4X6AH

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x6aH00
1EOVA 4NXNQ 4GKJQ 1XJVA 1QZHA 1KL9A 3I2ZA 3M9BA 4C3JH 2JEBI 4LFCL 1L0WA 4DV7L 1EFWA 3PO2H 4GNXA 2UU9Q 4DR2Q 1A62A 3BU2A 4BY7G 1Q1EA 4OWTB 3IRBA 4A3GG 4A3KH 1PV4A 5M3MG 1QUQA 1K8GA 3HOWG 5GADC 4LFBL 2RF4A 3EN2A 5DLQE 1XTDA 5C0XJ 3PO3G 1WOCA 4MZ9A 1UE1A 4AH6A 3STBC 3PV0A 4POGA 4WJ4A 2A19A 2DUDA 4FDBA 1N36L 1HH2P 2ZTEA 3GTMH 4GKKL 2LSSA 2Z6KC 4JI0Q 3PF5A 2PQAB 1YHQA 3GTGH 4X66L 2MO0A 4H02A 4L5RC 1E1OA 3G4SA 3F2DA 1VQ8A 3PUYA 3FHWA 4YWLA 3A5UA 1XNRQ 4LUZA 4LFBQ 2AWNA 5C44G 1SFOH 1Q82C 1HNXQ 3CC4A 3PUVA 1XMOL 1VQ5A 3T1HQ 4YY3Q 1XMQQ 3GD7A 4B3SL 4A3CH 1QVFA 2VNUD 1A8VA 1Q86C 3HOVG 4DR3L 4A93G 3PSIA 4LUOA 2N8NA 2R7ZH 1XNQQ 4LW1A 1CKOA 1FJGQ 1N36Q 4JI6L 1JJGA 2FXQA 1OXUA 1VQ7A 4DUYL 1PA6A 4DAYB 1QZGA 1GD7A 2UXBL 1V43A 3UDIA 4DV4L 4LFAL 1WCMG 4X62Q 3KF8B 1KC8C 1HJPA 1IBKQ 4LF4L 3CD6A 3I4MG 4QQBX 1K3RA 3T1YQ 2YTYA 3RLNA 1XMQL 2BA0A 4BY7H 2JK8A 1X3FA 1YVCA 4HJ8A 4IFDI 1V9PA 1PYBA 1WFQA 4IJHA 4JI8Q 3HOVH 2LXKA 1EWIA 2E8GA 5IWAQ 3VDYA 3HOWH 3PO3H 4GOPC 3KDFA 3H0GG 4J15A 3EIVA 3NEMA 1G6PA 2NVXH 2OQKA 3CCRA 2MO1A 4JBJA 4DKAC 1T9HA 4C3HH 1E22A 1RIPA 1X3EA 4JCVE 1I94Q 1KRTA 3TRZA 5LMNW 4A4IA 4HJAA 1S3OA 4DR6Q 2E5LQ 5BR8Q 4A3KG 4MTNA 2AMCB 1IBKL 2D0OA 4LF4Q 4JOIA 2VS1A 4BA1I 3PIOA 2D0PA 2ZM6L 4A3IH 3CXCA 1HR0L 2JA5H 3ICEA 2QGQA 4Y52H 5C3EH 4ALPA 1X3GA 1BKBA 4JBKA 3EBEA 1MIUA 4KI0A 4A3FH 4A3LG 1B8AA 1TWFH 1O7IA 3PUZA 2VW9A 1G51A 3HOXH 1YJNA 1HNZQ 5M5WH 2K5NA 4IPHA 2R7FA 4DV0L 4JC0A 3D31A 4R1JA 4DV1L 5M5XH 3J81c 1J5EQ 4BBSH 2OTJA 2Y0SG 3OTOL 5HGQA 1X9NA 1WCMH 2E2IH 3A74A 3GTPH 1I5FA 4TVAB 1JJ2A 5LMNL 2WFWA 2YV5A 1M1KC 3S17H 3E0EA 4JI1L 3UE0A 1C7YA 2VUMG 4A93H 5C4XH 5FJ8G 4HIOA 5M5YH 2UXDL 3S2DH 3F1ZA 2CQOA 1N34L 4DR7L 4BBRG 4X66Q 2Q2HA 4RG1A 3AFQA 5JJLA 4DV3L 4JBMA 1VS0A 3A5ZB 3GTLH 1J6QA 1DGSA 4B3ML 3RLOA 3G48A 3K81C 3F2CA 1SRUA 4QJFA 3I4OA 4HJ9A 4IPGA 3S1MH 3RN5A 2UXDQ 3UE1A 2UUCL 2GVBA 2IX0A 1W2BA 5C0XI 3K8AA 1KQSA 2A1AA 3PCOB 4A3IG 1FJGL 2JA6G 2JA8H 1KHIA 2JEAI 5C3EG 4NXNL 4P74A 1Q81C 1GKHA 2Y0SE 3MEFA 4A3FG 1N34Q 3ERSX 4AQYQ 1PVOA 2EQSA 1N32L 2KENA 2R93H 3RZDH 1TWCH 2HIXA 3OYYA 5IYDG 3W1GA 2PMZE 1TWAH 3CPWA 1RL2A 1FL0A 2NVQH 1VQ6A 2LXJA 4APVA 2NN6G 3A0JA 3UDFA 5GAGC 2VQFQ 4BBSG 5IWAL 1PH9A 4QGUA 1VQGA 3CW2C 3KF6A 4PZ8A 3S2HH 4A3LH 4YHHL 2JA6H 2WB1E 2JA8G 5K36G 2VL6A 3PUWA 4GN3B 4AQYL 1D7QA 1VQAA 5C0XG 3HKZE 1PH8A 2ID0A 5IYCH 1VQBA 3MXNB 5IYDH 2E5LL 3E9HA 1HNWL 3UDXA 3G6EA 2XGTA 5IYBH 4UP7A 2B63H 4YY3L 3J80i 4A3DG 1BBUA 2UUBL 1PH2A 4P75A 4C2MH 2KCTA 4OWXB 4UPAA 1Y1VH 5IP7G 3K0XA 4X64L 1TWGH 5FJ8H 2VQFL 4A76A 2F4VQ 4DV5L 3S1QH 4DR2L 5C4XG 1PFSA 4UY8C 1G291 3M4PA 2N49A 2E2HH 3CCQA 4BBRH 3PGZA 3RNUA 4DV2L 2CFMA 3T1YL 3I56A 4HJ7A 3RN2A 4LF9Q 1Q12A 2I5MX 1NJIC 1R9TH 4HIMA 2HIVA 3CC7A 4WJ3M 3CAMA 2KHJA 2Q2UA 4JI3L 2KHIA 1NMGA 3W1BA 2PNHA 4DNIA 1SLJA 5IYBG 4BXXG 1FGUA 3HOZH 4LF5Q 4IPCA 2QA4A 4GN4B 2IY5B 1GO3E 2NVTH 5IP7H 1Y1VG 1AH9A 1NBWA 4DUZQ 2UUBQ 4LF7L 4LF6L 1NMFA 1OXSC 1VQ9A 5GROA 4X64Q 4HJ5A 1JMCA 1C0AA 2Q2IA 1IYJB 4A3EH 1JJCB 1CKNA 2NVYH 4DV6Q 3CCVA 5M3FG 5JEAG 2ZM6Q 1UE7A 1AE2A 3WWVA 3CCMA 4DR5Q 3U58A 1IZ6A 1U5KA 1NY4A 3I55A 2K50A 4LF9L 2R93G 3AYHB 4DR3Q 3GTQH 4BXXH 4JI3Q 2IHFA 2VZAA 3M3YH 1SN8A 1EIFA 1X54A 3HFZB 5IYCG 1MJEA 5H1SE 4A3JH 3M4OH 1LTLA 4GKKQ 4LF7Q 4GLVB 1WJJA 2JA9A 3RLFA 5IP9G 3GTJH 2HQLA 1X55A 4OX9L 4YWMA 3RZOH 3J81j 2JA5G 2IX1A 2YU9H 5JJKA 4EX5A 4A3DH 3HKZG 1OXXK 1U0LA 5E7NA 4A3EG 2Z6KA 1X6OA 2AHOB 2VQEQ 5M3FH 3TS2A 1Z47A 4YCUA 4DK6C 2A8VA 1B7YB 4JOIC 1C9OA 4B3TL 1D8LA 2EIFA 2H5XA 5C4JH 3CMAA 1LUZA 3ER0A 1LYLA 1YITA 4JI1Q 1GVPA 2CWPA 1LM0A 4B3SQ 2KCMA 1NE3A 3HOYH 1N33Q 4DR1L 1L2FA 4LFCQ 4A3MG 4HIKA 1HZAA 4GOPA 1KIXA 4DPGA 4LWCA 2PI2A 2R7DA 1ASYA 1YI2A 4IPDA 4OX9Q 1ASZA 4DV7Q 4LFAQ 3J81i 3TS0A 1VQKA 2NZHA 3JAMc 1HZBA 1NTGA 2K5VA 2WB1G 1UE6A 2UXCQ 3S1NH 5GAEC 3RR5A 3CCLA 4KHPQ 4B3TQ 2ZJRA 1VCIA 1YHBA 1VQJA 4O2DA 4R4OA 4B3RQ 4GNXC 3CC2A 3HOYG 1IXRA 3HOZG 1EIYB 3J80c 2VY3A 4A3MH 1UEBA 3GDEA 4A75A 1CSPA 2UUAQ 4OONA 3STBD 1VQLA 4NPSA 1S40A 1JE5A 4BY1H 4P71A 5AJ3Q 4X65L 4JG2A 5IP9H 3PIPA 3M85A 4IOAA 3ZJYC 1Q8KA 2WAQE 4KHPL 1Y14B 4P73A 3I7FA 1PH4A 1PH1A 4UP9A 1MJCA 4JI7Q 1EQRA 1Q7YC 3NBHB 1HNXL 2I5HA 2PQAA 2MNAA 2GN5A 1IBMQ 2WP8J 3F8TA 3K80C 1EUJA 1FVIA 4QY7A 4GLXA 3BZKA 1Y1WH 5JJIA 2ZJQA 1PHJA 2OQ0A 4YWKA 1UWVA 2AWOA 3NENA 4NB3A 4PG3A 4L5SA 1SR3A 1K9MC 3ULLA 4X6AH 1L1OB 2OTLA 5AJ3L 1S72A 5GQOA 2Q2TA 4BY1G 4OO1G 1CSQA 3Q8DA 3HKSA 2L15A 4ME3A 2ZTCA 5FLXc 1PH5A 4JI7L 4JI8L 1JT8A 3FKIG 1BVSA 2DGYA 4POFA 2F52A 2QEXA 2ES2A 2YYZA 1JB7A 3AEVA 4YCWA 4IOCA 1HZ9A 1MKHA 2YTXA 2OCEA 4DV5Q 2R92G 1Z9FA 4IO9A 4YCVA 1EYGA 1A63A 2JA7H 3L0OA 4GLAC 1YNXA 3FP9A 3NELA 4XTCS 1XPOA 1GM5A 3TREA 2V1CC 1QVCA 2UU9L 1XNRL 2C35B 2B63G 2ASBA 1N32Q 4JI2Q 2F3IA 3ULJA 3G71A 2VQEL 4KLKA 4JYAL 1VQFA 3GO5A 3OW2A 1K83H 3M4QA 3FKIH 2K52A 2B29A 5LMUL 2NZOA 3L7ZC 4OWWB 5HY6A 4JI6Q 1HNZL 4LF6Q 4LNQA 2R92H 4YHHQ 4DR1Q 1I6HH 4DUYQ 1I3QH 2JA7G 1W3SA 3JC66 4JI5Q 3HOUG 4PZ6A 3CP0A 2YTVA 4JI2L 2K14A 4DV1Q 1OTCA 3KYHC 2Z0SA 1CKNB 4DV0Q 2K4KA 2XTIA 1E1TA 1A0IA 4JI4Q 4JYAQ 4DR5L 2HHHQ 1PYSB 2K75A 2JE6I 2KBNA 1H95A 4A3GH 1K73C 5LMNQ 4LF8Q 2E2JH 1WYDA 3F2BA 1K0RA 1YJWA 4AYBG 2UUAL 4L5TA 4O0AA 2AKWB 1KD1C 4DV2Q 2OWOA 4GN5A 2EXDA 4JI5L 4DV4Q 3CMEA 4B3MQ 4A3JG 3S16H 3SGIA 3PUXA 1N9WA 4UP8A 2MFIA 4Y7NH 1YJ9A 4K0KL 3KJOA 3L2PA 1YHAA 4JI4L 3KFUA 1EQQA 3AQQA 4JV5L 2RHQB 1AE3A 4IJLA 1XPRA 1M90C 1YZ6A 1N33L 4QIWE 1VQPA 4LF8L 5GAHC 2JQOA 2PI2E 3CPFA 3CQZH 4P72A 5FLMG 4DV6L 2BA1A 2R6GA 3KLWA 3S14H 1J5EL 3ULPA 2UXCL 3T1HL 1OXTA 3HOUH 2ALYB 4K0KQ 1HR0W 5BR8L 1KXLA 2RHSB 3KF6B 1VQEA 4PZ7A 1L1OA 1E3PA 4AYBE 1XNQL 4OXPA 3U50C 4AIMA 4GKJL 2ZJPA 4DAMA 3I4NH 1IBLL 3LGJA 4DR7Q 2N78A 4OO1I 4R4IA 2N3SA 4X62L 3H3VI 3CCJA 4IFDJ 3U4ZA 5IE8A 4R4CA 2UXBQ 1KAWA 3W5OA 3JAMi 3CCEA 2CKZB 1VQNA 3UDGA 3H0GH 3BJUA 1PH6A 2HT1A 3OTOQ 3D0FA 1WI5A 4QL5A 1QVGA 1Q46A 1VQIA 4DK3C 1IBML 2BH2A 3GTKH 4TQUS 4RMFA 4A3BG 2K5HA 2I0QA 3CF5A 5LMUQ 1IBLQ 3J7A5 1CKMA 4MNOA 3J7ZC 1OXVA 1KRSA 1VQMA 2ATWA 3AFPA 1I94L 4NXMQ 2CCZA 3S15H 1CUKA 3BZCA 4PMWA 3H15A 2F4VL 1TWHH 1VQCA 3K7UC 4KHZA 1Y1WG 1TXYA 4C3IH 1XMOQ 1P8LA 4HIDA 1HR0Q 1XPUA 1V1QA 1B70B 3HOXG 1HZCA 4R4TA 4GS3A 2MQHA 5FLMH 1PH3A 4B3RL 5IY0A 1N8RC 2RCNA 4GOPB 4DUZL 4LF5L 5IT9c 2GVAA 1IL2A 1E7ZA 1QUQB 4L5QA 5M3MH 1YIJA 1PH7A 4NXML 3CCUA 3B6YA 3KJPA 1SROA 5C44H 5ELOA 4GNXB 2WAQG 2VUMH 1E24A 3M7NA 3S1RH 1UE5A 3I4NG 3K7AH 4XIGS 4IFDG 3S24A 1P16A 1HNWQ 1SMXA 3TEHB 2JJQA 4R4QA 5ELNA 5J3BA 1YBYA 3E9IA 1I50H 2R7ZG 2BH8A 1K8AC 2IHEA 4DR4Q 4LUVA 4JV5Q 5EAYA 3U4VA 2IT1A 1Q1BA 4BA2I 3PO2G 1YEZA 2CWAA 4A3BH 4DV3Q 2I5LX 1VQOA 1VQDA 2D62A 3I4MH 4A3CG 4DR6L 4EQ5A 4X65Q 2NN6I 1X65A 2ZTDA 3KOJA 1X56A 4JBWA 1L1OC 1BBWA 2B3GA 3DM3A 1SE8A 1VQHA 5JEAJ 2UUCQ 3KDFB 4JI0L 1VQ4A 3GTOH 4DR4L 2HHHL 3H3VH 3CCSA 3PF4A 3TQYA 3DLLA
chains in the Genus database with same CATH superfamily
2JN4A 1Y1VB 4C3JH 3SK5A 2UU9Q 2A6HD 4OWTB 4A3GG 4A3KH 2FHTA 3I8ZA 3KLRA 5GADC 4LFBL 1GHKA 5C0XJ 1I4GA 4QUCA 4MZ9A 1JOKA 1S4ZA 3PV0A 4KD4A 3S17B 2RDHA 1PLFA 4CGYB 1HH2P 4A3MB 4ZK9B 2TMPA 4JI0Q 1DONA 2PQAB 1YHQA 4GZYC 4CJ0B 4X66L 5IIFA 4ZQ3A 3R2IA 1XNRQ 1STHA 4LUZA 3T56B 1Q82C 1ML0D 4XDXA 1LV9A 1JQYD 2Q8RE 1XMOL 2KJXA 4YY3Q 3HOVG 4DR3L 1KLUD 3WOEA 1XNQQ 3JAML 3PIP3 2JA8B 1CHPD 4X3KA 3BVMA 2B2YC 1V43A 1SYGA 3KF8B 4MIUA 1HJPA 4HCSA 4QQBX 2XSCA 5M3FB 3RLNA 2B2UA 1TS5A 2JK8A 4HJ8A 1PYBA 1U4RA 2F0VA 5IWAQ 3HOWH 1LTTD 3R8BA 2JA6B 3H0GG 3EIVA 3NEMA 1K0SA 4ABNA 2MO1A 4H0LC 4JBJA 4DKAC 4JCVE 1X3EA 2AQ3B 3SR1A 2KEDA 3TRZA 4A4IA 4UHVA 3W2DA 5IGCA 2K01A 4FVMA 4A3KG 2AMCB 2D0OA 4JOIA 2VS1A 2NBFA 4A3IH 2HCCA 2EJFC 4Y52H 5C3EH 1X3GA 2K04A 4A3LG 1B8AA 5DAUA 4ZKBB 1O7IA 4A3DB 3PUZA 2VW9A 1HNZQ 5ELCA 3NWTA 4DV0L 3CU7A 1GXDC 4R1JA 3N52A 4DU9A 4DV1L 2B2WC 1KDBA 3I70A 3J81c 1J5EQ 2OTJA 2PZWA 3A54A 1X9NA 1WCMH 3T53B 2KQ3A 2YV5A 5C5MA 5KRUA 1C4QA 3JAME 4HIOA 2JA7B 4KY7A 2LMCB 2F0NA 2V4DA 2E2JB 4KY6A 4G4KA 3TSSA 5L37A 1MGSA 5CGKA 1VS0A 2E74C 2EZVA 4PMCA 5I2YA 2KCCA 3H6MA 3G48A 4IPGA 1GUTA 2P5ZX 5C0XI 4IURA 2OF1A 2JA6G 2AUJD 5TSSA 4NXNL 4P74A 2K6AA 3WOFA 1RTOA 3S14B 3OSOA 1GUWA 2PMZE 4KN7C 4X3SA 4AYBB 3A0JA 1EIGA 4FF4A 1HUNA 1HHVA 4BBSG 4KTAA 4X3TA 1TS3A 3MHBA 4PZ8A 4A3LH 2JA8G 2WB1E 1TWGB 1SFOB 2F0QA 1B50A 1PH8A 3NSWA 4RHRA 2BE5D 3O13A 1VQBA 2E5LL 5I6WA 3E9HA 1JWSD 4UP7A 5I4DA 1EQVA 1RHPA 1A3TA 2R7ZB 1TWAB 3KBGA 1BBUA 4ODGA 3BYTB 3GTKB 4NDXA 1Q3LA 5IP7G 4UPAA 2F03A 3K0XA 1TWGH 1NCVA 2NZ1D 2N49A 4MHEA 3PGZA 2CFMA 3T1YL 2FINB 2I5MX 1NJIC 1R9TH 2HD3A 3CC7A 2KHJA 3M3YB 2KHIA 3W1BA 3NQIA 2PNHA 3M4OB 4BXXG 4RH6A 4IPCA 1JICA 4GN4B 2NVTH 1Y8PB 1Y1VG 2K28A 2EYMA 1OXSC 1A3VA 1VQ9A 2NN6H 5GROA 4HJ5A 3SK6A 1C0AA 3RZOB 2NVXB 1MD2D 3T51B 4FXDA 1LTAD 1EZ6A 1WVLA 1JE4A 1IZ6A 2A6HC 1NY4A 2K50A 2DJFC 3A55A 5IYCG 1MJEA 1B9MA 5BN4A 2CW0C 3BVGA 4N9TA 4RKLA 1WJJA 2JA9A 5JJKA 3J81j 3TDQA 4A3DH 1PTOC 3HKZG 1TWHB 5E7NA 5M9OA 3TS2A 4DK6C 2A8VA 4B3TL 2R93B 2H5XA 4K6LA 5C4JH 1LUZA 2DNCA 1II3A 3D4WA 3FPPA 1L2FA 4U68A 4LFCQ 1FYCA 1EFID 4DPGA 4ZYSA 1TS4A 4DV7Q 3J81i 2O5IC 3JAMc 1NTGA 1EEID 5EBCA 4A3IB 4K2KA 1EU4A 3CCLA 4KHPQ 2ZJRA 1PRTF 4O2DA 4R4OA 4GNXC 3HOYG 4DGZA 4B9XA 1IXRA 3AB9A 3H91A 2NWGA 4G7HC 4OGQC 