 1BBUA 5JEAJ 4LF4Q 3UDXA 1C9OA 2Y0SE 3PUVA 2PNHA 1KRSA 1VQGA 2AKWB 4OX9Q 3K7AH 3S1QH 4JBMA 4P73A 5FLMH 3JAMi 4KI0A 5GROA 3J7A5 4IFDI 1HR0Q 2E2JH 2AWNA 2IHEA 1XNQL 5FLXc 1SN8A 3G48A 1X65A 4QGUA 4GS3A 4JV5L 1A62A 2Q2HA 2NVYH 4DR6L 4WJ3M 3UDIA 4JI6Q 1WI5A 1TWAH 3TREA 3K7UC 5M5WH 1I5FA 1TWFH 5LMUL 3GTOH 1IZ6A 4LF8Q 3FKIH 4GNXA 2VY3A 1HH2P 2BH8A 3STBD 4UP9A 1OXSC 3HOXH 1JB7A 1V9PA 4DR1Q 2CCZA 2KENA 1IL2A 4JI8Q 1UE5A 1J5EL 4R1JA 1VCIA 4QJFA 1X54A 1PH8A 4L5TA 1PH5A 3PF5A 4DR4Q 1N32L 2DGYA 3FHWA 3ULJA 3KDFB 3TS0A 1Y1VH 1XJVA 2CKZB 3PSIA 1HZAA 4DV3L 4L5SA 3S2DH 1SMXA 4A3CG 2CFMA 2BA0A 1VQ4A 2DUDA 1N32Q 3GTGH 1JT8A 4LNQA 3Q8DA 2NZHA 5HGQA 3OW2A 4DV0Q 4ME3A 2KHIA 5ELNA 4QY7A 4GNXB 1VQMA 1XMQL 1HR0W 2ZJQA 4JBKA 3U58A 5C44G 3RNUA 2MO1A 4TVAB 1CUKA 4DV7L 4B3MQ 3PCOB 1X3FA 2MQHA 2OQKA 1K73C 3H0GH 3SGIA 1GKHA 4DR5Q 1E7ZA 4IJLA 1JE5A 3MEFA 4JI6L 3GTKH 3PO2H 4HIOA 2EIFA 3JAMc 2A1AA 1LTLA 1L1OA 4YWKA 2AWOA 4APVA 1IBML 3T1HL 1QUQB 2GVAA 4A3KG 1ASYA 3OTOL 2IX1A 5C4XG 2ALYB 2UXDL 1YJNA 1W2BA 1KL9A 2WAQG 4Y7NH 1YEZA 2N3SA 4DR2Q 3K0XA 2EXDA 2VQFL 4GN3B 1PH9A 2HHHL 2JA6H 1WYDA 1X55A 1X6OA 4B3SQ 4A75A 1HNZL 3HOVH 4OWXB 4YHHL 2IT1A 1E1OA 4JBWA 3DM3A 3PV0A 4JOIA 2XTIA 1FJGL 3KYHC 4IPCA 2K14A 1M90C 4BBRG 1PH3A 2B29A 4AQYQ 1YIJA 4A3GG 2NVXH 1L1OB 1N34Q 1MIUA 3K80C 4BY1G 2R7ZG 1YHBA 1B7YB 3PUZA 3L2PA 1QUQA 1Q12A 3AYHB 4HJ8A 2I0QA 2A8VA 1AE3A 2WB1G 4QL5A 3S1NH 4AIMA 3HOUH 3G71A 4TQUS 2LXKA 4LF6L 1Y1VG 1HZCA 1VQBA 4YCWA 4YY3L 1V43A 5AJ3L 4O0AA 4AYBE 1VQJA 1Y1WH 1E3PA 1OXUA 3D0FA 3CCQA 4JI8L 1VQ5A 1XTDA 4KHPQ 3RN5A 4R4IA 1HNZQ 1X56A 1IBLQ 2JEAI 1PH4A 4BXXH 5IT9c 3HFZB 1FL0A 2UU9L 1K9MC 1I3QH 4DV2L 4GKJQ 3CXCA 4A3GH 1N36Q 4H02A 4QIWE 5EAYA 1IXRA 5IP9G 1PH7A 2ID0A 4IOCA 3GTPH 1SLJA 1K3RA 3GTJH 1EFWA 2UU9Q 3RLOA 1VQDA 3CPFA 1GM5A 3L0OA 2ASBA 1E22A 1Q1BA 4HJ7A 2R93H 3KLWA 4OO1I 5M5XH 5C44H 4GLVB 1VQHA 1Q86C 3CF5A 2JA7H 4LUZA 4DV6Q 3E0EA 4A3EH 3S1MH 4A93G 1N9WA 5C4XH 4DV4Q 2RCNA 1HNXL 1VQOA 4JI4L 2VUMH 1PA6A 3KF6B 2LXJA 3I7FA 5LMNW 1UE7A 2K75A 2R92G 3UDGA 1Q7YC 3HKSA 4DR4L 1V1QA 4JI1L 2OQ0A 4LF6Q 4BBSH 4UP8A 1CKMA 4C3IH 5IP7G 3F2BA 1NE3A 4NXNQ 1B70B 2RHSB 3HKZE 1HZ9A 2E8GA 4X65Q 1FJGQ 3CMEA 2D62A 1K8AC 4PZ7A 1A0IA 4IPGA 3G6EA 1X3GA 3M7NA 1ASZA 4PZ8A 1TWGH 3NELA 2OCEA 1VQ9A 2JK8A 4MZ9A 1JJCB 4NXNL 4JI1Q 5GAGC 1XNRQ 4DR7L 1SE8A 2Z6KC 3RN2A 3S14H 4DR6Q 4LUOA 2KCTA 4X62L 3OTOQ 1G6PA 4KLKA 3RR5A 4YHHQ 4RG1A 1T9HA 3RLNA 4WJ4A 1VQEA 2MNAA 3RZOH 3PUXA 5ELOA 3CC2A 2A19A 5C0XI 4DR2L 3ULLA 2KHJA 2N78A 1VQPA 1S72A 4A3DH 4A3LG 2MO0A 3J80c 3FKIG 1R9TH 1VQIA 2OTJA 5BR8Q 4A3JG 4JV5Q 2BH2A 3J80i 3KDFA 2F4VL 1PH2A 3I55A 4LF7L 4R4CA 4YCVA 4C3HH 3S15H 2F52A 3HOYH 4PZ6A 5IP9H 2NN6G 2VZAA 1Z9FA 4JI5L 1YNXA 2CWAA 1JJ2A 4XIGS 3STBC 3AFQA 4UP7A 2B3GA 4DPGA 3KOJA 1IBKQ 1QVFA 2H5XA 2YTYA 5C4JH 3I2ZA 1NBWA 4LFBL 1U0LA 5GADC 3CCJA 4QQBX 3F8TA 1PH1A 3CCRA 3CCMA 4LFAL 1S40A 4GKKL 1SROA 4YY3Q 3GTQH 1Q1EA 1Y14B 5J3BA 2FXQA 5FJ8H 4X64Q 4GLAC 3E9HA 4POFA 4L5RC 4GNXC 4BY1H 2Q2UA 4LFAQ 1D8LA 3RLFA 4BBRH 2R7ZH 4GKKQ 4MNOA 1VS0A 5GAHC 1M1KC 2JA5G 3HOWG 5HY6A 5FLMG 4IJHA 1J6QA 4P71A 4KHZA 4C3JH 4BA2I 4RMFA 4GOPB 4DV6L 1QZHA 1P16A 1AE2A 4X64L 4L5QA 2ATWA 1OXVA 5K36G 3HOUG 5JJKA 2VQEQ 2WFWA 3GDEA 2UXDQ 1VQ6A 3KJPA 1SRUA 4HJ5A 4FDBA 3I56A 1XMOL 4LF5L 2NVTH 1X3EA 1A63A 5GAEC 1BVSA 3M85A 4OONA 3T1YQ 4A3KH 4LWCA 2ZM6L 1HJPA 2CQOA 4P72A 2JJQA 3EIVA 1VQ7A 2ZJRA 3ICEA 3HKZG 2B63G 2I5HA 4K0KQ 3BJUA 1N36L 1A8VA 1I50H 2R6GA 4DUZQ 1CKNB 4JI5Q 4UY8C 4X66L 4LF4L 2V1CC 1KRTA 3CW2C 4BY7G 1IBMQ 2OWOA 3T1YL 1VQAA 4JI0L 4R4QA 4IFDJ 1QVCA 4LF7Q 2ZTCA 1XNQQ 1Q46A 4X66Q 3PUWA 3H3VI 5C0XG 4DUZL 1NMGA 5E7NA 4GOPA 4HJAA 4PMWA 1YJWA 4A93H 2YU9H 2PMZE 1G51A 1WCMH 1E1TA 3ERSX 3NBHB 2ZM6Q 1NTGA 4DR3Q 3U50C 3E9IA 2EQSA 3J7ZC 1N8RC 1JMCA 4NXML 2R92H 1P8LA 4A3IG 4LUVA 1Q82C 3U4ZA 4GOPC 3BU2A 2IHFA 4X62Q 2LSSA 3I4MH 1S3OA 4BBSG 1VQFA 4DR7Q 4A3MH 3HOZG 1CKNA 1K83H 1YHAA 2QGQA 3CMAA 2UXBL 4DR1L 4YWMA 2KBNA 1GO3E 4B3SL 4BXXG 2HHHQ 2JE6I 1OTCA 4AH6A 3A74A 2E2HH 4EX5A 5C3EH 3J81i 4HIDA 2OTLA 2WAQE 3CCEA 4A3FG 2HT1A 5M3FG 3A5UA 3BZKA 4AYBG 1OXXK 1Z47A 1PV4A 1PVOA 4EQ5A 5M3MG 1K8GA 2UXCL 3AEVA 3B6YA 1KD1C 3GTMH 4IFDG 4MTNA 1NMFA 4O2DA 1YITA 2K50A 2JA9A 4NXMQ 1L0WA 3KF6A 4JCVE 1EUJA 3CP0A 4OO1G 4IPDA 2Y0SG 3CQZH 3S2HH 1XPUA 3F2CA 4DV5L 1LYLA 1TWHH 3HOVG 2R93G 1PYBA 1GVPA 3K81C 4JC0A 4NPSA 4A3DG 3J81j 2GN5A 3S24A 4DV7Q 4B3ML 5C3EG 4JYAL 5IYCG 4JI0Q 2D0OA 4DV1Q 4A3JH 1SR3A 2VL6A 1E24A 2K4KA 1LUZA 2NN6I 4BA1I 4DAYB 1OXTA 1XMOQ 1HR0L 5IYDG 2N8NA 3J81c 2PI2E 3BZCA 3D31A 4XTCS 1HNWQ 2JEBI 2JA8G 1N33L 4YCUA 4Y52H 4IO9A 1CSQA 4JBJA 3LGJA 3PUYA 1PYSB 1NJIC 4A4IA 1MKHA 2VS1A 4A3BH 1CKOA 3GO5A 1IBLL 2HIVA 1Y1WG 1N34L 2UXBQ 1EIFA 2MFIA 3AQQA 5IE8A 1Q81C 1TWCH 3MXNB 1KC8C 3G4SA 4IPHA 4UPAA 1I94Q 1C0AA 3H15A 1J5EQ 4PG3A 2F3IA 4JI3L 1L1OC 3PIOA 3I4MG 4B3RQ 3CCUA 5GQOA 1I6HH 3TQYA 4DNIA 2Q2TA 4A3MG 2E5LQ 5C0XJ 3HOWH 4DK6C 4JI3Q 3HOXG 4A3LH 3M4PA 2RF4A 2IY5B 2Q2IA 3A0JA 2UUAL 3NENA 2PQAA 3CC4A 2BA1A 1EWIA 4R4TA 3TEHB 3HOZH 4JG2A 1H95A 3CC7A 4JI4Q 3DLLA
chains in the Genus database with same CATH superfamily
1HCZA 3I73A 4JI7Q 3NWTA 2YTVA 1EY0A 4ULLA 2DNEA 5LMUQ 2B2TA 4KK7A 3KK7A 4O1NA 1WTRA 4DR5L 3KF8B 2E2IH 4BY7H 2AUJD 1A3TA 3X3NA 4DV0L 2PPBC 4FF3A 4P74A 2KECA 2PQAB 1XPRA 1YI2A 2XWJB 3FP9A 2ZXPA 1SYFA 4JI2Q 2Z1CA 4F7XA 2YTXA 3UI2A 2QDLA 3TS2A 2CH4A 2YV5A 1X9NA 4DAMA 2K5WA 3J7AV 1BKBA 3R3OA 3UDFA 3W5OA 1EY9A 4QMGA 4B3RL 3ITPA 4X6AH 2AUKA 2A74C 4AQYL 2KEEA 3HKZB 2HD3A 3EBEA 4QIWB 1I6HB 1F2LA 2I5LX 1C4QA 1RIPA 3F1ZA 3H0GG 3ZJYC 1CSPA 3CCVA 4KJOA 2R7FA 5CV7A 2FJ2A 2N49A 5IGEA 4DV2Q 4GKJL 4G7HC 1LLRD 3CKIB 2C35B 4K8JA 1XNRL 4CJ2C 3HS0C 4OX9L 4FVMA 5IGDA 3A7AB 3I4OA 1FGUA 2ES2A 3OIQA 3Q0AA 4DK1A 2E5LL 4JI7L 1PFNA 1W3SA 2JA7G 1XMQQ 4A3BG 5CBEE 3VR4A 3HOYB 5JJIA 4FO2A 1TXYA 4J15A 4XXEA 5I6YA 5EJWA 1SNCA 4DUYQ 3GTLH 3LWEA 4LF9Q 1DGSA 3S1NB 1WTHA 4X3UA 4HIMA 2Q8RE 3UE0A 1PFSA 4YWLA 2K5VA 2PI2A 4IURA 1LO5D 1LTGD 2MUYA 5BN3A 4LF4Q 5JEAJ 1C9OA 2Y0SE 2Z9HA 2E75C 2AKWB 2SEBD 4KKSA 4KI0A 2E2JH 2AWNA 1X65A 4GS3A 4JV5L 5D14A 4P2CB 4DR6L 1CQVA 3P1HA 1WI5A 3TREA 1ICWA 4ZUIA 3GTOH 4IQZA 3BVZA 4V0BA 2VY3A 2AQ2B 3STBD 3H94A 1B3QA 4JI8Q 4C3HG 1I50B 1BXTA 3P7JA 4ID6A 1O7ZA 4QJFA 1A6XA 1X54A 4L5TA 1PH5A 1N32L 1SYEA 3KF8A 1SE3A 1X32A 1PDQA 1XJVA 3PSIA 4Z9CB 3NK9A 3S2DH 1NNXA 2AQ1B 4BBSB 2CFMA 2F4IA 1VQ4A 4LNQA 1U4PA 3Q8DA 3K7AB 4DV0Q 1XNRQ 2KHIA 3K5OA 1VMPA 2B8FA 5E1FA 1VQMA 1XMQL 1MI2A 1B53A 3U58A 3RNUA 3SK4A 4TVAB 4B3MQ 3C1EA 3PCOB 1BCPF 1I4GA 3E5SA 3GTKH 4G7OC 1ML0D 3MEFA 4PMBA 4HIOA 2M9VA 1LTRD 3JAMc 4BS9A 4L6TB 4YWKA 1SMYD 3AB9A 1IKLA 1O7LA 4ZUJA 1U4RA 5C4XG 2UXDL 4RFBA 1GUOA 1KL9A 1W2BA 5K5PA 1YEZA 2QEJC 4GN3B 1MD2D 1HQMC 1HNZL 2LKVA 3BG3A 4JBWA 1FJGL 2J7ZA 3MXUA 3TMEA 3KYHC 5A35A 4IALA 4G4KA 3HOUB 4AQYQ 5L37A 1YHBA 1PTOF 1B7YB 3PUZA 3AYHB 3H0GB 5IT9L 4HJ8A 2A8VA 1AE3A 4QL5A 3T16A 4AIMA 4ZKCB 4TQUS 4YCWA 1Z6HA 4AYBE 1VQJA 3VYUA 1VQ5A 2H1EA 1IBLQ 5KNCA 1S5DD 1PH4A 3AU7A 1PTOH 2IPKD 3HFZB 1K9MC 1I3QH 1I4QA 1S5FD 5M3FB 1WTPA 3VYSA 1PH7A 2CH4W 2IJ0A 3URYA 2EYLA 3RLOA 1VQDA 3S2HB 1GM5A 3L0OA 2A6HC 1CI3M 3TZDA 3KLWA 4OO1I 5M5XH 1D2BA 3C1FA 5C44H 1A15A 2D2CC 2KUMA 3E0EA 1I6VC 1HNXL 3GTOB 4RGOS 3WDNA 2EXZA 2VUMH 1PA6A 3KF6B 2G5DA 1UE7A 1B1ZA 4LK1C 1K83B 5LHY1 1Q7YC 3HKSA 4DR4L 1CKMA 4C3IH 4NXNQ 5CR3A 3JAML 1FJGQ 1HZ9A 2E8GA 5CV4A 3LNNA 4N9TA 3CMEA 1ASZA 4PZ8A 5EKLA 1Y1WB 1TWGH 3NELA 1HTLD 4MZ9A 4K14A 3S14H 1BCPB 2KCTA 2F0PA 3OTOQ 4KLKA 1A2UA 1T9HA 2BOSA 4WJ4A 3RZOH 3H6MA 3H3VC 3PO3B 3SDZA 5C0XI 3ULLA 2KHJA 4KY5A 1S72A 1T5EA 5DEHA 2MO0A 1LT5D 2EY2A 3FKIG 5JPMC 5ELBA 2OTJA 2F4VL 3S15H 1BF4A 4R9WA 2F52A 1E2WA 3HOYH 4PQXA 2NVTB 1STHA 1WTWA 5EBCA 2XRQD 3STBC 3K5MA 1QOHA 3QWNA 2PZWA 2H5XA 5C4JH 5I6WA 4KY7A 2Z8LA 1PH1A 1FGBD 3CCRA 5DNFA 2L12A 2FXQA 2LFNA 4GLAC 4X64Q 3VYTA 4RH6A 4BBRH 4GKKQ 4MNOA 5GAHC 2JA5G 3G7LA 5DAUA 4R8IA 1B9MA 4C3JH 3DM1A 1AE2A 1G6ZA 1FD7D 1SRUA 4FDBA 4ZYSA 4A3GB 1DD2A 3M85A 2KCCA 4WFN3 3OMGA 1HJPA 3ND9A 2F0LA 4A3FB 2K6AA 4DAPA 1EY7A 2B63G 4DGZA 4K0KQ 3RMHA 4JI5Q 1ET9A 2B2UA 1IBMQ 2O5IC 4IFDJ 3FVQA 1BDOA 1QVCA 2B2YC 1LTTD 3NTIA 2B2WC 5E7NA 2PMZE 1LABA 3MAQA 1NTGA 3U50C 3E9IA 1DXMA 1P8LA 1Q82C 3DEOA 5HGTA 5EQ0A 3A7LA 1KABA 2JSOA 4CBVA 4DR1L 4YWMA 4CKEA 4AH6A 2NB0A 4HIDA 3CCEA 5G3LD 5M3FG 1RKNA 3BZKA 1OO9B 1IL8A 2BE5D 4AYBG 3IL8A 3SR1A 1GOZA 3GTKB 2A6ED 3GTMH 4IFDG 1C48A 1YITA 2NYZD 2K50A 1Y8NB 4JCVE 4IPDA 2RKSA 3CQZH 2Y0SG 1XYIA 3F2CA 1WTXA 1I4HA 1GVPA 2RA4A 2V4DA 2X6LA 4Q5VA 3SE0A 1Q8IA 1VMCA 1MGSA 2K4KA 1XMOQ 4BBRB 4YCUA 2QCPX 3LGJA 1FNUA 3MFYA 2XN9C 5CBAE 5ELEA 1FNWA 1Y1WG 1EIFA 1NUCA 1Q81C 1TWCH 4HMJA 3BDOA 4PG3A 1EEFD 1FNVA 1NR4A 5JPNC 4B3RQ 5FO7B 2TMPA 4DNIA 3HOWH 1TS5A 2NTSA 4DK6C 4HCSA 1PRTD 3M4PA 2RF4A 4C3JB 1QNUA 2B2YA 2TSSA 2PQAA 5F2DA 4J6HA 4JI4Q 4JI0L 3PO3H 2FFKB 2WP8J 3IFTA 2WB1B 1LTID 1CZGA 4PMCA 3WWVA 1PHJA 1HNWL 3QR8A 5E4WC 2NVQH 1U5KA 4JOIC 1NY4A 5C0XH 4C1NK 2K5DA 2G9DA 1SMYC 3M3YH 4CKCA 2OXPA 3PIPA 2I46A 5FJ8G 2NZOA 2R61A 1PTOC 3M4QA 