4X6AH

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x6aH00
4A3KG 1HR0W 2VNUD 2PQAA 1E1TA 3J80c 4JI5L 2C35B 3GO5A 4DR3Q 4BY7G 4BBRG 1OXSC 4A3KH 4JI1L 5IYCG 2R7ZH 4GKJL 1N36L 2Q2HA 4P73A 3J7A5 1WFQA 2F3IA 4BY7H 5K36G 4DR1L 1L1OA 4P75A 3UDFA 3D0FA 2WAQE 3M3YH 3H3VH 1HR0Q 4YCWA 3CCUA 2I5HA 4GNXC 3CCJA 2AKWB 4LF4Q 3ER0A 1XPOA 1HNZL 2JA9A 5LMNL 1EYGA 4JV5L 2KHJA 1PH6A 1PYBA 1XJVA 4JI4L 3K7UC 3KYHC 3OW2A 3M4QA 1OXUA 2VUMH 4A3BH 1BKBA 2UUAQ 4RMFA 4LF9Q 3S2DH 4DV3Q 4NXNQ 1HZAA 1B8AA 1IBKQ 4DR5Q 4TVAB 4JI3Q 1MJCA 3E0EA 2BH2A 1LM0A 4JBJA 2I5LX 4IOCA 4GLVB 3CCVA 1OXXK 2GVAA 4LUVA 1HNXQ 3RLNA 1K83H 2K14A 2JEBI 4LF8Q 2UU9L 2PI2E 2CCZA 3PUVA 3PV0A 1I3QH 2BH8A 1HNWL 5IP7H 4DV2L 3CAMA 3KF8B 5GAHC 4B3RL 3CD6A 1KAWA 3PUZA 1LUZA 2N3SA 3CC7A 2ATWA 4AYBE 3CCSA 2E2IH 3I7FA 1N34Q 3TS2A 1L2FA 1CUKA 4JI6L 4LFCL 5GROA 4DV5L 4HJ8A 4A3JG 3A5ZB 3PO3H 1UE5A 1VQBA 1Z47A 2D62A 4GOPB 4A3JH 1OXVA 2JA5G 3CC2A 2XTIA 2JA7G 2JEAI 4JOIA 2JA5H 2JA7H 4MTNA 1E7ZA 1EQRA 1NBWA 2K4KA 2ZTDA 3M7NA 3CMAA 3NENA 2OQKA 1EOVA 3J7ZC 3RN2A 1HZ9A 4K0KQ 2KHIA 4PMWA 4WJ4A 2GVBA 2ZM6Q 2KCTA 2LXJA 3HKSA 2UXBQ 1XNQQ 4GOPC 4X6AH 4B3ML 1O7IA 1IBML 3S15H 4LF6L 2PQAB 3ERSX 3S1QH 4C2MH 2K5HA 2NVTH 1UWVA 4KHPQ 5HGQA 5IE8A 3RNUA 3CQZH 1IXRA 5FLMG 2HHHQ 1W3SA 1QUQA 4X66Q 1CKOA 2IY5B 5FLMH 1K73C 3KF6A 1I5FA 2NZOA 3FKIG 4AH6A 1I94L 4IJLA 1M1KC 3KFUA 4DV4Q 1HJPA 2EIFA 3FKIH 3L0OA 5IWAQ 2Z0SA 1PH3A 1KRTA 1NY4A 1U5KA 1S3OA 2R92G 1J6QA 5LMUQ 2IT1A 1YZ6A 1B70B 2PNHA 3H0GG 1JJGA 2R92H 2ZTEA 1D8LA 1K9MC 1GO3E 1NMGA 3H0GH 3K8AA 2NVQH 3AYHB 4X64Q 2UXCQ 3U58A 2EQSA 1YEZA 2Q2UA 4X62L 1EFWA 3GTLH 5JEAJ 4LF5L 3GTJH 1I50H 3ULPA 5GADC 1E24A 2A19A 1JB7A 1IL2A 3F8TA 1UE7A 3I55A 4DV6Q 4DV0Q 1XMQL 1Y1VG 3TREA 4QQBX 3J81c 3W1GA 3BU2A 2I5MX 2KBNA 1SE8A 3PO2G 2ALYB 1N9WA 1Y1VH 5GQOA 5C4JH 3UE0A 3PO2H 1VQ5A 3J80i 5AJ3L 4LWCA 4EQ5A 2VQFQ 2ZTCA 4P74A 3T1HL 1R9TH 4MNOA 4YHHQ 3KJOA 1PH1A 1X65A 2EXDA 4JI8Q 3UDIA 2K75A 4DUZL 4JYAL 3EBEA 4HIMA 1TWFH 3TRZA 4JI7Q 1Z9FA 4JI2L 1N33L 2WFWA 2Z6KA 2UUCQ 1S40A 1XPRA 3GTOH 3AQQA 3FHWA 1YIJA 3HOWG 3DLLA 3ULLA 1Q82C 1KHIA 1IBLL 1CSQA 3HOWH 1VQ9A 4A4IA 5LMNW 2AWOA 4JI0Q 3CXCA 3A0JA 1FJGL 3BZCA 3E9IA 4NB3A 1TWHH 1X3GA 4IPCA 4DV1L 4BBRH 4L5TA 1S72A 1GKHA 3PUWA 5IYCH 3VDYA 4B3SQ 4BA2I 4DR6L 1J5EL 4AQYQ 4UY8C 3G6EA 4GKKQ 1VS0A 4OO1G 1LTLA 4LFBL 4PG3A 2I0QA 1NJIC 4A3CG 1YHAA 1N32L 4YWLA 1X55A 1Q7YC 4DNIA 4A75A 2OWOA 4OO1I 4UP7A 1VQKA 3I4MG 1Q1EA 4A3CH 4GLXA 2ZJRA 2JE6I 1SR3A 4B3TQ 1QZHA 2ID0A 4XTCS 4JOIC 3JAMc 5JJIA 5IYBG 4HIDA 1AE3A 1Q81C 3CPWA 5C3EG 4HJ7A 4IPDA 1PH8A 2NVXH 3ICEA 1X9NA 4DR3L 2RHQB 4L5SA 4HIKA 2VS1A 3F2DA 1YBYA 1QUQB 5JEAG 4LFAQ 5FJ8G 3CCMA 4ALPA 4A3EG 2B63G 3KF6B 3CC4A 1GD7A 2CKZB 