2UUAQ 2LKVA 3HRZC 1G91A 4FXGC 4JG2A 4XYQA 4KHPL 4P73A 3I7FA 4RCNA 4UP9A 2RSNA 2JA5B 5EJWA 2MNAA 2F0HA 2GN5A 2WP8J 3K80C 3DWAA 4GLXA 1IBMQ 3S2HB 4K5VA 1PHJA 1SDFA 4NB3A 2SNMA 1EY6A 3VR5A 1CI3M 4K14A 1B4OA 2Q2TA 1SE3A 1RD9D 4ME3A 1LTBD 1TU2B 1VF7A 1JT8A 4KKSA 2QEXA 3BG3A 1JB7A 4YCWA 1B2TA 3MXPA 2OCEA 2CVRA 3IL8A 1Z9FA 4PNYA 4YCVA 3J7YW 4IO9A 2R92G 3M4YA 3FP9A 4XTCS 1XPOA 3C2PA 4NP5A 2C35B 1N32Q 2QCPX 1VQFA 4QIWB 3OW2A 1KDAA 1FGBD 2NZOA 1ZKOA 4HR7B 3S1MB 3MVVA 4LNQA 1V8QA 4HMJA 5FO8B 3HOUG 3OMGA 2YTVA 3PQIA 2L12A 1OTCA 1A2UA 4DK0A 1UUPA 1CKNB 2LFNA 1BOSA 5BN3A 1A0IA 1PZJD 2CHBD 3VR4A 2F0JA 4FXKC 4JYAQ 2SDFA 4WORA 2HHHQ 1PYSB 3D8GA 2JE6I 2KBNA 3LX0A 1U4PA 2Z9HA 3P7JA 1K8MA 5IOCA 5LMNQ 1WYDA 2RKSA 1K0RA 2OXPA 3HGBA 3KF8A 2A6EC 5EPJA 4DV2Q 2B8GA 4JI5L 1PRTB 3CMEA 1DM0B 5FO7B 4A3JG 3S16H 4QMGA 1TT2A 1VMCA 1IL8A 4JV5L 3OIQA 4HMIA 1M90C 5A2QE 2WINB 3CQZH 4DV6L 3H0GB 1STNA 1UEAB 3T1HL 1IKMA 2DNEA 5A35A 1X3PA 1ESFA 2C9OA 3NUCA 4CDFC 1EL0A 3U50C 1TY0A 4KK7A 4GKJL 2ZJPA 4DAMA 4DXGA 3LGJA 4DR7Q 2N78A 1PFMA 4OIKA 2F0FA 3JAMi 1ENCA 3CCEA 1VQNA 2HQEA 1K28A 3A8JE 1WTRA 3AMUA 3HOVB 1FNUA 2EYFA 4QL5A 3X3NA 3HOUB 1SYFA 4TQUS 1HCZA 3CKIB 3CF5A 1ZYRC 2B2UC 1SE2A 1NR4A 2ATWA 3S15H 1I4PA 2CCZA 1BCPF 3I4NB 5DM73 3H15A 1TWCB 1TXYA 1F2MA 1F9PA 4C3IH 2EY5A 2KCNA 2NVQB 1XPUA 1PTOB 1CTMA 1JC7A 5FLMH 2MQHA 4XYOA 4B3RL 2NVTB 1KNAA 3NXWA 2RCNA 4HSVA 3ND8A 1D5ZC 3QR8A 1IL2A 4A3GB 1E7ZA 1HTPA 4K5WA 3MA2B 2PZTA 1PZID 1EU3A 3KJPA 3D4RA 2WV6D 2WAQG 3M7NA 3I4MB 1O78A 3M7GA 2E2IB 3SE0A 2JJQA 1FNWA 5IGBA 3E9IA 2R7ZG 1KAAA 1JB3A 1B53A 2IT1A 3FVQA 1YEZA 2CWAA 2ZXOA 4DV3Q 4ZUIA 3U9OA 1VQDA 2D62A 3EQLC 4X65Q 3SVMA 1S5ED 5FLXE 2ZTDA 2IPKD 4KHVA 4OELB 2WAQB 2HHHL 3H3VH 2BCOA 1LACA 3HOYB 1STBA 1TVXA 1XJVA 1QZHA 2NUCA 4GKJQ 3I2ZA 2F0PA 1L0WA 2PYKA 1IW7C 1DCZA 4BWGB 5KNDA 1K8GA 3HOWG 2K5QA 1WOCA 1UE1A 4AH6A 3GTPB 5K36H 1Y69U 4WJ4A 2DUDA 5F2DA 1N36L 3GTMH 4GKKL 4PMBA 4NW2A 1E2VA 1E1OA 3G4SA 1VQ8A 3PUYA 3FHWA 2B2WA 3CQZB 2F0EA 1SFOH 4HEDA 4DAVA 1HNXQ 3R2TA 2NTTA 1PTOF 4A3CH 4B3SL 1Q86C 3ZYYX 1WTQA 3V05A 4L8JA 2R7ZH 1TQOA 1FJGQ 3RUZA 2H4OA 1N36Q 2FXQA 1BUVT 1VQ7A 4IALA 3VYSA 4DUYL 1QZGA 1EY7A 2KHSA 3UDIA 3MAQA 1WCMG 4X62Q 5EKIA 5FO9B 1IBKQ 3CD6A 1H9SA 1K3RA 4K8JA 2ENBA 4CJ1B 3ONAB 4BY7H 1YVCA 4IUNA 2XVSA 4IJHA 1EWHA 3VDYA 2X6GA 5C3EB 3PO3H 2K05A 1DZ1A 3KDFA 2QILA 1LT3D 2MGSA 2NVYB 4QCLA 1T9HA 1PMRA 1ESRA 3J81E 5BR8Q 2WKDA 3C46A 4MTNA 2B2YA 3ICEA 3PIOA 2IL8A 3CXCA 4A3JB 1PRTC 2QGQA 2IX3A 4ALPA 3ND9A 3EBEA 1TWFH 1G51A 1LTGD 4JC0A 3D31A 3GV6A 4K5XA 1FD7D 5KIXA 1QILA 4BBSH 4DAYA 3A74A 2A6ED 2I07B 1SJED 2N55A 2WFWA 1O7LA 3UE0A 4IN3A 2VUMG 5FJ8G 3F1ZA 3C3LA 4DK1A 4BBRG 4DR7L 3AFQA 5JJLA 3GTLH 3Q23A 2WACA 2FJ2A 1SRUA 2EY6A 3I4OA 1S5DD 1EYDA 2UXDQ 2UUCL 4QB4A 2I46A 3BDOA 1FJGL 4ID6A 2JEAI 4J8QA 2K32A 4A3FG 3ERSX 4AQYQ 1N34Q 1PVOA 3NBIA 2R93H 2O2LD 3OYYA 1H9RA 4C3JG 4Q5VA 3E0JA 2NVQH 4CKCA 1FL0A 3P75A 1G2SA 2LXJA 2NN6G 4OIJA 5IWAL 2F0KA 1VQGA 3CW2C 4N8FA 4YHHL 4XT3B 3EROA 3PUWA 3VYUA 1VQAA 3E3XA 2MUYA 5IYCH 3MTSA 3K7AB 1HA5A 1AW7A 3MXNB 5IYDH 5I6YA 3MFGA 2B63H 4A3DG 3T13A 4P75A 2KCTA 1B3QA 2F0OA 1Z6HA 1C8CA 5FJ8H 2F4VQ 4DV5L 1PFSA 1G291 1BCPB 5JVH3 4BBRH 1Q12A 4WJ3M 3CAMA 4JI3L 1NMGA 1ILPA 4DNIA 5IYBG 3KLSA 3HOZH 4PQXA 3PO3B 2QA4A 2IY5B 5M3MB 4K2LA 5D3IB 2EJMA 1NBWA 2DN8A 1JMCA 1WD1A 4A3EH 4QUFA 3CCVA 5M3FG 5JEAG 5CORA 4DR5Q 2R93G 1SXTA 4S3SA 2B39A 2F3WA 4JI3Q 2IHFA 4OL7A 1AP0A 5H1SE 3HKZB 3M4OH 1LTLA 4UAIA 4GLVB 3GTJH 4LF7Q 1Q8IA 1X55A 4DXFA 4LJZC 1J8IA 1BXTA 3NWSA 3MFYA 3URYA 3K5MA 4JOIC 1C9OA 3FPUB 1PTOH 1GUNA 1VDZA 3ER0A 1LYLA 5AFWA 4KY5A 1GVPA 1LM0A 5CR3A 4RKBA 2KCMA 5G3LF 5M5YB 2KECA 1N33Q 4DR1L 1HFGA 4A3MG 3OHXC 4LWCA 2PI2A 2R7DA 2Z1CA 3TZUA 2E76C 4LFAQ 2PZUA 1XWEA 4ME5A 1HZBA 2K5VA 2A5HA 1E2ZA 1UE6A 5GAEC 3RR5A 1YHBA 5J22A 1Y1WB 3X3MA 4B3RQ 2RQXA 3HOZG 3NHHA 1EIYB 1D5XC 5LL6S 1UEBA 3GDEA 2KVMA 5EQ0A 1VMPA 2CW0D 2MJ8A 5AJ3Q 4X65L 5IP9H 4ZCKA 3PIPA 2OT2A 5CV5A 4IOAA 1Q8KA 2WAQE 5JEAH 2B8FA 4ZRZA 4L6TB 1MJCA 2G5DA 3G7LA 3DMUA 2RSOA 4CDDC 2PQAA 1MI2A 1QVFA 1DOKA 3F8TA 1EUJA 1Y1WH 4YWKA 1UWVA 5CV4A 5C6AA 5LHY1 4X6AH 3ULLA 1L1OB 1S72A 2KEEA 4BY1G 4OO1G 1CSQA 3HKSA 4QF4A 5FLXc 2ZTCA 3T16A 1PH5A 4EQNA 1EYAA 1RODA 4C3IB 3FKIG 1MSHA 1B9NA 2J7ZA 1X32A 1UNSA 1CHQD 2YYZA 3AEVA 4IOCA 1HZ9A 2ICEC 2YTXA 1EYCA 2F0DA 1D2BA 1YNXA 2QDBA 1GM5A 1XNRL 1QVCA 2ICIA 2SOBA 3V96A 2ASBA 2KA7A 1XX8A 4JI2Q 1W6JA 2K33A 3I73A 4JYAL 3KLSX 3G71A 4KLKA 3GTLB 1O7ZA 3P1HA 4OWWB 4A3BB 2AUKA 1AZPA 1G8ZD 1I3QH 2JA7G 1W3SA 1QNKA 3JC66 4JI5Q 3K5OA 4JI2L 2K14A 4ZLTF 2Z0SA 3DEOA 4O1NA 1HPCA 2XTIA 1E1TA 4JI4Q 4HTHA 4IQZA 4DR5L 1HTLD 2K75A 4CKEA 4A93B 4KN4C 3K5LA 4CKBA 2B2TC 1H9JA 3TP7A 5C44B 2AKWB 2OWOA 1ET9A 4GN5A 3PUXA 1N9WA 2L1BA 4A3KB 1TKWB 4Y7NH 5E4XA 1IYVA 3L2PA 3DWQA 2A68C 2B63B 1LTID 3AQQA 1AE3A 4IJLA 3KBXA 5NUCA 1ICWA 5ELDA 2Q8IB 4QIWE 3CPFA 5FLMG 2R6GA 3S14H 1J5EL 3ULPA 1QJOA 2UXCL 1OXTA 1EIHA 2QW7A 4IUQA 4K0KQ 4F87A 3RZDB 3KF6B 3SXHA 2F3VA 3OMCA 4DNRB 4OO1I 1D5MC 4KJNA 3U4ZA 4R4CA 4A3EB 2CKZB 1CQFA 2G9DA 2L9HA 1G2TA 4RCOA 3BJUA 2HT1A 3I4LA 4RFBA 3D0FA 1WI5A 1IBML 1Q46A 1LTRD 3UI2A 4C3HG 3K5NA 2KUMA 1IBLQ 3J7A5 3J7ZC 3L9AX 1I94L 1I6HB 3S1QB 4KJOA 1VQCA 3K7UC 1I4XA 1IKLA 3MZ5A 1P8LA 4HIDA 1SMYC 2WB1B 3HOXG 1PH3A 1HZCA 4GS3A 3HEJA 1BCPD 2Z4IA 1N8RC 4GOPB 1G6ZA 4DUZL 2GVAA 3QOLA 1QUQB 3FRPB 4NXML 1PRTD 2A74C 1SROA 5C44H 4LK1C 5ELOA 4GNXB 1UE5A 5CBAE 4R8NA 3DXJC 5ELNA 2MHVA 1I50H 2M2LA 1K8AC 1JR0D 3PO2B 4LUVA 4BA2I 1BDOA 3AU7A 3BDLA 4A3CG 2NN6I 1SYEA 1X56A 2A69D 2XRQD 1F2LA 1I4QA 3DM3A 2UUCQ 1VQ4A 1QOHA 1BBXC 3PF4A 5T1GA 4TSSA 3DLLA 1CA6A 2R3ZA 1KL9A 1EFWA 2DJGC 4LFCL 3PO2H 4GNXA 4DR2Q 1D1IA 1A62A 3BU2A 4BY7G 5HURA 3IRBA 5M3MG 1A15A 1QUQA 3A8KE 1U9RA 1XTDA 3PO3G 1SNQA 2X6LA 1J9OA 3GTQB 1VF5C 2PW5A 4ZKCB 1SNCA 2A19A 3CHBD 2H1EA 3I90A 2ZTEA 3MWYW 4FNFA 3NPPA 4CHTB 2Z6KC 5FLXL 3PF5A 5ELEA 1LT6D 2MO0A 5IODA 4H02A 2M00A 3A5UA 4YWLA 1RTNA 4LFBQ 5C44G 4V0BA 4NKLA 1IW7D 3GV3A 2EYJA 5HGTA 2VNUD 4PV1C 4A93G 4LUOA 4CDEC 2N8NA 5FK9C 1L0YB 5C5LA 1NSNS 5EBDA 1CKOA 1A6XA 5JJZA 1OXUA 2UXBL 2RCFA 4E6IA 4DV4L 2EJGC 2IW3A 1ENAA 1KC8C 2ZT9C 4LF4L 1X3QA 1W6KA 3J80L 2YTYA 1CQVA 1X3FA 1WFQA 3HOVH 4IUTA 1EWIA 3S9WA 4FF3A 3IFTA 4GOPC 1QB5D 2OQKA 1WD0A 2C5CA 3HOXB 1RIPA 1QNUA 4HJAA 2QEJC 2E5LQ 4LF4Q 4BA1I 2JA5H 2CH4W 3GTJB 1BKBA 1MIUA 4A3FH 4C3IG 5DNFA 3VR6A 2PNRC 1YJNA 5M5WH 4BBRB 4IPHA 1K8OA 4H7BA 4BY1B 5M5XH 5T1IA 5IGFA 2Y0SG 5KGUA 5HGQA 2XRSD 1JOQA 2E2IH 4I7AA 4TVAB 3E6ZX 1M1KC 1ENFA 2PCFB 3H09A 1C7YA 4A93H 5C4XH 2UXDL 1CZWA 1M4VA 2CQOA 4RGMA 1N34L 1IHZA 2Q2HA 4RG1A 1B3AA 4DV3L 4JBMA 1J6QA 4CJ2C 1DGSA 3J81L 2RDFA 3RLOA 3V2TA 3K81C 3F2CA 1F9QA 4QJFA 4HJ9A 3UE1A 2GVBA 1LABA 5CV7A 5KYLA 1KQSA 2A1AA 5D65A 2JA8H 1KHIA 2ZXRA 1GKHA 2Y0SE 3DHQA 3BS1A 2EQSA 2KENA 2NTSA 1XYIA 3IFDA 2HIXA 3W1GA 1RL2A 2JP1A 4APVA 5GAGC 2VQFQ 5K5PA 1PH9A 4QGUA 3SK4A 3KF6A 3S2HH 1EY8A 1S5BD 1YNND 2JA6H 5K36G 2D9UA 4LAAA 2JSOA 2JYOA 1U4LA 3HKZE 3EJIA 4EGVA 3UDXA 2XGTA 1E2WA 5JAVA 4YY3L 1PDQA 1EZ8A 1PH2A 5IGEA 3IAYA 1Y1VH 4X64L 5C4XG 3S1QH 4UY8C 3M4PA 2E2HH 3IKJA 4I7ZC 4DV2L 3I56A 4HJ7A 3RN2A 3ERQA 5IT9E 2QDLA 2HIVA 2Q2UA 3QOJA 1SLJA 5EKLA 4LF5Q 4BY7B 1GO3E 1Q90A 5IP7H 1AH9A 4DUZQ 2UUBQ 4LF7L 4LF6L 1NMFA 3FDTA 4X64Q 1JJCB 2NVYH 1SNDA 4DV6Q 5C4JB 2MP1A 1UE7A 2BDNA 3WWVA 3CCMA 4LF9L 1U5KA 5C0XH 1A2TA 4F7XA 1STEA 4BXXH 2E2DC 3M3YH 1SN8A 2JXMB 5EGTA 4KKUA 3OIPA 2K1BA 1HQMC 2CQAA 3GTMB 4GKKQ 5IP9G 5M5WB 2HQLA 4YWMA 1JOOA 3RZOH 2IX1A 1OXXK 5CV9A 3S16B 1M8AA 1B1ZA 1Z47A 1SNMA 1B7YB 3I72A 1D8LA 3QIAA 2EIFA 2EYPA 3VA7A 4JI1Q 2CWPA 4B3SQ 3NE5B 1NE3A 3HOYH 3D6WA 4FYDA 4HIKA 1HZAA 4MN3A 1JWUD 1KIXA 2DY8A 1YI2A 1BF4A 4DF7A 1ASZA 4L63B 2NZHA 2WB1G 1GOZA 2UXCQ 3S1NH 1ZYRD 1VCIA 3A56A 1R4PB 3J80c 3OWEB 1I6VC 1LO5D 4N9PA 4LMQD 1H9MA 3EFXD 4C3HB 3OWFA 3M85A 1Y14B 5J39A 1PH1A 1EQRA 1DXMA 3NBHB 1TIID 1RCVD 2VB3X 4RWSC 2AWOA 3EVQA 2L5TA 1SR3A 5GQOA 1AZQA 2K5WA 2ZXPA 1PZKD 2EYHA 4JI7L 1BVSA 4POFA 2F52A 4F88A 1MBYA 3NQTA 3DEPA 1I3QB 4RGNA 3NBHA 2M9VA 4DV5Q 3E5SA 1EYGA 2F0WA 1A63A 1WTWA 3H3VC 1SYDA 2SNSA 4GLAC 3NELA 4C1NI 2V1CC 2B63G 3CRLC 2PPBC 1GHJA 2K5DA 3KK7A 4JPBW 2VQEL 4FF2A 4P2CB 1K83H 1AFPA 2QF7A 2EY1A 1HA6A 1KNEA 2LS01 5DEHA 4DFAA 5JPMC 3A8IE 5HY6A 2XWBB 4HAEA 4JI6Q 4LF6Q 2R92H 4YHHQ 4DR1Q 2EYLA 1I6HH 4PZ6A 1BR9A 2F0UA 3CP0A 3KYHC 4HSPA 3Q22A 1I4RA 2K4KA 3QB3A 4XQNA 3SDZA 3TP6A 5I9PA 3VR2A 3CRKC 2G9HD 4RA8A 1CK1A 4KV6A 3J7AV 4A3GH 4LF8Q 3F2BA 2F0TA 5KNBA 1YJWA 4ULLA 2UUAL 1KD1C 4C3JB 1KABA 5E3FA 3C1EA 4R8IA 4B3MQ 3SGIA 2Z4HA 3L3OC 1SSOA 2MFIA 1R4QB 4K0KL 3KJOA 1YHAA 5DM63 3HS0C 5C4HA 3OOCA 2EE1A 3LWEA 4IUPA 3TN2A 4UDUC 1U4MA 1YZ6A 1N33L 3SHLA 1VQPA 3VA5A 3MXNA 5GAHC 2JQOA 2PI2E 4P72A 3EA6A 2KOLA 4KD3A 3VYTA 4IFDH 4EQPA 3PIO3 1SYBA 5BR8L 1DOLA 3S1NB 1VQEA 4PZ7A 4AYBE 1E3PA 4G57A 3I91A 3P20A 4ZAIA 2J0TD 2PQEA 5FOBB 1TWFB 4HCEA 4R4IA 2N3SA 3H3VI 4IFDJ 5IE8A 2UXBQ 1KAWA 3W5OA 5CC4A 3H0GH 1PH6A 1ONLA 3OTOQ 3GP7A 1QVGA 3GTKH 1NUCA 1EY4A 4RMFA 5LMUQ 1KLGD 1OXVA 4HN7A 1VQMA 5KEEA 3DUZA 4NXMQ 1JORA 1CUKA 2IJ0A 3BZCA 2F4VL 2PW7A 1TWHH 3A7LA 1A3UA 1Y1WG 1ET6A 3N6RA 4DN4M 2L0CA 1HR0Q 4G7ZC 1IYUA 5EKKA 1V1QA 1JCKB 4R4TA 2FMCA 4RAUC 1I4HA 2TSSA 4LF5L 2WKCA 2EDGA 1Y8NB 1YIJA 5M3MH 1PH7A 