2JA8H 5TSSA 5E4XA 4LMQD 5C6AA 3S17H 3J80L 3GV3A 3KUPA 1GJXA 5IYBH 4HJ9A 1EIHA 5NUCA 3VA5A 4JI2L 1HZBA 4OELB 4DUYL 4DV3Q 1IYJB 1YNNC 1JJGA 2JA6G 1TY2A 4RKBA 3AFPA 1YNND 2DNCA 4LW1A 4R4OA 2QILA 4A76A 3M7GA 5DM63 1BOSA 2KCMA 1U9RA 1EQQA 3PQIA 1G291 4F87A 3ER0A 5FLXE 4DV1L 3JC66 5LMNQ 4E6IA 1VQKA 1UEBA 3F2DA 3EFXD 3PMFA 1Y1VB 5I4DA 2AQ3B 1VQCA 3A55A 3PF4A 1GUWA 3CCLA 3KFUA 2R7DA 4KHPL 3A54A 2L55A 4K0KL 4A3IH 4CHTB 2R93B 4LF9L 1EQRA 1F9PA 3OIPA 1GHKA 2K5HA 4HR7B 4XQNA 1VQLA 1TWFB 1QE6A 3BDCA 4RAUC 1SJED 3RZDB 2RDHA 5AJ3Q 4I65A 4GN5A 1PTOB 2PZUA 2N55A 2UUAQ 3Q6SA 2MP1A 2XGTA 3M4OH 4XYQA 1Q8KA 2FINB 5IWAL 1VF7A 3D4DA 4OWWB 3OYYA 2F0OA 1UE6A 4FYDA 4DAYA 5H1SE 2K01A 2B2WA 1HXYD 2JXMB 1RJTA 2GA4B 3W1BA 4OIJA 5T1IA 1X3PA 5M5YB 4DU9A 1EOTA 1YBYA 5IYCH 1PLFA 3K57A 2L15A 4LFCL 5IP7H 1D5MC 3CPWA 1Y69U 4K6LA 2EY1A 2FMCA 4WJWA 3PUVA 2PNHA 3X3MA 1KRSA 3HRZC 4ZQ3A 4JBMA 5FLMH 1QNKA 2Q8IB 3JAMi 2EY6A 3J7A5 1RCVD 4IFDI 1HR0Q 2IHEA 1J8IA 1QCBD 1UEAB 3N52A 4ZKBB 4XQQA 2Z4HA 4WJ3M 4UAIA 4F88A 3K7UC 1I5FA 1TWFH 4DF7A 5LMUL 1IZ6A 4LF8Q 3FKIH 2BH8A 3HOXH 4EQOA 1JB7A 4DR1Q 2KENA 1J5EL 1VCIA 3A8KE 3BS1A 1PH8A 1GUNA 4DR4Q 3TBIB 4ZK9B 3MFGA 3KDFB 1Y1VH 4B9WA 4RWSC 3GTPB 4DV3L 2BE5C 1KLUD 1TS2A 4RGMA 4A3CG 1D5ZC 1RDPD 3FEWX 1JT8A 2ZXOA 2KHSA 1EEID 3S9WA 3OW2A 2F1MA 4QY7A 4CDCC 1X3FA 3SGIA 1GKHA 3W3AA 1K28A 4JW0A 1B2TA 4JI6L 3PO2H 3D6CA 1PFBA 1JB3A 1LTLA 4APVA 1QUQB 2VXWA 2GVAA 2F0HA 1ASYA 3OTOL 3GTJB 1YJNA 3IAYA 3HOVB 4Y7NH 1STEA 2EXDA 2VQFL 1JCKB 3I4MB 2HHHL 3MTSA 4B3SQ 3HOVH 2B39A 3NP8A 4JOIA 3DM3A 2XTIA 4K5VA 4A93B 3MXGA 5EKIA 1YIJA 4A3GG 2NVXH 1L1OB 2SDFA 4BY1G 5IODA 1EYDA 5CORA 1Q12A 2I0QA 3S1NH 1H9SB 1EYCA 4RCNA 2F0UA 3G71A 1Y1VG 3GTLB 1VQBA 1G6PA 4KHPQ 2SNMA 1XTDA 3RN5A 5CV9A 4M8AA 4M1UB 4S3SA 2JEAI 3C3LA 4DK0A 4C3IB 3R93A 1FL0A 4CKBA 3DWAA 5IT9c 4DV2L 2UU9L 4GKJQ 4H02A 1EL0A 4IOCA 3GTPH 1WTQA 1TIID 3CPFA 3PIP3 2ASBA 2DY7A 4IFDH 1TU2B 3V96A 3I91A 4JVZA 4KTAA 3ONAB 3S1MH 3KLRA 3GTQB 3P20A 1D5XC 1N9WA 2RCNA 2KVMA 3BDLA 5ELFA 2R92G 3UDGA 1PTOD 3MVVA 4K5WA 1V1QA 1I3QB 4XYOA 4LF6Q 4UP8A 2A73B 4AYBB 4CGYB 1L0YB 1B70B 1B44D 1IW7C 2PZTA 5CMDA 1A0IA 1STNA 3M7NA 1EY4A 1RHPA 5KRUA 1VQ9A 1JJCB 4N8X1 4JI1Q 5GAGC 1JE4A 1VDZA 3QG1A 4RG1A 3RLNA 1JOOA 3CRLC 4NMZA 1VQEA 2MNAA 5A2QE 3H09A 5ELOA 1DOMA 2A19A 5CV8A 4A3DH 3J81E 3ERQA 1CZWA 2IL8A 3J80c 1VQIA 1XWEA 3I90A 5BR8Q 2EY5A 2BH2A 4JV5Q 1SE2A 1PH2A 1KLGD 1U4MA 3LX0A 2XIWA 3TZUA 4H44C 2M2LA 2VZAA 3EROA 4JI5L 3S1QB 1JC7A 3FPPA 3AFQA 4HSPA 2WKCA 1SNOA 4K5XA 1QVFA 1NBWA 4CJ1B 3MHBA 5GADC 1SYDA 1ZYRD 4LFAL 3CCMA 4TRDA 4PNYA 1ZYRC 3QB3A 4L5RC 1JWUD 3K5NA 1WVLA 3MXPA 4BY1H 5IGFA 1D8LA 3RLFA 1VS0A 3T4AC 1J6QA 1DCZA 1TVXA 4KHZA 2NTTA 1HHVA 1SFOB 1JR0D 1P16A 1JOKA 2VQEQ 2WFWA 1VQ6A 1S5CD 3R2IA 2NVTH 2O2LD 4A3KH 1BVSA 4OONA 1HRJA 1K8MA 5HURA 4ABNA 2XNAC 2G9HD 2ZJRA 1VQ7A 1S4ZA 2EYOA 2I5HA 2R6GA 4UY8C 4UDUC 5EPKA 4X66L 2V1CC 2OWOA 4LF7Q 2ZTCA 1Q46A 3PUWA 3VR5A 5C0XG 4DUZL 4GOPA 4HJAA 3HGBA 4A93H 1WCMH 4HCEA 1E1TA 1XTCD 1O7YA 1SBBB 2ZM6Q 1EIGA 2JA5B 3QO2A 2EQSA 2QF7A 1N8RC 1JMCA 2R92H 4A3IG 4LUVA 2JA6B 3U4ZA 1ILPA 2ICIA 3CU7A 4BBSG 1O80A 4ZLTF 3TP5A 1ICFB 1KNAA 1K83H 2QGQA 3LWUA 3QIAA 4QF4A 3CMAA 3I4NB 4B3SL 4BXXG 2ZXRA 5IGBA 4XT1B 1OTCA 1CTMA 4KKTA 1EY6A 4A3FG 2JYOA 1TS4A 4IUNA 1ZXTA 1Y8OB 5M3MG 3WOFA 2MJ8A 4NXMQ 2F0EA 2JA9A 1E2VA 1E0BA 1RF2D 4A3MB 3CP0A 3GP7A 3S2HH 3BYTB 1XPUA 2L1BA 4DV5L 2R93G 3H91A 4JC0A 1ONLA 4NPSA 5IT9E 2GN5A 4DV7Q 1Z7TA 2VB3X 2NZ1D 4A3JH 1E24A 3OHXC 4YIJA 4GZYC 1OXTA 4WRDA 2PI2E 3BZCA 2VUMB 1V8QA 1WD1A 2JEBI 2JA8G 2P5ZX 1ZKOA 4RHSA 1STGA 3OMCA 4A4IA 1CKOA 1IBLL 2HIVA 2UXBQ 1EQVA 4L8JA 4FF1A 3MXNB 1BCPD 2F0KA 4UPAA 5ELCA 1C0AA 3H15A 1GUTA 2L0CA 1L1OC 2H4OA 5G3LF 3PIOA 3MZ5A 3KBGA 3U9SA 1PZKD 2F0GA 1I6HH 3TQYA 4RGTA 3K0YA 2Y0SB 3HOXG 3SXHA 1D6EC 1D1KA 2IY5B 5KNBA 4WORA 3HOZH 1SYGA 1S5BD 2R7ZB 5EBDA 3CC7A 3FPUB 1O7IA 1GD7A 3FRPB 1IBKL 5BR8L 1MJEA 1KIXA 4POGA 3S1RH 2EYFA 5T1GA 1WFQA 1DZ1A 2ICEC 5IOCA 5DLQE 4OIKA 4C2MH 4CDFC 2EJMA 1HPCA 2Z0SA 5IGCA 1ENFA 3OW7A 1VQ8A 2D0PA 4MIUA 3NE5B 1WCMG 1WD0A 5D3IB 2MHVA 3RUZA 2PW5A 5KIXA 4BY7B 3ULPA 3RZDH 1QZGA 3TP7A 1D7QA 2B8GA 2ZJPA 1K0RA 4KMUC 5EGTA 3CHBD 2QEXA 4IUVA 1BCPC 4KD3A 5C4HA 1YHQA 4KKUA 2WB1E 4A3FH 4NB3A 4LJZC 5IGGA 2XWBB 1F2YA 2K5NA 3R2TA 2J0TD 1QB5D 3VDYA 4TKOB 4FNFA 1XX8A 4IUPA 1M8AA 4RKLA 3IRBA 3M9BA 2K52A 1GUSA 2F0JA 2E2JB 2K7VA 4OEMB 1NR2A 4GLXA 2AHOB 1BO0A 2ZTEA 5JEAG 4HIKA 5EPJA 2F4VQ 2AMCB 3D8GA 1HUNA 4DFAA 4B3TL 1VQNA 1WJJA 5DM73 1K3BC 4H13C 4A3JB 2UUCL 4OWTB 3I4NG 2UUBL 2RDGA 2EJFC 4ALPA 4G7ZC 2NVYB 3A5ZB 1R4QB 1I94L 1KHIA 4IUTA 3S15B 2Z6KA 1RTNA 4OHJA 2NN6H 4OXPA 1R9TB 2F0WA 4K8IA 4DV4L 1FVIA 2J4XA 4C3IG 3DEPA 4IOAA 4CDEC 4X3KA 4QUCA 2B63B 2E2HB 3U4VA 3SK8A 3NEMA 3QJYA 2Z6BA 2K04A 1B8AA 4DR3L 2VQFQ 1EOVA 1BBUA 3UDXA 1PRTF 2BDOA 3DXJC 1VQGA 4EVOA 2HCCA 4OX9Q 4ZAIA 3C46A 2HQEA 2PO4A 2F0QA 1XNQL 5FLXc 4L63B 1SN8A 4IZ8A 1A62A 2Q2HA 4EQPA 2NVYH 3NXWA 1PZJD 1TWAH 5M5WH 3BYYB 1M4VA 1TWCB 2EYJA 4N8FA 4NDXA 4GNXA 3T53B 4UP9A 1V9PA 3PO2B 1IL2A 1SDFA 3HOXB 1STBA 4R1JA 3SEBA 1A2TA 5ISRA 3PF5A 1U4LA 2F03A 2CKZB 4L5SA 3VYRA 1EY8A 3E0JA 2DUDA 3GTGH 5HGQA 4ME3A 3HG9A 5C44G 2MO1A 1B50A 1CUKA 2EYHA 4C2MB 4OL7A 2MQHA 3GTMB 3H0GH 4DR5Q 3ND8A 1D1IA 1JE5A 1SYCA 4IJLA 1JQYD 2OT2A 2ZT9C 1PXUA 2CHBD 1L1OA 2AWOA 1IBML 2NUCA 4A3KG 2ALYB 4H0LC 1LT6D 3J81L 4DR2Q 4ODGA 1IHZA 2RVLA 1C8CA 1ENCA 4OWXB 3U9OA 2RDFA 1E1OA 1ILQA 2X69A 1M90C 2MPMA 2E2IB 3SHLA 1PH3A 4NP5A 1N34Q 3NQTA 3L2PA 1QUQA 4J1MA 3T56B 1B4OA 2WB1G 4XDXA 3HOUH 4CJ0B 3MEHA 1HZCA 3HOZB 1V43A 2WV6D 3OOCA 5AJ3L 1PRTB 1SNQA 1E3PA 1OXUA 3D0FA 2E74C 1KTKA 3CCQA 3KBXA 5BN4A 2SNSA 4BXXH 1DOLA 2DN8A 4A3GH 1N36Q 5CGKA 4QIWE 5EAYA 2ID0A 3J7AF 2UU9Q 1EFWA 1GUGA 1E22A 4HN7A 3V05A 1PFMA 1Q1BA 4HJ7A 4A3IB 2R93H 3S1MB 4GLVB 5IIFA 3CF5A 2JA7H 2DJFC 4X3SA 3C2PA 4Q0FA 4DV6Q 4A3EH 1HFNA 4A93G 5I9OA 3KLSA 5JJZA 3S17B 1A3VA 1VQOA 2R3ZA 1RD9D 2B2VA 5C4JB 2K75A 4ME5A 4JI1L 4BBSH 3F2BA 1SEBD 5M3MB 2LY7A 4FXKC 3L3OC 5CC4A 4PZ7A 3ZYYX 4IPGA 1X3GA 1NCVA 3O13A 2EPBA 1II3A 1IW7D 2JK8A 4NXNL 2NVQB 2HDLA 4DR7L 1SE8A 3RN2A 5FK9C 4YHHQ 3RZOB 4MN3A 4RA8A 3PUXA 5M5WB 4DR2L 2N78A 3R8BA 2JA8B 3EQLC 4IUQA 1R9TH 5JOBA 4LF7L 2NBFA 4YCVA 5KYLA 4PZ6A 1KAAA 3KLSX 1Y8PB 2R92B 1Z9FA 1CM9A 1DJRD 1AEXA 1JOQA 2QDBA 1T5XD 3OPOA 1IBKQ 1DONA 4LFBL 1LACA 1U0LA 3CCJA 3EJIA 3F8TA 1YNJD 4RCOA 1LTBD 1W6KA 1Y14B 5FJ8H 3K58A 2CQAA 2JN4A 1ESFA 2Q2UA 4LFAQ 3TN2A 4ZCKA 1SYBA 3HOWG 1EZ8A 4O42A 5M5XB 5E3FA 4PV1C 4P71A 3QOJA 4BA2I 3I70A 4GOPB 4DV6L 1BQQT 4G57A 1QZHA 5JJKA 4L5QA 1OXVA 5K36G 3GDEA 5J39A 5A2QL 4HJ5A 1XMOL 1X3EA 4I7ZC 1SAPA 5GAEC 1W6JA 4LWCA 1SE4A 2EDGA 4LAAA 3BJUA 1N36L 1A8VA 1CKNB 4LF4L 1KRTA 4BY7G 1AZQA 3T1YL 1KDBA 2L5TA 1GXDC 1TKWB 4X66Q 3H3VI 3SK5A 4JK1C 1YJWA 2WINB 3TP6A 4HMIA 4FXDA 2I07B 1LT4D 2ENBA 4RHRA 4NXML 1WTOA 4GOPC 3N6RA 4X62Q 2PMZB 1VQFA 3NWSA 2KQ3A 3HOZG 2KEDA 1CKNA 1KNEA 2UXBL 1TR5A 2HHHQ 2JE6I 2IX3A 2F0FA 3M4YA 3EA6A 5C3EH 1TQOA 2HT1A 1JICA 2K03A 3NPPA 1Z47A 4F8MA 1PV4A 3DWQA 3AEVA 1KD1C 4MTNA 4O2DA 1NMFA 1L0WA 3KF6A 1DM0B 4OO1G 2A6EC 3E6ZX 2HUGA 2OEOA 1QG7A 4BWGB 2A69D 1LYLA 3K6OA 1TWHH 3QOLA 5BN5A 3HOVG 1PYBA 1LTSD 3I8ZA 5JAVA 4A3DG 4B3ML 4JYAL 2F0NA 2N88A 3Q24A 3HP3A 5IYCG 4JI0Q 4ZRZA 2Q8TA 1TT2A 1SR3A 1RTOA 2VL6A 1LUZA 4BA1I 4I7AA 2L9HA 1IYVA 3J81c 1EY5A 1HNWQ 2KOLA 1I4RA 3S1RB 1N33L 5LL6S 4Y52H 4KN4C 4JBJA 5M9OA 3PUYA 2QKIC 2F0VA 5FO9B 3HZXA 1MKHA 2VS1A 4A3BH 1G2TA 1J9OA 1S5ED 5FLXL 1N34L 3AQQA 5IE8A 2NVXB 3SK6A 3I3CA 3HEJA 1ZEQX 3G4SA 1I94Q 3I72A 3J7YW 1GHJA 2F3IA 3OWFA 4JI3L 4FF4A 4DNTB 2CVRA 2FMMA 3NSWA 2KCNA 5C0XJ 4A3MG 3FMCA 1CFMA 2LMCB 4A3LH 1TY0A 1F9QA 3J80E 1K8OA 1EWIA 1G2SA 4JG2A 1XPOA 1SNPA 1HNXQ 4NKLA 2UUCQ 2RSNA 2QA4A 4B9XA 2VUMG 1FYCA 1EYGA 3S16H 3I4NH 2MGSA 2B63H 4QCLA 5IY0A 5LMNL 1BBWA 1STYA 4KN7C 3PO2G 2CWPA 3CD6A 4JYAQ 3NTKA 4IN3A 5FOBB 4FF2A 1AH9A 3T13A 2IX0A 1YJ9A 4N9PA 2JA5H 1KXLA 1RL2A 1KAWA 2VB2X 4Y7NB 2VW9A 1MJCA 2YU9B 3SVMA 2O4XA 4LF5Q 2UXCQ 3W1GA 1MSHA 2VQEL 2XRSD 1EZ6A 5IYDH 4HEDA 1QILA 4QB4A 1F9SA 3T51B 1UNSA 2F0IA 2JQOA 3TRZA 2F0MA 4LFBQ 2JA7B 1HFGA 5C44B 4P75A 4DKAC 4GN4B 5JJLA 1AP0A 5AFWA 1N33Q 1TWGB 1EWHA 3HOYG 1EWCA 1Q90A 3UE1A 2RHQB 1UUPA 3FDTA 4DA2A 5M3MH 2EYMA 3CAMA 2UUBQ 1EFID 3DMUA 1SFOH 3KJOA 1WCMB 1JWMD 1KQSA 1YZ6A 4B3TQ 2HQLA 2IW3A 4DK3C 1WOCA 2JP1A 2GVBA 1V1PA 4C56C 3T1HQ 2HDMA 5LL6X 1O78A 2L11A 3L7ZC 3PO3G 2K32A 1LM0A 1EIYB 3FKIB 4DV5Q 2YYZA 4C1NI 2RBMA 3L9AX 1UWVA 3H3VH 3EN2A 4A3CH 5IWAQ 4LFCQ 4A3EG 2I5MX 3I4LA 5M3FH 2HIXA 3GD7A 1H9RA 1SNMA 3K8AA 1CT1D 1YVCA 1PH6A 1C7YA 5JEAH 3NUCA 1V1PB 3PGZA 4K2LA 4RGNA 4X65L 2D5DA 1HQRD 2ZTDA 2VNUD 1L2FA 3IFDA 3TDQA 1QVGA 2NWGA 1LTAD 5M5YH 2EOTA 3CCSA 4ILWA 5IYBG 1CHPD 3DHQA 2B2TC 2XSCA 2BCOA 1H9MA 4LF8L 1UE1A 1X3QA 3MXNA 2PCFB 3Q22A 3K7AH 4B08A 3S1QH 4P73A 5GROA 1TS3A 3G48A 3S2DB 4QGUA 1EQTA 1F2MA 3UDIA 4JI6Q 1DYQA 5JVH3 1HH2P 2F0TA 4MTKA 1OXSC 2CCZA 1A3UA 1UE5A 1QWYA 2DGYA 4X3TA 3FHWA 3ULJA 3TS0A 3F2UA 5EPLA 1HZAA 3GTGB 1H9JA 1SMXA 3BVMA 