4A3EH 5FJ8H 5M5XH 1SN8A 2B63H 1HR0L 3I4NG 1EIFA 2CWAA 2QEXA 3AEVA 2WB1E 5M5YH 1PV4A 4LF4L 4QIWE 3KLWA 4BA1I 4O2DA 1NTGA 2E5LQ 3PIOA 1T9HA 4POFA 3RZOH 2OCEA 1KL9A 1RIPA 2VW9A 1Q1BA 4PZ8A 1PH4A 2OQ0A 1E1OA 4KLKA 2CFMA 2N8NA 1OXTA 3NEMA 2UUAL 4LF9L 2BA0A 1B7YB 4NXNL 3U4ZA 4DV3L 1MIUA 3G48A 4OONA 2JK8A 1IBKL 4DR5L 4JI3L 1K8GA 4POGA 2IHEA 2K50A 4YWMA 3HOYG 1A8VA 1DGSA 1K0RA 4QJFA 1VCIA 4DUYQ 3HOYH 1QVCA 2D0PA 2XGTA 2MQHA 4HJ5A 1HNXL 1X54A 4LNQA 1PHJA 1MKHA 3F2CA 3FP9A 3W1BA 1X6OA 2HIVA 4IO9A 4LF8L 3HOVG 2YTVA 5DLQE 1VQHA 2VQEQ 3HOVH 1A62A 3HOUG 2MNAA 3S17H 4MZ9A 1SMXA 4LF7Q 4DKAC 4IOAA 3HKZG 1NMFA 5EAYA 1XPUA 1UE6A 4APVA 1N34L 4DR4Q 2GN5A 1PH2A 3PF5A 4J15A 1JJCB 2NZHA 1XMOQ 1A0IA 4DV7Q 2D0OA 4GKJQ 3F1ZA 3CCEA 1CSPA 3KJPA 2UUBQ 1WCMG 1L1OB 3JC66 3RN5A 2LXKA 1XNRQ 4BBSG 4WJ3M 1SLJA 3NELA 4A93G 5ELNA 3GTPH 4Y7NH 2ZJQA 1EWIA 4X65Q 1PYSB 2V1CC 3CMEA 1FL0A 1ASZA 3I4OA 4A93H 5ELOA 2MFIA 4A3MG 5BR8Q 2HT1A 2H5XA 1OTCA 4K0KL 3MXNB 3U4VA 2UXDQ 1MJEA 4A3MH 2QGQA 3L7ZC 2B3GA 2IHFA 2ZM6L 1L1OC 4JBWA 3J81i 4HJAA 4OXPA 4BXXG 1PH7A 2YV5A 4AIMA 5C44G 1XNQL 2UXBL 3K80C 2RF4A 3OTOQ 1YVCA 3MEFA 3PGZA 3DM3A 3Q8DA 4BY1G 4ME3A 4P71A 5C44H 4BXXH 2OTJA 3AFQA 3T1YQ 2IX1A 3U50C 4LUOA 1V1QA 1VQLA 4BY1H 2F4VQ 3GTGH 4KHPL 2ES2A 1KQSA 4DR2Q 1X56A 2Y0SG 4YCVA 4DK6C 1SRUA 3TS0A 3A74A 2HHHL 1TWAH 4OX9Q 4X66L 2KENA 3G4SA 1HZBA 4DV4L 5HY6A 4NXMQ 5IWAL 3AFPA 3STBC 4YY3Q 4DR7Q 5IYDG 2B29A 5LMUL 1HH2P 2MO0A 1YHQA 5IYDH 1E3PA 4GS3A 5IT9c 3PF4A 1AE2A 1VQPA 1JJ2A 4A3LG 2HIXA 3NBHB 4O0AA 1KRSA 4X64L 2K5VA 4JI5Q 3PCOB 3CCRA 2E2HH 4A3LH 2UXCL 4DAYB 4JI1Q 3ZJYC 1N36Q 4A76A 3RLFA 1FVIA 1VQ8A 4HJ9A 3K7AH 5M3MG 4DR1Q 2YYZA 3CP0A 4DV6L 4DV0L 3EN2A 5M3MH 1QZGA 4JC0A 1X3FA 3PUYA 4LW1A 1HNZQ 1K8AC 5JJLA 5LMNQ 2VQFL 2R6GA 4JV5Q 4YHHL 2RCNA 4JI8L 2YTXA 2PI2A 4JI4Q 1IYJB 1AH9A 4JI7L 1XTDA 1RL2A 1Y1WG 1BBWA 2UUCL 1YJ9A 3I4MH 5M5WH 3S1RH 1TWCH 3GDEA 2R7ZG 2LSSA 1Y1WH 4PZ7A 2Q2IA 2ASBA 2AMCB 1BBUA 1Q46A 1VQEA 4FDBA 5IYBH 5C3EH 2VL6A 4JI0L 5IY0A 1BVSA 3CCQA 1EIYB 3CW2C 5M3FG 1SFOH 1VQOA 2AHOB 2VZAA 2RHSB 4B3SL 1C9OA 3EIVA 3H3VI 1V9PA 2F52A 5M3FH 1KIXA 4AQYL 3UE1A 2A1AA 1Q12A 2UU9Q 2JA8G 4GKKL 4RG1A 2HQLA 2JQOA 1GM5A 2JA8H 3S2HH 3KDFA 2OTLA 3W5OA 3I4NH 2KCMA 5C0XG 1HNWQ 2CWPA 2Q2TA 3HKZE 4DV2Q 1VQ6A 4HIOA 2VUMG 4A3BG 4Y52H 4R4TA 4KI0A 4B3RQ 1PA6A 5C0XI 3BJUA 3B6YA 4B3TL 1PVOA 1C7YA 4P72A 4OWTB 2ZJPA 1QVGA 1VQJA 1LYLA 3HOXG 1UEBA 4UP8A 3H15A 2L15A 4R4OA 4JI6Q 3LGJA 4R1JA 3STBD 2K52A 2N78A 5H1SE 3HOXH 4DV5Q 4LFCQ 4IFDJ 2K5NA 5GAGC 1VQIA 4C3IH 4LFAL 4R4IA 3UDXA 3CCLA 4JCVE 1PH5A 3WWVA 4R4CA 1H95A 1YJWA 2A8VA 4GN5A 4L5RC 1KXLA 5IP7G 2WAQG 1G291 1YI2A 3I56A 3K81C 3PUXA 1Q86C 1CKNA 2E5LL 1GVPA 4QL5A 3A5UA 