1RF2D 4N8X1 3CCUA 3B6YA 3FMCA 4TKOB 3NTKA 3T4AC 2IWHA 1PXUA 3I4NG 3K7AH 4JK1C 3A7AB 4RHSA 4XIGS 1WCMB 4IFDG 1P16A 4H44C 1O7YA 1SMXA 1KTKA 2VB2X 3TEHB 5J3BA 4DA2A 1T5XD 5C3WA 3I3CA 2IHEA 5EAYA 3U4VA 4R9WA 1SE4A 1Q1BA 2OEOA 1XTCD 1DJRD 4A3BH 1L0XB 2K03A 3OPOA 3I4MH 2YU9B 4DR6L 4BS9A 4EQ5A 1X65A 1YNJD 3KOJA 3S1RB 3RMHA 1L1OC 2B3GA 2F1MA 2F0LA 3KDFB 3D6CA 5CMDA 3WDNA 3TQYA 3W3AA 1EOVA 4NXNQ 3M9BA 2JEBI 1RKNA 4DV7L 1BNZA 4Q0FA 1Q1EA 2K7VA 1PV4A 2RF4A 3EN2A 3NP8A 5DLQE 2NB0A 1YNJC 3MXGA 3STBC 4POGA 4FDBA 4Z9CB 1PTOD 1FNVA 2LSSA 3GTGH 3D3RA 4J6HA 1V1PA 4L5RC 1NR2A 2BDOA 3F2DA 3VYRA 1MSGA 1NAPA 2AWNA 5IGDA 3K0YA 1YNNC 3CC4A 3PUVA 3F2UA 1VQ5A 3T1HQ 1XMQQ 3GD7A 1LT4D 1A8VA 3R93A 1EOTA 3PSIA 3LNNA 4LW1A 1JJGA 4JI6L 1CT1D 2E2HB 1PA6A 2QKIC 4DAYB 1GD7A 4TRDA 4LFAL 1CFMA 3I4MG 3T1YQ 1XMQL 2BA0A 1C48A 4IFDI 1V9PA 1T5EA 4JI8Q 4A3FB 2LXKA 1TR5A 2E8GA 2XWJB 4V190 4OEMB 4J15A 1G6PA 2NVXH 3CCRA 4C3HH 2N88A 1E22A 5JPNC 1I94Q 1KRTA 3NTIA 5LMNW 1HRJA 1S3OA 4DR6Q 1AN8A 1IBKL 2F0IA 2ZM6L 2D0PA 1HR0L 3NK9A 1WTVA 2F0SA 5C4XB 5I9OA 4EQOA 4C2MB 4B9WA 4J1MA 4JBKA 4KI0A 5JVG3 3HOXH 5J1ZA 2MPMA 3H94A 3TP5A 2K5NA 2VUMB 2R7FA 1LLRD 1H9SB 1R9TB 2HDMA 3OTOL 1EY0A 1F77A 3GTPH 1I5FA 1JJ2A 5LMNL 3S17H 3E0EA 4JI1L 2O5JC 5M5YH 3HP3A 3VR3A 3PMFA 5FKAC 4X3UA 5CYUA 3S2DH 1Y8OB 4X66Q 2RA4A 3C1FA 4IUVA 3Q24A 5ELFA 1B44D 3A5ZB 3J80E 4B3ML 1PFBA 2PMZB 1S5FD 3S1MH 3RN5A 2IX0A 1W2BA 3K8AA 3PCOB 4RGTA 2EXZA 4A3IG 1GUSA 2L11A 3D4DA 1QG7A 4XQJA 5C3EG 3Q0AA 2A73B 1MHWC 1Q81C 5CV8A 3MEFA 5I2XA 1N32L 3RZDH 1TWCH 5IYDG 1BCPC 1VQ6A 1TWAH 1TY2A 2HCIA 3CPWA 3FKIB 1F2YA 5LL6X 3UDFA 4JVZA 1WTXA 1SNPA 2VL6A 4GN3B 4AQYL 1D7QA 2Y0SB 5C0XG 4XXEA 4IUUA 5IGGA 4CDCC 2ID0A 4C56C 2GA4B 1DYQA 3DWPA 1F9RA 4CBVA 3G6EA 1HNWL 1CZGA 5IYBH 2A69C 3J7AF 5ISRA 5C4ZA 3J80i 2UUBL 1I50B 4C2MH 3TP8A 4OWXB 2VQFL 2PO4A 5C3XA 4A76A 4DR2L 3BZDB 1RJTA 4M1UB 3MXUA 3CCQA 3RNUA 1LT5D 1ICFB 1S5CD 1V1PB 4LF9Q 4HIMA 1JWMD 3HOWB 1FGUA 1EQTA 2F0MA 2R92B 1QE6A 3SEBA 1ILQA 2EPBA 2Q2IA 1IYJB 1DOMA 1CKNA 1EY5A 2J4XA 1GJXA 1RDPD 2ZM6Q 1AE2A 3U58A 4KKTA 3I55A 3AYHB 4DR3Q 3GTQH 2VZAA 1X54A 1EIFA 3HFZB 4A3JH 1LTSD 1BQQT 3RLFA 4RGOS 4OX9L 3TZDA 2JA5G 2LY7A 2YU9H 1D6EC 4EX5A 4K6DA 1U0LA 4A3EG 1NNXA 1HQRD 2Z6KA 1UAPA 1X6OA 2AHOB 3QG1A 4XT1B 2VQEQ 5M3FH 4YCUA 2AQ2B 5IT9L 4YIJA 2R61A 5CBEE 3CMAA 2NYZD 1YITA 4BBSB 4B08A 1EY9A 2D5DA 1GUGA 4GOPA 3K58A 3BYYB 1ASYA 4OX9Q 4IPDA 3S2DB 3TS0A 3ITPA 1VQKA 1HXYD 4FF1A 1FR3A 1HUMA 4B3TQ 1BO0A 1VQJA 1PFNA 2X69A 3CC2A 2Z6BA 4H13C 2VY3A 4A3MH 5E1FA 4A75A 1CSPA 4OONA 3STBD 1VQLA 4NPSA 1S40A 1JE5A 4BY1H 3G6JB 4P71A 1F2ZA 5E4WC 3ZJYC 2D2CC 1PH4A 5EPKA 1WTHA 4JI7Q 1Q7YC 3TBIB 1HNXL 2I5HA 4QY7A 5G3LD 5JJIA 1FVIA 3BZKA 2ZJQA 2OQ0A 3NENA 2DY7A 3DM1A 4PG3A 4O42A 4L5SA 1K9MC 2OTLA 5AJ3L 1SNOA 1PYWD 5D3DA 1K3BC 3Q8DA 2L15A 3K59A 2EOTA 2F4IA 3QO2A 1H9KA 2RDGA 4JI8L 4F8MA 2DGYA 2ES2A 2A68D 2FMMA 1STYA 1MKHA 4EVOA 3SK8A 2VXWA 1E0BA 2EY2A 1O80A 2JA7H 3L0OA 1V1OA 3LWUA 1GUOA 3TREA 2UU9L 4OO1H 1D1KA 2F3IA 4NMZA 3ULJA 4K8IA 3OW7A 3GO5A 3GQBA 3M4QA 3FKIH 2K52A 2B29A 5LMUL 4U673 3L7ZC 5A2QL 1HNZL 1SJHD 4DUYQ 3KUPA 3K6OA 4DV1Q 2B2VC 4OHJA 2L4NA 1QWYA 3RD4A 3Q6SA 4DV0Q 4M8AA 4Y7NB 2Q8TA 2XIWA 1H95A 1K73C 3MC0B 2L55A 3FEWX 2E2JH 1DD2A 4AYBG 4L5TA 4O0AA 2EXDA 4DV4Q 3QWNA 1WTPA 4UP8A 1SBBB 1SMYD 1YJ9A 1ZEQX 2B2VA 4IZ8A 3HOZB 2EYOA 4JI4L 1HFNA 3KFUA 1EQQA 2RHQB 1XPRA 4WJWA 4LF8L 3HZXA 1KDCA 2WIIB 1XXGA 2BA1A 3KLWA 5M5XB 1F9SA 4DNTB 4JW0A 2ALYB 2SEBD 3HOUH 1HR0W 4ILWA 1QCBD 1ZXTA 1WTOA 1KXLA 1EWCA 2RHSB 4FO2A 3NTHA 1XNQL 1L1OA 2O4XA 3R3OA 4OXPA 4AIMA 5BN5A 3I4NH 1IBLL 4XQQA 4I65A 4X62L 3CCJA 4MTKA 1CA5A 1EEFD 2BOSA 3UDGA 2RBMA 1VQIA 2BH2A 4DK3C 1SYCA 2FFKB 5EPLA 4A3BG 2XN9C 2K5HA 2I0QA 5ELBA 3GTGB 1CKMA 4MNOA 4C1NK 1KRSA 3MEHA 2EVBA 4FP5D 3AFPA 4WFN3 5KNCA 4PMWA 2F0GA 3QJYA 4DAPA 4KHZA 1SAPA 1XMOQ 3HG9A 3K57A 1B70B 2RVLA 5IY0A 5COYA 5IT9c 2B2TA 5D14A 4L5QA 3S15B 4G7OC 2BE5C 4WRDA 1TS2A 4ZUJA 2VUMH 1E24A 3S1RH 3BDCA 1CM9A 1K83B 3U9SA 2E75C 1STAA 1STGA 3S24A 1HNWQ 1AEXA 4R4QA 2HUGA 1YBYA 2BH8A 5CV6A 3GTOB 4DR4Q 4JV5Q 2CH4A 3TMEA 1SEBD 4KMUC 2Z8LA 3BVZA 3PO2G 2I5LX 1VQOA 5KYIA 4JBWA 1Z7TA 1BBWA 1SE8A 1VQHA 5JEAJ 2XNAC 1OO9B 2AQ1B 2HDLA 4JI0L 3GTOH 4DR4L 3CCSA 5JOBA
chains in the Genus database with same CATH topology
1EOVA 4NXNQ 4GKJQ 1XJVA 1QZHA 1KL9A 3I2ZA 3M9BA 4C3JH 2JEBI 4LFCL 1L0WA 4DV7L 1EFWA 3PO2H 4GNXA 2UU9Q 4DR2Q 1A62A 3BU2A 4BY7G 1Q1EA 4OWTB 3IRBA 4A3GG 4A3KH 1PV4A 5M3MG 1QUQA 1K8GA 3HOWG 5GADC 4LFBL 2RF4A 3EN2A 5DLQE 1XTDA 5C0XJ 3PO3G 1WOCA 4MZ9A 1UE1A 4AH6A 3STBC 3PV0A 4POGA 4WJ4A 2A19A 2DUDA 4FDBA 1N36L 1HH2P 2ZTEA 3GTMH 4GKKL 2LSSA 2Z6KC 4JI0Q 3PF5A 2PQAB 1YHQA 3GTGH 4X66L 2MO0A 4H02A 4L5RC 1E1OA 3G4SA 3F2DA 1VQ8A 3PUYA 3FHWA 4YWLA 3A5UA 1XNRQ 4LUZA 4LFBQ 2AWNA 5C44G 1SFOH 1Q82C 1HNXQ 3CC4A 3PUVA 1XMOL 1VQ5A 3T1HQ 4YY3Q 1XMQQ 3GD7A 4B3SL 4A3CH 1QVFA 2VNUD 1A8VA 1Q86C 3HOVG 4DR3L 4A93G 3PSIA 4LUOA 2N8NA 2R7ZH 1XNQQ 4LW1A 1CKOA 1FJGQ 1N36Q 4JI6L 1JJGA 2FXQA 1OXUA 1VQ7A 4DUYL 1PA6A 4DAYB 1QZGA 1GD7A 2UXBL 1V43A 3UDIA 4DV4L 4LFAL 1WCMG 4X62Q 3KF8B 1KC8C 1HJPA 1IBKQ 4LF4L 3CD6A 3I4MG 4QQBX 1K3RA 3T1YQ 2YTYA 3RLNA 1XMQL 2BA0A 4BY7H 2JK8A 1X3FA 1YVCA 4HJ8A 4IFDI 1V9PA 1PYBA 1WFQA 4IJHA 4JI8Q 3HOVH 2LXKA 1EWIA 2E8GA 5IWAQ 3VDYA 3HOWH 3PO3H 4GOPC 3KDFA 3H0GG 4J15A 3EIVA 3NEMA 1G6PA 2NVXH 2OQKA 3CCRA 2MO1A 4JBJA 4DKAC 1T9HA 4C3HH 1E22A 1RIPA 1X3EA 4JCVE 1I94Q 1KRTA 3TRZA 5LMNW 4A4IA 4HJAA 1S3OA 4DR6Q 2E5LQ 5BR8Q 4A3KG 4MTNA 2AMCB 1IBKL 2D0OA 4LF4Q 4JOIA 2VS1A 4BA1I 3PIOA 2D0PA 2ZM6L 4A3IH 3CXCA 1HR0L 2JA5H 3ICEA 2QGQA 4Y52H 5C3EH 4ALPA 1X3GA 1BKBA 4JBKA 3EBEA 1MIUA 4KI0A 4A3FH 4A3LG 1B8AA 1TWFH 1O7IA 3PUZA 2VW9A 1G51A 3HOXH 1YJNA 1HNZQ 5M5WH 2K5NA 4IPHA 2R7FA 4DV0L 4JC0A 3D31A 4R1JA 4DV1L 5M5XH 3J81c 1J5EQ 4BBSH 2OTJA 2Y0SG 3OTOL 5HGQA 1X9NA 1WCMH 2E2IH 3A74A 3GTPH 1I5FA 4TVAB 1JJ2A 5LMNL 2WFWA 2YV5A 1M1KC 3S17H 3E0EA 4JI1L 3UE0A 1C7YA 2VUMG 4A93H 5C4XH 5FJ8G 4HIOA 5M5YH 2UXDL 3S2DH 3F1ZA 2CQOA 1N34L 4DR7L 4BBRG 4X66Q 2Q2HA 4RG1A 3AFQA 5JJLA 4DV3L 4JBMA 1VS0A 3A5ZB 3GTLH 1J6QA 1DGSA 4B3ML 3RLOA 3G48A 3K81C 3F2CA 1SRUA 4QJFA 3I4OA 4HJ9A 4IPGA 3S1MH 3RN5A 2UXDQ 3UE1A 2UUCL 2GVBA 2IX0A 1W2BA 5C0XI 3K8AA 1KQSA 2A1AA 3PCOB 4A3IG 1FJGL 2JA6G 2JA8H 1KHIA 2JEAI 5C3EG 4NXNL 4P74A 1Q81C 1GKHA 2Y0SE 3MEFA 4A3FG 1N34Q 3ERSX 4AQYQ 1PVOA 2EQSA 1N32L 2KENA 2R93H 3RZDH 1TWCH 2HIXA 3OYYA 5IYDG 3W1GA 2PMZE 1TWAH 3CPWA 1RL2A 1FL0A 2NVQH 1VQ6A 2LXJA 4APVA 2NN6G 3A0JA 3UDFA 5GAGC 2VQFQ 4BBSG 5IWAL 1PH9A 4QGUA 1VQGA 3CW2C 3KF6A 4PZ8A 3S2HH 4A3LH 4YHHL 2JA6H 2WB1E 2JA8G 5K36G 2VL6A 3PUWA 4GN3B 4AQYL 1D7QA 1VQAA 5C0XG 3HKZE 1PH8A 2ID0A 5IYCH 1VQBA 3MXNB 5IYDH 2E5LL 3E9HA 1HNWL 3UDXA 3G6EA 2XGTA 5IYBH 4UP7A 2B63H 4YY3L 3J80i 4A3DG 1BBUA 2UUBL 1PH2A 4P75A 4C2MH 2KCTA 4OWXB 4UPAA 1Y1VH 5IP7G 3K0XA 4X64L 1TWGH 5FJ8H 2VQFL 4A76A 2F4VQ 4DV5L 3S1QH 4DR2L 5C4XG 1PFSA 4UY8C 1G291 3M4PA 2N49A 2E2HH 3CCQA 4BBRH 3PGZA 3RNUA 4DV2L 2CFMA 3T1YL 3I56A 4HJ7A 3RN2A 4LF9Q 1Q12A 2I5MX 1NJIC 1R9TH 4HIMA 2HIVA 3CC7A 4WJ3M 3CAMA 2KHJA 2Q2UA 4JI3L 2KHIA 1NMGA 3W1BA 2PNHA 4DNIA 1SLJA 5IYBG 4BXXG 1FGUA 3HOZH 4LF5Q 4IPCA 2QA4A 4GN4B 2IY5B 1GO3E 2NVTH 5IP7H 1Y1VG 1AH9A 1NBWA 4DUZQ 2UUBQ 4LF7L 4LF6L 1NMFA 1OXSC 1VQ9A 5GROA 4X64Q 4HJ5A 1JMCA 1C0AA 2Q2IA 1IYJB 4A3EH 1JJCB 1CKNA 2NVYH 4DV6Q 3CCVA 5M3FG 5JEAG 2ZM6Q 1UE7A 1AE2A 3WWVA 3CCMA 4DR5Q 3U58A 1IZ6A 1U5KA 1NY4A 3I55A 2K50A 4LF9L 2R93G 3AYHB 4DR3Q 3GTQH 4BXXH 4JI3Q 2IHFA 2VZAA 3M3YH 1SN8A 1EIFA 1X54A 3HFZB 5IYCG 1MJEA 5H1SE 4A3JH 3M4OH 1LTLA 4GKKQ 4LF7Q 4GLVB 1WJJA 2JA9A 3RLFA 5IP9G 3GTJH 2HQLA 1X55A 4OX9L 4YWMA 3RZOH 3J81j 2JA5G 2IX1A 2YU9H 5JJKA 4EX5A 4A3DH 3HKZG 1OXXK 1U0LA 5E7NA 4A3EG 2Z6KA 1X6OA 2AHOB 2VQEQ 5M3FH 3TS2A 1Z47A 4YCUA 4DK6C 2A8VA 1B7YB 4JOIC 1C9OA 4B3TL 1D8LA 2EIFA 2H5XA 5C4JH 3CMAA 1LUZA 3ER0A 1LYLA 1YITA 4JI1Q 1GVPA 2CWPA 1LM0A 4B3SQ 2KCMA 1NE3A 3HOYH 1N33Q 4DR1L 1L2FA 4LFCQ 4A3MG 4HIKA 1HZAA 4GOPA 1KIXA 4DPGA 4LWCA 2PI2A 2R7DA 1ASYA 1YI2A 4IPDA 4OX9Q 1ASZA 4DV7Q 4LFAQ 3J81i 3TS0A 1VQKA 2NZHA 3JAMc 1HZBA 1NTGA 2K5VA 2WB1G 1UE6A 2UXCQ 3S1NH 5GAEC 3RR5A 3CCLA 4KHPQ 4B3TQ 2ZJRA 1VCIA 1YHBA 1VQJA 4O2DA 4R4OA 4B3RQ 4GNXC 3CC2A 3HOYG 1IXRA 3HOZG 1EIYB 3J80c 2VY3A 4A3MH 1UEBA 3GDEA 4A75A 1CSPA 2UUAQ 4OONA 3STBD 1VQLA 4NPSA 1S40A 1JE5A 4BY1H 4P71A 5AJ3Q 4X65L 4JG2A 5IP9H 3PIPA 3M85A 4IOAA 3ZJYC 1Q8KA 2WAQE 4KHPL 1Y14B 4P73A 3I7FA 1PH4A 1PH1A 4UP9A 1MJCA 4JI7Q 1EQRA 1Q7YC 3NBHB 1HNXL 2I5HA 2PQAA 2MNAA 2GN5A 1IBMQ 2WP8J 3F8TA 3K80C 1EUJA 1FVIA 4QY7A 4GLXA 3BZKA 1Y1WH 5JJIA 2ZJQA 1PHJA 2OQ0A 4YWKA 1UWVA 2AWOA 3NENA 4NB3A 4PG3A 4L5SA 1SR3A 1K9MC 3ULLA 4X6AH 1L1OB 2OTLA 5AJ3L 1S72A 5GQOA 2Q2TA 4BY1G 4OO1G 1CSQA 3Q8DA 3HKSA 2L15A 4ME3A 2ZTCA 5FLXc 1PH5A 4JI7L 4JI8L 1JT8A 3FKIG 1BVSA 2DGYA 4POFA 2F52A 2QEXA 2ES2A 2YYZA 1JB7A 3AEVA 4YCWA 4IOCA 1HZ9A 1MKHA 2YTXA 2OCEA 4DV5Q 2R92G 1Z9FA 4IO9A 4YCVA 1EYGA 1A63A 2JA7H 3L0OA 4GLAC 1YNXA 3FP9A 3NELA 4XTCS 1XPOA 1GM5A 3TREA 2V1CC 1QVCA 2UU9L 1XNRL 2C35B 2B63G 2ASBA 1N32Q 4JI2Q 2F3IA 3ULJA 3G71A 2VQEL 4KLKA 4JYAL 1VQFA 3GO5A 3OW2A 1K83H 3M4QA 3FKIH 2K52A 2B29A 5LMUL 2NZOA 3L7ZC 4OWWB 5HY6A 4JI6Q 1HNZL 4LF6Q 4LNQA 2R92H 4YHHQ 4DR1Q 1I6HH 4DUYQ 1I3QH 2JA7G 1W3SA 3JC66 