1DOKA 2BA0A 1N32Q 1PMRA 2RQXA 1LT3D 2NZHA 5CV6A 4DN4M 4GNXB 5ELNA 2E2DC 5C3WA 1HR0W 2ZJQA 4JBKA 4V190 3WOEA 1EU3A 5ELDA 4DV7L 3D3RA 2OQKA 1K73C 1E7ZA 2A6HD 2EIFA 2A1AA 3V2TA 3K5LA 3T1HL 2IX1A 1B9NA 2X6GA 2WAQG 2C5CA 2N3SA 1EYAA 3K0XA 3MC0B 5FKAC 5FO8B 2KA7A 1STAA 4U68A 2EJGC 3DUZA 1PH9A 3HOWB 2JA6H 1WYDA 1X55A 1X6OA 3VR2A 4A75A 1RODA 4YHHL 2IT1A 3PV0A 4OGQC 2LS01 1AN8A 2K14A 4IPCA 5C5LA 4BBRG 5D3DA 2B29A 2KJXA 1MIUA 3K80C 2R7ZG 4HSVA 2BDNA 4A3BB 4KV6A 2EVBA 2A68D 2EYPA 2CW0D 2QW7A 4IUUA 4MHEA 3VR6A 3JAME 4LF6L 2LXKA 3VA7A 4YY3L 4O0AA 1Y1WH 2A68C 4HTHA 3NBHA 2CW0C 4JPBW 4JI8L 4DAVA 4R4IA 1HNZQ 1X56A 3PIO3 4A3KB 2EZVA 3CXCA 2WKDA 1IXRA 2DY8A 5IP9G 2SOBA 1SLJA 5I9PA 1K3RA 3GTJH 1L0XB 1JWSD 3CQZB 4KY6A 5C3XA 3K59A 1ESRA 3OWEB 3Q23A 1CA5A 1XXGA 4A3EB 2WACA 1H9SA 1VQHA 1Q86C 4LUZA 1HA5A 3G6JB 2K5QA 5C3EB 2D9UA 5C4XH 4DV4Q 1AFPA 2F0DA 4JI4L 3D4RA 2PNRC 2LXJA 3I7FA 5LMNW 4XT3B 3DWPA 4DXGA 1BUVT 5J1ZA 2K33A 2OQ0A 3A8IE 4UHVA 5IP7G 1NE3A 2RHSB 3HKZE 4X65Q 4H7BA 2RSOA 2PYKA 2D62A 2PW7A 1K8AC 3G6EA 1TWHB 1KDCA 5CYUA 4C3HB 2OCEA 3P75A 4KHVA 2Z6KC 2F3VA 3RD4A 4DR6Q 4LUOA 5JVG3 4A3DB 4X62L 3RR5A 1VF5C 3W2DA 5D65A 4J8QA 3D4WA 3CC2A 5EKKA 1VQPA 3TP8A 4A3LG 1IKMA 4A3JG 4FP5D 3KDFA 3J80i 3I55A 4R4CA 4NW2A 4C3HH 1AZPA 1SXTA 4EGVA 5IP9H 5I2YA 3IKJA 2NN6G 1G91A 1JJ2A 1YNXA 2CWAA 5C4ZA 4XIGS 4UP7A 2B3GA 4DPGA 3KOJA 2L4NA 2YTYA 3I2ZA 5I2XA 4TSSA 5KNDA 4QQBX 4K6DA 4GKKL 5C4XB 1S40A 1SROA 4YY3Q 3GTQH 1Q1EA 2B2VC 5J3BA 2K05A 3E9HA 4POFA 2C9OA 4GNXC 2R7ZH 1M1KC 1SSOA 4XQJA 5HY6A 3VR3A 5FLMG 4IJHA 1E2ZA 3A56A 4DXFA 3M4OB 1KDAA 4RMFA 1SJHD 1PZID 4X64L 2ATWA 4OO1H 3HOUG 1CHQD 2E76C 2UXDQ 3KJPA 3I56A 4LF5L 2B2UC 1BR9A 1A63A 4EQNA 1HUMA 3T1YQ 1LV9A 1F77A 2ZM6L 2CQOA 4P72A 2JJQA 3EIVA 3ICEA 1K0SA 3HKZG 2WAQB 1NSNS 1MHWC 3A8JE 1I50H 4DUZQ 2DJGC 3CW2C 4QUFA 2F3WA 4DNRB 1VQAA 4R4QA 3D6WA 1XNQQ 1B3AA 5KYIA 1JORA 1TWAB 1UAPA 1BBXC 1NMGA 4PMWA 3MWYW 2YU9H 2K28A 1G51A 1BNZA 1WTVA 2WIIB 3ERSX 3NBHB 1V1OA 1H9KA 4DR3Q 3M3YB 3J7ZC 3NTHA 1HA6A 4CDDC 3BU2A 2IHFA 2LSSA 3I4MH 1ET6A 1S3OA 4R8NA 4DR7Q 1SNDA 4A3MH 1HTPA 1F2ZA 3NHHA 1I4PA 4KJNA 1YNJC 3MA2B 1YHAA 2KBNA 1GO3E 2PQEA 3OSOA 3S16B 3A74A 2E2HH 4EX5A 3J81i 1CA6A 2OTLA 2WAQE 2O5JC 3A5UA 2RCFA 3CRKC 1OXXK 1PVOA 4EQ5A 1K8GA 3GQBA 2UXCL 4HAEA 3B6YA 3S14B 4KD4A 1MSGA 3GV6A 5C5MA 5J22A 3E3XA 1EUJA 1FR3A 4FXGC 3AMUA 2A5HA 1F9RA 3NQIA 3BVGA 4C3JG 2Z4IA 1NAPA 3TSSA 3K81C 1ENAA 3J81j 3S24A 2A69C 5C3EG 2D0OA 4DV1Q 2F0SA 1HR0L 2NN6I 4DAYB 1IYUA 1CK1A 2N8NA 2OF1A 2IWHA 3D31A 4XTCS 5IYDG 2FHTA 1CQFA 2M00A 5KEEA 1R4PB 4IO9A 1CSQA 1EU4A 4U673 1PYSB 1NJIC 1PYWD 2HCIA 3NBIA 3GO5A 2MFIA 5CV5A 1KC8C 1AW7A 4IPHA 1Q3LA 1J5EQ 3EVQA 2XVSA 3I4MG 1PRTC 3CCUA 5GQOA 2EE1A 2Q2TA 2K1BA 2E5LQ 4JI3Q 1I4XA 1QJOA 1MBYA 3BZDB 2Q2IA 3A0JA 5KGUA 2UUAL 3NENA 3CC4A 2BA1A 4R4TA 3TEHB 4K2KA 5K36H 1H95A 4BY1B 1G8ZD 5COYA 3DLLA
chains in the Genus database with same CATH topology
3PO3H 1XPOA 4JI7Q 1O7IA 1GD7A 2WP8J 2YTVA 1IBKL 1HNXQ 2UUCQ 5BR8L 1MJEA 1KIXA 2QA4A 4POGA 5LMUQ 3S1RH 2VUMG 1EYGA 3WWVA 1PHJA 3S16H 1HNWL 4DR5L 1WFQA 3KF8B 3I4NH 2B63H 5IY0A 5DLQE 4C2MH 2E2IH 5LMNL 1BBWA 2Z0SA 2NVQH 1U5KA 4BY7H 4JOIC 1NY4A 1VQ8A 3PO2G 2CWPA 3CD6A 4JYAQ 2D0PA 4DV0L 1WCMG 1AH9A 4P74A 2IX0A 1YJ9A 3M3YH 2PQAB 1XPRA 3PIPA 2JA5H 1YI2A 1KXLA 1RL2A 3FP9A 1KAWA 3ULPA 5FJ8G 2NZOA 2VW9A 3RZDH 1QZGA 3M4QA 1MJCA 2JA8H 4LF5Q 1D7QA 4JI2Q 2UXCQ 3W1GA 2ZJPA 2VQEL 3S17H 5IYDH 2YTXA 1K0RA 5IYBH 2QEXA 4HJ9A 4JI2L 3TS2A 2YV5A 2JQOA 1X9NA 4DAMA 3TRZA 1HZBA 4DV3Q 4DUYL 4LFBQ 1IYJB 1BKBA 3UDFA 1YHQA 3W5OA 4P75A 4B3RL 1JJGA 4DKAC 2WB1E 4A3FH 4GN4B 2JA6G 4X6AH 5JJLA 4AQYL 4NB3A 3AFPA 1N33Q 4LW1A 4R4OA 3EBEA 3HOYG 4A76A 2K5NA 2KCMA 3UE1A 1EQQA 3VDYA 2RHQB 1G291 3ER0A 2I5LX 5M3MH 3IRBA 3M9BA 3JC66 2K52A 3CAMA 5LMNQ 4DV1L 2UUBQ 1VQKA 1UEBA 1RIPA 3F1ZA 3H0GG 1SFOH 3ZJYC 1CSPA 3F2DA 3CCVA 3KJOA 2R7FA 4GLXA 1KQSA 1YZ6A 2AHOB 2HQLA 4DK3C 2N49A 1WOCA 4B3TQ 1VQCA 4DV2Q 4GKJL 3PF4A 2GVBA 2ZTEA 3CCLA 3T1HQ 3KFUA 2C35B 2R7DA 5JEAG 4HIKA 1XNRL 2F4VQ 2AMCB 4KHPL 3PO3G 3L7ZC 4K0KL 4OX9L 4B3TL 1LM0A 1VQNA 4A3IH 1WJJA 1EQRA 1EIYB 3I4OA 4DV5Q 4LF9L 1FGUA 2ES2A 2K5HA 2YYZA 1VQLA 2UUCL 2E5LL 4OWTB 3I4NG 2UUBL 4JI7L 1UWVA 1W3SA 2JA7G 3H3VH 3EN2A 4ALPA 4A3CH 1XMQQ 5IWAQ 4A3BG 4LFCQ 4A3EG 2I5MX 5M3FH 3A5ZB 2HIXA 3GD7A 5AJ3Q 4GN5A 3K8AA 1I94L 2UUAQ 5JJIA 1YVCA 1PH6A 2XGTA 1KHIA 1C7YA 3M4OH 1Q8KA 1TXYA 2Z6KA 4J15A 4OXPA 5IWAL 3PGZA 4OWWB 3OYYA 4DUYQ 1UE6A 4DV4L 1FVIA 3GTLH 5H1SE 4X65L 4IOAA 2ZTDA 4LF9Q 1DGSA 3W1BA 2VNUD 4HIMA 1L2FA 1QVGA 3U4VA 3UE0A 1YBYA 5IYCH 3NEMA 2L15A 1PFSA 4LFCL 5IP7H 5M5YH 3CCSA 4YWLA 2K5VA 5IYBG 3CPWA 1B8AA 2PI2A 4DR3L 2VQFQ 4LF8L 1EOVA 1UE1A 1BBUA 5JEAJ 4LF4Q 3UDXA 1C9OA 2Y0SE 3PUVA 2PNHA 1KRSA 1VQGA 2AKWB 4OX9Q 3K7AH 3S1QH 4JBMA 4P73A 5FLMH 3JAMi 4KI0A 5GROA 3J7A5 4IFDI 1HR0Q 2E2JH 2AWNA 2IHEA 1XNQL 5FLXc 1SN8A 3G48A 1X65A 4QGUA 4GS3A 4JV5L 1A62A 2Q2HA 2NVYH 4DR6L 4WJ3M 3UDIA 4JI6Q 1WI5A 1TWAH 3TREA 3K7UC 5M5WH 1I5FA 1TWFH 5LMUL 3GTOH 1IZ6A 4LF8Q 3FKIH 4GNXA 2VY3A 1HH2P 2BH8A 3STBD 4UP9A 1OXSC 3HOXH 1JB7A 1V9PA 4DR1Q 2CCZA 2KENA 1IL2A 4JI8Q 1UE5A 1J5EL 4R1JA 1VCIA 4QJFA 1X54A 1PH8A 4L5TA 1PH5A 3PF5A 4DR4Q 1N32L 2DGYA 3FHWA 3ULJA 3KDFB 3TS0A 1Y1VH 1XJVA 2CKZB 3PSIA 1HZAA 4DV3L 4L5SA 3S2DH 1SMXA 4A3CG 2CFMA 2BA0A 1VQ4A 2DUDA 1N32Q 3GTGH 1JT8A 4LNQA 3Q8DA 2NZHA 5HGQA 3OW2A 4DV0Q 4ME3A 2KHIA 5ELNA 4QY7A 4GNXB 1VQMA 1XMQL 1HR0W 2ZJQA 4JBKA 3U58A 5C44G 3RNUA 2MO1A 4TVAB 1CUKA 4DV7L 4B3MQ 3PCOB 1X3FA 2MQHA 2OQKA 1K73C 3H0GH 3SGIA 1GKHA 4DR5Q 1E7ZA 4IJLA 1JE5A 3MEFA 4JI6L 3GTKH 3PO2H 4HIOA 2EIFA 3JAMc 2A1AA 1LTLA 1L1OA 4YWKA 2AWOA 4APVA 1IBML 3T1HL 1QUQB 2GVAA 4A3KG 1ASYA 3OTOL 2IX1A 5C4XG 2ALYB 2UXDL 1YJNA 1W2BA 1KL9A 2WAQG 4Y7NH 1YEZA 2N3SA 4DR2Q 3K0XA 2EXDA 2VQFL 4GN3B 1PH9A 2HHHL 2JA6H 1WYDA 1X55A 1X6OA 4B3SQ 4A75A 1HNZL 3HOVH 4OWXB 4YHHL 2IT1A 1E1OA 4JBWA 3DM3A 3PV0A 4JOIA 2XTIA 1FJGL 3KYHC 4IPCA 2K14A 1M90C 4BBRG 1PH3A 2B29A 4AQYQ 1YIJA 4A3GG 2NVXH 1L1OB 1N34Q 1MIUA 3K80C 4BY1G 2R7ZG 1YHBA 1B7YB 3PUZA 3L2PA 1QUQA 1Q12A 3AYHB 4HJ8A 2I0QA 2A8VA 1AE3A 2WB1G 4QL5A 3S1NH 4AIMA 3HOUH 3G71A 4TQUS 2LXKA 4LF6L 1Y1VG 1HZCA 1VQBA 4YCWA 4YY3L 1V43A 5AJ3L 4O0AA 4AYBE 1VQJA 1Y1WH 1E3PA 1OXUA 3D0FA 3CCQA 4JI8L 1VQ5A 1XTDA 4KHPQ 3RN5A 4R4IA 1HNZQ 1X56A 1IBLQ 2JEAI 1PH4A 4BXXH 5IT9c 3HFZB 1FL0A 2UU9L 1K9MC 1I3QH 4DV2L 4GKJQ 3CXCA 4A3GH 1N36Q 4H02A 4QIWE 5EAYA 1IXRA 5IP9G 1PH7A 2ID0A 4IOCA 3GTPH 1SLJA 1K3RA 3GTJH 1EFWA 2UU9Q 3RLOA 1VQDA 3CPFA 1GM5A 3L0OA 2ASBA 1E22A 1Q1BA 4HJ7A 2R93H 3KLWA 4OO1I 5M5XH 5C44H 4GLVB 1VQHA 1Q86C 3CF5A 2JA7H 4LUZA 4DV6Q 3E0EA 4A3EH 3S1MH 4A93G 1N9WA 5C4XH 4DV4Q 2RCNA 1HNXL 1VQOA 4JI4L 2VUMH 1PA6A 3KF6B 2LXJA 3I7FA 5LMNW 1UE7A 2K75A 2R92G 3UDGA 1Q7YC 3HKSA 4DR4L 1V1QA 4JI1L 2OQ0A 4LF6Q 4BBSH 4UP8A 1CKMA 4C3IH 5IP7G 3F2BA 1NE3A 4NXNQ 1B70B 2RHSB 3HKZE 1HZ9A 2E8GA 4X65Q 1FJGQ 3CMEA 2D62A 1K8AC 4PZ7A 1A0IA 4IPGA 3G6EA 1X3GA 3M7NA 1ASZA 4PZ8A 1TWGH 3NELA 2OCEA 1VQ9A 2JK8A 4MZ9A 1JJCB 4NXNL 4JI1Q 5GAGC 1XNRQ 4DR7L 1SE8A 2Z6KC 3RN2A 3S14H 4DR6Q 4LUOA 2KCTA 4X62L 3OTOQ 1G6PA 4KLKA 3RR5A 4YHHQ 4RG1A 1T9HA 3RLNA 4WJ4A 1VQEA 2MNAA 3RZOH 3PUXA 5ELOA 3CC2A 2A19A 5C0XI 4DR2L 3ULLA 2KHJA 2N78A 1VQPA 1S72A 4A3DH 4A3LG 2MO0A 3J80c 3FKIG 1R9TH 1VQIA 2OTJA 5BR8Q 4A3JG 4JV5Q 2BH2A 3J80i 3KDFA 2F4VL 1PH2A 3I55A 4LF7L 4R4CA 4YCVA 4C3HH 3S15H 2F52A 3HOYH 4PZ6A 5IP9H 2NN6G 2VZAA 1Z9FA 4JI5L 1YNXA 2CWAA 1JJ2A 4XIGS 3STBC 3AFQA 4UP7A 2B3GA 4DPGA 3KOJA 1IBKQ 1QVFA 2H5XA 2YTYA 5C4JH 3I2ZA 1NBWA 4LFBL 1U0LA 5GADC 3CCJA 4QQBX 3F8TA 1PH1A 3CCRA 3CCMA 4LFAL 1S40A 4GKKL 1SROA 4YY3Q 3GTQH 1Q1EA 1Y14B 5J3BA 2FXQA 5FJ8H 4X64Q 4GLAC 3E9HA 4POFA 4L5RC 4GNXC 4BY1H 2Q2UA 4LFAQ 1D8LA 3RLFA 4BBRH 2R7ZH 4GKKQ 4MNOA 1VS0A 5GAHC 1M1KC 2JA5G 3HOWG 5HY6A 5FLMG 4IJHA 1J6QA 4P71A 4KHZA 4C3JH 4BA2I 4RMFA 4GOPB 4DV6L 1QZHA 1P16A 1AE2A 4X64L 4L5QA 2ATWA 1OXVA 5K36G 3HOUG 5JJKA 2VQEQ 2WFWA 3GDEA 2UXDQ 1VQ6A 3KJPA 1SRUA 4HJ5A 4FDBA 3I56A 1XMOL 4LF5L 2NVTH 1X3EA 1A63A 5GAEC 1BVSA 3M85A 4OONA 3T1YQ 4A3KH 4LWCA 2ZM6L 1HJPA 2CQOA 4P72A 2JJQA 3EIVA 1VQ7A 2ZJRA 3ICEA 3HKZG 2B63G 2I5HA 4K0KQ 3BJUA 1N36L 1A8VA 1I50H 2R6GA 4DUZQ 1CKNB 4JI5Q 4UY8C 4X66L 4LF4L 2V1CC 1KRTA 3CW2C 4BY7G 1IBMQ 2OWOA 3T1YL 1VQAA 4JI0L 4R4QA 4IFDJ 1QVCA 4LF7Q 2ZTCA 1XNQQ 1Q46A 4X66Q 3PUWA 3H3VI 5C0XG 4DUZL 1NMGA 5E7NA 4GOPA 4HJAA 4PMWA 1YJWA 4A93H 2YU9H 2PMZE 1G51A 1WCMH 1E1TA 3ERSX 3NBHB 2ZM6Q 1NTGA 4DR3Q 3U50C 3E9IA 2EQSA 3J7ZC 1N8RC 1JMCA 4NXML 2R92H 1P8LA 4A3IG 4LUVA 1Q82C 3U4ZA 4GOPC 3BU2A 2IHFA 4X62Q 2LSSA 3I4MH 1S3OA 4BBSG 1VQFA 4DR7Q 4A3MH 3HOZG 1CKNA 1K83H 1YHAA 2QGQA 3CMAA 2UXBL 4DR1L 4YWMA 2KBNA 1GO3E 4B3SL 4BXXG 2HHHQ 2JE6I 1OTCA 4AH6A 3A74A 2E2HH 4EX5A 5C3EH 3J81i 4HIDA 2OTLA 2WAQE 3CCEA 4A3FG 2HT1A 5M3FG 3A5UA 3BZKA 4AYBG 1OXXK 1Z47A 1PV4A 1PVOA 4EQ5A 5M3MG 1K8GA 2UXCL 3AEVA 3B6YA 1KD1C 3GTMH 4IFDG 4MTNA 1NMFA 4O2DA 1YITA 2K50A 2JA9A 4NXMQ 1L0WA 3KF6A 4JCVE 1EUJA 3CP0A 4OO1G 4IPDA 2Y0SG 3CQZH 3S2HH 1XPUA 3F2CA 4DV5L 1LYLA 1TWHH 