2YU9H 3HOUH 4B3MQ 1IBMQ 4A3DG 1VQCA 4LF6Q 3S24A 1YJNA 1HZCA 1FGUA 4YCUA 1EQQA 4GNXA 4OWWB 4A3DH 1YHBA 1KD1C 3TEHB 2Y0SE 3PO3G 3M9BA 4A3FG 1K3RA 2NVYH 4L5QA 1VQFA 1W2BA 1G6PA 2WP8J 4DUYL 4A3FH 1VQ4A 4QY7A 1PFSA 3M4PA 4GN4B 1WI5A 1P16A 2PMZE 2VY3A 3HFZB 5JJKA 1I94Q 5FLXc 2BA1A 2Z6KC 3CPFA 1WCMH 2E8GA 4KHZA 5IP9G 2R93G 4TQUS 2QA4A 4BBSH 2DUDA 2YTYA 3I2ZA 4IPHA 2NN6G 1C0AA 5IP9H 1PH9A 3F2BA 2R93H 2VQEL 2FXQA 2WB1G 5J3BA 2DGYA 3PIPA 2NN6I 4R4QA 4JBKA 4LF7L 3GTMH 1D7QA 2R7DA 3OYYA 1U0LA 4X62Q 2MO1A 4DR4L 2CQOA 4A3GG 4LF5Q 1I6HH 4AYBG 3J81j 4DV7L 4XIGS 4EX5A 1XMOL 3GD7A 4GN3B 5E7NA 3ULJA 3CF5A 1NE3A 2JJQA 3RLOA 1VQMA 1XMQQ 4A3GH 1X3EA 2UUBL 3S14H 3D31A 3K0XA 1XNRL 1SROA 4IFDG 4C3HH 1QVFA 1KC8C 3GTKH 3KOJA 4X65L 5AJ3Q 5C0XJ 3KDFB 4IFDI 4DK3C 1L0WA 3T1HQ 1A63A 2N49A 5GAEC 4JYAQ 3PSIA 2AWNA 1TXYA 5BR8L 4PZ6A 4DUZQ 2JA6G 1EUJA 3IRBA 3S1NH 2UXDL 4JBMA 1Q8KA 4UPAA 4JI2Q 1N33Q 2JA6H 3E9HA 4JG2A 3L2PA 3TQYA 3GTQH 1WYDA 3OTOL 1WOCA 1JE5A 1WJJA 1IBLQ 3M4OH 4DAMA 3RZDH 3T1YL 5C4XG 1M90C 1VQGA 4A3IG 1FJGQ 1CKMA 2IX0A 2F4VL 5C4XH 3SGIA 1E22A 3M85A 4C3JH 2R7FA 4DV1Q 4DR2L 1VQAA 4A3IH 1VQNA 4H02A 4DR6Q 3S1MH 1J5EQ 3G71A 1VQ7A 4GOPA 4OX9L 4GLAC 1IZ6A 4OWXB 4UP9A 3JAMi 1JT8A 4IJHA 3HOZG 4LFBQ 1N8RC 4NXML 1UE1A 1YNXA 1CKNB 1V43A 1YITA 3S16H 3HOZH 3RR5A 4YY3L 1N32Q 4QGUA 4DR7L 3UDGA 1TWGH 3BZKA 1G51A 1P8LA 4LUZA 1Y14B 2E2JH 4YWKA 4DPGA 4NPSA 4IPGA 1JMCA 1ASYA 1VQDA 4GNXB
chains in the Genus database with same CATH superfamily
4QUFA 1PTOC 3QOJA 2R7ZB 2HCCA 1E1TA 1STYA 4DR3Q 5C3EB 4A3KH 3MEHA 2R7ZH 3V96A 3MFGA 4HMIA 4ZKBB 2F3IA 2F3VA 5K36H 1LTTD 2WAQE 4ZKCB 1EWCA 1E2VA 4G7OC 3C1EA 5T1GA 3CCJA 4LF4Q 3S2HB 1WTVA 2JA9A 1PH6A 1XJVA 3KYHC 1GHKA 3M4QA 2FHTA 1I4GA 2UUAQ 4LF9Q 1STGA 4NXNQ 1HZAA 1B8AA 5IIFA 4TVAB 3HOXB 4JI3Q 1MJCA 3E3XA 1G2TA 4JBJA 2I5LX 2RVLA 5ELFA 1SE2A 4C3IB 1GUSA 2EY5A 4GLVB 2EYJA 3NTHA 2JYOA 4LUVA 2B2TC 1HNXQ 3OIPA 4FNFA 5LL6X 2DNCA 3NSWA 2K14A 3K5OA 1IKLA 3DWAA 3PUVA 3TSSA 2YU9B 3NTIA 5I2XA 1GJXA 2F1MA 1LUZA 1L2FA 2NVYB 4JI6L 4G4KA 1S5DD 5NUCA 3PO3H 1HXYD 3T53B 4GOPB 2JA5G 4A3JH 1OXVA 2E75C 4J8QA 2KQ3A 2NTSA 4MTNA 1NBWA 1IKMA 2K4KA 3M7NA 1DONA 2OQKA 2QEJC 3J7ZC 4KJOA 2OF1A 4PMWA 1YNNC 3S15B 2B2YA 1LTRD 3HKSA 4HCEA 2UXBQ 1SNQA 1AFPA 2EY1A 4NMZA 4B3ML 3S15H 2LFNA 3S1QH 2NVTH 1UWVA 4AYBB 2CVRA 2F0SA 5IE8A 1H9RA 1CKOA 2C5CA 5FLMH 1I5FA 3JAME 2Q8TA 3A56A 3R8BA 1M1KC 1I4XA 4DV4Q 2EIFA 2EXZA 2F0UA 3FKIH 4DK1A 1NY4A 1S3OA 4QF4A 5LMUQ 1RTOA 1YZ6A 1B70B 2F0PA 3DWQA 3BDLA 2AQ3B 1GO3E 3H0GH 2NVQH 4H0LC 2EQSA 1EFWA 2A6HD 5JEAJ 4XQJA 1BOSA 3SE0A 3ULPA 5ELCA 1ENFA 1SDFA 3F8TA 1QNUA 1XMQL 2A6ED 2KBNA 1JCKB 2FJ2A 1Y1VH 5GQOA 5C4JH 3PO2H 2EOTA 4I7ZC 1TWGB 3KJOA 4JYAL 1EQTA 