4JI5Q 3HOUG 4PZ6A 3CP0A 2YTVA 4JI2L 2K14A 4DV1Q 1OTCA 3KYHC 2Z0SA 1CKNB 4DV0Q 2K4KA 2XTIA 1E1TA 1A0IA 4JI4Q 4JYAQ 4DR5L 2HHHQ 1PYSB 2K75A 2JE6I 2KBNA 1H95A 4A3GH 1K73C 5LMNQ 4LF8Q 2E2JH 1WYDA 3F2BA 1K0RA 1YJWA 4AYBG 2UUAL 4L5TA 4O0AA 2AKWB 1KD1C 4DV2Q 2OWOA 4GN5A 2EXDA 4JI5L 4DV4Q 3CMEA 4B3MQ 4A3JG 3S16H 3SGIA 3PUXA 1N9WA 4UP8A 2MFIA 4Y7NH 1YJ9A 4K0KL 3KJOA 3L2PA 1YHAA 4JI4L 3KFUA 1EQQA 3AQQA 4JV5L 2RHQB 1AE3A 4IJLA 1XPRA 1M90C 1YZ6A 1N33L 4QIWE 1VQPA 4LF8L 5GAHC 2JQOA 2PI2E 3CPFA 3CQZH 4P72A 5FLMG 4DV6L 2BA1A 2R6GA 3KLWA 3S14H 1J5EL 3ULPA 2UXCL 3T1HL 1OXTA 3HOUH 2ALYB 4K0KQ 1HR0W 5BR8L 1KXLA 2RHSB 3KF6B 1VQEA 4PZ7A 1L1OA 1E3PA 4AYBE 1XNQL 4OXPA 3U50C 4AIMA 4GKJL 2ZJPA 4DAMA 3I4NH 1IBLL 3LGJA 4DR7Q 2N78A 4OO1I 4R4IA 2N3SA 4X62L 3H3VI 3CCJA 4IFDJ 3U4ZA 5IE8A 4R4CA 2UXBQ 1KAWA 3W5OA 3JAMi 3CCEA 2CKZB 1VQNA 3UDGA 3H0GH 3BJUA 1PH6A 2HT1A 3OTOQ 3D0FA 1WI5A 4QL5A 1QVGA 1Q46A 1VQIA 4DK3C 1IBML 2BH2A 3GTKH 4TQUS 4RMFA 4A3BG 2K5HA 2I0QA 3CF5A 5LMUQ 1IBLQ 3J7A5 1CKMA 4MNOA 3J7ZC 1OXVA 1KRSA 1VQMA 2ATWA 3AFPA 1I94L 4NXMQ 2CCZA 3S15H 1CUKA 3BZCA 4PMWA 3H15A 2F4VL 1TWHH 1VQCA 3K7UC 4KHZA 1Y1WG 1TXYA 4C3IH 1XMOQ 1P8LA 4HIDA 1HR0Q 1XPUA 1V1QA 1B70B 3HOXG 1HZCA 4R4TA 4GS3A 2MQHA 5FLMH 1PH3A 4B3RL 5IY0A 1N8RC 2RCNA 4GOPB 4DUZL 4LF5L 5IT9c 2GVAA 1IL2A 1E7ZA 1QUQB 4L5QA 5M3MH 1YIJA 1PH7A 4NXML 3CCUA 3B6YA 3KJPA 1SROA 5C44H 5ELOA 4GNXB 2WAQG 2VUMH 1E24A 3M7NA 3S1RH 1UE5A 3I4NG 3K7AH 4XIGS 4IFDG 3S24A 1P16A 1HNWQ 1SMXA 3TEHB 2JJQA 4R4QA 5ELNA 5J3BA 1YBYA 3E9IA 1I50H 2R7ZG 2BH8A 1K8AC 2IHEA 4DR4Q 4LUVA 4JV5Q 5EAYA 3U4VA 2IT1A 1Q1BA 4BA2I 3PO2G 1YEZA 2CWAA 4A3BH 4DV3Q 2I5LX 1VQOA 1VQDA 2D62A 3I4MH 4A3CG 4DR6L 4EQ5A 4X65Q 2NN6I 1X65A 2ZTDA 3KOJA 1X56A 4JBWA 1L1OC 1BBWA 2B3GA 3DM3A 1SE8A 1VQHA 5JEAJ 2UUCQ 3KDFB 4JI0L 1VQ4A 3GTOH 4DR4L 2HHHL 3H3VH 3CCSA 3PF4A 3TQYA 3DLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOV A;  4NXN Q;  4GKJ Q;  1XJV A;  1QZH A;  1KL9 A;  3I2Z A;  3M9B A;  4C3J H;  2JEB I;  4LFC L;  1L0W A;  4DV7 L;  1EFW A;  3PO2 H;  4GNX A;  2UU9 Q;  4DR2 Q;  1A62 A;  3BU2 A;  4BY7 G;  1Q1E A;  4OWT B;  3IRB A;  4A3G G;  4A3K H;  1PV4 A;  5M3M G;  1QUQ A;  1K8G A;  3HOW G;  5GAD C;  4LFB L;  2RF4 A;  3EN2 A;  5DLQ E;  1XTD A;  5C0X J;  3PO3 G;  1WOC A;  4MZ9 A;  1UE1 A;  4AH6 A;  3STB C;  3PV0 A;  4POG A;  4WJ4 A;  2A19 A;  2DUD A;  4FDB A;  1N36 L;  1HH2 P;  2ZTE A;  3GTM H;  4GKK L;  2LSS A;  2Z6K C;  4JI0 Q;  3PF5 A;  2PQA B;  1YHQ A;  3GTG H;  4X66 L;  2MO0 A;  4H02 A;  4L5R C;  1E1O A;  3G4S A;  3F2D A;  1VQ8 A;  3PUY A;  3FHW A;  4YWL A;  3A5U A;  1XNR Q;  4LUZ A;  4LFB Q;  2AWN A;  5C44 G;  1SFO H;  1Q82 C;  1HNX Q;  3CC4 A;  3PUV A;  1XMO L;  1VQ5 A;  3T1H Q;  4YY3 Q;  1XMQ Q;  3GD7 A;  4B3S L;  4A3C H;  1QVF A;  2VNU D;  1A8V A;  1Q86 C;  3HOV G;  4DR3 L;  4A93 G;  3PSI A;  4LUO A;  2N8N A;  2R7Z H;  1XNQ Q;  4LW1 A;  1CKO A;  1FJG Q;  1N36 Q;  4JI6 L;  1JJG A;  2FXQ A;  1OXU A;  1VQ7 A;  4DUY L;  1PA6 A;  4DAY B;  1QZG A;  1GD7 A;  2UXB L;  1V43 A;  3UDI A;  4DV4 L;  4LFA L;  1WCM G;  4X62 Q;  3KF8 B;  1KC8 C;  1HJP A;  1IBK Q;  4LF4 L;  3CD6 A;  3I4M G;  4QQB X;  1K3R A;  3T1Y Q;  2YTY A;  3RLN A;  1XMQ L;  2BA0 A;  4BY7 H;  2JK8 A;  1X3F A;  1YVC A;  4HJ8 A;  4IFD I;  1V9P A;  1PYB A;  1WFQ A;  4IJH A;  4JI8 Q;  3HOV H;  2LXK A;  1EWI A;  2E8G A;  5IWA Q;  3VDY A;  3HOW H;  3PO3 H;  4GOP C;  3KDF A;  3H0G G;  4J15 A;  3EIV A;  3NEM A;  1G6P A;  2NVX H;  2OQK A;  3CCR A;  2MO1 A;  4JBJ A;  4DKA C;  1T9H A;  4C3H H;  1E22 A;  1RIP A;  1X3E A;  4JCV E;  1I94 Q;  1KRT A;  3TRZ A;  5LMN W;  4A4I A;  4HJA A;  1S3O A;  4DR6 Q;  2E5L Q;  5BR8 Q;  4A3K G;  4MTN A;  2AMC B;  1IBK L;  2D0O A;  4LF4 Q;  4JOI A;  2VS1 A;  4BA1 I;  3PIO A;  2D0P A;  2ZM6 L;  4A3I H;  3CXC A;  1HR0 L;  2JA5 H;  3ICE A;  2QGQ A;  4Y52 H;  5C3E H;  4ALP A;  1X3G A;  1BKB A;  4JBK A;  3EBE A;  1MIU A;  4KI0 A;  4A3F H;  4A3L G;  1B8A A;  1TWF H;  1O7I A;  3PUZ A;  2VW9 A;  1G51 A;  3HOX H;  1YJN A;  1HNZ Q;  5M5W H;  2K5N A;  4IPH A;  2R7F A;  4DV0 L;  4JC0 A;  3D31 A;  4R1J A;  4DV1 L;  5M5X H;  3J81 c;  1J5E Q;  4BBS H;  2OTJ A;  2Y0S G;  3OTO L;  5HGQ A;  1X9N A;  1WCM H;  2E2I H;  3A74 A;  3GTP H;  1I5F A;  4TVA B;  1JJ2 A;  5LMN L;  2WFW A;  2YV5 A;  1M1K C;  3S17 H;  3E0E A;  4JI1 L;  3UE0 A;  1C7Y A;  2VUM G;  4A93 H;  5C4X H;  5FJ8 G;  4HIO A;  5M5Y H;  2UXD L;  3S2D H;  3F1Z A;  2CQO A;  1N34 L;  4DR7 L;  4BBR G;  4X66 Q;  2Q2H A;  4RG1 A;  3AFQ A;  5JJL A;  4DV3 L;  4JBM A;  1VS0 A;  3A5Z B;  3GTL H;  1J6Q A;  1DGS A;  4B3M L;  3RLO A;  3G48 A;  3K81 C;  3F2C A;  1SRU A;  4QJF A;  3I4O A;  4HJ9 A;  4IPG A;  3S1M H;  3RN5 A;  2UXD Q;  3UE1 A;  2UUC L;  2GVB A;  2IX0 A;  1W2B A;  5C0X I;  3K8A A;  1KQS A;  2A1A A;  3PCO B;  4A3I G;  1FJG L;  2JA6 G;  2JA8 H;  1KHI A;  2JEA I;  5C3E G;  4NXN L;  4P74 A;  1Q81 C;  1GKH A;  2Y0S E;  3MEF A;  4A3F G;  1N34 Q;  3ERS X;  4AQY Q;  1PVO A;  2EQS A;  1N32 L;  2KEN A;  2R93 H;  3RZD H;  1TWC H;  2HIX A;  3OYY A;  5IYD G;  3W1G A;  2PMZ E;  1TWA H;  3CPW A;  1RL2 A;  1FL0 A;  2NVQ H;  1VQ6 A;  2LXJ A;  4APV A;  2NN6 G;  3A0J A;  3UDF A;  5GAG C;  2VQF Q;  4BBS G;  5IWA L;  1PH9 A;  4QGU A;  1VQG A;  3CW2 C;  3KF6 A;  4PZ8 A;  3S2H H;  4A3L H;  4YHH L;  2JA6 H;  2WB1 E;  2JA8 G;  5K36 G;  2VL6 A;  3PUW A;  4GN3 B;  4AQY L;  1D7Q A;  1VQA A;  5C0X G;  3HKZ E;  1PH8 A;  2ID0 A;  5IYC H;  1VQB A;  3MXN B;  5IYD H;  2E5L L;  3E9H A;  1HNW L;  3UDX A;  3G6E A;  2XGT A;  5IYB H;  4UP7 A;  2B63 H;  4YY3 L;  3J80 i;  4A3D G;  1BBU A;  2UUB L;  1PH2 A;  4P75 A;  4C2M H;  2KCT A;  4OWX B;  4UPA A;  1Y1V H;  5IP7 G;  3K0X A;  4X64 L;  1TWG H;  5FJ8 H;  2VQF L;  4A76 A;  2F4V Q;  4DV5 L;  3S1Q H;  4DR2 L;  5C4X G;  1PFS A;  4UY8 C;  1G29 1;  3M4P A;  2N49 A;  2E2H H;  3CCQ A;  4BBR H;  3PGZ A;  3RNU A;  4DV2 L;  2CFM A;  3T1Y L;  3I56 A;  4HJ7 A;  3RN2 A;  4LF9 Q;  1Q12 A;  2I5M X;  1NJI C;  1R9T H;  4HIM A;  2HIV A;  3CC7 A;  4WJ3 M;  3CAM A;  2KHJ A;  2Q2U A;  4JI3 L;  2KHI A;  1NMG A;  3W1B A;  2PNH A;  4DNI A;  1SLJ A;  5IYB G;  4BXX G;  1FGU A;  3HOZ H;  4LF5 Q;  4IPC A;  2QA4 A;  4GN4 B;  2IY5 B;  1GO3 E;  2NVT H;  5IP7 H;  1Y1V G;  1AH9 A;  1NBW A;  4DUZ Q;  2UUB Q;  4LF7 L;  4LF6 L;  1NMF A;  1OXS C;  1VQ9 A;  5GRO A;  4X64 Q;  4HJ5 A;  1JMC A;  1C0A A;  2Q2I A;  1IYJ B;  4A3E H;  1JJC B;  1CKN A;  2NVY H;  4DV6 Q;  3CCV A;  5M3F G;  5JEA G;  2ZM6 Q;  1UE7 A;  1AE2 A;  3WWV A;  3CCM A;  4DR5 Q;  3U58 A;  1IZ6 A;  1U5K A;  1NY4 A;  3I55 A;  2K50 A;  4LF9 L;  2R93 G;  3AYH B;  4DR3 Q;  3GTQ H;  4BXX H;  4JI3 Q;  2IHF A;  2VZA A;  3M3Y H;  1SN8 A;  1EIF A;  1X54 A;  3HFZ B;  5IYC G;  1MJE A;  5H1S E;  4A3J H;  3M4O H;  1LTL A;  4GKK Q;  4LF7 Q;  4GLV B;  1WJJ A;  2JA9 A;  3RLF A;  5IP9 G;  3GTJ H;  2HQL A;  1X55 A;  4OX9 L;  4YWM A;  3RZO H;  3J81 j;  2JA5 G;  2IX1 A;  2YU9 H;  5JJK A;  4EX5 A;  4A3D H;  3HKZ G;  1OXX K;  1U0L A;  5E7N A;  4A3E G;  2Z6K A;  1X6O A;  2AHO B;  2VQE Q;  5M3F H;  3TS2 A;  1Z47 A;  4YCU A;  4DK6 C;  2A8V A;  1B7Y B;  4JOI C;  1C9O A;  4B3T L;  1D8L A;  2EIF A;  2H5X A;  5C4J H;  3CMA A;  1LUZ A;  3ER0 A;  1LYL A;  1YIT A;  4JI1 Q;  1GVP A;  2CWP A;  1LM0 A;  4B3S Q;  2KCM A;  1NE3 A;  3HOY H;  1N33 Q;  4DR1 L;  1L2F A;  4LFC Q;  4A3M G;  4HIK A;  1HZA A;  4GOP A;  1KIX A;  4DPG A;  4LWC A;  2PI2 A;  2R7D A;  1ASY A;  1YI2 A;  4IPD A;  4OX9 Q;  1ASZ A;  4DV7 Q;  4LFA Q;  3J81 i;  3TS0 A;  1VQK A;  2NZH A;  3JAM c;  1HZB A;  1NTG A;  2K5V A;  2WB1 G;  1UE6 A;  2UXC Q;  3S1N H;  5GAE C;  3RR5 A;  3CCL A;  4KHP Q;  4B3T Q;  2ZJR A;  1VCI A;  1YHB A;  1VQJ A;  4O2D A;  4R4O A;  4B3R Q;  4GNX C;  3CC2 A;  3HOY G;  1IXR A;  3HOZ G;  1EIY B;  3J80 c;  2VY3 A;  4A3M H;  1UEB A;  3GDE A;  4A75 A;  1CSP A;  2UUA Q;  4OON A;  3STB D;  1VQL A;  4NPS A;  1S40 A;  1JE5 A;  4BY1 H;  4P71 A;  5AJ3 Q;  4X65 L;  4JG2 A;  5IP9 H;  3PIP A;  3M85 A;  4IOA A;  3ZJY C;  1Q8K A;  2WAQ E;  4KHP L;  1Y14 B;  4P73 A;  3I7F A;  1PH4 A;  1PH1 A;  4UP9 A;  1MJC A;  4JI7 Q;  1EQR A;  1Q7Y C;  3NBH B;  1HNX L;  2I5H A;  2PQA A;  2MNA A;  2GN5 A;  1IBM Q;  2WP8 J;  3F8T A;  3K80 C;  1EUJ A;  1FVI A;  4QY7 A;  4GLX A;  3BZK A;  1Y1W H;  5JJI A;  2ZJQ A;  1PHJ A;  2OQ0 A;  4YWK A;  1UWV A;  2AWO A;  3NEN A;  4NB3 A;  4PG3 A;  4L5S A;  1SR3 A;  1K9M C;  3ULL A;  4X6A H;  1L1O B;  2OTL A;  5AJ3 L;  1S72 A;  5GQO A;  2Q2T A;  4BY1 G;  4OO1 G;  1CSQ A;  3Q8D A;  3HKS A;  2L15 A;  4ME3 A;  2ZTC A;  5FLX c;  1PH5 A;  4JI7 L;  4JI8 L;  1JT8 A;  3FKI G;  1BVS A;  2DGY A;  4POF A;  2F52 A;  2QEX A;  2ES2 A;  2YYZ A;  1JB7 A;  3AEV A;  4YCW A;  4IOC A;  1HZ9 A;  1MKH A;  2YTX A;  2OCE A;  4DV5 Q;  2R92 G;  1Z9F A;  4IO9 A;  4YCV A;  1EYG A;  1A63 A;  2JA7 H;  3L0O A;  4GLA C;  1YNX A;  3FP9 A;  3NEL A;  4XTC S;  1XPO A;  1GM5 A;  3TRE A;  2V1C C;  1QVC A;  2UU9 L;  1XNR L;  2C35 B;  2B63 G;  2ASB A;  1N32 Q;  4JI2 Q;  2F3I A;  3ULJ A;  3G71 A;  2VQE L;  4KLK A;  4JYA L;  1VQF A;  3GO5 A;  3OW2 A;  1K83 H;  3M4Q A;  3FKI H;  2K52 A;  2B29 A;  5LMU L;  2NZO A;  3L7Z C;  4OWW B;  5HY6 A;  4JI6 Q;  1HNZ L;  4LF6 Q;  4LNQ A;  2R92 H;  4YHH Q;  4DR1 Q;  1I6H H;  4DUY Q;  1I3Q H;  2JA7 G;  1W3S A;  3JC6 6;  4JI5 Q;  3HOU G;  4PZ6 A;  3CP0 A;  2YTV A;  4JI2 L;  2K14 A;  4DV1 Q;  1OTC A;  3KYH C;  2Z0S A;  1CKN B;  4DV0 Q;  2K4K A;  2XTI A;  1E1T A;  1A0I A;  4JI4 Q;  4JYA Q;  4DR5 L;  2HHH Q;  1PYS B;  2K75 A;  2JE6 I;  2KBN A;  1H95 A;  4A3G H;  1K73 C;  5LMN Q;  4LF8 Q;  2E2J H;  1WYD A;  3F2B A;  1K0R A;  1YJW A;  4AYB G;  2UUA L;  4L5T A;  4O0A A;  2AKW B;  1KD1 C;  4DV2 Q;  2OWO A;  4GN5 A;  2EXD A;  4JI5 L;  4DV4 Q;  3CME A;  4B3M Q;  4A3J G;  3S16 H;  3SGI A;  3PUX A;  1N9W A;  4UP8 A;  2MFI A;  4Y7N H;  1YJ9 A;  4K0K L;  3KJO A;  3L2P A;  1YHA A;  4JI4 L;  3KFU A;  1EQQ A;  3AQQ A;  4JV5 L;  2RHQ B;  1AE3 A;  4IJL A;  1XPR A;  1M90 C;  1YZ6 A;  1N33 L;  4QIW E;  1VQP A;  4LF8 L;  5GAH C;  2JQO A;  2PI2 E;  3CPF A;  3CQZ H;  4P72 A;  5FLM G;  4DV6 L;  2BA1 A;  2R6G A;  3KLW A;  3S14 H;  1J5E L;  3ULP A;  2UXC L;  3T1H L;  1OXT A;  3HOU H;  2ALY B;  4K0K Q;  1HR0 W;  5BR8 L;  1KXL A;  2RHS B;  3KF6 B;  1VQE A;  4PZ7 A;  1L1O A;  1E3P A;  4AYB E;  1XNQ L;  4OXP A;  3U50 C;  4AIM A;  4GKJ L;  2ZJP A;  4DAM A;  3I4N H;  1IBL L;  3LGJ A;  4DR7 Q;  2N78 A;  4OO1 I;  4R4I A;  2N3S A;  4X62 L;  3H3V I;  3CCJ A;  4IFD J;  3U4Z A;  5IE8 A;  4R4C A;  2UXB Q;  1KAW A;  3W5O A;  3JAM i;  3CCE A;  2CKZ B;  1VQN A;  3UDG A;  3H0G H;  3BJU A;  1PH6 A;  2HT1 A;  3OTO Q;  3D0F A;  1WI5 A;  4QL5 A;  1QVG A;  1Q46 A;  1VQI A;  4DK3 C;  1IBM L;  2BH2 A;  3GTK H;  4TQU S;  4RMF A;  4A3B G;  2K5H A;  2I0Q A;  3CF5 A;  5LMU Q;  1IBL Q;  3J7A 5;  1CKM A;  4MNO A;  3J7Z C;  1OXV A;  1KRS A;  1VQM A;  2ATW A;  3AFP A;  1I94 L;  4NXM Q;  2CCZ A;  3S15 H;  1CUK A;  3BZC A;  4PMW A;  3H15 A;  2F4V L;  1TWH H;  1VQC A;  3K7U C;  4KHZ A;  1Y1W G;  1TXY A;  4C3I H;  1XMO Q;  1P8L A;  4HID A;  1HR0 Q;  1XPU A;  1V1Q A;  1B70 B;  3HOX G;  1HZC A;  4R4T A;  4GS3 A;  2MQH A;  5FLM H;  1PH3 A;  4B3R L;  5IY0 A;  1N8R C;  2RCN A;  4GOP B;  4DUZ L;  4LF5 L;  5IT9 c;  2GVA A;  1IL2 A;  1E7Z A;  1QUQ B;  4L5Q A;  5M3M H;  1YIJ A;  1PH7 A;  4NXM L;  3CCU A;  3B6Y A;  3KJP A;  1SRO A;  5C44 H;  5ELO A;  4GNX B;  2WAQ G;  2VUM H;  1E24 A;  3M7N A;  3S1R H;  1UE5 A;  3I4N G;  3K7A H;  4XIG S;  4IFD G;  3S24 A;  1P16 A;  1HNW Q;  1SMX A;  3TEH B;  2JJQ A;  4R4Q A;  5ELN A;  5J3B A;  1YBY A;  3E9I A;  1I50 H;  2R7Z G;  2BH8 A;  1K8A C;  2IHE A;  4DR4 Q;  4LUV A;  4JV5 Q;  5EAY A;  3U4V A;  2IT1 A;  1Q1B A;  4BA2 I;  3PO2 G;  1YEZ A;  2CWA A;  4A3B H;  4DV3 Q;  2I5L X;  1VQO A;  1VQD A;  2D62 A;  3I4M H;  4A3C G;  4DR6 L;  4EQ5 A;  4X65 Q;  2NN6 I;  1X65 A;  2ZTD A;  3KOJ A;  1X56 A;  4JBW A;  1L1O C;  1BBW A;  2B3G A;  3DM3 A;  1SE8 A;  1VQH A;  5JEA J;  2UUC Q;  3KDF B;  4JI0 L;  1VQ4 A;  3GTO H;  4DR4 L;  2HHH L;  3H3V H;  3CCS A;  3PF4 A;  3TQY A;  3DLL A; 
#chains in the Genus database with same CATH topology
 2JN4 A;  1Y1V B;  4C3J H;  3SK5 A;  2UU9 Q;  2A6H D;  4OWT B;  4A3G G;  4A3K H;  2FHT A;  3I8Z A;  3KLR A;  5GAD C;  4LFB L;  1GHK A;  5C0X J;  1I4G A;  4QUC A;  4MZ9 A;  1JOK A;  1S4Z A;  3PV0 A;  4KD4 A;  3S17 B;  2RDH A;  1PLF A;  4CGY B;  1HH2 P;  4A3M B;  4ZK9 B;  2TMP A;  4JI0 Q;  1DON A;  2PQA B;  1YHQ A;  4GZY C;  4CJ0 B;  4X66 L;  5IIF A;  4ZQ3 A;  3R2I A;  1XNR Q;  1STH A;  4LUZ A;  3T56 B;  1Q82 C;  1ML0 D;  4XDX A;  1LV9 A;  1JQY D;  2Q8R E;  1XMO L;  2KJX A;  4YY3 Q;  3HOV G;  4DR3 L;  1KLU D;  3WOE A;  1XNQ Q;  3JAM L;  3PIP 3;  2JA8 B;  1CHP D;  4X3K A;  3BVM A;  2B2Y C;  1V43 A;  1SYG A;  3KF8 B;  4MIU A;  1HJP A;  4HCS A;  4QQB X;  2XSC A;  5M3F B;  3RLN A;  2B2U A;  1TS5 A;  2JK8 A;  4HJ8 A;  1PYB A;  1U4R A;  2F0V A;  5IWA Q;  3HOW H;  1LTT D;  3R8B A;  2JA6 B;  3H0G G;  3EIV A;  3NEM A;  1K0S A;  4ABN A;  2MO1 A;  4H0L C;  4JBJ A;  4DKA C;  4JCV E;  1X3E A;  2AQ3 B;  3SR1 A;  2KED A;  3TRZ A;  4A4I A;  4UHV A;  3W2D A;  5IGC A;  2K01 A;  4FVM A;  4A3K G;  2AMC B;  2D0O A;  4JOI A;  2VS1 A;  2NBF A;  4A3I H;  2HCC A;  2EJF C;  4Y52 H;  5C3E H;  1X3G A;  2K04 A;  4A3L G;  1B8A A;  5DAU A;  4ZKB B;  1O7I A;  4A3D B;  3PUZ A;  2VW9 A;  1HNZ Q;  5ELC A;  3NWT A;  4DV0 L;  3CU7 A;  1GXD C;  4R1J A;  3N52 A;  4DU9 A;  4DV1 L;  2B2W C;  1KDB A;  3I70 A;  3J81 c;  1J5E Q;  2OTJ A;  2PZW A;  3A54 A;  1X9N A;  1WCM H;  3T53 B;  2KQ3 A;  2YV5 A;  5C5M A;  5KRU A;  1C4Q A;  3JAM E;  4HIO A;  2JA7 B;  4KY7 A;  2LMC B;  2F0N A;  2V4D A;  2E2J B;  4KY6 A;  4G4K A;  3TSS A;  5L37 A;  1MGS A;  5CGK A;  1VS0 A;  2E74 C;  2EZV A;  4PMC A;  5I2Y A;  2KCC A;  3H6M A;  3G48 A;  4IPG A;  1GUT A;  2P5Z X;  5C0X I;  4IUR A;  2OF1 A;  2JA6 G;  2AUJ D;  5TSS A;  4NXN L;  4P74 A;  2K6A A;  3WOF A;  1RTO A;  3S14 B;  3OSO A;  1GUW A;  2PMZ E;  4KN7 C;  4X3S A;  4AYB B;  3A0J A;  1EIG A;  4FF4 A;  1HUN A;  1HHV A;  4BBS G;  4KTA A;  4X3T A;  1TS3 A;  3MHB A;  4PZ8 A;  4A3L H;  2JA8 G;  2WB1 E;  1TWG B;  1SFO B;  2F0Q A;  1B50 A;  1PH8 A;  3NSW A;  4RHR A;  2BE5 D;  3O13 A;  1VQB A;  2E5L L;  5I6W A;  3E9H A;  1JWS D;  4UP7 A;  5I4D A;  1EQV A;  1RHP A;  1A3T A;  2R7Z B;  1TWA B;  3KBG A;  1BBU A;  4ODG A;  3BYT B;  3GTK B;  4NDX A;  1Q3L A;  5IP7 G;  4UPA A;  2F03 A;  3K0X A;  1TWG H;  1NCV A;  2NZ1 D;  2N49 A;  4MHE A;  3PGZ A;  2CFM A;  3T1Y L;  2FIN B;  2I5M X;  1NJI C;  1R9T H;  2HD3 A;  3CC7 A;  2KHJ A;  3M3Y B;  2KHI A;  3W1B A;  3NQI A;  2PNH A;  3M4O B;  4BXX G;  4RH6 A;  4IPC A;  1JIC A;  4GN4 B;  2NVT H;  1Y8P B;  1Y1V G;  2K28 A;  2EYM A;  1OXS C;  1A3V A;  1VQ9 A;  2NN6 H;  5GRO A;  4HJ5 A;  3SK6 A;  1C0A A;  3RZO B;  2NVX B;  1MD2 D;  3T51 B;  4FXD A;  1LTA D;  1EZ6 A;  1WVL A;  1JE4 A;  1IZ6 A;  2A6H C;  1NY4 A;  2K50 A;  2DJF C;  3A55 A;  5IYC G;  1MJE A;  1B9M A;  5BN4 A;  2CW0 C;  3BVG A;  4N9T A;  4RKL A;  1WJJ A;  2JA9 A;  5JJK A;  3J81 j;  3TDQ A;  4A3D H;  1PTO C;  3HKZ G;  1TWH B;  5E7N A;  5M9O A;  3TS2 A;  4DK6 C;  2A8V A;  4B3T L;  2R93 B;  2H5X A;  4K6L A;  5C4J H;  1LUZ A;  2DNC A;  1II3 A;  3D4W A;  3FPP A;  1L2F A;  4U68 A;  4LFC Q;  1FYC A;  1EFI D;  4DPG A;  4ZYS A;  1TS4 A;  4DV7 Q;  3J81 i;  2O5I C;  3JAM c;  1NTG A;  1EEI D;  5EBC A;  4A3I B;  4K2K A;  1EU4 A;  3CCL A;  4KHP Q;  2ZJR A;  1PRT F;  4O2D A;  4R4O A;  4GNX C;  3HOY G;  4DGZ A;  4B9X A;  1IXR A;  3AB9 A;  3H91 A;  2NWG A;  4G7H C;  4OGQ C;  2UUA Q;  2LKV A;  3HRZ C;  1G91 A;  4FXG C;  4JG2 A;  4XYQ A;  4KHP L;  4P73 A;  3I7F A;  4RCN A;  4UP9 A;  2RSN A;  2JA5 B;  5EJW A;  2MNA A;  2F0H A;  2GN5 A;  2WP8 J;  3K80 C;  3DWA A;  4GLX A;  1IBM Q;  3S2H B;  4K5V A;  1PHJ A;  1SDF A;  4NB3 A;  2SNM A;  1EY6 A;  3VR5 A;  1CI3 M;  4K14 A;  1B4O A;  2Q2T A;  1SE3 A;  1RD9 D;  4ME3 A;  1LTB D;  1TU2 B;  1VF7 A;  1JT8 A;  4KKS A;  2QEX A;  3BG3 A;  1JB7 A;  4YCW A;  1B2T A;  3MXP A;  2OCE A;  2CVR A;  3IL8 A;  1Z9F A;  4PNY A;  4YCV A;  3J7Y W;  4IO9 A;  2R92 G;  3M4Y A;  3FP9 A;  4XTC S;  1XPO A;  3C2P A;  4NP5 A;  2C35 B;  1N32 Q;  2QCP X;  1VQF A;  4QIW B;  3OW2 A;  1KDA A;  1FGB D;  2NZO A;  1ZKO A;  4HR7 B;  3S1M B;  3MVV A;  4LNQ A;  1V8Q A;  4HMJ A;  5FO8 B;  3HOU G;  3OMG A;  2YTV A;  3PQI A;  2L12 A;  1OTC A;  1A2U A;  4DK0 A;  1UUP A;  1CKN B;  2LFN A;  1BOS A;  5BN3 A;  1A0I A;  1PZJ D;  2CHB D;  3VR4 A;  2F0J A;  4FXK C;  4JYA Q;  2SDF A;  4WOR A;  2HHH Q;  1PYS B;  3D8G A;  2JE6 I;  2KBN A;  3LX0 A;  1U4P A;  2Z9H A;  3P7J A;  1K8M A;  5IOC A;  5LMN Q;  1WYD A;  2RKS A;  1K0R A;  2OXP A;  3HGB A;  3KF8 A;  2A6E C;  5EPJ A;  4DV2 Q;  2B8G A;  4JI5 L;  1PRT B;  3CME A;  1DM0 B;  5FO7 B;  4A3J G;  3S16 H;  4QMG A;  1TT2 A;  1VMC A;  1IL8 A;  4JV5 L;  3OIQ A;  4HMI A;  1M90 C;  5A2Q E;  2WIN B;  3CQZ H;  4DV6 L;  3H0G B;  1STN A;  1UEA B;  3T1H L;  1IKM A;  2DNE A;  5A35 A;  1X3P A;  1ESF A;  2C9O A;  3NUC A;  4CDF C;  1EL0 A;  3U50 C;  1TY0 A;  4KK7 A;  4GKJ L;  2ZJP A;  4DAM A;  4DXG A;  3LGJ A;  4DR7 Q;  2N78 A;  1PFM A;  4OIK A;  2F0F A;  3JAM i;  1ENC A;  3CCE A;  1VQN A;  2HQE A;  1K28 A;  3A8J E;  1WTR A;  3AMU A;  3HOV B;  1FNU A;  2EYF A;  4QL5 A;  3X3N A;  3HOU B;  1SYF A;  4TQU S;  1HCZ A;  3CKI B;  3CF5 A;  1ZYR C;  2B2U C;  1SE2 A;  1NR4 A;  2ATW A;  3S15 H;  1I4P A;  2CCZ A;  1BCP F;  3I4N B;  5DM7 3;  3H15 A;  1TWC B;  1TXY A;  1F2M A;  1F9P A;  4C3I H;  2EY5 A;  2KCN A;  2NVQ B;  1XPU A;  1PTO B;  1CTM A;  1JC7 A;  5FLM H;  2MQH A;  4XYO A;  4B3R L;  2NVT B;  1KNA A;  3NXW A;  2RCN A;  4HSV A;  3ND8 A;  1D5Z C;  3QR8 A;  1IL2 A;  4A3G B;  1E7Z A;  1HTP A;  4K5W A;  3MA2 B;  2PZT A;  1PZI D;  1EU3 A;  3KJP A;  3D4R A;  2WV6 D;  2WAQ G;  3M7N A;  3I4M B;  1O78 A;  3M7G A;  2E2I B;  3SE0 A;  2JJQ A;  1FNW A;  5IGB A;  3E9I A;  2R7Z G;  1KAA A;  1JB3 A;  1B53 A;  2IT1 A;  3FVQ A;  1YEZ A;  2CWA A;  2ZXO A;  4DV3 Q;  4ZUI A;  3U9O A;  1VQD A;  2D62 A;  3EQL C;  4X65 Q;  3SVM A;  1S5E D;  5FLX E;  2ZTD A;  2IPK D;  4KHV A;  4OEL B;  2WAQ B;  2HHH L;  3H3V H;  2BCO A;  1LAC A;  3HOY B;  1STB A;  1TVX A;  1XJV A;  1QZH A;  2NUC A;  4GKJ Q;  3I2Z A;  2F0P A;  1L0W A;  2PYK A;  1IW7 C;  1DCZ A;  4BWG B;  5KND A;  1K8G A;  3HOW G;  2K5Q A;  1WOC A;  1UE1 A;  4AH6 A;  3GTP B;  