3HOVG 2R93G 1PYBA 1GVPA 3K81C 4JC0A 4NPSA 4A3DG 3J81j 2GN5A 3S24A 4DV7Q 4B3ML 5C3EG 4JYAL 5IYCG 4JI0Q 2D0OA 4DV1Q 4A3JH 1SR3A 2VL6A 1E24A 2K4KA 1LUZA 2NN6I 4BA1I 4DAYB 1OXTA 1XMOQ 1HR0L 5IYDG 2N8NA 3J81c 2PI2E 3BZCA 3D31A 4XTCS 1HNWQ 2JEBI 2JA8G 1N33L 4YCUA 4Y52H 4IO9A 1CSQA 4JBJA 3LGJA 3PUYA 1PYSB 1NJIC 4A4IA 1MKHA 2VS1A 4A3BH 1CKOA 3GO5A 1IBLL 2HIVA 1Y1WG 1N34L 2UXBQ 1EIFA 2MFIA 3AQQA 5IE8A 1Q81C 1TWCH 3MXNB 1KC8C 3G4SA 4IPHA 4UPAA 1I94Q 1C0AA 3H15A 1J5EQ 4PG3A 2F3IA 4JI3L 1L1OC 3PIOA 3I4MG 4B3RQ 3CCUA 5GQOA 1I6HH 3TQYA 4DNIA 2Q2TA 4A3MG 2E5LQ 5C0XJ 3HOWH 4DK6C 4JI3Q 3HOXG 4A3LH 3M4PA 2RF4A 2IY5B 2Q2IA 3A0JA 2UUAL 3NENA 2PQAA 3CC4A 2BA1A 1EWIA 4R4TA 3TEHB 3HOZH 4JG2A 1H95A 3CC7A 4JI4Q 3DLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 H;  1XPO A;  4JI7 Q;  1O7I A;  1GD7 A;  2WP8 J;  2YTV A;  1IBK L;  1HNX Q;  2UUC Q;  5BR8 L;  1MJE A;  1KIX A;  2QA4 A;  4POG A;  5LMU Q;  3S1R H;  2VUM G;  1EYG A;  3WWV A;  1PHJ A;  3S16 H;  1HNW L;  4DR5 L;  1WFQ A;  3KF8 B;  3I4N H;  2B63 H;  5IY0 A;  5DLQ E;  4C2M H;  2E2I H;  5LMN L;  1BBW A;  2Z0S A;  2NVQ H;  1U5K A;  4BY7 H;  4JOI C;  1NY4 A;  1VQ8 A;  3PO2 G;  2CWP A;  3CD6 A;  4JYA Q;  2D0P A;  4DV0 L;  1WCM G;  1AH9 A;  4P74 A;  2IX0 A;  1YJ9 A;  3M3Y H;  2PQA B;  1XPR A;  3PIP A;  2JA5 H;  1YI2 A;  1KXL A;  1RL2 A;  3FP9 A;  1KAW A;  3ULP A;  5FJ8 G;  2NZO A;  2VW9 A;  3RZD H;  1QZG A;  3M4Q A;  1MJC A;  2JA8 H;  4LF5 Q;  1D7Q A;  4JI2 Q;  2UXC Q;  3W1G A;  2ZJP A;  2VQE L;  3S17 H;  5IYD H;  2YTX A;  1K0R A;  5IYB H;  2QEX A;  4HJ9 A;  4JI2 L;  3TS2 A;  2YV5 A;  2JQO A;  1X9N A;  4DAM A;  3TRZ A;  1HZB A;  4DV3 Q;  4DUY L;  4LFB Q;  1IYJ B;  1BKB A;  3UDF A;  1YHQ A;  3W5O A;  4P75 A;  4B3R L;  1JJG A;  4DKA C;  2WB1 E;  4A3F H;  4GN4 B;  2JA6 G;  4X6A H;  5JJL A;  4AQY L;  4NB3 A;  3AFP A;  1N33 Q;  4LW1 A;  4R4O A;  3EBE A;  3HOY G;  4A76 A;  2K5N A;  2KCM A;  3UE1 A;  1EQQ A;  3VDY A;  2RHQ B;  1G29 1;  3ER0 A;  2I5L X;  5M3M H;  3IRB A;  3M9B A;  3JC6 6;  2K52 A;  3CAM A;  5LMN Q;  4DV1 L;  2UUB Q;  1VQK A;  1UEB A;  1RIP A;  3F1Z A;  3H0G G;  1SFO H;  3ZJY C;  1CSP A;  3F2D A;  3CCV A;  3KJO A;  2R7F A;  4GLX A;  1KQS A;  1YZ6 A;  2AHO B;  2HQL A;  4DK3 C;  2N49 A;  1WOC A;  4B3T Q;  1VQC A;  4DV2 Q;  4GKJ L;  3PF4 A;  2GVB A;  2ZTE A;  3CCL A;  3T1H Q;  3KFU A;  2C35 B;  2R7D A;  5JEA G;  4HIK A;  1XNR L;  2F4V Q;  2AMC B;  4KHP L;  3PO3 G;  3L7Z C;  4K0K L;  4OX9 L;  4B3T L;  1LM0 A;  1VQN A;  4A3I H;  1WJJ A;  1EQR A;  1EIY B;  3I4O A;  4DV5 Q;  4LF9 L;  1FGU A;  2ES2 A;  2K5H A;  2YYZ A;  1VQL A;  2UUC L;  2E5L L;  4OWT B;  3I4N G;  2UUB L;  4JI7 L;  1UWV A;  1W3S A;  2JA7 G;  3H3V H;  3EN2 A;  4ALP A;  4A3C H;  1XMQ Q;  5IWA Q;  4A3B G;  4LFC Q;  4A3E G;  2I5M X;  5M3F H;  3A5Z B;  2HIX A;  3GD7 A;  5AJ3 Q;  4GN5 A;  3K8A A;  1I94 L;  2UUA Q;  5JJI A;  1YVC A;  1PH6 A;  2XGT A;  1KHI A;  1C7Y A;  3M4O H;  1Q8K A;  1TXY A;  2Z6K A;  4J15 A;  4OXP A;  5IWA L;  3PGZ A;  4OWW B;  3OYY A;  4DUY Q;  1UE6 A;  4DV4 L;  1FVI A;  3GTL H;  5H1S E;  4X65 L;  4IOA A;  2ZTD A;  4LF9 Q;  1DGS A;  3W1B A;  2VNU D;  4HIM A;  1L2F A;  1QVG A;  3U4V A;  3UE0 A;  1YBY A;  5IYC H;  3NEM A;  2L15 A;  1PFS A;  4LFC L;  5IP7 H;  5M5Y H;  3CCS A;  4YWL A;  2K5V A;  5IYB G;  3CPW A;  1B8A A;  2PI2 A;  4DR3 L;  2VQF Q;  4LF8 L;  1EOV A;  1UE1 A;  1BBU A;  5JEA J;  4LF4 Q;  3UDX A;  1C9O A;  2Y0S E;  3PUV A;  2PNH A;  1KRS A;  1VQG A;  2AKW B;  4OX9 Q;  3K7A H;  3S1Q H;  4JBM A;  4P73 A;  5FLM H;  3JAM i;  4KI0 A;  5GRO A;  3J7A 5;  4IFD I;  1HR0 Q;  2E2J H;  2AWN A;  2IHE A;  1XNQ L;  5FLX c;  1SN8 A;  3G48 A;  1X65 A;  4QGU A;  4GS3 A;  4JV5 L;  1A62 A;  2Q2H A;  2NVY H;  4DR6 L;  4WJ3 M;  3UDI A;  4JI6 Q;  1WI5 A;  1TWA H;  3TRE A;  3K7U C;  5M5W H;  1I5F A;  1TWF H;  5LMU L;  3GTO H;  1IZ6 A;  4LF8 Q;  3FKI H;  4GNX A;  2VY3 A;  1HH2 P;  2BH8 A;  3STB D;  4UP9 A;  1OXS C;  3HOX H;  1JB7 A;  1V9P A;  4DR1 Q;  2CCZ A;  2KEN A;  1IL2 A;  4JI8 Q;  1UE5 A;  1J5E L;  4R1J A;  1VCI A;  4QJF A;  1X54 A;  1PH8 A;  4L5T A;  1PH5 A;  3PF5 A;  4DR4 Q;  1N32 L;  2DGY A;  3FHW A;  3ULJ A;  3KDF B;  3TS0 A;  1Y1V H;  1XJV A;  2CKZ B;  3PSI A;  1HZA A;  4DV3 L;  4L5S A;  3S2D H;  1SMX A;  4A3C G;  2CFM A;  2BA0 A;  1VQ4 A;  2DUD A;  1N32 Q;  3GTG H;  1JT8 A;  4LNQ A;  3Q8D A;  2NZH A;  5HGQ A;  3OW2 A;  4DV0 Q;  4ME3 A;  2KHI A;  5ELN A;  4QY7 A;  4GNX B;  1VQM A;  1XMQ L;  1HR0 W;  2ZJQ A;  4JBK A;  3U58 A;  5C44 G;  3RNU A;  2MO1 A;  4TVA B;  1CUK A;  4DV7 L;  4B3M Q;  3PCO B;  1X3F A;  2MQH A;  2OQK A;  1K73 C;  3H0G H;  3SGI A;  1GKH A;  4DR5 Q;  1E7Z A;  4IJL A;  1JE5 A;  3MEF A;  4JI6 L;  3GTK H;  3PO2 H;  4HIO A;  2EIF A;  3JAM c;  2A1A A;  1LTL A;  1L1O A;  4YWK A;  2AWO A;  4APV A;  1IBM L;  3T1H L;  1QUQ B;  2GVA A;  4A3K G;  1ASY A;  3OTO L;  2IX1 A;  5C4X G;  2ALY B;  2UXD L;  1YJN A;  1W2B A;  1KL9 A;  2WAQ G;  4Y7N H;  1YEZ A;  2N3S A;  4DR2 Q;  3K0X A;  2EXD A;  2VQF L;  4GN3 B;  1PH9 A;  2HHH L;  2JA6 H;  1WYD A;  1X55 A;  1X6O A;  4B3S Q;  4A75 A;  1HNZ L;  3HOV H;  4OWX B;  4YHH L;  2IT1 A;  1E1O A;  4JBW A;  3DM3 A;  3PV0 A;  4JOI A;  2XTI A;  1FJG L;  3KYH C;  4IPC A;  2K14 A;  1M90 C;  4BBR G;  1PH3 A;  2B29 A;  4AQY Q;  1YIJ A;  4A3G G;  2NVX H;  1L1O B;  1N34 Q;  1MIU A;  3K80 C;  4BY1 G;  2R7Z G;  1YHB A;  1B7Y B;  3PUZ A;  3L2P A;  1QUQ A;  1Q12 A;  3AYH B;  4HJ8 A;  2I0Q A;  2A8V A;  1AE3 A;  2WB1 G;  4QL5 A;  3S1N H;  4AIM A;  3HOU H;  3G71 A;  4TQU S;  2LXK A;  4LF6 L;  1Y1V G;  1HZC A;  1VQB A;  4YCW A;  4YY3 L;  1V43 A;  5AJ3 L;  4O0A A;  4AYB E;  1VQJ A;  1Y1W H;  1E3P A;  1OXU A;  3D0F A;  3CCQ A;  4JI8 L;  1VQ5 A;  1XTD A;  4KHP Q;  3RN5 A;  4R4I A;  1HNZ Q;  1X56 A;  1IBL Q;  2JEA I;  1PH4 A;  4BXX H;  5IT9 c;  3HFZ B;  1FL0 A;  2UU9 L;  1K9M C;  1I3Q H;  4DV2 L;  4GKJ Q;  3CXC A;  4A3G H;  1N36 Q;  4H02 A;  4QIW E;  5EAY A;  1IXR A;  5IP9 G;  1PH7 A;  2ID0 A;  4IOC A;  3GTP H;  1SLJ A;  1K3R A;  3GTJ H;  1EFW A;  2UU9 Q;  3RLO A;  1VQD A;  3CPF A;  1GM5 A;  3L0O A;  2ASB A;  1E22 A;  1Q1B A;  4HJ7 A;  2R93 H;  3KLW A;  4OO1 I;  5M5X H;  5C44 H;  4GLV B;  1VQH A;  1Q86 C;  3CF5 A;  2JA7 H;  4LUZ A;  4DV6 Q;  3E0E A;  4A3E H;  3S1M H;  4A93 G;  1N9W A;  5C4X H;  4DV4 Q;  2RCN A;  1HNX L;  1VQO A;  4JI4 L;  2VUM H;  1PA6 A;  3KF6 B;  2LXJ A;  3I7F A;  5LMN W;  1UE7 A;  2K75 A;  2R92 G;  3UDG A;  1Q7Y C;  3HKS A;  4DR4 L;  1V1Q A;  4JI1 L;  2OQ0 A;  4LF6 Q;  4BBS H;  4UP8 A;  1CKM A;  4C3I H;  5IP7 G;  3F2B A;  1NE3 A;  4NXN Q;  1B70 B;  2RHS B;  3HKZ E;  1HZ9 A;  2E8G A;  4X65 Q;  1FJG Q;  3CME A;  2D62 A;  1K8A C;  4PZ7 A;  1A0I A;  4IPG A;  3G6E A;  1X3G A;  3M7N A;  1ASZ A;  4PZ8 A;  1TWG H;  3NEL A;  2OCE A;  1VQ9 A;  2JK8 A;  4MZ9 A;  1JJC B;  4NXN L;  4JI1 Q;  5GAG C;  1XNR Q;  4DR7 L;  1SE8 A;  2Z6K C;  3RN2 A;  3S14 H;  4DR6 Q;  4LUO A;  2KCT A;  4X62 L;  3OTO Q;  1G6P A;  4KLK A;  3RR5 A;  4YHH Q;  4RG1 A;  1T9H A;  3RLN A;  4WJ4 A;  1VQE A;  2MNA A;  3RZO H;  3PUX A;  5ELO A;  3CC2 A;  2A19 A;  5C0X I;  4DR2 L;  3ULL A;  2KHJ A;  2N78 A;  1VQP A;  1S72 A;  4A3D H;  4A3L G;  2MO0 A;  3J80 c;  3FKI G;  1R9T H;  1VQI A;  2OTJ A;  5BR8 Q;  4A3J G;  4JV5 Q;  2BH2 A;  3J80 i;  3KDF A;  2F4V L;  1PH2 A;  3I55 A;  4LF7 L;  4R4C A;  4YCV A;  4C3H H;  3S15 H;  2F52 A;  3HOY H;  4PZ6 A;  5IP9 H;  2NN6 G;  2VZA A;  1Z9F A;  4JI5 L;  1YNX A;  2CWA A;  1JJ2 A;  4XIG S;  3STB C;  3AFQ A;  4UP7 A;  2B3G A;  4DPG A;  3KOJ A;  1IBK Q;  1QVF A;  2H5X A;  2YTY A;  5C4J H;  3I2Z A;  1NBW A;  4LFB L;  1U0L A;  5GAD C;  3CCJ A;  4QQB X;  3F8T A;  1PH1 A;  3CCR A;  3CCM A;  4LFA L;  1S40 A;  4GKK L;  1SRO A;  4YY3 Q;  3GTQ H;  1Q1E A;  1Y14 B;  5J3B A;  2FXQ A;  5FJ8 H;  4X64 Q;  4GLA C;  3E9H A;  4POF A;  4L5R C;  4GNX C;  4BY1 H;  2Q2U A;  4LFA Q;  1D8L A;  3RLF A;  4BBR H;  2R7Z H;  4GKK Q;  4MNO A;  1VS0 A;  5GAH C;  1M1K C;  2JA5 G;  3HOW G;  5HY6 A;  5FLM G;  4IJH A;  1J6Q A;  4P71 A;  4KHZ A;  4C3J H;  4BA2 I;  4RMF A;  4GOP B;  4DV6 L;  1QZH A;  1P16 A;  1AE2 A;  4X64 L;  4L5Q A;  2ATW A;  1OXV A;  5K36 G;  3HOU G;  5JJK A;  2VQE Q;  2WFW A;  3GDE A;  2UXD Q;  1VQ6 A;  3KJP A;  1SRU A;  4HJ5 A;  4FDB A;  3I56 A;  1XMO L;  4LF5 L;  2NVT H;  1X3E A;  1A63 A;  5GAE C;  1BVS A;  3M85 A;  4OON A;  3T1Y Q;  4A3K H;  4LWC A;  2ZM6 L;  1HJP A;  2CQO A;  4P72 A;  2JJQ A;  3EIV A;  1VQ7 A;  2ZJR A;  3ICE A;  3HKZ G;  2B63 G;  2I5H A;  4K0K Q;  3BJU A;  1N36 L;  1A8V A;  1I50 H;  2R6G A;  4DUZ Q;  1CKN B;  4JI5 Q;  4UY8 C;  4X66 L;  4LF4 L;  2V1C C;  1KRT A;  3CW2 C;  4BY7 G;  1IBM Q;  2OWO A;  3T1Y L;  1VQA A;  4JI0 L;  4R4Q A;  4IFD J;  1QVC A;  4LF7 Q;  2ZTC A;  1XNQ Q;  1Q46 A;  4X66 Q;  3PUW A;  3H3V I;  5C0X G;  4DUZ L;  1NMG A;  5E7N A;  4GOP A;  4HJA A;  4PMW A;  1YJW A;  4A93 H;  2YU9 H;  2PMZ E;  1G51 A;  1WCM H;  1E1T A;  3ERS X;  3NBH B;  2ZM6 Q;  1NTG A;  4DR3 Q;  3U50 C;  3E9I A;  2EQS A;  3J7Z C;  1N8R C;  1JMC A;  4NXM L;  2R92 H;  1P8L A;  4A3I G;  4LUV A;  1Q82 C;  3U4Z A;  4GOP C;  3BU2 A;  2IHF A;  4X62 Q;  2LSS A;  3I4M H;  1S3O A;  4BBS G;  1VQF A;  4DR7 Q;  4A3M H;  3HOZ G;  1CKN A;  1K83 H;  1YHA A;  2QGQ A;  3CMA A;  2UXB L;  4DR1 L;  4YWM A;  2KBN A;  1GO3 E;  4B3S L;  4BXX G;  2HHH Q;  2JE6 I;  1OTC A;  4AH6 A;  3A74 A;  2E2H H;  4EX5 A;  5C3E H;  3J81 i;  4HID A;  2OTL A;  2WAQ E;  3CCE A;  4A3F G;  2HT1 A;  5M3F G;  3A5U A;  3BZK A;  4AYB G;  1OXX K;  1Z47 A;  1PV4 A;  1PVO A;  4EQ5 A;  5M3M G;  1K8G A;  2UXC L;  3AEV A;  3B6Y A;  1KD1 C;  3GTM H;  4IFD G;  4MTN A;  1NMF A;  4O2D A;  1YIT A;  2K50 A;  2JA9 A;  4NXM Q;  1L0W A;  3KF6 A;  4JCV E;  1EUJ A;  3CP0 A;  4OO1 G;  4IPD A;  2Y0S G;  3CQZ H;  3S2H H;  1XPU A;  3F2C A;  4DV5 L;  1LYL A;  1TWH H;  3HOV G;  2R93 G;  1PYB A;  1GVP A;  3K81 C;  4JC0 A;  4NPS A;  4A3D G;  3J81 j;  2GN5 A;  3S24 A;  4DV7 Q;  4B3M L;  5C3E G;  4JYA L;  5IYC G;  4JI0 Q;  2D0O A;  4DV1 Q;  4A3J H;  1SR3 A;  2VL6 A;  1E24 A;  2K4K A;  1LUZ A;  2NN6 I;  4BA1 I;  4DAY B;  1OXT A;  1XMO Q;  1HR0 L;  5IYD G;  2N8N A;  3J81 c;  2PI2 E;  3BZC A;  3D31 A;  4XTC S;  1HNW Q;  2JEB I;  2JA8 G;  1N33 L;  4YCU A;  4Y52 H;  4IO9 A;  1CSQ A;  4JBJ A;  3LGJ A;  3PUY A;  1PYS B;  1NJI C;  4A4I A;  1MKH A;  2VS1 A;  4A3B H;  1CKO A;  3GO5 A;  1IBL L;  2HIV A;  1Y1W G;  1N34 L;  2UXB Q;  1EIF A;  2MFI A;  3AQQ A;  5IE8 A;  1Q81 C;  1TWC H;  3MXN B;  1KC8 C;  3G4S A;  4IPH A;  4UPA A;  1I94 Q;  1C0A A;  3H15 A;  1J5E Q;  4PG3 A;  2F3I A;  4JI3 L;  1L1O C;  3PIO A;  3I4M G;  4B3R Q;  3CCU A;  5GQO A;  1I6H H;  3TQY A;  4DNI A;  2Q2T A;  4A3M G;  2E5L Q;  5C0X J;  3HOW H;  4DK6 C;  4JI3 Q;  3HOX G;  4A3L H;  3M4P A;  2RF4 A;  2IY5 B;  2Q2I A;  3A0J A;  2UUA L;  3NEN A;  2PQA A;  3CC4 A;  2BA1 A;  1EWI A;  4R4T A;  3TEH B;  3HOZ H;  4JG2 A;  1H95 A;  3CC7 A;  4JI4 Q;  3DLL A; 
#chains in the Genus database with same CATH topology
 1HCZ A;  3I73 A;  4JI7 Q;  3NWT A;  2YTV A;  1EY0 A;  4ULL A;  2DNE A;  5LMU Q;  2B2T A;  4KK7 A;  3KK7 A;  4O1N A;  1WTR A;  4DR5 L;  3KF8 B;  2E2I H;  4BY7 H;  2AUJ D;  1A3T A;  3X3N A;  4DV0 L;  2PPB C;  4FF3 A;  4P74 A;  2KEC A;  2PQA B;  1XPR A;  1YI2 A;  2XWJ B;  3FP9 A;  2ZXP A;  1SYF A;  4JI2 Q;  2Z1C A;  4F7X A;  2YTX A;  3UI2 A;  2QDL A;  3TS2 A;  2CH4 A;  2YV5 A;  1X9N A;  4DAM A;  2K5W A;  3J7A V;  1BKB A;  3R3O A;  3UDF A;  3W5O A;  1EY9 A;  4QMG A;  4B3R L;  3ITP A;  4X6A H;  2AUK A;  2A74 C;  4AQY L;  2KEE A;  3HKZ B;  2HD3 A;  3EBE A;  4QIW B;  1I6H B;  1F2L A;  2I5L X;  1C4Q A;  1RIP A;  3F1Z A;  3H0G G;  3ZJY C;  1CSP A;  3CCV A;  4KJO A;  2R7F A;  5CV7 A;  2FJ2 A;  2N49 A;  5IGE A;  4DV2 Q;  4GKJ L;  4G7H C;  1LLR D;  3CKI B;  2C35 B;  4K8J A;  1XNR L;  4CJ2 C;  3HS0 C;  4OX9 L;  4FVM A;  5IGD A;  3A7A B;  3I4O A;  1FGU A;  2ES2 A;  3OIQ A;  3Q0A A;  4DK1 A;  2E5L L;  4JI7 L;  1PFN A;  1W3S A;  2JA7 G;  1XMQ Q;  4A3B G;  5CBE E;  3VR4 A;  3HOY B;  5JJI A;  4FO2 A;  1TXY A;  4J15 A;  4XXE A;  5I6Y A;  5EJW A;  1SNC A;  4DUY Q;  3GTL H;  3LWE A;  4LF9 Q;  1DGS A;  3S1N B;  1WTH A;  4X3U A;  4HIM A;  2Q8R E;  3UE0 A;  1PFS A;  4YWL A;  2K5V A;  2PI2 A;  4IUR A;  1LO5 D;  1LTG D;  2MUY A;  5BN3 A;  4LF4 Q;  5JEA J;  1C9O A;  2Y0S E;  2Z9H A;  2E75 C;  2AKW B;  2SEB D;  4KKS A;  4KI0 A;  2E2J H;  2AWN A;  1X65 A;  4GS3 A;  4JV5 L;  5D14 A;  4P2C B;  4DR6 L;  1CQV A;  3P1H A;  1WI5 A;  3TRE A;  1ICW A;  4ZUI A;  3GTO H;  4IQZ A;  3BVZ A;  4V0B A;  2VY3 A;  2AQ2 B;  3STB D;  3H94 A;  1B3Q A;  4JI8 Q;  4C3H G;  1I50 B;  1BXT A;  3P7J A;  4ID6 A;  1O7Z A;  4QJF A;  1A6X A;  1X54 A;  4L5T A;  1PH5 A;  1N32 L;  1SYE A;  3KF8 A;  1SE3 A;  1X32 A;  1PDQ A;  1XJV A;  3PSI A;  4Z9C B;  3NK9 A;  3S2D H;  1NNX A;  2AQ1 B;  4BBS B;  2CFM A;  2F4I A;  1VQ4 A;  4LNQ A;  1U4P A;  3Q8D A;  3K7A B;  4DV0 Q;  1XNR Q;  2KHI A;  3K5O A;  1VMP A;  2B8F A;  5E1F A;  1VQM A;  1XMQ L;  1MI2 A;  1B53 A;  3U58 A;  3RNU A;  3SK4 A;  4TVA B;  4B3M Q;  3C1E A;  3PCO B;  1BCP F;  1I4G A;  3E5S A;  3GTK H;  4G7O C;  1ML0 D;  3MEF A;  4PMB A;  4HIO A;  2M9V A;  1LTR D;  3JAM c;  4BS9 A;  4L6T B;  4YWK A;  1SMY D;  3AB9 A;  1IKL A;  1O7L A;  4ZUJ A;  1U4R A;  5C4X G;  2UXD L;  4RFB A;  1GUO A;  1KL9 A;  1W2B A;  5K5P A;  1YEZ A;  2QEJ C;  4GN3 B;  1MD2 D;  1HQM C;  1HNZ L;  2LKV A;  3BG3 A;  4JBW A;  1FJG L;  2J7Z A;  3MXU A;  3TME A;  3KYH C;  5A35 A;  4IAL A;  4G4K A;  3HOU B;  4AQY Q;  5L37 A;  1YHB A;  1PTO F;  1B7Y B;  3PUZ A;  3AYH B;  3H0G B;  5IT9 L;  4HJ8 A;  2A8V A;  1AE3 A;  4QL5 A;  3T16 A;  4AIM A;  4ZKC B;  4TQU S;  4YCW A;  1Z6H A;  4AYB E;  1VQJ A;  3VYU A;  1VQ5 A;  2H1E A;  1IBL Q;  5KNC A;  1S5D D;  1PH4 A;  3AU7 A;  1PTO H;  2IPK D;  3HFZ B;  1K9M C;  1I3Q H;  1I4Q A;  1S5F D;  5M3F B;  1WTP A;  3VYS A;  1PH7 A;  2CH4 W;  2IJ0 A;  3URY A;  2EYL A;  3RLO A;  1VQD A;  3S2H B;  1GM5 A;  3L0O A;  2A6H C;  1CI3 M;  3TZD A;  3KLW A;  4OO1 I;  5M5X H;  1D2B A;  3C1F A;  5C44 H;  1A15 A;  2D2C C;  2KUM A;  3E0E A;  1I6V C;  1HNX L;  3GTO B;  4RGO S;  3WDN A;  2EXZ A;  2VUM H;  1PA6 A;  3KF6 B;  2G5D A;  1UE7 A;  1B1Z A;  4LK1 C;  1K83 B;  5LHY 1;  1Q7Y C;  3HKS A;  4DR4 L;  1CKM A;  4C3I H;  4NXN Q;  5CR3 A;  3JAM L;  1FJG Q;  1HZ9 A;  2E8G A;  5CV4 A;  3LNN A;  4N9T A;  3CME A;  1ASZ A;  4PZ8 A;  5EKL A;  1Y1W B;  1TWG H;  3NEL A;  1HTL D;  4MZ9 A;  4K14 A;  3S14 H;  1BCP B;  2KCT A;  2F0P A;  3OTO Q;  4KLK A;  1A2U A;  1T9H A;  2BOS A;  4WJ4 A;  3RZO H;  3H6M A;  3H3V C;  3PO3 B;  3SDZ A;  5C0X I;  3ULL A;  2KHJ A;  4KY5 A;  1S72 A;  1T5E A;  5DEH A;  2MO0 A;  1LT5 D;  2EY2 A;  3FKI G;  5JPM C;  5ELB A;  2OTJ A;  2F4V L;  3S15 H;  1BF4 A;  4R9W A;  2F52 A;  1E2W A;  3HOY H;  4PQX A;  2NVT B;  1STH A;  1WTW A;  5EBC A;  2XRQ D;  3STB C;  3K5M A;  1QOH A;  3QWN A;  2PZW A;  2H5X A;  5C4J H;  5I6W A;  4KY7 A;  2Z8L A;  1PH1 A;  1FGB D;  3CCR A;  5DNF A;  2L12 A;  2FXQ A;  2LFN A;  4GLA C;  4X64 Q;  3VYT A;  4RH6 A;  4BBR H;  4GKK Q;  4MNO A;  5GAH C;  2JA5 G;  3G7L A;  5DAU A;  4R8I A;  1B9M A;  4C3J H;  3DM1 A;  1AE2 A;  1G6Z A;  1FD7 D;  1SRU A;  4FDB A;  4ZYS A;  4A3G B;  1DD2 A;  3M85 A;  2KCC A;  4WFN 3;  3OMG A;  1HJP A;  3ND9 A;  2F0L A;  4A3F B;  2K6A A;  4DAP A;  1EY7 A;  2B63 G;  4DGZ A;  4K0K Q;  3RMH A;  4JI5 Q;  1ET9 A;  2B2U A;  1IBM Q;  2O5I C;  4IFD J;  3FVQ A;  1BDO A;  1QVC A;  2B2Y C;  1LTT D;  3NTI A;  2B2W C;  5E7N A;  2PMZ E;  1LAB A;  3MAQ A;  1NTG A;  3U50 C;  3E9I A;  1DXM A;  1P8L A;  1Q82 C;  3DEO A;  5HGT A;  5EQ0 A;  3A7L A;  1KAB A;  2JSO A;  4CBV A;  4DR1 L;  4YWM A;  4CKE A;  4AH6 A;  2NB0 A;  4HID A;  3CCE A;  5G3L D;  5M3F G;  1RKN A;  3BZK A;  1OO9 B;  1IL8 A;  2BE5 D;  4AYB G;  3IL8 A;  3SR1 A;  1GOZ A;  3GTK B;  2A6E D;  3GTM H;  4IFD G;  1C48 A;  1YIT A;  2NYZ D;  2K50 A;  1Y8N B;  4JCV E;  4IPD A;  2RKS A;  3CQZ H;  2Y0S G;  1XYI A;  3F2C A;  1WTX A;  1I4H A;  1GVP A;  2RA4 A;  2V4D A;  2X6L A;  4Q5V A;  3SE0 A;  1Q8I A;  1VMC A;  1MGS A;  2K4K A;  1XMO Q;  4BBR B;  4YCU A;  2QCP X;  3LGJ A;  1FNU A;  3MFY A;  2XN9 C;  5CBA E;  5ELE A;  1FNW A;  1Y1W G;  1EIF A;  1NUC A;  1Q81 C;  1TWC H;  4HMJ A;  3BDO A;  4PG3 A;  1EEF D;  1FNV A;  1NR4 A;  5JPN C;  4B3R Q;  5FO7 B;  2TMP A;  4DNI A;  3HOW H;  1TS5 A;  2NTS A;  4DK6 C;  4HCS A;  1PRT D;  3M4P A;  2RF4 A;  4C3J B;  1QNU A;  2B2Y A;  2TSS A;  2PQA A;  5F2D A;  4J6H A;  4JI4 Q;  4JI0 L;  3PO3 H;  2FFK B;  2WP8 J;  3IFT A;  2WB1 B;  1LTI D;  1CZG A;  4PMC A;  3WWV A;  1PHJ A;  1HNW L;  3QR8 A;  5E4W C;  2NVQ H;  1U5K A;  4JOI C;  1NY4 A;  5C0X H;  4C1N K;  2K5D A;  2G9D A;  1SMY C;  3M3Y H;  4CKC A;  2OXP A;  3PIP A;  2I46 A;  5FJ8 G;  2NZO A;  2R61 A;  1PTO C;  3M4Q A;  2JA8 H;  5TSS A;  5E4X A;  4LMQ D;  5C6A A;  3S17 H;  3J80 L;  3GV3 A;  3KUP A;  1GJX A;  5IYB H;  4HJ9 A;  1EIH A;  5NUC A;  3VA5 A;  4JI2 L;  1HZB A;  4OEL B;  4DUY L;  4DV3 Q;  1IYJ B;  1YNN C;  1JJG A;  2JA6 G;  1TY2 A;  4RKB A;  3AFP A;  1YNN D;  2DNC A;  4LW1 A;  4R4O A;  2QIL A;  4A76 A;  3M7G A;  5DM6 3;  1BOS A;  2KCM A;  1U9R A;  1EQQ A;  3PQI A;  1G29 1;  4F87 A;  3ER0 A;  5FLX E;  4DV1 L;  3JC6 6;  5LMN Q;  4E6I A;  1VQK A;  1UEB A;  3F2D A;  3EFX D;  3PMF A;  1Y1V B;  5I4D A;  2AQ3 B;  1VQC A;  3A55 A;  3PF4 A;  1GUW A;  3CCL A;  3KFU A;  2R7D A;  4KHP L;  3A54 A;  2L55 A;  4K0K L;  4A3I H;  4CHT B;  2R93 B;  4LF9 L;  1EQR A;  1F9P A;  3OIP A;  1GHK A;  2K5H A;  4HR7 B;  4XQN A;  1VQL A;  1TWF B;  1QE6 A;  3BDC A;  4RAU C;  1SJE D;  3RZD B;  2RDH A;  5AJ3 Q;  4I65 A;  4GN5 A;  1PTO B;  2PZU A;  2N55 A;  2UUA Q;  3Q6S A;  2MP1 A;  2XGT A;  3M4O H;  4XYQ A;  1Q8K A;  2FIN B;  5IWA L;  1VF7 A;  3D4D A;  4OWW B;  3OYY A;  2F0O A;  1UE6 A;  4FYD A;  4DAY A;  5H1S E;  2K01 A;  2B2W A;  1HXY D;  2JXM B;  1RJT A;  2GA4 B;  3W1B A;  4OIJ A;  5T1I A;  