2IX3A 2E2JB 2H4OA 3DUZA 2KVMA 4IUNA 1N33L 1F9PA 2WFWA 3AQQA 3FHWA 2PNRC 3DLLA 3ULLA 3F2UA 1Q82C 4TRDA 1EY4A 1JR0D 1VQ9A 3VA7A 1X3GA 4DV1L 5IYCH 4DR6L 1O7LA 4AQYQ 4UY8C 2B8GA 3N52A 4G7ZC 1XX8A 3BVGA 4UP7A 1Q1EA 4ZAIA 2VUMB 3MXNA 4A3BB 4MN3A 2EYLA 4LAAA 1HCZA 4JOIC 4IQZA 5IYBG 1AE3A 3IAYA 3K58A 1NR4A 2B2VA 1QUQB 4F88A 5JEAG 4XXEA 1K83B 1JC7A 4G7HC 2QF7A 5FJ8H 1HR0L 4FF1A 3BDCA 4JW0A 2PO4A 3TZUA 2E5LQ 1RIPA 3GQBA 1IYVA 2EY6A 1PH4A 1E1OA 2QDBA 4LK1C 3NEMA 1B7YB 1IBKL 3G48A 4OONA 3S17H 3HOYG 1PRTF 2K50A 1STAA 4KY5A 5G3LD 4DUYQ 2MQHA 1ZYRD 2JA7B 1PHJA 3K57A 3FP9A 3P20A 3R93A 3SXHA 2JN4A 3L3OC 2OXPA 1I4QA 2WB1B 1SMXA 4QIWB 1A3TA 2XN9C 5IODA 1BCPB 2K33A 1NMFA 4C2MB 4APVA 4XQQA 2M9VA 1N34L 1PFNA 1PH2A 3TN2A 4PNYA 2D0OA 4GKJQ 1WCMG 3FDTA 4K6LA 1LACA 3RN5A 2Z9HA 3QJYA 4A93G 5ELNA 1V1OA 1EWIA 3KLSX 4X65Q 1I4HA 4QUCA 4A3MG 5BR8Q 4B9WA 2HT1A 4QCLA 2R92B 2ZM6L 2IHFA 3J81i 3IFTA 2YV5A 3K80C 2RF4A 4BXXH 1AEXA 1I50B 1KQSA 1B3QA 1X56A 5COYA 4DK6C 3A54A 1HTPA 1M8AA 2L4NA 2CW0C 2KENA 4RGNA 5EJWA 3G4SA 1HZBA 3C46A 4FF3A 2F0IA 4DR7Q 2B29A 3I90A 4N9TA 5IYDH 1E3PA 4GS3A 1KLGD 1JJ2A 4O0AA 4X64L 2K5VA 5I2YA 4A3LH 2UXCL 2E2HH 1QCBD 4JI1Q 3S9WA 4A76A 1FVIA 1MSHA 4OEMB 5M3MG 5BN4A 4DV6L 4DV0L 1PTOB 3SVMA 1Q90A 3NP8A 1CK1A 1HNZQ 1K8AC 1PTOH 2IL8A 5LMNQ 3A8JE 2R6GA 1ZEQX 4YHHL 4JI8L 1V8QA 4JI4Q 4Z9CB 1CHPD 1AH9A 4JI7L 2RA4A 2EYMA 1XTDA 2EYPA 2WINB 1IL8A 2AUKA 3TP7A 5M5WH 2R7ZG 4PZ7A 1BCPD 1MGSA 3URYA 2VL6A 2B2UA 5IY0A 3CCQA 1EIYB 3CW2C 3L9AX 5M5XB 2B63B 1VQOA 2RHSB 5M3FH 5M5YB 3UE1A 1Q12A 4GKKL 2JQOA 2VB3X 2KCMA 1HNWQ 3HKZE 1VQ6A 4HIOA 4R4TA 1W6JA 2A68C 4P72A 3HOXG 2DJGC 2L15A 5H1SE 4C3IG 5CV4A 3NUCA 5GAGC 3UDXA 5EKIA 2L12A 2HQEA 4JCVE 1LO5D 1Y8NB 4OL7A 1LTSD 4FXKC 5DNFA 4GN5A 1G291 5LHY1 5D3DA 3D4WA 4YIJA 3SEBA 3MTSA 1K0SA 4K14A 3J81E 3A5UA 3HOUH 3R3OA 1QNKA 1GHJA 1IBMQ 1YJNA 1FGUA 4IUUA 1FNUA 4A3DH 3PO3G 3KUPA 1K3RA 1G6PA 1BO0A 3OW7A 4QY7A 4EQPA 2A73B 5AFWA 1KDBA 3CPFA 1IW7D 4OHJA 1SJHD 1PTOD 4CHTB 5HGTA 2QA4A 2YTYA 3I2ZA 5IP9H 1PH9A 2R93H 2VQEL 3O13A 2NN6I 2I07B 3GTMH 5DEHA 4Q5VA 3FRPB 5C44B 3K5LA 3OHXC 2R7DA 3OYYA 4ID6A 3GTGB 4LF5Q 5IGCA 4AYBG 1XMOL 4DV7L 5E7NA 1WTOA 2JJQA 1U4LA 2EE1A 2R61A 3D3RA 1QE6A 1KC8C 3KOJA 1WD1A 4IFDH 1LT6D 3MXPA 5FO9B 1A63A 4M8AA 5EQ0A 5E4WC 1B53A 2Z6BA 4JBMA 4UPAA 3E9HA 4JG2A 1EOTA 1WOCA 3MA2B 3DHQA 1JE5A 1WJJA 2F0NA 2PQEA 2SNSA 1B9MA 1FJGQ 2IX0A 5C4XH 3M85A 4A3IH 4XYQA 3A7LA 1JE4A 1VQAA 3EFXD 2XSCA 3S1MH 4OX9L 5C5MA 4GOPA 2H1EA 1IZ6A 1SXTA 1JT8A 4LFBQ 1G91A 3S16H 4QGUA 4RGTA 1G51A 3DM1A 1CZWA 3J80L 4V190 5CGKA 1VQDA 1STNA 4MTKA 2C35B 2AQ1B 3I4LA 5J39A 5IYCG 1N36L 1D1KA 3J7A5 4BY7H 3U9SA 4DR1L 1L1OA 1YNND 5CBEE 2EY2A 3D0FA 2DNEA 1WVLA 3BYTB 