5K36 H;  1Y69 U;  4WJ4 A;  2DUD A;  5F2D A;  1N36 L;  3GTM H;  4GKK L;  4PMB A;  4NW2 A;  1E2V A;  1E1O A;  3G4S A;  1VQ8 A;  3PUY A;  3FHW A;  2B2W A;  3CQZ B;  2F0E A;  1SFO H;  4HED A;  4DAV A;  1HNX Q;  3R2T A;  2NTT A;  1PTO F;  4A3C H;  4B3S L;  1Q86 C;  3ZYY X;  1WTQ A;  3V05 A;  4L8J A;  2R7Z H;  1TQO A;  1FJG Q;  3RUZ A;  2H4O A;  1N36 Q;  2FXQ A;  1BUV T;  1VQ7 A;  4IAL A;  3VYS A;  4DUY L;  1QZG A;  1EY7 A;  2KHS A;  3UDI A;  3MAQ A;  1WCM G;  4X62 Q;  5EKI A;  5FO9 B;  1IBK Q;  3CD6 A;  1H9S A;  1K3R A;  4K8J A;  2ENB A;  4CJ1 B;  3ONA B;  4BY7 H;  1YVC A;  4IUN A;  2XVS A;  4IJH A;  1EWH A;  3VDY A;  2X6G A;  5C3E B;  3PO3 H;  2K05 A;  1DZ1 A;  3KDF A;  2QIL A;  1LT3 D;  2MGS A;  2NVY B;  4QCL A;  1T9H A;  1PMR A;  1ESR A;  3J81 E;  5BR8 Q;  2WKD A;  3C46 A;  4MTN A;  2B2Y A;  3ICE A;  3PIO A;  2IL8 A;  3CXC A;  4A3J B;  1PRT C;  2QGQ A;  2IX3 A;  4ALP A;  3ND9 A;  3EBE A;  1TWF H;  1G51 A;  1LTG D;  4JC0 A;  3D31 A;  3GV6 A;  4K5X A;  1FD7 D;  5KIX A;  1QIL A;  4BBS H;  4DAY A;  3A74 A;  2A6E D;  2I07 B;  1SJE D;  2N55 A;  2WFW A;  1O7L A;  3UE0 A;  4IN3 A;  2VUM G;  5FJ8 G;  3F1Z A;  3C3L A;  4DK1 A;  4BBR G;  4DR7 L;  3AFQ A;  5JJL A;  3GTL H;  3Q23 A;  2WAC A;  2FJ2 A;  1SRU A;  2EY6 A;  3I4O A;  1S5D D;  1EYD A;  2UXD Q;  2UUC L;  4QB4 A;  2I46 A;  3BDO A;  1FJG L;  4ID6 A;  2JEA I;  4J8Q A;  2K32 A;  4A3F G;  3ERS X;  4AQY Q;  1N34 Q;  1PVO A;  3NBI A;  2R93 H;  2O2L D;  3OYY A;  1H9R A;  4C3J G;  4Q5V A;  3E0J A;  2NVQ H;  4CKC A;  1FL0 A;  3P75 A;  1G2S A;  2LXJ A;  2NN6 G;  4OIJ A;  5IWA L;  2F0K A;  1VQG A;  3CW2 C;  4N8F A;  4YHH L;  4XT3 B;  3ERO A;  3PUW A;  3VYU A;  1VQA A;  3E3X A;  2MUY A;  5IYC H;  3MTS A;  3K7A B;  1HA5 A;  1AW7 A;  3MXN B;  5IYD H;  5I6Y A;  3MFG A;  2B63 H;  4A3D G;  3T13 A;  4P75 A;  2KCT A;  1B3Q A;  2F0O A;  1Z6H A;  1C8C A;  5FJ8 H;  2F4V Q;  4DV5 L;  1PFS A;  1G29 1;  1BCP B;  5JVH 3;  4BBR H;  1Q12 A;  4WJ3 M;  3CAM A;  4JI3 L;  1NMG A;  1ILP A;  4DNI A;  5IYB G;  3KLS A;  3HOZ H;  4PQX A;  3PO3 B;  2QA4 A;  2IY5 B;  5M3M B;  4K2L A;  5D3I B;  2EJM A;  1NBW A;  2DN8 A;  1JMC A;  1WD1 A;  4A3E H;  4QUF A;  3CCV A;  5M3F G;  5JEA G;  5COR A;  4DR5 Q;  2R93 G;  1SXT A;  4S3S A;  2B39 A;  2F3W A;  4JI3 Q;  2IHF A;  4OL7 A;  1AP0 A;  5H1S E;  3HKZ B;  3M4O H;  1LTL A;  4UAI A;  4GLV B;  3GTJ H;  4LF7 Q;  1Q8I A;  1X55 A;  4DXF A;  4LJZ C;  1J8I A;  1BXT A;  3NWS A;  3MFY A;  3URY A;  3K5M A;  4JOI C;  1C9O A;  3FPU B;  1PTO H;  1GUN A;  1VDZ A;  3ER0 A;  1LYL A;  5AFW A;  4KY5 A;  1GVP A;  1LM0 A;  5CR3 A;  4RKB A;  2KCM A;  5G3L F;  5M5Y B;  2KEC A;  1N33 Q;  4DR1 L;  1HFG A;  4A3M G;  3OHX C;  4LWC A;  2PI2 A;  2R7D A;  2Z1C A;  3TZU A;  2E76 C;  4LFA Q;  2PZU A;  1XWE A;  4ME5 A;  1HZB A;  2K5V A;  2A5H A;  1E2Z A;  1UE6 A;  5GAE C;  3RR5 A;  1YHB A;  5J22 A;  1Y1W B;  3X3M A;  4B3R Q;  2RQX A;  3HOZ G;  3NHH A;  1EIY B;  1D5X C;  5LL6 S;  1UEB A;  3GDE A;  2KVM A;  5EQ0 A;  1VMP A;  2CW0 D;  2MJ8 A;  5AJ3 Q;  4X65 L;  5IP9 H;  4ZCK A;  3PIP A;  2OT2 A;  5CV5 A;  4IOA A;  1Q8K A;  2WAQ E;  5JEA H;  2B8F A;  4ZRZ A;  4L6T B;  1MJC A;  2G5D A;  3G7L A;  3DMU A;  2RSO A;  4CDD C;  2PQA A;  1MI2 A;  1QVF A;  1DOK A;  3F8T A;  1EUJ A;  1Y1W H;  4YWK A;  1UWV A;  5CV4 A;  5C6A A;  5LHY 1;  4X6A H;  3ULL A;  1L1O B;  1S72 A;  2KEE A;  4BY1 G;  4OO1 G;  1CSQ A;  3HKS A;  4QF4 A;  5FLX c;  2ZTC A;  3T16 A;  1PH5 A;  4EQN A;  1EYA A;  1ROD A;  4C3I B;  3FKI G;  1MSH A;  1B9N A;  2J7Z A;  1X32 A;  1UNS A;  1CHQ D;  2YYZ A;  3AEV A;  4IOC A;  1HZ9 A;  2ICE C;  2YTX A;  1EYC A;  2F0D A;  1D2B A;  1YNX A;  2QDB A;  1GM5 A;  1XNR L;  1QVC A;  2ICI A;  2SOB A;  3V96 A;  2ASB A;  2KA7 A;  1XX8 A;  4JI2 Q;  1W6J A;  2K33 A;  3I73 A;  4JYA L;  3KLS X;  3G71 A;  4KLK A;  3GTL B;  1O7Z A;  3P1H A;  4OWW B;  4A3B B;  2AUK A;  1AZP A;  1G8Z D;  1I3Q H;  2JA7 G;  1W3S A;  1QNK A;  3JC6 6;  4JI5 Q;  3K5O A;  4JI2 L;  2K14 A;  4ZLT F;  2Z0S A;  3DEO A;  4O1N A;  1HPC A;  2XTI A;  1E1T A;  4JI4 Q;  4HTH A;  4IQZ A;  4DR5 L;  1HTL D;  2K75 A;  4CKE A;  4A93 B;  4KN4 C;  3K5L A;  4CKB A;  2B2T C;  1H9J A;  3TP7 A;  5C44 B;  2AKW B;  2OWO A;  1ET9 A;  4GN5 A;  3PUX A;  1N9W A;  2L1B A;  4A3K B;  1TKW B;  4Y7N H;  5E4X A;  1IYV A;  3L2P A;  3DWQ A;  2A68 C;  2B63 B;  1LTI D;  3AQQ A;  1AE3 A;  4IJL A;  3KBX A;  5NUC A;  1ICW A;  5ELD A;  2Q8I B;  4QIW E;  3CPF A;  5FLM G;  2R6G A;  3S14 H;  1J5E L;  3ULP A;  1QJO A;  2UXC L;  1OXT A;  1EIH A;  2QW7 A;  4IUQ A;  4K0K Q;  4F87 A;  3RZD B;  3KF6 B;  3SXH A;  2F3V A;  3OMC A;  4DNR B;  4OO1 I;  1D5M C;  4KJN A;  3U4Z A;  4R4C A;  4A3E B;  2CKZ B;  1CQF A;  2G9D A;  2L9H A;  1G2T A;  4RCO A;  3BJU A;  2HT1 A;  3I4L A;  4RFB A;  3D0F A;  1WI5 A;  1IBM L;  1Q46 A;  1LTR D;  3UI2 A;  4C3H G;  3K5N A;  2KUM A;  1IBL Q;  3J7A 5;  3J7Z C;  3L9A X;  1I94 L;  1I6H B;  3S1Q B;  4KJO A;  1VQC A;  3K7U C;  1I4X A;  1IKL A;  3MZ5 A;  1P8L A;  4HID A;  1SMY C;  2WB1 B;  3HOX G;  1PH3 A;  1HZC A;  4GS3 A;  3HEJ A;  1BCP D;  2Z4I A;  1N8R C;  4GOP B;  1G6Z A;  4DUZ L;  2GVA A;  3QOL A;  1QUQ B;  3FRP B;  4NXM L;  1PRT D;  2A74 C;  1SRO A;  5C44 H;  4LK1 C;  5ELO A;  4GNX B;  1UE5 A;  5CBA E;  4R8N A;  3DXJ C;  5ELN A;  2MHV A;  1I50 H;  2M2L A;  1K8A C;  1JR0 D;  3PO2 B;  4LUV A;  4BA2 I;  1BDO A;  3AU7 A;  3BDL A;  4A3C G;  2NN6 I;  1SYE A;  1X56 A;  2A69 D;  2XRQ D;  1F2L A;  1I4Q A;  3DM3 A;  2UUC Q;  1VQ4 A;  1QOH A;  1BBX C;  3PF4 A;  5T1G A;  4TSS A;  3DLL A;  1CA6 A;  2R3Z A;  1KL9 A;  1EFW A;  2DJG C;  4LFC L;  3PO2 H;  4GNX A;  4DR2 Q;  1D1I A;  1A62 A;  3BU2 A;  4BY7 G;  5HUR A;  3IRB A;  5M3M G;  1A15 A;  1QUQ A;  3A8K E;  1U9R A;  1XTD A;  3PO3 G;  1SNQ A;  2X6L A;  1J9O A;  3GTQ B;  1VF5 C;  2PW5 A;  4ZKC B;  1SNC A;  2A19 A;  3CHB D;  2H1E A;  3I90 A;  2ZTE A;  3MWY W;  4FNF A;  3NPP A;  4CHT B;  2Z6K C;  5FLX L;  3PF5 A;  5ELE A;  1LT6 D;  2MO0 A;  5IOD A;  4H02 A;  2M00 A;  3A5U A;  4YWL A;  1RTN A;  4LFB Q;  5C44 G;  4V0B A;  4NKL A;  1IW7 D;  3GV3 A;  2EYJ A;  5HGT A;  2VNU D;  4PV1 C;  4A93 G;  4LUO A;  4CDE C;  2N8N A;  5FK9 C;  1L0Y B;  5C5L A;  1NSN S;  5EBD A;  1CKO A;  1A6X A;  5JJZ A;  1OXU A;  2UXB L;  2RCF A;  4E6I A;  4DV4 L;  2EJG C;  2IW3 A;  1ENA A;  1KC8 C;  2ZT9 C;  4LF4 L;  1X3Q A;  1W6K A;  3J80 L;  2YTY A;  1CQV A;  1X3F A;  1WFQ A;  3HOV H;  4IUT A;  1EWI A;  3S9W A;  4FF3 A;  3IFT A;  4GOP C;  1QB5 D;  2OQK A;  1WD0 A;  2C5C A;  3HOX B;  1RIP A;  1QNU A;  4HJA A;  2QEJ C;  2E5L Q;  4LF4 Q;  4BA1 I;  2JA5 H;  2CH4 W;  3GTJ B;  1BKB A;  1MIU A;  4A3F H;  4C3I G;  5DNF A;  3VR6 A;  2PNR C;  1YJN A;  5M5W H;  4BBR B;  4IPH A;  1K8O A;  4H7B A;  4BY1 B;  5M5X H;  5T1I A;  5IGF A;  2Y0S G;  5KGU A;  5HGQ A;  2XRS D;  1JOQ A;  2E2I H;  4I7A A;  4TVA B;  3E6Z X;  1M1K C;  1ENF A;  2PCF B;  3H09 A;  1C7Y A;  4A93 H;  5C4X H;  2UXD L;  1CZW A;  1M4V A;  2CQO A;  4RGM A;  1N34 L;  1IHZ A;  2Q2H A;  4RG1 A;  1B3A A;  4DV3 L;  4JBM A;  1J6Q A;  4CJ2 C;  1DGS A;  3J81 L;  2RDF A;  3RLO A;  3V2T A;  3K81 C;  3F2C A;  1F9Q A;  4QJF A;  4HJ9 A;  3UE1 A;  2GVB A;  1LAB A;  5CV7 A;  5KYL A;  1KQS A;  2A1A A;  5D65 A;  2JA8 H;  1KHI A;  2ZXR A;  1GKH A;  2Y0S E;  3DHQ A;  3BS1 A;  2EQS A;  2KEN A;  2NTS A;  1XYI A;  3IFD A;  2HIX A;  3W1G A;  1RL2 A;  2JP1 A;  4APV A;  5GAG C;  2VQF Q;  5K5P A;  1PH9 A;  4QGU A;  3SK4 A;  3KF6 A;  3S2H H;  1EY8 A;  1S5B D;  1YNN D;  2JA6 H;  5K36 G;  2D9U A;  4LAA A;  2JSO A;  2JYO A;  1U4L A;  3HKZ E;  3EJI A;  4EGV A;  3UDX A;  2XGT A;  1E2W A;  5JAV A;  4YY3 L;  1PDQ A;  1EZ8 A;  1PH2 A;  5IGE A;  3IAY A;  1Y1V H;  4X64 L;  5C4X G;  3S1Q H;  4UY8 C;  3M4P A;  2E2H H;  3IKJ A;  4I7Z C;  4DV2 L;  3I56 A;  4HJ7 A;  3RN2 A;  3ERQ A;  5IT9 E;  2QDL A;  2HIV A;  2Q2U A;  3QOJ A;  1SLJ A;  5EKL A;  4LF5 Q;  4BY7 B;  1GO3 E;  1Q90 A;  5IP7 H;  1AH9 A;  4DUZ Q;  2UUB Q;  4LF7 L;  4LF6 L;  1NMF A;  3FDT A;  4X64 Q;  1JJC B;  2NVY H;  1SND A;  4DV6 Q;  5C4J B;  2MP1 A;  1UE7 A;  2BDN A;  3WWV A;  3CCM A;  4LF9 L;  1U5K A;  5C0X H;  1A2T A;  4F7X A;  1STE A;  4BXX H;  2E2D C;  3M3Y H;  1SN8 A;  2JXM B;  5EGT A;  4KKU A;  3OIP A;  2K1B A;  1HQM C;  2CQA A;  3GTM B;  4GKK Q;  5IP9 G;  5M5W B;  2HQL A;  4YWM A;  1JOO A;  3RZO H;  2IX1 A;  1OXX K;  5CV9 A;  3S16 B;  1M8A A;  1B1Z A;  1Z47 A;  1SNM A;  1B7Y B;  3I72 A;  1D8L A;  3QIA A;  2EIF A;  2EYP A;  3VA7 A;  4JI1 Q;  2CWP A;  4B3S Q;  3NE5 B;  1NE3 A;  3HOY H;  3D6W A;  4FYD A;  4HIK A;  1HZA A;  4MN3 A;  1JWU D;  1KIX A;  2DY8 A;  1YI2 A;  1BF4 A;  4DF7 A;  1ASZ A;  4L63 B;  2NZH A;  2WB1 G;  1GOZ A;  2UXC Q;  3S1N H;  1ZYR D;  1VCI A;  3A56 A;  1R4P B;  3J80 c;  3OWE B;  1I6V C;  1LO5 D;  4N9P A;  4LMQ D;  1H9M A;  3EFX D;  4C3H B;  3OWF A;  3M85 A;  1Y14 B;  5J39 A;  1PH1 A;  1EQR A;  1DXM A;  3NBH B;  1TII D;  1RCV D;  2VB3 X;  4RWS C;  2AWO A;  3EVQ A;  2L5T A;  1SR3 A;  5GQO A;  1AZQ A;  2K5W A;  2ZXP A;  1PZK D;  2EYH A;  4JI7 L;  1BVS A;  4POF A;  2F52 A;  4F88 A;  1MBY A;  3NQT A;  3DEP A;  1I3Q B;  4RGN A;  3NBH A;  2M9V A;  4DV5 Q;  3E5S A;  1EYG A;  2F0W