1X3P A;  5M5Y B;  4DU9 A;  1EOT A;  1YBY A;  5IYC H;  1PLF A;  3K57 A;  2L15 A;  4LFC L;  5IP7 H;  1D5M C;  3CPW A;  1Y69 U;  4K6L A;  2EY1 A;  2FMC A;  4WJW A;  3PUV A;  2PNH A;  3X3M A;  1KRS A;  3HRZ C;  4ZQ3 A;  4JBM A;  5FLM H;  1QNK A;  2Q8I B;  3JAM i;  2EY6 A;  3J7A 5;  1RCV D;  4IFD I;  1HR0 Q;  2IHE A;  1J8I A;  1QCB D;  1UEA B;  3N52 A;  4ZKB B;  4XQQ A;  2Z4H A;  4WJ3 M;  4UAI A;  4F88 A;  3K7U C;  1I5F A;  1TWF H;  4DF7 A;  5LMU L;  1IZ6 A;  4LF8 Q;  3FKI H;  2BH8 A;  3HOX H;  4EQO A;  1JB7 A;  4DR1 Q;  2KEN A;  1J5E L;  1VCI A;  3A8K E;  3BS1 A;  1PH8 A;  1GUN A;  4DR4 Q;  3TBI B;  4ZK9 B;  3MFG A;  3KDF B;  1Y1V H;  4B9W A;  4RWS C;  3GTP B;  4DV3 L;  2BE5 C;  1KLU D;  1TS2 A;  4RGM A;  4A3C G;  1D5Z C;  1RDP D;  3FEW X;  1JT8 A;  2ZXO A;  2KHS A;  1EEI D;  3S9W A;  3OW2 A;  2F1M A;  4QY7 A;  4CDC C;  1X3F A;  3SGI A;  1GKH A;  3W3A A;  1K28 A;  4JW0 A;  1B2T A;  4JI6 L;  3PO2 H;  3D6C A;  1PFB A;  1JB3 A;  1LTL A;  4APV A;  1QUQ B;  2VXW A;  2GVA A;  2F0H A;  1ASY A;  3OTO L;  3GTJ B;  1YJN A;  3IAY A;  3HOV B;  4Y7N H;  1STE A;  2EXD A;  2VQF L;  1JCK B;  3I4M B;  2HHH L;  3MTS A;  4B3S Q;  3HOV H;  2B39 A;  3NP8 A;  4JOI A;  3DM3 A;  2XTI A;  4K5V A;  4A93 B;  3MXG A;  5EKI A;  1YIJ A;  4A3G G;  2NVX H;  1L1O B;  2SDF A;  4BY1 G;  5IOD A;  1EYD A;  5COR A;  1Q12 A;  2I0Q A;  3S1N H;  1H9S B;  1EYC A;  4RCN A;  2F0U A;  3G71 A;  1Y1V G;  3GTL B;  1VQB A;  1G6P A;  4KHP Q;  2SNM A;  1XTD A;  3RN5 A;  5CV9 A;  4M8A A;  4M1U B;  4S3S A;  2JEA I;  3C3L A;  4DK0 A;  4C3I B;  3R93 A;  1FL0 A;  4CKB A;  3DWA A;  5IT9 c;  4DV2 L;  2UU9 L;  4GKJ Q;  4H02 A;  1EL0 A;  4IOC A;  3GTP H;  1WTQ A;  1TII D;  3CPF A;  3PIP 3;  2ASB A;  2DY7 A;  4IFD H;  1TU2 B;  3V96 A;  3I91 A;  4JVZ A;  4KTA A;  3ONA B;  3S1M H;  3KLR A;  3GTQ B;  3P20 A;  1D5X C;  1N9W A;  2RCN A;  2KVM A;  3BDL A;  5ELF A;  2R92 G;  3UDG A;  1PTO D;  3MVV A;  4K5W A;  1V1Q A;  1I3Q B;  4XYO A;  4LF6 Q;  4UP8 A;  2A73 B;  4AYB B;  4CGY B;  1L0Y B;  1B70 B;  1B44 D;  1IW7 C;  2PZT A;  5CMD A;  1A0I A;  1STN A;  3M7N A;  1EY4 A;  1RHP A;  5KRU A;  1VQ9 A;  1JJC B;  4N8X 1;  4JI1 Q;  5GAG C;  1JE4 A;  1VDZ A;  3QG1 A;  4RG1 A;  3RLN A;  1JOO A;  3CRL C;  4NMZ A;  1VQE A;  2MNA A;  5A2Q E;  3H09 A;  5ELO A;  1DOM A;  2A19 A;  5CV8 A;  4A3D H;  3J81 E;  3ERQ A;  1CZW A;  2IL8 A;  3J80 c;  1VQI A;  1XWE A;  3I90 A;  5BR8 Q;  2EY5 A;  2BH2 A;  4JV5 Q;  1SE2 A;  1PH2 A;  1KLG D;  1U4M A;  3LX0 A;  2XIW A;  3TZU A;  4H44 C;  2M2L A;  2VZA A;  3ERO A;  4JI5 L;  3S1Q B;  1JC7 A;  3FPP A;  3AFQ A;  4HSP A;  2WKC A;  1SNO A;  4K5X A;  1QVF A;  1NBW A;  4CJ1 B;  3MHB A;  5GAD C;  1SYD A;  1ZYR D;  4LFA L;  3CCM A;  4TRD A;  4PNY A;  1ZYR C;  3QB3 A;  4L5R C;  1JWU D;  3K5N A;  1WVL A;  3MXP A;  4BY1 H;  5IGF A;  1D8L A;  3RLF A;  1VS0 A;  3T4A C;  1J6Q A;  1DCZ A;  1TVX A;  4KHZ A;  2NTT A;  1HHV A;  1SFO B;  1JR0 D;  1P16 A;  1JOK A;  2VQE Q;  2WFW A;  1VQ6 A;  1S5C D;  3R2I A;  2NVT H;  2O2L D;  4A3K H;  1BVS A;  4OON A;  1HRJ A;  1K8M A;  5HUR A;  4ABN A;  2XNA C;  2G9H D;  2ZJR A;  1VQ7 A;  1S4Z A;  2EYO A;  2I5H A;  2R6G A;  4UY8 C;  4UDU C;  5EPK A;  4X66 L;  2V1C C;  2OWO A;  4LF7 Q;  2ZTC A;  1Q46 A;  3PUW A;  3VR5 A;  5C0X G;  4DUZ L;  4GOP A;  4HJA A;  3HGB A;  4A93 H;  1WCM H;  4HCE A;  1E1T A;  1XTC D;  1O7Y A;  1SBB B;  2ZM6 Q;  1EIG A;  2JA5 B;  3QO2 A;  2EQS A;  2QF7 A;  1N8R C;  1JMC A;  2R92 H;  4A3I G;  4LUV A;  2JA6 B;  3U4Z A;  1ILP A;  2ICI A;  3CU7 A;  4BBS G;  1O80 A;  4ZLT F;  3TP5 A;  1ICF B;  1KNA A;  1K83 H;  2QGQ A;  3LWU A;  3QIA A;  4QF4 A;  3CMA A;  3I4N B;  4B3S L;  4BXX G;  2ZXR A;  5IGB A;  4XT1 B;  1OTC A;  1CTM A;  4KKT A;  1EY6 A;  4A3F G;  2JYO A;  1TS4 A;  4IUN A;  1ZXT A;  1Y8O B;  5M3M G;  3WOF A;  2MJ8 A;  4NXM Q;  2F0E A;  2JA9 A;  1E2V A;  1E0B A;  1RF2 D;  4A3M B;  3CP0 A;  3GP7 A;  3S2H H;  3BYT B;  1XPU A;  2L1B A;  4DV5 L;  2R93 G;  3H91 A;  4JC0 A;  1ONL A;  4NPS A;  5IT9 E;  2GN5 A;  4DV7 Q;  1Z7T A;  2VB3 X;  2NZ1 D;  4A3J H;  1E24 A;  3OHX C;  4YIJ A;  4GZY C;  1OXT A;  4WRD A;  2PI2 E;  3BZC A;  2VUM B;  1V8Q A;  1WD1 A;  2JEB I;  2JA8 G;  2P5Z X;  1ZKO A;  4RHS A;  1STG A;  3OMC A;  4A4I A;  1CKO A;  1IBL L;  2HIV A;  2UXB Q;  1EQV A;  4L8J A;  4FF1 A;  3MXN B;  1BCP D;  2F0K A;  4UPA A;  5ELC A;  1C0A A;  3H15 A;  1GUT A;  2L0C A;  1L1O C;  2H4O A;  5G3L F;  3PIO A;  3MZ5 A;  3KBG A;  3U9S A;  1PZK D;  2F0G A;  1I6H H;  3TQY A;  4RGT A;  3K0Y A;  2Y0S B;  3HOX G;  3SXH A;  1D6E C;  1D1K A;  2IY5 B;  5KNB A;  4WOR A;  3HOZ H;  1SYG A;  1S5B D;  2R7Z B;  5EBD A;  3CC7 A;  3FPU B;  1O7I A;  1GD7 A;  3FRP B;  1IBK L;  5BR8 L;  1MJE A;  1KIX A;  4POG A;  3S1R H;  2EYF A;  5T1G A;  1WFQ A;  1DZ1 A;  2ICE C;  5IOC A;  5DLQ E;  4OIK A;  4C2M H;  4CDF C;  2EJM A;  1HPC A;  2Z0S A;  5IGC A;  1ENF A;  3OW7 A;  1VQ8 A;  2D0P A;  4MIU A;  3NE5 B;  1WCM G;  1WD0 A;  5D3I B;  2MHV A;  3RUZ A;  2PW5 A;  5KIX A;  4BY7 B;  3ULP A;  3RZD H;  1QZG A;  3TP7 A;  1D7Q A;  2B8G A;  2ZJP A;  1K0R A;  4KMU C;  5EGT A;  3CHB D;  2QEX A;  4IUV A;  1BCP C;  4KD3 A;  5C4H A;  1YHQ A;  4KKU A;  2WB1 E;  4A3F H;  4NB3 A;  4LJZ C;  5IGG A;  2XWB B;  1F2Y A;  2K5N A;  3R2T A;  2J0T D;  1QB5 D;  3VDY A;  4TKO B;  4FNF A;  1XX8 A;  4IUP A;  1M8A A;  4RKL A;  3IRB A;  3M9B A;  2K52 A;  1GUS A;  2F0J A;  2E2J B;  2K7V A;  4OEM B;  1NR2 A;  4GLX A;  2AHO B;  1BO0 A;  2ZTE A;  5JEA G;  4HIK A;  5EPJ A;  2F4V Q;  2AMC B;  3D8G A;  1HUN A;  4DFA A;  4B3T L;  1VQN A;  1WJJ A;  5DM7 3;  1K3B C;  4H13 C;  4A3J B;  2UUC L;  4OWT B;  3I4N G;  2UUB L;  2RDG A;  2EJF C;  4ALP A;  4G7Z C;  2NVY B;  3A5Z B;  1R4Q B;  1I94 L;  1KHI A;  4IUT A;  3S15 B;  2Z6K A;  1RTN A;  4OHJ A;  2NN6 H;  4OXP A;  1R9T B;  2F0W A;  4K8I A;  4DV4 L;  1FVI A;  2J4X A;  4C3I G;  3DEP A;  4IOA A;  4CDE C;  4X3K A;  4QUC A;  2B63 B;  2E2H B;  3U4V A;  3SK8 A;  3NEM A;  3QJY A;  2Z6B A;  2K04 A;  1B8A A;  4DR3 L;  2VQF Q;  1EOV A;  1BBU A;  3UDX A;  1PRT F;  2BDO A;  3DXJ C;  1VQG A;  4EVO A;  2HCC A;  4OX9 Q;  4ZAI A;  3C46 A;  2HQE A;  2PO4 A;  2F0Q A;  1XNQ L;  5FLX c;  4L63 B;  1SN8 A;  4IZ8 A;  1A62 A;  2Q2H A;  4EQP A;  2NVY H;  3NXW A;  1PZJ D;  1TWA H;  5M5W H;  3BYY B;  1M4V A;  1TWC B;  2EYJ A;  4N8F A;  4NDX A;  4GNX A;  3T53 B;  4UP9 A;  1V9P A;  3PO2 B;  1IL2 A;  1SDF A;  3HOX B;  1STB A;  4R1J A;  3SEB A;  1A2T A;  5ISR A;  3PF5 A;  1U4L A;  2F03 A;  2CKZ B;  4L5S A;  3VYR A;  1EY8 A;  3E0J A;  2DUD A;  3GTG H;  5HGQ A;  4ME3 A;  3HG9 A;  5C44 G;  2MO1 A;  1B50 A;  1CUK A;  2EYH A;  4C2M B;  4OL7 A;  2MQH A;  3GTM B;  3H0G H;  4DR5 Q;  3ND8 A;  1D1I A;  1JE5 A;  1SYC A;  4IJL A;  1JQY D;  2OT2 A;  2ZT9 C;  1PXU A;  2CHB D;  1L1O A;  2AWO A;  1IBM L;  2NUC A;  4A3K G;  2ALY B;  4H0L C;  1LT6 D;  3J81 L;  4DR2 Q;  4ODG A;  1IHZ A;  2RVL A;  1C8C A;  1ENC A;  4OWX B;  3U9O A;  2RDF A;  1E1O A;  1ILQ A;  2X69 A;  1M90 C;  2MPM A;  2E2I B;  3SHL A;  1PH3 A;  4NP5 A;  1N34 Q;  3NQT A;  3L2P A;  1QUQ A;  4J1M A;  3T56 B;  1B4O A;  2WB1 G;  4XDX A;  3HOU H;  4CJ0 B;  3MEH A;  1HZC A;  3HOZ B;  1V43 A;  2WV6 D;  3OOC A;  5AJ3 L;  1PRT B;  1SNQ A;  1E3P A;  1OXU A;  3D0F A;  2E74 C;  1KTK A;  3CCQ A;  3KBX A;  5BN4 A;  2SNS A;  4BXX H;  1DOL A;  2DN8 A;  4A3G H;  1N36 Q;  5CGK A;  4QIW E;  5EAY A;  2ID0 A;  3J7A F;  2UU9 Q;  1EFW A;  1GUG A;  1E22 A;  4HN7 A;  3V05 A;  1PFM A;  1Q1B A;  4HJ7 A;  4A3I B;  2R93 H;  3S1M B;  4GLV B;  5IIF A;  3CF5 A;  2JA7 H;  2DJF C;  4X3S A;  3C2P A;  4Q0F A;  4DV6 Q;  4A3E H;  1HFN A;  4A93 G;  5I9O A;  3KLS A;  5JJZ A;  3S17 B;  1A3V A;  1VQO A;  2R3Z A;  1RD9 D;  2B2V A;  5C4J B;  2K75 A;  4ME5 A;  4JI1 L;  4BBS H;  3F2B A;  1SEB D;  5M3M B;  2LY7 A;  4FXK C;  3L3O C;  5CC4 A;  4PZ7 A;  3ZYY X;  4IPG A;  1X3G A;  1NCV A;  3O13 A;  2EPB A;  1II3 A;  1IW7 D;  2JK8 A;  4NXN L;  2NVQ B;  2HDL A;  4DR7 L;  1SE8 A;  3RN2 A;  5FK9 C;  4YHH Q;  3RZO B;  4MN3 A;  4RA8 A;  3PUX A;  5M5W B;  4DR2 L;  2N78 A;  3R8B A;  2JA8 B;  3EQL C;  4IUQ A;  1R9T H;  5JOB A;  4LF7 L;  2NBF A;  4YCV A;  5KYL A;  4PZ6 A;  1KAA A;  3KLS X;  1Y8P B;  2R92 B;  1Z9F A;  1CM9 A;  1DJR D;  1AEX A;  1JOQ A;  2QDB A;  1T5X D;  3OPO A;  1IBK Q;  1DON A;  4LFB L;  1LAC A;  1U0L A;  3CCJ A;  3EJI A;  3F8T A;  1YNJ D;  4RCO A;  1LTB D;  1W6K A;  1Y14 B;  5FJ8 H;  3K58 A;  2CQA A;  2JN4 A;  1ESF A;  2Q2U A;  4LFA Q;  3TN2 A;  4ZCK A;  1SYB A;  3HOW G;  1EZ8 A;  4O42 A;  5M5X B;  5E3F A;  4PV1 C;  4P71 A;  3QOJ A;  4BA2 I;  3I70 A;  4GOP B;  4DV6 L;  1BQQ T;  4G57 A;  1QZH A;  5JJK A;  4L5Q A;  1OXV A;  5K36 G;  3GDE A;  5J39 A;  5A2Q L;  4HJ5 A;  1XMO L;  1X3E A;  4I7Z C;  1SAP A;  5GAE C;  1W6J A;  4LWC A;  1SE4 A;  2EDG A;  4LAA A;  3BJU A;  1N36 L;  1A8V A;  1CKN B;  4LF4 L;  1KRT A;  4BY7 G;  1AZQ A;  3T1Y L;  1KDB A;  2L5T A;  1GXD C;  1TKW B;  4X66 Q;  3H3V