3HZXA 3CCUA 4GNXC 2JA8B 1F9RA 2BDNA 4RCOA 5C0XH 2F0MA 2XIWA 3NXWA 4DV3Q 4DR5Q 4IOCA 2FFKB 5JOBA 1OXXK 2GVAA 3MWYW 4X3TA 4K2KA 4LF8Q 2UU9L 4ULLA 2CCZA 3PV0A 2WAQB 2BH8A 3P75A 4DV2L 3A8IE 3KF8B 1O7ZA 3CD6A 3CC7A 1JOQA 3I73A 3I7FA 3TS2A 4CDFC 1CUKA 2Z4HA 4LFCL 4DV5L 1PFBA 4XT3B 4HJ8A 3U9OA 3A5ZB 2NWGA 4BS9A 5FLXL 1VQBA 1Z47A 2JA7G 2KEDA 3CC2A 1QILA 1EOVA 3RN2A 4K0KQ 5FOBB 4WJ4A 2GVBA 4CJ0B 2LXJA 2RKSA 2B39A 4LF6L 2L55A 5C4HA 3ERSX 1RCVD 1EYDA 4MIUA 3N6RA 3S14B 2WKDA 3RNUA 3A8KE 1DCZA 3SK6A 3ND9A 2EYHA 1QUQA 2IY5B 4IUQA 3MXGA 4DU9A 1EU4A 2NZOA 5DM73 3GTKB 1I94L 4IJLA 3VR6A 2L9HA 2E74C 1ESFA 1HJPA 5BN5A 2MJ8A 1RKNA 1PH3A 1HPCA 2F03A 2EPBA 1U5KA 1JWSD 2R92G 2HDMA 3C1FA 5J22A 2PNHA 3GTQB 2NTTA 1NMGA 3OPOA 3LNNA 4NW2A 1EEID 3M4OB 1TKWB 4X62L 1PRTC 5IGBA 3GTJH 4C3JB 5GADC 1E24A 1DZ1A 2M00A 3D6CA 1AZQA 3J81c 3W1GA 3BU2A 2J0TD 4QQBX 1J8IA 1N9WA 1CZGA 3UE0A 2BE5C 4ZYSA 5AJ3L 2WIIB 3QR8A 2VQFQ 2ZTCA 4P74A 2SDFA 3T1HL 2PW7A 3ERQA 1X65A 2EXDA 3UDIA 2K75A 4HIMA 1QG7A 1TWFH 3TRZA 1Z9FA 4EGVA 4JI2L 4R9WA 2UUCQ 4FO2A 4PV1C 4EVOA 3GTOH 3NE5B 1YIJA 5LL6S 2KEEA 4A3KB 1A3VA 1H9JA 5D65A 1CSQA 3HOWH 4JI0Q 3CXCA 2Z1CA 3BZCA 3E9IA 1TWHH 5ISRA 4BBRH 4B3SQ 1GKHA 3VDYA 4OELB 4ZLTF 2P5ZX 1WTQA 3Q22A 1J5EL 1EZ8A 3LX0A 3G6EA 1VS0A 4OO1G 4PG3A 2I0QA 1BQQT 1NJIC 1Y8OB 4A3CG 3PIP3 2XWBB 1YHAA 1VQKA 4CGYB 3MXUA 4GLXA 2JE6I 3H3VC 2K6AA 5J1ZA 1SR3A 4B3TQ 1QZHA 4XTCS 4HIDA 5F2DA 2O2LD 1Q81C 2PW5A 1NCVA 1X9NA 3VR4A 4DR3L 1EY9A 4ZCKA 5A2QE 1X32A 3CCMA 2B63G 1CI3M 3KF6B 1CM9A 1GD7A 1NUCA 1B44D 4A3EH 1ET6A 1LTBD 4DNTB 4FXDA 1EIFA 2CWAA 5K5PA 4LF4L 4XQNA 4DK0A 5I6YA 3KLWA 5FO8B 1NTGA 3RZOH 2OCEA 1KL9A 3D6WA 4X3KA 4PZ8A 5C5LA 2CW0D 3HRZC 4FF2A 5KNDA 2CFMA 2N8NA 1OXTA 2EVBA 2UUAL 4LF9L 4NXNL 5KNBA 1MIUA 4JI3L 4DGZA 3PO3B 1CHQD 1MSGA 4A3JB 1AP0A 2D0PA 1A3UA 1PMRA 1HNXL 1EYCA 4LNQA 1MKHA 4FXGC 5FK9C 3VYTA 4IO9A 3KLSA 3KBXA 4KMUC 4F87A 4OIKA 1NSNS 2WACA 3HOVH 3HOUG 2MNAA 3HP3A 4KN7C 1MHWC 4IOAA 3Q6SA 3S1QB 3MAQA 3MFYA 3SK8A 1XPUA 1UE6A 2NVTB 2K5WA 3PF5A 2NZHA 1ONLA 1A0IA 1TS2A 2A69D 2KUMA 3KJPA 2UUBQ 1L1OB 1NR2A 2G9DA 4WJ3M 1EY8A 2F0EA 3FKIB 3GTPH 3DWPA 1FL0A 5ELOA 1TU2B 2WKCA 1WD0A 3U4VA 4M1UB 2QGQA 2B2TA 2EYOA 3H0GB 3VR5A 2NVQB 2UXBL 5C44G 3HS0C 3W2DA 1YVCA 5I6WA 4Y52H 1HRJA 4KY6A 3AFQA 3QOLA 2BOSA 3U50C 1VQLA 1S4ZA 4BY1H 1S5FD 2ES2A 1STBA 4YCVA 3OMCA 2R3ZA 1Y1VB 5C4JB 2F0DA 3PO2B 1R4QB 1RODA 4DV4L 5HY6A 4NXMQ 3STBC 4MHEA 3E5SA 4YY3Q 2B2VC 5IT9L 3QWNA 5LMUL 4HAEA 2K28A 1AE2A 1VQPA 2HIXA 1ILPA 4JI5Q 3T16A 3CCRA 3H91A 4DAYB 1YNJC 5A35A 3K7AH 1EWHA 2IJ0A 3H94A 1ZXTA 2EJMA 3CP0A 4JC0A 5E4XA 2N55A 2L0CA 5JJLA 5JVG3 4HSVA 4JV5Q 4V0BA 2XVSA 3S1RH 1TWCH 3GDEA 1WTHA 1Y1WH 4ODGA 2Q2IA 2EZVA 