A;  1A63 A;  1WTW A;  3H3V C;  1SYD A;  2SNS A;  4GLA C;  3NEL A;  4C1N I;  2V1C C;  2B63 G;  3CRL C;  2PPB C;  1GHJ A;  2K5D A;  3KK7 A;  4JPB W;  2VQE L;  4FF2 A;  4P2C B;  1K83 H;  1AFP A;  2QF7 A;  2EY1 A;  1HA6 A;  1KNE A;  2LS0 1;  5DEH A;  4DFA A;  5JPM C;  3A8I E;  5HY6 A;  2XWB B;  4HAE A;  4JI6 Q;  4LF6 Q;  2R92 H;  4YHH Q;  4DR1 Q;  2EYL A;  1I6H H;  4PZ6 A;  1BR9 A;  2F0U A;  3CP0 A;  3KYH C;  4HSP A;  3Q22 A;  1I4R A;  2K4K A;  3QB3 A;  4XQN A;  3SDZ A;  3TP6 A;  5I9P A;  3VR2 A;  3CRK C;  2G9H D;  4RA8 A;  1CK1 A;  4KV6 A;  3J7A V;  4A3G H;  4LF8 Q;  3F2B A;  2F0T A;  5KNB A;  1YJW A;  4ULL A;  2UUA L;  1KD1 C;  4C3J B;  1KAB A;  5E3F A;  3C1E A;  4R8I A;  4B3M Q;  3SGI A;  2Z4H A;  3L3O C;  1SSO A;  2MFI A;  1R4Q B;  4K0K L;  3KJO A;  1YHA A;  5DM6 3;  3HS0 C;  5C4H A;  3OOC A;  2EE1 A;  3LWE A;  4IUP A;  3TN2 A;  4UDU C;  1U4M A;  1YZ6 A;  1N33 L;  3SHL A;  1VQP A;  3VA5 A;  3MXN A;  5GAH C;  2JQO A;  2PI2 E;  4P72 A;  3EA6 A;  2KOL A;  4KD3 A;  3VYT A;  4IFD H;  4EQP A;  3PIO 3;  1SYB A;  5BR8 L;  1DOL A;  3S1N B;  1VQE A;  4PZ7 A;  4AYB E;  1E3P A;  4G57 A;  3I91 A;  3P20 A;  4ZAI A;  2J0T D;  2PQE A;  5FOB B;  1TWF B;  4HCE A;  4R4I A;  2N3S A;  3H3V I;  4IFD J;  5IE8 A;  2UXB Q;  1KAW A;  3W5O A;  5CC4 A;  3H0G H;  1PH6 A;  1ONL A;  3OTO Q;  3GP7 A;  1QVG A;  3GTK H;  1NUC A;  1EY4 A;  4RMF A;  5LMU Q;  1KLG D;  1OXV A;  4HN7 A;  1VQM A;  5KEE A;  3DUZ A;  4NXM Q;  1JOR A;  1CUK A;  2IJ0 A;  3BZC A;  2F4V L;  2PW7 A;  1TWH H;  3A7L A;  1A3U A;  1Y1W G;  1ET6 A;  3N6R A;  4DN4 M;  2L0C A;  1HR0 Q;  4G7Z C;  1IYU A;  5EKK A;  1V1Q A;  1JCK B;  4R4T A;  2FMC A;  4RAU C;  1I4H A;  2TSS A;  4LF5 L;  2WKC A;  2EDG A;  1Y8N B;  1YIJ A;  5M3M H;  1PH7 A;  1RF2 D;  4N8X 1;  3CCU A;  3B6Y A;  3FMC A;  4TKO B;  3NTK A;  3T4A C;  2IWH A;  1PXU A;  3I4N G;  3K7A H;  4JK1 C;  3A7A B;  4RHS A;  4XIG S;  1WCM B;  4IFD G;  1P16 A;  4H44 C;  1O7Y A;  1SMX A;  1KTK A;  2VB2 X;  3TEH B;  5J3B A;  4DA2 A;  1T5X D;  5C3W A;  3I3C A;  2IHE A;  5EAY A;  3U4V A;  4R9W A;  1SE4 A;  1Q1B A;  2OEO A;  1XTC D;  1DJR D;  4A3B H;  1L0X B;  2K03 A;  3OPO A;  3I4M H;  2YU9 B;  4DR6 L;  4BS9 A;  4EQ5 A;  1X65 A;  1YNJ D;  3KOJ A;  3S1R B;  3RMH A;  1L1O C;  2B3G A;  2F1M A;  2F0L A;  3KDF B;  3D6C A;  5CMD A;  3WDN A;  3TQY A;  3W3A A;  1EOV A;  4NXN Q;  3M9B A;  2JEB I;  1RKN A;  4DV7 L;  1BNZ A;  4Q0F A;  1Q1E A;  2K7V A;  1PV4 A;  2RF4 A;  3EN2 A;  3NP8 A;  5DLQ E;  2NB0 A;  1YNJ C;  3MXG A;  3STB C;  4POG A;  4FDB A;  4Z9C B;  1PTO D;  1FNV A;  2LSS A;  3GTG H;  3D3R A;  4J6H A;  1V1P A;  4L5R C;  1NR2 A;  2BDO A;  3F2D A;  3VYR A;  1MSG A;  1NAP A;  2AWN A;  5IGD A;  3K0Y A;  1YNN C;  3CC4 A;  3PUV A;  3F2U A;  1VQ5 A;  3T1H Q;  1XMQ Q;  3GD7 A;  1LT4 D;  1A8V A;  3R93 A;  1EOT A;  3PSI A;  3LNN A;  4LW1 A;  1JJG A;  4JI6 L;  1CT1 D;  2E2H B;  1PA6 A;  2QKI C;  4DAY B;  1GD7 A;  4TRD A;  4LFA L;  1CFM A;  3I4M G;  3T1Y Q;  1XMQ L;  2BA0 A;  1C48 A;  4IFD I;  1V9P A;  1T5E A;  4JI8 Q;  4A3F B;  2LXK A;  1TR5 A;  2E8G A;  2XWJ B;  4V19 0;  4OEM B;  4J15 A;  1G6P A;  2NVX H;  3CCR A;  4C3H H;  2N88 A;  1E22 A;  5JPN C;  1I94 Q;  1KRT A;  3NTI A;  5LMN W;  1HRJ A;  1S3O A;  4DR6 Q;  1AN8 A;  1IBK L;  2F0I A;  2ZM6 L;  2D0P A;  1HR0 L;  3NK9 A;  1WTV A;  2F0S A;  5C4X B;  5I9O A;  4EQO A;  4C2M B;  4B9W A;  4J1M A;  4JBK A;  4KI0 A;  5JVG 3;  3HOX H;  5J1Z A;  2MPM A;  3H94 A;  3TP5 A;  2K5N A;  2VUM B;  2R7F A;  1LLR D;  1H9S B;  1R9T B;  2HDM A;  3OTO L;  1EY0 A;  1F77 A;  3GTP H;  1I5F A;  1JJ2 A;  5LMN L;  3S17 H;  3E0E A;  4JI1 L;  2O5J C;  5M5Y H;  3HP3 A;  3VR3 A;  3PMF A;  5FKA C;  4X3U A;  5CYU A;  3S2D H;  1Y8O B;  4X66 Q;  2RA4 A;  3C1F A;  4IUV A;  3Q24 A;  5ELF A;  1B44 D;  3A5Z B;  3J80 E;  4B3M L;  1PFB A;  2PMZ B;  1S5F D;  3S1M H;  3RN5 A;  2IX0 A;  1W2B A;  3K8A A;  3PCO B;  4RGT A;  2EXZ A;  4A3I G;  1GUS A;  2L11 A;  3D4D A;  1QG7 A;  4XQJ A;  5C3E G;  3Q0A A;  2A73 B;  1MHW C;  1Q81 C;  5CV8 A;  3MEF A;  5I2X A;  1N32 L;  3RZD H;  1TWC H;  5IYD G;  1BCP C;  1VQ6 A;  1TWA H;  1TY2 A;  2HCI A;  3CPW A;  3FKI B;  1F2Y A;  5LL6 X;  3UDF A;  4JVZ A;  1WTX A;  1SNP A;  2VL6 A;  4GN3 B;  4AQY L;  1D7Q A;  2Y0S B;  5C0X G;  4XXE A;  4IUU A;  5IGG A;  4CDC C;  2ID0 A;  4C56 C;  2GA4 B;  1DYQ A;  3DWP A;  1F9R A;  4CBV A;  3G6E A;  1HNW L;  1CZG A;  5IYB H;  2A69 C;  3J7A F;  5ISR A;  5C4Z A;  3J80 i;  2UUB L;  1I50 B;  4C2M H;  3TP8 A;  4OWX B;  2VQF L;  2PO4 A;  5C3X A;  4A76 A;  4DR2 L;  3BZD B;  1RJT A;  4M1U B;  3MXU A;  3CCQ A;  3RNU A;  1LT5 D;  1ICF B;  1S5C D;  1V1P B;  4LF9 Q;  4HIM A;  1JWM D;  3HOW B;  1FGU A;  1EQT A;  2F0M A;  2R92 B;  1QE6 A;  3SEB A;  1ILQ A;  2EPB A;  2Q2I A;  1IYJ B;  1DOM A;  1CKN A;  1EY5 A;  2J4X A;  1GJX A;  1RDP D;  2ZM6 Q;  1AE2 A;  3U58 A;  4KKT A;  3I55 A;  3AYH B;  4DR3 Q;  3GTQ H;  2VZA A;  1X54 A;  1EIF A;  3HFZ B;  4A3J H;  1LTS D;  1BQQ T;  3RLF A;  4RGO S;  4OX9 L;  3TZD A;  2JA5 G;  2LY7 A;  2YU9 H;  1D6E C;  4EX5 A;  4K6D A;  1U0L A;  4A3E G;  1NNX A;  1HQR D;  2Z6K A;  1UAP A;  1X6O A;  2AHO B;  3QG1 A;  4XT1 B;  2VQE Q;  5M3F H;  4YCU A;  2AQ2 B;  5IT9 L;  4YIJ A;  2R61 A;  5CBE E;  3CMA A;  2NYZ D;  1YIT A;  4BBS B;  4B08 A;  1EY9 A;  2D5D A;  1GUG A;  4GOP A;  3K58 A;  3BYY B;  1ASY A;  4OX9 Q;  4IPD A;  3S2D B;  3TS0 A;  3ITP A;  1VQK A;  1HXY D;  4FF1 A;  1FR3 A;  1HUM A;  4B3T Q;  1BO0 A;  1VQJ A;  1PFN A;  2X69 A;  3CC2 A;  2Z6B A;  4H13 C;  2VY3 A;  4A3M H;  5E1F A;  4A75 A;  1CSP A;  4OON A;  3STB D;  1VQL A;  4NPS A;  1S40 A;  1JE5 A;  4BY1 H;  3G6J B;  4P71 A;  1F2Z A;  5E4W C;  3ZJY C;  2D2C C;  1PH4 A;  5EPK A;  1WTH A;  4JI7 Q;  1Q7Y C;  3TBI B;  1HNX L;  2I5H A;  4QY7 A;  5G3L D;  5JJI A;  1FVI A;  3BZK A;  2ZJQ A;  2OQ0 A;  3NEN A;  2DY7 A;  3DM1 A;  4PG3 A;  4O42 A;  4L5S A;  1K9M C;  2OTL A;  5AJ3 L;  1SNO A;  1PYW D;  5D3D A;  1K3B C;  3Q8D A;  2L15 A;  3K59 A;  2EOT A;  2F4I A;  3QO2 A;  1H9K A;  2RDG A;  4JI8 L;  4F8M A;  2DGY A;  2ES2 A;  2A68 D;  2FMM A;  1STY A;  1MKH A;  4EVO A;  3SK8 A;  2VXW A;  1E0B A;  2EY2 A;  1O80 A;  2JA7 H;  3L0O A;  1V1O A;  3LWU A;  1GUO A;  3TRE A;  2UU9 L;  4OO1 H;  1D1K A;  2F3I A;  4NMZ A;  3ULJ A;  4K8I A;  3OW7 A;  3GO5 A;  3GQB A;  3M4Q A;  3FKI H;  2K52 A;  2B29 A;  5LMU L;  4U67 3;  3L7Z C;  5A2Q L;  1HNZ L;  1SJH D;  4DUY Q;  3KUP A;  3K6O A;  4DV1 Q;  2B2V C;  4OHJ A;  2L4N A;  1QWY A;  3RD4 A;  3Q6S A;  4DV0 Q;  4M8A A;  4Y7N B;  2Q8T A;  2XIW A;  1H95 A;  1K73 C;  3MC0 B;  2L55 A;  3FEW X;  2E2J H;  1DD2 A;  4AYB G;  4L5T A;  4O0A A;  2EXD A;  4DV4 Q;  3QWN A;  1WTP A;  4UP8 A;  1SBB B;  1SMY D;  1YJ9 A;  1ZEQ X;  2B2V A;  4IZ8 A;  3HOZ B;  2EYO A;  4JI4 L;  1HFN A;  3KFU A;  1EQQ A;  2RHQ B;  1XPR A;  4WJW A;  4LF8 L;  3HZX A;  1KDC A;  2WII B;  1XXG A;  2BA1 A;  3KLW A;  5M5X B;  1F9S A;  4DNT B;  4JW0 A;  2ALY B;  2SEB D;  3HOU H;  1HR0 W;  4ILW A;  1QCB D;  1ZXT A;  1WTO A;  1KXL A;  1EWC A;  2RHS B;  4FO2 A;  3NTH A;  1XNQ L;  1L1O A;  2O4X A;  3R3O A;  4OXP A;  4AIM A;  5BN5 A;  3I4N H;  1IBL L;  4XQQ A;  4I65 A;  4X62 L;  3CCJ A;  4MTK A;  1CA5 A;  1EEF D;  2BOS A;  3UDG A;  2RBM A;  1VQI A;  2BH2 A;  4DK3 C;  1SYC A;  2FFK B;  5EPL A;  4A3B G;  2XN9 C;  2K5H A;  2I0Q A;  5ELB A;  3GTG B;  1CKM A;  4MNO A;  4C1N K;  1KRS A;  3MEH A;  2EVB A;  4FP5 D;  3AFP A;  4WFN 3;  5KNC A;  4PMW A;  2F0G A;  3QJY A;  4DAP A;  4KHZ A;  1SAP A;  1XMO Q;  3HG9 A;  3K57 A;  1B70 B;  2RVL A;  5IY0 A;  5COY A;  5IT9 c;  2B2T A;  5D14 A;  4L5Q A;  3S15 B;  4G7O C;  2BE5 C;  4WRD A;  1TS2 A;  4ZUJ A;  2VUM H;  1E24 A;  3S1R H;  3BDC A;  1CM9 A;  1K83 B;  3U9S A;  2E75 C;  1STA A;  1STG A;  3S24 A;  1HNW Q;  1AEX A;  4R4Q A;  2HUG A;  1YBY A;  2BH8 A;  5CV6 A;  3GTO B;  4DR4 Q;  4JV5 Q;  2CH4 A;  3TME A;  1SEB D;  4KMU C;  2Z8L A;  3BVZ A;  3PO2 G;  2I5L X;  1VQO A;  5KYI A;  4JBW A;  1Z7T A;  1BBW A;  1SE8 A;  1VQH A;  5JEA J;  2XNA C;  1OO9 B;  2AQ1 B;  2HDL A;  4JI0 L;  3GTO H;  4DR4 L;  3CCS A;  5JOB A; 
#chains in the Genus database with same CATH homology