I;  3SK5 A;  4JK1 C;  1YJW A;  2WIN B;  3TP6 A;  4HMI A;  4FXD A;  2I07 B;  1LT4 D;  2ENB A;  4RHR A;  4NXM L;  1WTO A;  4GOP C;  3N6R A;  4X62 Q;  2PMZ B;  1VQF A;  3NWS A;  2KQ3 A;  3HOZ G;  2KED A;  1CKN A;  1KNE A;  2UXB L;  1TR5 A;  2HHH Q;  2JE6 I;  2IX3 A;  2F0F A;  3M4Y A;  3EA6 A;  5C3E H;  1TQO A;  2HT1 A;  1JIC A;  2K03 A;  3NPP A;  1Z47 A;  4F8M A;  1PV4 A;  3DWQ A;  3AEV A;  1KD1 C;  4MTN A;  4O2D A;  1NMF A;  1L0W A;  3KF6 A;  1DM0 B;  4OO1 G;  2A6E C;  3E6Z X;  2HUG A;  2OEO A;  1QG7 A;  4BWG B;  2A69 D;  1LYL A;  3K6O A;  1TWH H;  3QOL A;  5BN5 A;  3HOV G;  1PYB A;  1LTS D;  3I8Z A;  5JAV A;  4A3D G;  4B3M L;  4JYA L;  2F0N A;  2N88 A;  3Q24 A;  3HP3 A;  5IYC G;  4JI0 Q;  4ZRZ A;  2Q8T A;  1TT2 A;  1SR3 A;  1RTO A;  2VL6 A;  1LUZ A;  4BA1 I;  4I7A A;  2L9H A;  1IYV A;  3J81 c;  1EY5 A;  1HNW Q;  2KOL A;  1I4R A;  3S1R B;  1N33 L;  5LL6 S;  4Y52 H;  4KN4 C;  4JBJ A;  5M9O A;  3PUY A;  2QKI C;  2F0V A;  5FO9 B;  3HZX A;  1MKH A;  2VS1 A;  4A3B H;  1G2T A;  1J9O A;  1S5E D;  5FLX L;  1N34 L;  3AQQ A;  5IE8 A;  2NVX B;  3SK6 A;  3I3C A;  3HEJ A;  1ZEQ X;  3G4S A;  1I94 Q;  3I72 A;  3J7Y W;  1GHJ A;  2F3I A;  3OWF A;  4JI3 L;  4FF4 A;  4DNT B;  2CVR A;  2FMM A;  3NSW A;  2KCN A;  5C0X J;  4A3M G;  3FMC A;  1CFM A;  2LMC B;  4A3L H;  1TY0 A;  1F9Q A;  3J80 E;  1K8O A;  1EWI A;  1G2S A;  4JG2 A;  1XPO A;  1SNP A;  1HNX Q;  4NKL A;  2UUC Q;  2RSN A;  2QA4 A;  4B9X A;  2VUM G;  1FYC A;  1EYG A;  3S16 H;  3I4N H;  2MGS A;  2B63 H;  4QCL A;  5IY0 A;  5LMN L;  1BBW A;  1STY A;  4KN7 C;  3PO2 G;  2CWP A;  3CD6 A;  4JYA Q;  3NTK A;  4IN3 A;  5FOB B;  4FF2 A;  1AH9 A;  3T13 A;  2IX0 A;  1YJ9 A;  4N9P A;  2JA5 H;  1KXL A;  1RL2 A;  1KAW A;  2VB2 X;  4Y7N B;  2VW9 A;  1MJC A;  2YU9 B;  3SVM A;  2O4X A;  4LF5 Q;  2UXC Q;  3W1G A;  1MSH A;  2VQE L;  2XRS D;  1EZ6 A;  5IYD H;  4HED A;  1QIL A;  4QB4 A;  1F9S A;  3T51 B;  1UNS A;  2F0I A;  2JQO A;  3TRZ A;  2F0M A;  4LFB Q;  2JA7 B;  1HFG A;  5C44 B;  4P75 A;  4DKA C;  4GN4 B;  5JJL A;  1AP0 A;  5AFW A;  1N33 Q;  1TWG B;  1EWH A;  3HOY G;  1EWC A;  1Q90 A;  3UE1 A;  2RHQ B;  1UUP A;  3FDT A;  4DA2 A;  5M3M H;  2EYM A;  3CAM A;  2UUB Q;  1EFI D;  3DMU A;  1SFO H;  3KJO A;  1WCM B;  1JWM D;  1KQS A;  1YZ6 A;  4B3T Q;  2HQL A;  2IW3 A;  4DK3 C;  1WOC A;  2JP1 A;  2GVB A;  1V1P A;  4C56 C;  3T1H Q;  2HDM A;  5LL6 X;  1O78 A;  2L11 A;  3L7Z C;  3PO3 G;  2K32 A;  1LM0 A;  1EIY B;  3FKI B;  4DV5 Q;  2YYZ A;  4C1N I;  2RBM A;  3L9A X;  1UWV A;  3H3V H;  3EN2 A;  4A3C H;  5IWA Q;  4LFC Q;  4A3E G;  2I5M X;  3I4L A;  5M3F H;  2HIX A;  3GD7 A;  1H9R A;  1SNM A;  3K8A A;  1CT1 D;  1YVC A;  1PH6 A;  1C7Y A;  5JEA H;  3NUC A;  1V1P B;  3PGZ A;  4K2L A;  4RGN A;  4X65 L;  2D5D A;  1HQR D;  2ZTD A;  2VNU D;  1L2F A;  3IFD A;  3TDQ A;  1QVG A;  2NWG A;  1LTA D;  5M5Y H;  2EOT A;  3CCS A;  4ILW A;  5IYB G;  1CHP D;  3DHQ A;  2B2T C;  2XSC A;  2BCO A;  1H9M A;  4LF8 L;  1UE1 A;  1X3Q A;  3MXN A;  2PCF B;  3Q22 A;  3K7A H;  4B08 A;  3S1Q H;  4P73 A;  5GRO A;  1TS3 A;  3G48 A;  3S2D B;  4QGU A;  1EQT A;  1F2M A;  3UDI A;  4JI6 Q;  1DYQ A;  5JVH 3;  1HH2 P;  2F0T A;  4MTK A;  1OXS C;  2CCZ A;  1A3U A;  1UE5 A;  1QWY A;  2DGY A;  4X3T A;  3FHW A;  3ULJ A;  3TS0 A;  3F2U A;  5EPL A;  1HZA A;  3GTG B;  1H9J A;  1SMX A;  3BVM A;  1DOK A;  2BA0 A;  1N32 Q;  1PMR A;  2RQX A;  1LT3 D;  2NZH A;  5CV6 A;  4DN4 M;  4GNX B;  5ELN A;  2E2D C;  5C3W A;  1HR0 W;  2ZJQ A;  4JBK A;  4V19 0;  3WOE A;  1EU3 A;  5ELD A;  4DV7 L;  3D3R A;  2OQK A;  1K73 C;  1E7Z A;  2A6H D;  2EIF A;  2A1A A;  3V2T A;  3K5L A;  3T1H L;  2IX1 A;  1B9N A;  2X6G A;  2WAQ G;  2C5C A;  2N3S A;  1EYA A;  3K0X A;  3MC0 B;  5FKA C;  5FO8 B;  2KA7 A;  1STA A;  4U68 A;  2EJG C;  3DUZ A;  1PH9 A;  3HOW B;  2JA6 H;  1WYD A;  1X55 A;  1X6O A;  3VR2 A;  4A75 A;  1ROD A;  4YHH L;  2IT1 A;  3PV0 A;  4OGQ C;  2LS0 1;  1AN8 A;  2K14 A;  4IPC A;  5C5L A;  4BBR G;  5D3D A;  2B29 A;  2KJX A;  1MIU A;  3K80 C;  2R7Z G;  4HSV A;  2BDN A;  4A3B B;  4KV6 A;  2EVB A;  2A68 D;  2EYP A;  2CW0 D;  2QW7 A;  4IUU A;  4MHE A;  3VR6 A;  3JAM E;  4LF6 L;  2LXK A;  3VA7 A;  4YY3 L;  4O0A A;  1Y1W H;  2A68 C;  4HTH A;  3NBH A;  2CW0 C;  4JPB W;  4JI8 L;  4DAV A;  4R4I A;  1HNZ Q;  1X56 A;  3PIO 3;  4A3K B;  2EZV A;  3CXC A;  2WKD A;  1IXR A;  2DY8 A;  5IP9 G;  2SOB A;  1SLJ A;  5I9P A;  1K3R A;  3GTJ H;  1L0X B;  1JWS D;  3CQZ B;  4KY6 A;  5C3X A;  3K59 A;  1ESR A;  3OWE B;  3Q23 A;  1CA5 A;  1XXG A;  4A3E B;  2WAC A;  1H9S A;  1VQH A;  1Q86 C;  4LUZ A;  1HA5 A;  3G6J B;  2K5Q A;  5C3E B;  2D9U A;  5C4X H;  4DV4 Q;  1AFP A;  2F0D A;  4JI4 L;  3D4R A;  2PNR C;  2LXJ A;  3I7F A;  5LMN W;  4XT3 B;  3DWP A;  4DXG A;  1BUV T;  5J1Z A;  2K33 A;  2OQ0 A;  3A8I E;  4UHV A;  5IP7 G;  1NE3 A;  2RHS B;  3HKZ E;  4X65 Q;  4H7B A;  2RSO A;  2PYK A;  2D62 A;  2PW7 A;  1K8A C;  3G6E A;  1TWH B;  1KDC A;  5CYU A;  4C3H B;  2OCE A;  3P75 A;  4KHV A;  2Z6K C;  2F3V A;  3RD4 A;  4DR6 Q;  4LUO A;  5JVG 3;  4A3D B;  4X62 L;  3RR5 A;  1VF5 C;  3W2D A;  5D65 A;  4J8Q A;  3D4W A;  3CC2 A;  5EKK A;  1VQP A;  3TP8 A;  4A3L G;  1IKM A;  4A3J G;  4FP5 D;  3KDF A;  3J80 i;  3I55 A;  4R4C A;  4NW2 A;  4C3H H;  1AZP A;  1SXT A;  4EGV A;  5IP9 H;  5I2Y A;  3IKJ A;  2NN6 G;  1G91 A;  1JJ2 A;  1YNX A;  2CWA A;  5C4Z A;  4XIG S;  4UP7 A;  2B3G A;  4DPG A;  3KOJ A;  2L4N A;  2YTY A;  3I2Z A;  5I2X A;  4TSS A;  5KND A;  4QQB X;  4K6D A;  4GKK L;  5C4X B;  1S40 A;  1SRO A;  4YY3 Q;  3GTQ H;  1Q1E A;  2B2V C;  5J3B A;  2K05 A;  3E9H A;  4POF A;  2C9O A;  4GNX C;  2R7Z H;  1M1K C;  1SSO A;  4XQJ A;  5HY6 A;  3VR3 A;  5FLM G;  4IJH A;  1E2Z A;  3A56 A;  4DXF A;  3M4O B;  1KDA A;  4RMF A;  1SJH D;  1PZI D;  4X64 L;  2ATW A;  4OO1 H;  3HOU G;  1CHQ D;  2E76 C;  2UXD Q;  3KJP A;  3I56 A;  4LF5 L;  2B2U C;  1BR9 A;  1A63 A;  4EQN A;  1HUM A;  3T1Y Q;  1LV9 A;  1F77 A;  2ZM6 L;  2CQO A;  4P72 A;  2JJQ A;  3EIV A;  3ICE A;  1K0S A;  3HKZ G;  2WAQ B;  1NSN S;  1MHW C;  3A8J E;  1I50 H;  4DUZ Q;  2DJG C;  3CW2 C;  4QUF A;  2F3W A;  4DNR B;  1VQA A;  4R4Q A;  3D6W A;  1XNQ Q;  1B3A A;  5KYI A;  1JOR A;  1TWA B;  1UAP A;  1BBX C;  1NMG A;  4PMW A;  3MWY W;  2YU9 H;  2K28 A;  1G51 A;  1BNZ A;  1WTV A;  2WII B;  3ERS X;  3NBH B;  1V1O A;  1H9K A;  4DR3 Q;  3M3Y B;  3J7Z C;  3NTH A;  1HA6 A;  4CDD C;  3BU2 A;  2IHF A;  2LSS A;  3I4M H;  1ET6 A;  1S3O A;  4R8N A;  4DR7 Q;  1SND A;  4A3M H;  1HTP A;  1F2Z A;  3NHH A;  1I4P A;  4KJN A;  1YNJ C;  3MA2 B;  1YHA A;  2KBN A;  1GO3 E;  2PQE A;  3OSO A;  3S16 B;  3A74 A;  2E2H H;  4EX5 A;  3J81 i;  1CA6 A;  2OTL A;  2WAQ E;  2O5J C;  3A5U A;  2RCF A;  3CRK C;  1OXX K;  1PVO A;  4EQ5 A;  1K8G A;  3GQB A;  2UXC L;  4HAE A;  3B6Y A;  3S14 B;  4KD4 A;  1MSG A;  3GV6 A;  5C5M A;  5J22 A;  3E3X A;  1EUJ A;  1FR3 A;  4FXG C;  3AMU A;  2A5H A;  1F9R A;  3NQI A;  3BVG A;  4C3J G;  2Z4I A;  1NAP A;  3TSS A;  3K81 C;  1ENA A;  3J81 j;  3S24 A;  2A69 C;  5C3E G;  2D0O A;  4DV1 Q;  2F0S A;  1HR0 L;  2NN6 I;  4DAY B;  1IYU A;  1CK1 A;  2N8N A;  2OF1 A;  2IWH A;  3D31 A;  4XTC S;  5IYD G;  2FHT A;  1CQF A;  2M00 A;  5KEE A;  1R4P B;  4IO9 A;  1CSQ A;  1EU4 A;  4U67 3;  1PYS B;  1NJI C;  1PYW D;  2HCI A;  3NBI A;  3GO5 A;  2MFI A;  5CV5 A;  1KC8 C;  1AW7 A;  4IPH A;  1Q3L A;  1J5E Q;  3EVQ A;  2XVS A;  3I4M G;  1PRT C;  3CCU A;  5GQO A;  2EE1 A;  2Q2T A;  2K1B A;  2E5L Q;  4JI3 Q;  1I4X A;  1QJO A;  1MBY A;  3BZD B;  2Q2I A;  3A0J A;  5KGU A;  2UUA L;  3NEN A;  3CC4 A;  2BA1 A;  4R4T A;  3TEH B;  4K2K A;  5K36 H;  1H95 A;  4BY1 B;  1G8Z D;  5COY A;  3DLL A; 
#chains in the Genus database with same CATH homology