4FDBA 1BVSA 1SFOH 2LS01 2DY8A 3HGBA 1RTNA 1C9OA 3EIVA 4AQYL 1G8ZD 1QJOA 2JA8G 3A55A 3DEPA 2HQLA 3I4NH 4N8X1 3W5OA 5C0XG 2CWPA 4K5VA 2D9UA 4KI0A 4B3RQ 4RKLA 1PA6A 4OIJA 3B6YA 5CV8A 5CYUA 1MBYA 3S17B 1QVGA 3BG3A 1IHZA 3H15A 3J7AF 5KIXA 4R1JA 2K52A 5CR3A 1M4VA 2NYZD 1TY2A 4R4CA 1H95A 2L11A 2VXWA 3J7AV 4WORA 4L5RC 2WAQG 4KY7A 2PZUA 1EZ6A 1ICWA 2K1BA 2E5LL 1XYIA 1EQVA 1GVPA 3D4DA 4HCSA 4QL5A 1BXTA 2HCIA 3WOEA 1VQCA 3HKZB 5EKLA 3S24A 4YCUA 2L1BA 1KD1C 2Y0SE 1H9KA 4EQOA 1AW7A 1UUPA 2WP8J 4DUYL 4A3FH 2PMZE 3SK4A 1Q3LA 2BA1A 2Z6KC 5FLXc 4KHZA 1L0XB 2DN8A 4O1NA 4TQUS 4BBSH 2DUDA 1KAAA 3Q23A 5J3BA 3PIPA 2AUJD 2EDGA 1HQRD 1D7QA 1DOMA 1I6HB 2GA4B 2MO1A 2CQOA 1XWEA 1I6HH 4FVMA 1BUVT 4N8FA 3TP8A 4GN3B 4A3GH 2RSOA 4IUVA 3CF5A 4GKJL 1B3AA 4C3HH 4ZUIA 1PRTB 3BDOA 4X65L 3KDFB 4DK3C 3PIO3 5BR8L 4DUZQ 3S1NH 1EUJA 1K8OA 2F4IA 2JA6H 3KF8A 1PXUA 3NHHA 3TQYA 3KLRA 1ET9A 2E2HB 4U68A 1IBLQ 2J7ZA 1J9OA 1A2TA 4DAMA 1PLFA 3RZDH 5FKAC 1M90C 4C3JG 3SGIA 2IW3A 2R7FA 1VQNA 4H02A 1VQ7A 3BVZA 4GLAC 1VF7A 4IJHA 1N8RC 1YNXA 1V43A 3HOZH 1N32Q 2RSNA 3RR5A 1E0BA 4DR7L 2KHSA 2Z8LA 1Y14B 5M5WB 1EY5A 4IPGA 1JMCA 1ASYA 2NUCA 1PZJD 4A3KG 1D1IA 1HR0W 2VNUD 3GO5A 4BBRG 1OXSC 1B9NA 4JI1L 4FP5D 4P73A 5K36G 3IFDA 2K32A 2PZTA 5M3FB 4P75A 3UDFA 3M3YH 2EJGC 3H3VH 2X6LA 1RJTA 3MZ5A 4YCWA 1F2MA 4XT1B 1LV9A 1RD9D 1LT3D 3ER0A 5EKKA 1XPOA 1HNZL 5LMNL 1KABA 1PYBA 1V1PB 4JI4L 4CJ1B 1OXUA 3MHBA 1BKBA 1F77A 5EBDA 3E0EA 4WFN3 5ELDA 1BR9A 1X3QA 2A6HC 2CH4W 4RGOS 1PRTD 1DD2A 5IGFA 1I3QH 1DXMA 1HNWL 1T5EA 5IGDA 3HOUB 3CAMA 5GAHC 1B1ZA 1VMPA 4A3DB 2D5DA 5JPNC 4R8IA 2WV6D 1PZKD 5GROA 1TIID 3VYUA 4CKCA 4A3JG 4UDUC 2F0QA 1VF5C 1ZKOA 2D62A 4IUTA 1JICA 2JA5H 1HFGA 1B50A 1II3A 2R93B 3KK7A 1ML0D 2B8FA 3GTMB 2KA7A 1XNQQ 4GOPC 4X6AH 1IBML 1L0YB 2PQAB 1ILQA 4KHPQ 3SDZA 2FMMA 3NK9A 5HGQA 4H13C 1STEA 3CQZH 1IXRA 5FLMG 2HHHQ 1W3SA 4X66Q 3KF6A 3FKIG 2F0OA 4AH6A 3KFUA 4DN4M 5IWAQ 2Z0SA 1BDOA 2QILA 1KRTA 1J6QA 3H0GG 2E2DC 1SNMA 2F3WA 5L37A 1FNWA 3AYHB 2HUGA 2ZT9C 1YEZA 3GTLH 4LF5L 5C4XB 3T13A 4A3IB 2A19A 4K8IA 1UE7A 3S1MB 1Y1VG 3TREA 1HHVA 1SE8A 3PO2G 3ND8A 3ZYYX 2ALYB 1KLUD 2ZXRA 1R9TB 1VQ5A 3S16B 3J80i 4EQ5A 1TQOA 3NPPA 1R9TH 2JEAI 5DM63 4DNRB 1LT5D 2NBFA 2QKIC 4LJZC 1XPRA 1SMYC 3X3MA 4DAPA 2K05A 4KD4A 1KHIA 5KNCA 3WDNA 4DFAA 1FD7D 2K04A 4BY7B 5LMNW 2AWOA 4UHVA 3A0JA 2AQ2B 1FJGL 4NB3A 4IPCA 4L5TA 1D5MC 1JOOA 3PUWA 1K28A 1S72A 1HA5A 2G5DA 1SNPA 3DMUA 1LTLA 4LFBL 2B2WA 1G6ZA 1C4QA 4YWLA 4DNIA 5KRUA 4A75A 2OWOA 4OO1I 4TKOB 3ITPA 2ZJRA 2ID0A 2ENBA 3CPWA 1PH8A 4IPDA 2NVXH 3ICEA 4L5SA 4FF4A 3F2DA 1AN8A 4HN7A 5FJ8G 4LFAQ 1I6VC 4ALPA 3T56B 5JEAH 1SN8A 1A6XA 3I4NG 4IN3A 5DAUA 2MUYA 3PIOA 1F2ZA 1Q1BA 1A15A 2OQ0A 4DF7A 3J7YW 2BA0A 