 1EOV A;  4NXN Q;  4GKJ Q;  1XJV A;  1QZH A;  1KL9 A;  3I2Z A;  3M9B A;  4C3J H;  2JEB I;  4LFC L;  1L0W A;  4DV7 L;  1EFW A;  3PO2 H;  4GNX A;  2UU9 Q;  4DR2 Q;  1A62 A;  3BU2 A;  4BY7 G;  1Q1E A;  4OWT B;  3IRB A;  4A3G G;  4A3K H;  1PV4 A;  5M3M G;  1QUQ A;  1K8G A;  3HOW G;  5GAD C;  4LFB L;  2RF4 A;  3EN2 A;  5DLQ E;  1XTD A;  5C0X J;  3PO3 G;  1WOC A;  4MZ9 A;  1UE1 A;  4AH6 A;  3STB C;  3PV0 A;  4POG A;  4WJ4 A;  2A19 A;  2DUD A;  4FDB A;  1N36 L;  1HH2 P;  2ZTE A;  3GTM H;  4GKK L;  2LSS A;  2Z6K C;  4JI0 Q;  3PF5 A;  2PQA B;  1YHQ A;  3GTG H;  4X66 L;  2MO0 A;  4H02 A;  4L5R C;  1E1O A;  3G4S A;  3F2D A;  1VQ8 A;  3PUY A;  3FHW A;  4YWL A;  3A5U A;  1XNR Q;  4LUZ A;  4LFB Q;  2AWN A;  5C44 G;  1SFO H;  1Q82 C;  1HNX Q;  3CC4 A;  3PUV A;  1XMO L;  1VQ5 A;  3T1H Q;  4YY3 Q;  1XMQ Q;  3GD7 A;  4B3S L;  4A3C H;  1QVF A;  2VNU D;  1A8V A;  1Q86 C;  3HOV G;  4DR3 L;  4A93 G;  3PSI A;  4LUO A;  2N8N A;  2R7Z H;  1XNQ Q;  4LW1 A;  1CKO A;  1FJG Q;  1N36 Q;  4JI6 L;  1JJG A;  2FXQ A;  1OXU A;  1VQ7 A;  4DUY L;  1PA6 A;  4DAY B;  1QZG A;  1GD7 A;  2UXB L;  1V43 A;  3UDI A;  4DV4 L;  4LFA L;  1WCM G;  4X62 Q;  3KF8 B;  1KC8 C;  1HJP A;  1IBK Q;  4LF4 L;  3CD6 A;  3I4M G;  4QQB X;  1K3R A;  3T1Y Q;  2YTY A;  3RLN A;  1XMQ L;  2BA0 A;  4BY7 H;  2JK8 A;  1X3F A;  1YVC A;  4HJ8 A;  4IFD I;  1V9P A;  1PYB A;  1WFQ A;  4IJH A;  4JI8 Q;  3HOV H;  2LXK A;  1EWI A;  2E8G A;  5IWA Q;  3VDY A;  3HOW H;  3PO3 H;  4GOP C;  3KDF A;  3H0G G;  4J15 A;  3EIV A;  3NEM A;  1G6P A;  2NVX H;  2OQK A;  3CCR A;  2MO1 A;  4JBJ A;  4DKA C;  1T9H A;  4C3H H;  1E22 A;  1RIP A;  1X3E A;  4JCV E;  1I94 Q;  1KRT A;  3TRZ A;  5LMN W;  4A4I A;  4HJA A;  1S3O A;  4DR6 Q;  2E5L Q;  5BR8 Q;  4A3K G;  4MTN A;  2AMC B;  1IBK L;  2D0O A;  4LF4 Q;  4JOI A;  2VS1 A;  4BA1 I;  3PIO A;  2D0P A;  2ZM6 L;  4A3I H;  3CXC A;  1HR0 L;  2JA5 H;  3ICE A;  2QGQ A;  4Y52 H;  5C3E H;  4ALP A;  1X3G A;  1BKB A;  4JBK A;  3EBE A;  1MIU A;  4KI0 A;  4A3F H;  4A3L G;  1B8A A;  1TWF H;  1O7I A;  3PUZ A;  2VW9 A;  1G51 A;  3HOX H;  1YJN A;  1HNZ Q;  5M5W H;  2K5N A;  4IPH A;  2R7F A;  4DV0 L;  4JC0 A;  3D31 A;  4R1J A;  4DV1 L;  5M5X H;  3J81 c;  1J5E Q;  4BBS H;  2OTJ A;  2Y0S G;  3OTO L;  5HGQ A;  1X9N A;  1WCM H;  2E2I H;  3A74 A;  3GTP H;  1I5F A;  4TVA B;  1JJ2 A;  5LMN L;  2WFW A;  2YV5 A;  1M1K C;  3S17 H;  3E0E A;  4JI1 L;  3UE0 A;  1C7Y A;  2VUM G;  4A93 H;  5C4X H;  5FJ8 G;  4HIO A;  5M5Y H;  2UXD L;  3S2D H;  3F1Z A;  2CQO A;  1N34 L;  4DR7 L;  4BBR G;  4X66 Q;  2Q2H A;  4RG1 A;  3AFQ A;  5JJL A;  4DV3 L;  4JBM A;  1VS0 A;  3A5Z B;  3GTL H;  1J6Q A;  1DGS A;  4B3M L;  3RLO A;  3G48 A;  3K81 C;  3F2C A;  1SRU A;  4QJF A;  3I4O A;  4HJ9 A;  4IPG A;  3S1M H;  3RN5 A;  2UXD Q;  3UE1 A;  2UUC L;  2GVB A;  2IX0 A;  1W2B A;  5C0X I;  3K8A A;  1KQS A;  2A1A A;  3PCO B;  4A3I G;  1FJG L;  2JA6 G;  2JA8 H;  1KHI A;  2JEA I;  5C3E G;  4NXN L;  4P74 A;  1Q81 C;  1GKH A;  2Y0S E;  3MEF A;  4A3F G;  1N34 Q;  3ERS X;  4AQY Q;  1PVO A;  2EQS A;  1N32 L;  2KEN A;  2R93 H;  3RZD H;  1TWC H;  2HIX A;  3OYY A;  5IYD G;  3W1G A;  2PMZ E;  1TWA H;  3CPW A;  1RL2 A;  1FL0 A;  2NVQ H;  1VQ6 A;  2LXJ A;  4APV A;  2NN6 G;  3A0J A;  3UDF A;  5GAG C;  2VQF Q;  4BBS G;  5IWA L;  1PH9 A;  4QGU A;  1VQG A;  3CW2 C;  3KF6 A;  4PZ8 A;  3S2H H;  4A3L H;  4YHH L;  2JA6 H;  2WB1 E;  2JA8 G;  5K36 G;  2VL6 A;  3PUW A;  4GN3 B;  4AQY L;  1D7Q A;  1VQA A;  5C0X G;  3HKZ E;  1PH8 A;  2ID0 A;  5IYC H;  1VQB A;  3MXN B;  5IYD H;  2E5L L;  3E9H A;  1HNW L;  3UDX A;  3G6E A;  2XGT A;  5IYB H;  4UP7 A;  2B63 H;  4YY3 L;  3J80 i;  4A3D G;  1BBU A;  2UUB L;  1PH2 A;  4P75 A;  4C2M H;  2KCT A;  4OWX B;  4UPA A;  1Y1V H;  5IP7 G;  3K0X A;  4X64 L;  1TWG H;  5FJ8 H;  2VQF L;  4A76 A;  2F4V Q;  4DV5 L;  3S1Q H;  4DR2 L;  5C4X G;  1PFS A;  4UY8 C;  1G29 1;  3M4P A;  2N49 A;  2E2H H;  3CCQ A;  4BBR H;  3PGZ A;  3RNU A;  4DV2 L;  2CFM A;  3T1Y L;  3I56 A;  4HJ7 A;  3RN2 A;  4LF9 Q;  1Q12 A;  2I5M X;  1NJI C;  1R9T H;  4HIM A;  2HIV A;  3CC7 A;  4WJ3 M;  3CAM A;  2KHJ A;  2Q2U A;  4JI3 L;  2KHI A;  1NMG A;  3W1B A;  2PNH A;  4DNI A;  1SLJ A;  5IYB G;  4BXX G;  1FGU A;  3HOZ H;  4LF5 Q;  4IPC A;  2QA4 A;  4GN4 B;  2IY5 B;  1GO3 E;  2NVT H;  5IP7 H;  1Y1V G;  1AH9 A;  1NBW A;  4DUZ Q;  2UUB Q;  4LF7 L;  4LF6 L;  1NMF A;  1OXS C;  1VQ9 A;  5GRO A;  4X64 Q;  4HJ5 A;  1JMC A;  1C0A A;  2Q2I A;  1IYJ B;  4A3E H;  1JJC B;  1CKN A;  2NVY H;  4DV6 Q;  3CCV A;  5M3F G;  5JEA G;  2ZM6 Q;  1UE7 A;  1AE2 A;  3WWV A;  3CCM A;  4DR5 Q;  3U58 A;  1IZ6 A;  1U5K A;  1NY4 A;  3I55 A;  2K50 A;  4LF9 L;  2R93 G;  3AYH B;  4DR3 Q;  3GTQ H;  4BXX H;  4JI3 Q;  2IHF A;  2VZA A;  3M3Y H;  1SN8 A;  1EIF A;  1X54 A;  3HFZ B;  5IYC G;  1MJE A;  5H1S E;  4A3J H;  3M4O H;  1LTL A;  4GKK Q;  4LF7 Q;  4GLV B;  1WJJ A;  2JA9 A;  3RLF A;  5IP9 G;  3GTJ H;  2HQL A;  1X55 A;  4OX9 L;  4YWM A;  3RZO H;  3J81 j;  2JA5 G;  2IX1 A;  2YU9 H;  5JJK A;  4EX5 A;  4A3D H;  3HKZ G;  1OXX K;  1U0L A;  5E7N A;  4A3E G;  2Z6K A;  1X6O A;  2AHO B;  2VQE Q;  5M3F H;  3TS2 A;  1Z47 A;  4YCU A;  4DK6 C;  2A8V A;  1B7Y B;  4JOI C;  1C9O A;  4B3T L;  1D8L A;  2EIF A;  2H5X A;  5C4J H;  3CMA A;  1LUZ A;  3ER0 A;  1LYL A;  1YIT A;  4JI1 Q;  1GVP A;  2CWP A;  1LM0 A;  4B3S Q;  2KCM A;  1NE3 A;  3HOY H;  1N33 Q;  4DR1 L;  1L2F A;  4LFC Q;  4A3M G;  4HIK A;  1HZA A;  4GOP A;  1KIX A;  4DPG A;  4LWC A;  2PI2 A;  2R7D A;  1ASY A;  1YI2 A;  4IPD A;  4OX9 Q;  1ASZ A;  4DV7 Q;  4LFA Q;  3J81 i;  3TS0 A;  1VQK A;  2NZH A;  3JAM c;  1HZB A;  1NTG A;  2K5V A;  2WB1 G;  1UE6 A;  2UXC Q;  3S1N H;  5GAE C;  3RR5 A;  3CCL A;  4KHP Q;  4B3T Q;  2ZJR A;  1VCI A;  1YHB A;  1VQJ A;  4O2D A;  4R4O A;  4B3R Q;  4GNX C;  3CC2 A;  3HOY G;  1IXR A;  3HOZ G;  1EIY B;  3J80 c;  2VY3 A;  4A3M H;  1UEB A;  3GDE A;  4A75 A;  1CSP A;  2UUA Q;  4OON A;  3STB D;  1VQL A;  4NPS A;  1S40 A;  1JE5 A;  4BY1 H;  4P71 A;  5AJ3 Q;  4X65 L;  4JG2 A;  5IP9 H;  3PIP A;  3M85 A;  4IOA A;  3ZJY C;  1Q8K A;  2WAQ E;  4KHP L;  1Y14 B;  4P73 A;  3I7F A;  1PH4 A;  1PH1 A;  4UP9 A;  1MJC A;  4JI7 Q;  1EQR A;  1Q7Y C;  3NBH B;  1HNX L;  2I5H A;  2PQA A;  2MNA A;  2GN5 A;  1IBM Q;  2WP8 J;  3F8T A;  3K80 C;  1EUJ A;  1FVI A;  4QY7 A;  4GLX A;  3BZK A;  1Y1W H;  5JJI A;  2ZJQ A;  1PHJ A;  2OQ0 A;  4YWK A;  1UWV A;  2AWO A;  3NEN A;  4NB3 A;  4PG3 A;  4L5S A;  1SR3 A;  1K9M C;  3ULL A;  4X6A H;  1L1O B;  2OTL A;  5AJ3 L;  1S72 A;  5GQO A;  2Q2T A;  4BY1 G;  4OO1 G;  1CSQ A;  3Q8D A;  3HKS A;  2L15 A;  4ME3 A;  2ZTC A;  5FLX c;  1PH5 A;  4JI7 L;  4JI8 L;  1JT8 A;  3FKI G;  1BVS A;  2DGY A;  4POF A;  2F52 A;  2QEX A;  2ES2 A;  2YYZ A;  1JB7 A;  3AEV A;  4YCW A;  4IOC A;  1HZ9 A;  1MKH A;  2YTX A;  2OCE A;  4DV5 Q;  2R92 G;  1Z9F A;  4IO9 A;  4YCV A;  1EYG A;  1A63 A;  2JA7 H;  3L0O A;  4GLA C;  1YNX A;  3FP9 A;  3NEL A;  4XTC S;  1XPO A;  1GM5 A;  3TRE A;  2V1C C;  1QVC A;  2UU9 L;  1XNR L;  2C35 B;  2B63 G;  2ASB A;  1N32 Q;  4JI2 Q;  2F3I A;  3ULJ A;  3G71 A;  2VQE L;  4KLK A;  4JYA L;  1VQF A;  3GO5 A;  3OW2 A;  1K83 H;  3M4Q A;  3FKI H;  2K52 A;  2B29 A;  5LMU L;  2NZO A;  3L7Z C;  4OWW B;  5HY6 A;  4JI6 Q;  1HNZ L;  4LF6 Q;  4LNQ A;  2R92 H;  4YHH Q;  4DR1 Q;  1I6H H;  4DUY Q;  1I3Q H;  2JA7 G;  1W3S A;  3JC6 6;  4JI5 Q;  3HOU G;  4PZ6 A;  3CP0 A;  2YTV A;  4JI2 L;  2K14 A;  4DV1 Q;  1OTC A;  3KYH C;  2Z0S A;  1CKN B;  4DV0 Q;  2K4K A;  2XTI A;  1E1T A;  1A0I A;  4JI4 Q;  4JYA Q;  4DR5 L;  2HHH Q;  1PYS B;  2K75 A;  2JE6 I;  2KBN A;  1H95 A;  4A3G H;  1K73 C;  5LMN Q;  4LF8 Q;  2E2J H;  1WYD A;  3F2B A;  1K0R A;  1YJW A;  4AYB G;  2UUA L;  4L5T A;  4O0A A;  2AKW B;  1KD1 C;  4DV2 Q;  2OWO A;  4GN5 A;  2EXD A;  4JI5 L;  4DV4 Q;  3CME A;  4B3M Q;  4A3J G;  3S16 H;  3SGI A;  3PUX A;  1N9W A;  4UP8 A;  2MFI A;  4Y7N H;  1YJ9 A;  4K0K L;  3KJO A;  3L2P A;  1YHA A;  4JI4 L;  3KFU A;  1EQQ A;  3AQQ A;  4JV5 L;  2RHQ B;  1AE3 A;  4IJL A;  1XPR A;  1M90 C;  1YZ6 A;  1N33 L;  4QIW E;  1VQP A;  4LF8 L;  5GAH C;  2JQO A;  2PI2 E;  3CPF A;  3CQZ H;  4P72 A;  5FLM G;  4DV6 L;  2BA1 A;  2R6G A;  3KLW A;  3S14 H;  1J5E L;  3ULP A;  2UXC L;  3T1H L;  1OXT A;  3HOU H;  2ALY B;  4K0K Q;  1HR0 W;  5BR8 L;  1KXL A;  2RHS B;  3KF6 B;  1VQE A;  4PZ7 A;  1L1O A;  1E3P A;  4AYB E;  1XNQ L;  4OXP A;  3U50 C;  4AIM A;  4GKJ L;  2ZJP A;  4DAM A;  3I4N H;  1IBL L;  3LGJ A;  4DR7 Q;  2N78 A;  4OO1 I;  4R4I A;  2N3S A;  4X62 L;  3H3V I;  3CCJ A;  4IFD J;  3U4Z A;  5IE8 A;  4R4C A;  2UXB Q;  1KAW A;  3W5O A;  3JAM i;  3CCE A;  2CKZ B;  1VQN A;  3UDG A;  3H0G H;  3BJU A;  1PH6 A;  2HT1 A;  3OTO Q;  3D0F A;  1WI5 A;  4QL5 A;  1QVG A;  1Q46 A;  1VQI A;  4DK3 C;  1IBM L;  2BH2 A;  3GTK H;  4TQU S;  4RMF A;  4A3B G;  2K5H A;  2I0Q A;  3CF5 A;  5LMU Q;  1IBL Q;  3J7A 5;  1CKM A;  4MNO A;  3J7Z C;  1OXV A;  1KRS A;  1VQM A;  2ATW A;  3AFP A;  1I94 L;  4NXM Q;  2CCZ A;  3S15 H;  1CUK A;  3BZC A;  4PMW A;  3H15 A;  2F4V L;  1TWH H;  1VQC A;  3K7U C;  4KHZ A;  1Y1W G;  1TXY A;  4C3I H;  1XMO Q;  1P8L A;  4HID A;  1HR0 Q;  1XPU A;  1V1Q A;  1B70 B;  3HOX G;  1HZC A;  4R4T A;  4GS3 A;  2MQH A;  5FLM H;  1PH3 A;  4B3R L;  5IY0 A;  1N8R C;  2RCN A;  4GOP B;  4DUZ L;  4LF5 L;  5IT9 c;  2GVA A;  1IL2 A;  1E7Z A;  1QUQ B;  4L5Q A;  5M3M H;  1YIJ A;  1PH7 A;  4NXM L;  3CCU A;  3B6Y A;  3KJP A;  1SRO A;  5C44 H;  5ELO A;  4GNX B;  2WAQ G;  2VUM H;  1E24 A;  3M7N A;  3S1R H;  1UE5 A;  3I4N G;  3K7A H;  4XIG S;  4IFD G;  3S24 A;  1P16 A;  1HNW Q;  1SMX A;  3TEH B;  2JJQ A;  4R4Q A;  5ELN A;  5J3B A;  1YBY A;  3E9I A;  1I50 H;  2R7Z G;  2BH8 A;  1K8A C;  2IHE A;  4DR4 Q;  4LUV A;  4JV5 Q;  5EAY A;  3U4V A;  2IT1 A;  1Q1B A;  4BA2 I;  3PO2 G;  1YEZ A;  2CWA A;  4A3B H;  4DV3 Q;  2I5L X;  1VQO A;  1VQD A;  2D62 A;  3I4M H;  4A3C G;  4DR6 L;  4EQ5 A;  4X65 Q;  2NN6 I;  1X65 A;  2ZTD A;  3KOJ A;  1X56 A;  4JBW A;  1L1O C;  1BBW A;  2B3G A;  3DM3 A;  1SE8 A;  1VQH A;  5JEA J;  2UUC Q;  3KDF B;  4JI0 L;  1VQ4 A;  3GTO H;  4DR4 L;  2HHH L;  3H3V H;  3CCS A;  3PF4 A;  3TQY A;  3DLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...