 3PO3 H;  1XPO A;  4JI7 Q;  1O7I A;  1GD7 A;  2WP8 J;  2YTV A;  1IBK L;  1HNX Q;  2UUC Q;  5BR8 L;  1MJE A;  1KIX A;  2QA4 A;  4POG A;  5LMU Q;  3S1R H;  2VUM G;  1EYG A;  3WWV A;  1PHJ A;  3S16 H;  1HNW L;  4DR5 L;  1WFQ A;  3KF8 B;  3I4N H;  2B63 H;  5IY0 A;  5DLQ E;  4C2M H;  2E2I H;  5LMN L;  1BBW A;  2Z0S A;  2NVQ H;  1U5K A;  4BY7 H;  4JOI C;  1NY4 A;  1VQ8 A;  3PO2 G;  2CWP A;  3CD6 A;  4JYA Q;  2D0P A;  4DV0 L;  1WCM G;  1AH9 A;  4P74 A;  2IX0 A;  1YJ9 A;  3M3Y H;  2PQA B;  1XPR A;  3PIP A;  2JA5 H;  1YI2 A;  1KXL A;  1RL2 A;  3FP9 A;  1KAW A;  3ULP A;  5FJ8 G;  2NZO A;  2VW9 A;  3RZD H;  1QZG A;  3M4Q A;  1MJC A;  2JA8 H;  4LF5 Q;  1D7Q A;  4JI2 Q;  2UXC Q;  3W1G A;  2ZJP A;  2VQE L;  3S17 H;  5IYD H;  2YTX A;  1K0R A;  5IYB H;  2QEX A;  4HJ9 A;  4JI2 L;  3TS2 A;  2YV5 A;  2JQO A;  1X9N A;  4DAM A;  3TRZ A;  1HZB A;  4DV3 Q;  4DUY L;  4LFB Q;  1IYJ B;  1BKB A;  3UDF A;  1YHQ A;  3W5O A;  4P75 A;  4B3R L;  1JJG A;  4DKA C;  2WB1 E;  4A3F H;  4GN4 B;  2JA6 G;  4X6A H;  5JJL A;  4AQY L;  4NB3 A;  3AFP A;  1N33 Q;  4LW1 A;  4R4O A;  3EBE A;  3HOY G;  4A76 A;  2K5N A;  2KCM A;  3UE1 A;  1EQQ A;  3VDY A;  2RHQ B;  1G29 1;  3ER0 A;  2I5L X;  5M3M H;  3IRB A;  3M9B A;  3JC6 6;  2K52 A;  3CAM A;  5LMN Q;  4DV1 L;  2UUB Q;  1VQK A;  1UEB A;  1RIP A;  3F1Z A;  3H0G G;  1SFO H;  3ZJY C;  1CSP A;  3F2D A;  3CCV A;  3KJO A;  2R7F A;  4GLX A;  1KQS A;  1YZ6 A;  2AHO B;  2HQL A;  4DK3 C;  2N49 A;  1WOC A;  4B3T Q;  1VQC A;  4DV2 Q;  4GKJ L;  3PF4 A;  2GVB A;  2ZTE A;  3CCL A;  3T1H Q;  3KFU A;  2C35 B;  2R7D A;  5JEA G;  4HIK A;  1XNR L;  2F4V Q;  2AMC B;  4KHP L;  3PO3 G;  3L7Z C;  4K0K L;  4OX9 L;  4B3T L;  1LM0 A;  1VQN A;  4A3I H;  1WJJ A;  1EQR A;  1EIY B;  3I4O A;  4DV5 Q;  4LF9 L;  1FGU A;  2ES2 A;  2K5H A;  2YYZ A;  1VQL A;  2UUC L;  2E5L L;  4OWT B;  3I4N G;  2UUB L;  4JI7 L;  1UWV A;  1W3S A;  2JA7 G;  3H3V H;  3EN2 A;  4ALP A;  4A3C H;  1XMQ Q;  5IWA Q;  4A3B G;  4LFC Q;  4A3E G;  2I5M X;  5M3F H;  3A5Z B;  2HIX A;  3GD7 A;  5AJ3 Q;  4GN5 A;  3K8A A;  1I94 L;  2UUA Q;  5JJI A;  1YVC A;  1PH6 A;  2XGT A;  1KHI A;  1C7Y A;  3M4O H;  1Q8K A;  1TXY A;  2Z6K A;  4J15 A;  4OXP A;  5IWA L;  3PGZ A;  4OWW B;  3OYY A;  4DUY Q;  1UE6 A;  4DV4 L;  1FVI A;  3GTL H;  5H1S E;  4X65 L;  4IOA A;  2ZTD A;  4LF9 Q;  1DGS A;  3W1B A;  2VNU D;  4HIM A;  1L2F A;  1QVG A;  3U4V A;  3UE0 A;  1YBY A;  5IYC H;  3NEM A;  2L15 A;  1PFS A;  4LFC L;  5IP7 H;  5M5Y H;  3CCS A;  4YWL A;  2K5V A;  5IYB G;  3CPW A;  1B8A A;  2PI2 A;  4DR3 L;  2VQF Q;  4LF8 L;  1EOV A;  1UE1 A;  1BBU A;  5JEA J;  4LF4 Q;  3UDX A;  1C9O A;  2Y0S E;  3PUV A;  2PNH A;  1KRS A;  1VQG A;  2AKW B;  4OX9 Q;  3K7A H;  3S1Q H;  4JBM A;  4P73 A;  5FLM H;  3JAM i;  4KI0 A;  5GRO A;  3J7A 5;  4IFD I;  1HR0 Q;  2E2J H;  2AWN A;  2IHE A;  1XNQ L;  5FLX c;  1SN8 A;  3G48 A;  1X65 A;  4QGU A;  4GS3 A;  4JV5 L;  1A62 A;  2Q2H A;  2NVY H;  4DR6 L;  4WJ3 M;  3UDI A;  4JI6 Q;  1WI5 A;  1TWA H;  3TRE A;  3K7U C;  5M5W H;  1I5F A;  1TWF H;  5LMU L;  3GTO H;  1IZ6 A;  4LF8 Q;  3FKI H;  4GNX A;  2VY3 A;  1HH2 P;  2BH8 A;  3STB D;  4UP9 A;  1OXS C;  3HOX H;  1JB7 A;  1V9P A;  4DR1 Q;  2CCZ A;  2KEN A;  1IL2 A;  4JI8 Q;  1UE5 A;  1J5E L;  4R1J A;  1VCI A;  4QJF A;  1X54 A;  1PH8 A;  4L5T A;  1PH5 A;  3PF5 A;  4DR4 Q;  1N32 L;  2DGY A;  3FHW A;  3ULJ A;  3KDF B;  3TS0 A;  1Y1V H;  1XJV A;  2CKZ B;  3PSI A;  1HZA A;  4DV3 L;  4L5S A;  3S2D H;  1SMX A;  4A3C G;  2CFM A;  2BA0 A;  1VQ4 A;  2DUD A;  1N32 Q;  3GTG H;  1JT8 A;  4LNQ A;  3Q8D A;  2NZH A;  5HGQ A;  3OW2 A;  4DV0 Q;  4ME3 A;  2KHI A;  5ELN A;  4QY7 A;  4GNX B;  1VQM A;  1XMQ L;  1HR0 W;  2ZJQ A;  4JBK A;  3U58 A;  5C44 G;  3RNU A;  2MO1 A;  4TVA B;  1CUK A;  4DV7 L;  4B3M Q;  3PCO B;  1X3F A;  2MQH A;  2OQK A;  1K73 C;  3H0G H;  3SGI A;  1GKH A;  4DR5 Q;  1E7Z A;  4IJL A;  1JE5 A;  3MEF A;  4JI6 L;  3GTK H;  3PO2 H;  4HIO A;  2EIF A;  3JAM c;  2A1A A;  1LTL A;  1L1O A;  4YWK A;  2AWO A;  4APV A;  1IBM L;  3T1H L;  1QUQ B;  2GVA A;  4A3K G;  1ASY A;  3OTO L;  2IX1 A;  5C4X G;  2ALY B;  2UXD L;  1YJN A;  1W2B A;  1KL9 A;  2WAQ G;  4Y7N H;  1YEZ A;  2N3S A;  4DR2 Q;  3K0X A;  2EXD A;  2VQF L;  4GN3 B;  1PH9 A;  2HHH L;  2JA6 H;  1WYD A;  1X55 A;  1X6O A;  4B3S Q;  4A75 A;  1HNZ L;  3HOV H;  4OWX B;  4YHH L;  2IT1 A;  1E1O A;  4JBW A;  3DM3 A;  3PV0 A;  4JOI A;  2XTI A;  1FJG L;  3KYH C;  4IPC A;  2K14 A;  1M90 C;  4BBR G;  1PH3 A;  2B29 A;  4AQY Q;  1YIJ A;  4A3G G;  2NVX H;  1L1O B;  1N34 Q;  1MIU A;  3K80 C;  4BY1 G;  2R7Z G;  1YHB A;  1B7Y B;  3PUZ A;  3L2P A;  1QUQ A;  1Q12 A;  3AYH B;  4HJ8 A;  2I0Q A;  2A8V A;  1AE3 A;  2WB1 G;  4QL5 A;  3S1N H;  4AIM A;  3HOU H;  3G71 A;  4TQU S;  2LXK A;  4LF6 L;  1Y1V G;  1HZC A;  1VQB A;  4YCW A;  4YY3 L;  1V43 A;  5AJ3 L;  4O0A A;  4AYB E;  1VQJ A;  1Y1W H;  1E3P A;  1OXU A;  3D0F A;  3CCQ A;  4JI8 L;  1VQ5 A;  1XTD A;  4KHP Q;  3RN5 A;  4R4I A;  1HNZ Q;  1X56 A;  1IBL Q;  2JEA I;  1PH4 A;  4BXX H;  5IT9 c;  3HFZ B;  1FL0 A;  2UU9 L;  1K9M C;  1I3Q H;  4DV2 L;  4GKJ Q;  3CXC A;  4A3G H;  1N36 Q;  4H02 A;  4QIW E;  5EAY A;  1IXR A;  5IP9 G;  1PH7 A;  2ID0 A;  4IOC A;  3GTP H;  1SLJ A;  1K3R A;  3GTJ H;  1EFW A;  2UU9 Q;  3RLO A;  1VQD A;  3CPF A;  1GM5 A;  3L0O A;  2ASB A;  1E22 A;  1Q1B A;  4HJ7 A;  2R93 H;  3KLW A;  4OO1 I;  5M5X H;  5C44 H;  4GLV B;  1VQH A;  1Q86 C;  3CF5 A;  2JA7 H;  4LUZ A;  4DV6 Q;  3E0E A;  4A3E H;  3S1M H;  4A93 G;  1N9W A;  5C4X H;  4DV4 Q;  2RCN A;  1HNX L;  1VQO A;  4JI4 L;  2VUM H;  1PA6 A;  3KF6 B;  2LXJ A;  3I7F A;  5LMN W;  1UE7 A;  2K75 A;  2R92 G;  3UDG A;  1Q7Y C;  3HKS A;  4DR4 L;  1V1Q A;  4JI1 L;  2OQ0 A;  4LF6 Q;  4BBS H;  4UP8 A;  1CKM A;  4C3I H;  5IP7 G;  3F2B A;  1NE3 A;  4NXN Q;  1B70 B;  2RHS B;  3HKZ E;  1HZ9 A;  2E8G A;  4X65 Q;  1FJG Q;  3CME A;  2D62 A;  1K8A C;  4PZ7 A;  1A0I A;  4IPG A;  3G6E A;  1X3G A;  3M7N A;  1ASZ A;  4PZ8 A;  1TWG H;  3NEL A;  2OCE A;  1VQ9 A;  2JK8 A;  4MZ9 A;  1JJC B;  4NXN L;  4JI1 Q;  5GAG C;  1XNR Q;  4DR7 L;  1SE8 A;  2Z6K C;  3RN2 A;  3S14 H;  4DR6 Q;  4LUO A;  2KCT A;  4X62 L;  3OTO Q;  1G6P A;  4KLK A;  3RR5 A;  4YHH Q;  4RG1 A;  1T9H A;  3RLN A;  4WJ4 A;  1VQE A;  2MNA A;  3RZO H;  3PUX A;  5ELO A;  3CC2 A;  2A19 A;  5C0X I;  4DR2 L;  3ULL A;  2KHJ A;  2N78 A;  1VQP A;  1S72 A;  4A3D H;  4A3L G;  2MO0 A;  3J80 c;  3FKI G;  1R9T H;  1VQI A;  2OTJ A;  5BR8 Q;  4A3J G;  4JV5 Q;  2BH2 A;  3J80 i;  3KDF A;  2F4V L;  1PH2 A;  3I55 A;  4LF7 L;  4R4C A;  4YCV A;  4C3H H;  3S15 H;  2F52 A;  3HOY H;  4PZ6 A;  5IP9 H;  2NN6 G;  2VZA A;  1Z9F A;  4JI5 L;  1YNX A;  2CWA A;  1JJ2 A;  4XIG S;  3STB C;  3AFQ A;  4UP7 A;  2B3G A;  4DPG A;  3KOJ A;  1IBK Q;  1QVF A;  2H5X A;  2YTY A;  5C4J H;  3I2Z A;  1NBW A;  4LFB L;  1U0L A;  5GAD C;  3CCJ A;  4QQB X;  3F8T A;  1PH1 A;  3CCR A;  3CCM A;  4LFA L;  1S40 A;  4GKK L;  1SRO A;  4YY3 Q;  3GTQ H;  1Q1E A;  1Y14 B;  5J3B A;  2FXQ A;  5FJ8 H;  4X64 Q;  4GLA C;  3E9H A;  4POF A;  4L5R C;  4GNX C;  4BY1 H;  2Q2U A;  4LFA Q;  1D8L A;  3RLF A;  4BBR H;  2R7Z H;  4GKK Q;  4MNO A;  1VS0 A;  5GAH C;  1M1K C;  2JA5 G;  3HOW G;  5HY6 A;  5FLM G;  4IJH A;  1J6Q A;  4P71 A;  4KHZ A;  4C3J H;  4BA2 I;  4RMF A;  4GOP B;  4DV6 L;  1QZH A;  1P16 A;  1AE2 A;  4X64 L;  4L5Q A;  2ATW A;  1OXV A;  5K36 G;  3HOU G;  5JJK A;  2VQE Q;  2WFW A;  3GDE A;  2UXD Q;  1VQ6 A;  3KJP A;  1SRU A;  4HJ5 A;  4FDB A;  3I56 A;  1XMO L;  4LF5 L;  2NVT H;  1X3E A;  1A63 A;  5GAE C;  1BVS A;  3M85 A;  4OON A;  3T1Y Q;  4A3K H;  4LWC A;  2ZM6 L;  1HJP A;  2CQO A;  4P72 A;  2JJQ A;  3EIV A;  1VQ7 A;  2ZJR A;  3ICE A;  3HKZ G;  2B63 G;  2I5H A;  4K0K Q;  3BJU A;  1N36 L;  1A8V A;  1I50 H;  2R6G A;  4DUZ Q;  1CKN B;  4JI5 Q;  4UY8 C;  4X66 L;  4LF4 L;  2V1C C;  1KRT A;  3CW2 C;  4BY7 G;  1IBM Q;  2OWO A;  3T1Y L;  1VQA A;  4JI0 L;  4R4Q A;  4IFD J;  1QVC A;  4LF7 Q;  2ZTC A;  1XNQ Q;  1Q46 A;  4X66 Q;  3PUW A;  3H3V I;  5C0X G;  4DUZ L;  1NMG A;  5E7N A;  4GOP A;  4HJA A;  4PMW A;  1YJW A;  4A93 H;  2YU9 H;  2PMZ E;  1G51 A;  1WCM H;  1E1T A;  3ERS X;  3NBH B;  2ZM6 Q;  1NTG A;  4DR3 Q;  3U50 C;  3E9I A;  2EQS A;  3J7Z C;  1N8R C;  1JMC A;  4NXM L;  2R92 H;  1P8L A;  4A3I G;  4LUV A;  1Q82 C;  3U4Z A;  4GOP C;  3BU2 A;  2IHF A;  4X62 Q;  2LSS A;  3I4M H;  1S3O A;  4BBS G;  1VQF A;  4DR7 Q;  4A3M H;  3HOZ G;  1CKN A;  1K83 H;  1YHA A;  2QGQ A;  3CMA A;  2UXB L;  4DR1 L;  4YWM A;  2KBN A;  1GO3 E;  4B3S L;  4BXX G;  2HHH Q;  2JE6 I;  1OTC A;  4AH6 A;  3A74 A;  2E2H H;  4EX5 A;  5C3E H;  3J81 i;  4HID A;  2OTL A;  2WAQ E;  3CCE A;  4A3F G;  2HT1 A;  5M3F G;  3A5U A;  3BZK A;  4AYB G;  1OXX K;  1Z47 A;  1PV4 A;  1PVO A;  4EQ5 A;  5M3M G;  1K8G A;  2UXC L;  3AEV A;  3B6Y A;  1KD1 C;  3GTM H;  4IFD G;  4MTN A;  1NMF A;  4O2D A;  1YIT A;  2K50 A;  2JA9 A;  4NXM Q;  1L0W A;  3KF6 A;  4JCV E;  1EUJ A;  3CP0 A;  4OO1 G;  4IPD A;  2Y0S G;  3CQZ H;  3S2H H;  1XPU A;  3F2C A;  4DV5 L;  1LYL A;  1TWH H;  3HOV G;  2R93 G;  1PYB A;  1GVP A;  3K81 C;  4JC0 A;  4NPS A;  4A3D G;  3J81 j;  2GN5 A;  3S24 A;  4DV7 Q;  4B3M L;  5C3E G;  4JYA L;  5IYC G;  4JI0 Q;  2D0O A;  4DV1 Q;  4A3J H;  1SR3 A;  2VL6 A;  1E24 A;  2K4K A;  1LUZ A;  2NN6 I;  4BA1 I;  4DAY B;  1OXT A;  1XMO Q;  1HR0 L;  5IYD G;  2N8N A;  3J81 c;  2PI2 E;  3BZC A;  3D31 A;  4XTC S;  1HNW Q;  2JEB I;  2JA8 G;  1N33 L;  4YCU A;  4Y52 H;  4IO9 A;  1CSQ A;  4JBJ A;  3LGJ A;  3PUY A;  1PYS B;  1NJI C;  4A4I A;  1MKH A;  2VS1 A;  4A3B H;  1CKO A;  3GO5 A;  1IBL L;  2HIV A;  1Y1W G;  1N34 L;  2UXB Q;  1EIF A;  2MFI A;  3AQQ A;  5IE8 A;  1Q81 C;  1TWC H;  3MXN B;  1KC8 C;  3G4S A;  4IPH A;  4UPA A;  1I94 Q;  1C0A A;  3H15 A;  1J5E Q;  4PG3 A;  2F3I A;  4JI3 L;  1L1O C;  3PIO A;  3I4M G;  4B3R Q;  3CCU A;  5GQO A;  1I6H H;  3TQY A;  4DNI A;  2Q2T A;  4A3M G;  2E5L Q;  5C0X J;  3HOW H;  4DK6 C;  4JI3 Q;  3HOX G;  4A3L H;  3M4P A;  2RF4 A;  2IY5 B;  2Q2I A;  3A0J A;  2UUA L;  3NEN A;  2PQA A;  3CC4 A;  2BA1 A;  1EWI A;  4R4T A;  3TEH B;  3HOZ H;  4JG2 A;  1H95 A;  3CC7 A;  4JI4 Q;  3DLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...