1TR5A 3U4ZA 4KN4C 4DV3L 4POGA 2JK8A 1Y8PB 4DR5L 4YWMA 4KTAA 4QJFA 1K0RA 4DAYA 1VCIA 3HOYH 1QVCA 4RGMA 3LWEA 1X54A 3OIQA 1O7YA 4LF8L 5DLQE 1VQHA 3T4AC 1YNJD 1A62A 4LF7Q 4ME5A 3NWSA 3HKZG 5EAYA 1CA6A 4N9PA 5D14A 4DR4Q 4S3SA 1O78A 4J15A 5CV9A 3FPPA 3WOFA 2LY7A 4KKSA 4Y7NB 1C48A 2LXKA 1XNRQ 4BBSG 4Y7NH 3J80E 2ZXOA 2V1CC 1SYBA 3CMEA 4A93H 3I4OA 1CT1D 2MFIA 2H5XA 4K0KL 2UXDQ 2RQXA 4A3MH 3L7ZC 2B3GA 3Q24A 2N88A 4JBWA 4KK7A 4BXXG 4AIMA 2MP1A 5FO7B 3OTOQ 3Q8DA 1GUGA 2O5JC 2OTJA 3T1YQ 3GTJB 4LUOA 1V1QA 2F4VQ 2NZ1D 4DR2Q 4DA2A 1B2TA 3TS0A 1SRUA 1E2ZA 3NQTA 1STHA 2NB0A 3A74A 4K5WA 3K5NA 1TWAH 5JVH3 2O5IC 4HR7B 1PZID 5CORA 1TWFB 5IYDG 1RHPA 1HH2P 1YHQA 3GTOB 4A3LG 1KRSA 3HOWB 2C9OA 4KHVA 3PCOB 1ENCA 2KCNA 1EIGA 4O42A 1GOZA 3TP5A 2KJXA 3ZJYC 1TWHB 4BBRB 5EPKA 1SYFA 1F2YA 3EN2A 2X6GA 1K3BC 5M3MH 3Q0AA 1CQFA 4NDXA 1EY0A 4LW1A 4L8JA 4CDEC 5C4ZA 2VQFL 1FNVA 2RCNA 5ELBA 2YTXA 4KKTA 3I4MB 3G6JB 3JAML 5FLXE 1JORA 1BBWA 2UUCL 1YJ9A 1SE4A 4WRDA 3I4MH 2ASBA 1SJED 4P2CB 5C3EH 4JI0L 4F7XA 5M3FG 4A3EB 2AHOB 4B3SL 2B2YC 4C1NK 2F52A 3P1HA 1KIXA 2A1AA 5C6AA 5CBAE 3SHLA 3S2HH 3KDFA 2OTLA 1H9SB 3RZOB 2Q2TA 1BF4A 1R4PB 5C0XI 1H9MA 3BJUA 4B3TL 1C7YA 3AB9A 1VQJA 1U4RA 4UP8A 4JI6Q 3LGJA 2N78A 3HOXH 4IFDJ 2K5NA 4JK1C 1VQIA 4C3IH 1SNDA 3WWVA 4RHRA 1YJWA 2A8VA 1KXLA 1TS5A 3HOVB 1YI2A 2EJFC 3I56A 3K81C 3R2IA 3EA6A 5E1FA 2BDOA 4CJ2C 2JP1A 5G3LF 2YU9H 3C3LA 1EIHA 1BBXC 1JWMD 4B3MQ 4A3DG 2F0TA 4QB4A 2K7VA 1LT4D 2RDFA 4OWWB 1YHBA 3BVMA 3VYRA 1SEBD 2NVYH 1W2BA 1VQFA 1VQ4A 1PFSA 3GTPB 1P16A 3HFZB 3V2TA 4R8NA 2E8GA 4CDCC 5IP9G 2R93G 4CDDC 4IPHA 1KDAA 5CV6A 1GUTA 3T51B 3F2BA 3K0YA 3RMHA 4R4QA 1V1PA 4JBKA 3GP7A 1CFMA 3GV6A 3W3AA 4BY1B 2G9HD 3GD7A 5IGEA 2OT2A 3ULJA 1KTKA 1LLRD 1NE3A 1XMQQ 1X3EA 2L5TA 2Y0SB 2UUBL 5KYIA 1SROA 4IALA 4IFDG 1D5XC 1GUWA 1AZPA 2TMPA 2A68D 5C0XJ 2PMZB 3OWEB 1L0WA 2N49A 4JYAQ 2ZXPA 1TS3A 1N33Q 4C56C 2XRSD 4WJWA 3PQIA 4ZUJA 1GXDC 5C4XG 1LTGD 3K7AB 4A3IG 2JSOA 1E22A 4DV1Q 1C8CA 1SYDA 2F0VA 1MD2D 4UAIA 4DR6Q 1F2LA 3OOCA 1U4MA 3QIAA 4OWXB 1HTLD 1XXGA 3H09A 4NXML 1CKNB 2EYFA 4YY3L 2HDLA 2JXMB 1TT2A 1TWGH 5KGUA 1VMCA 2E2JH 1ESRA 1JB3A 4IUPA 4LUZA 3S1RB 4YWKA 1TWCB 4NPSA 4DPGA 1Y1WB 4TSSA 4GNXB 4DXGA 2PQAA 1SYEA 3J80c 4JI5L 2MGSA 4BY7G 4U673 2Q2HA 3DXJC 1SFOB 1WFQA 1SYGA 4PQXA 3PMFA 4DXFA 5ELEA 4C1NI 1HR0Q 1GUOA 2I5HA 2AKWB 1PDQA 3I4NB 1BCPF 3VR3A 1EYGA 4JV5L 2KHJA 3FEWX 3K7UC 3OW2A 3S2DB 2CQAA 2VUMH 4A3BH 3NWTA 4RMFA 1G2SA 3S2DH 1IBKQ 1FYCA 3R2TA 2CHBD 2BH2A 1LM0A 1DM0B 5IGGA 3CCVA 3TZDA 1GUNA 2HD3A 3RLNA 1K83H 4RHSA 2JEBI 4X3UA 2F0JA 2PI2E 1D5ZC 3VR2A 2MHVA 2BCOA 2Q8IB 5IP7H 2F0HA 2E2IB 4B3RL 4GZYC 1KAWA 3PUZA 2N3SA 5BN3A 2ATWA 4AYBE 2A74C 2Z4IA 3CCSA 3NBHA 2E2IH 1N34Q 3CHBD 2VB2X 2I46A 3NBIA 3ONAB 3BYYB 1PFMA 4A3FB 1UNSA 4EQNA 1X3PA 3TMEA 5IT9E 3M7GA 3CRKC 1UE5A 1SBBB 3DEOA 4I7AA 4CKEA 3K5MA 1WTWA 3M4YA 2XTIA 5M9OA 4BBSB 2ICIA 4JOIA 4XYOA 1SMYD 2JA7H 1E7ZA 1EQRA 2IPKD 2ZTDA 3CMAA 2KCCA 3NENA 3V05A 1HZ9A 4L6TB 2KHIA 4NKLA 2ZM6Q 2NN6H 2KCTA 2XNAC 1O7IA 4C2MH 1F9SA 1PTOF 1O80A 4BWGB 2K5HA 4A3GB 3I8ZA 1CA5A 3MVVA 2K01A 4K2LA 4C3HB 1D2BA 1K73C 3CU7A 3L0OA 4IZ8A 3S1NB 2DJFC 2XWJB 4RA8A 2JA6B 2IT1A 2B2UC 1JJGA 1VDZA 2R92H 2IWHA 1RDPD 2ZTEA 1D8LA 1K9MC 1KNEA 3K8AA 2DY7A 2MPMA 3RZDB 4X64Q 2UXCQ 3U58A 2Q2UA 4JVZA 2F0LA 4RH6A 3TP6A 1I50H 1EYAA 3J81L 1JB7A 3FVQA 1IL2A 4HSPA 3I55A 4DV6Q 4DV0Q 2QW7A 1KDCA 1SSOA 2I5MX 1KNAA 2RCFA 3HOZB 4LWCA 3CRLC 2Q8RE 1PH1A 4MNOA 4YHHQ 4JI8Q 3G7LA 4J1MA 4DUZL 4FYDA 3EBEA 3IL8A 4JI7Q 3GV3A 4X3SA 1LABA 2Z6KA 1S40A 4Q0FA 1DOKA 3HOWG 1IBLL 4A4IA 1BNZA 2PZWA 3M3YB 3SR1A 4BA2I 1EY7A 4L63B 4GKKQ 1QWYA 2A69C 1EU3A 1HUMA 2LKVA 4OO1H 1N32L 1X55A 2V4DA 1Q7YC 3I4MG 1FR3A 4A3CH 3UI2A 4KD3A 5JJIA 3JAMc 2RBMA 5C3EG 1S5ED 4HJ7A 4PMBA 2RHQB 4HIKA 2VS1A 1YBYA 1OO9B 4A3EG 3CC4A 3TBIB 4K8JA 2CKZB 5M5XH 2B63H 3AEVA 2QEXA 1I3QB 1Q8IA 2WB1E 5M5YH 1PV4A 4QIWE 3EVQA 4BA1I 4O2DA 3QO2A 3QG1A 1T9HA 5TSSA 4POFA 3EQLC 5JJZA 2VW9A 1S5CD 2A5HA 2A6EC 3H6MA 1JQYD 4ZRZA 2D2CC 4B08A 1DJRD 4KLKA 4RCNA 2F0WA 3X3NA 2F0FA 4JPBW 2BE5D 1K8GA 2IHEA 5I4DA 1HFNA 1A8VA 1DGSA 1SE3A 3HG9A 4DAVA 2XGTA 4ILWA 5D3IB 4HJ5A 2JA5B 2E76C 3K6OA 3F2CA 3W1BA 1X6OA 1Z7TA 2F0KA 3RD4A 2HIVA 2FINB 3HOVG 2YTVA 4OGQC 2VQEQ 1TS4A 2PYKA 1ENAA 4HEDA 4KKUA 5EPJA 4MZ9A 4E6IA 3C2PA 4DKAC 1CTMA 5CC4A 2RDGA 5JAVA 3HEJA 3BZDB 4KV6A 2GN5A 1SNOA 1A2UA 1JJCB 1XMOQ 4DV7Q 3CQZB 2PPBC 3EJIA 1Z6HA 1EFID 3F1ZA 1CSPA 2QCPX 3CCEA 3JC66 1SLJA 1NAPA 3NELA 2ZJQA 4K6DA 3BS1A 1PYSB 1HA6A 1ASZA 4ABNA 3I72A 1H9SA 4CKBA 3MXNB 1OTCA 1MJEA 1MI2A 5KYLA 1L1OC 4HJAA 2LMCB 3FPUB 4OXPA 1PH7A 1XNQL 1E2WA 3MEFA 3PGZA 1EEFD 3DM3A 4BY1G 4ME3A 4P71A 5C44H 3GTLB 3KBGA 2B2WC 2IX1A 3GTGH 4KHPL 2Y0SG 2J4XA 1IYUA 2HHHL 4OX9Q 4X66L 4ZQ3A 5IWAL 4K5XA 3AFPA 3CKIB 3NQIA 1CQVA 2MO0A 1ZYRC 3PF4A 5IT9c 3SK5A 2K5DA 3NBHB 3I3CA 1SYCA 2PCFB 1N36Q 3LWUA 1QOHA 3RLFA 1VQ8A 4HJ9A 4DR1Q 2YYZA 1HQMC 2SNMA 3D8GA 1QZGA 1X3FA 1U4PA 1W6KA 3E0JA 3PUYA 5EBCA 1ICFB 1LTID 5I9PA 3K59A 1JWUD 2PI2A 1IYJB 1F9QA 3VYSA 3AMUA 2QDLA 1WTPA 1RL2A 2TSSA 1Y1WG 1WTXA 1SAPA 3VA5A 2NVXB 2LSSA 5EPLA 2AMCB 1BBUA 1Q46A 1VQEA 2K5QA 4I65A 5IYBH 1S5BD 2VZAA 1TY0A 3H3VI 1V9PA 1SNCA 2UU9Q 5HURA 1FGBD 3RUZA 4RG1A 1GM5A 2F0GA 4H44C 2JA8H 1EL0A 1T5XD 2VUMG 4A3BG 4DV2Q 1PYWD 3P7JA 5CMDA 3A7AB 3FMCA 1PVOA 4OWTB 2ZJPA 1LYLA 1UEBA 5C3XA 4R4OA 5I9OA 4DV5Q 4LFCQ 3STBD 3I91A 4ZK9B 3HOYB 1LTAD 2KOLA 4LFAL 4R4IA 3CCLA 5EGTA 1PH5A 1QB5D 5CV7A 5KEEA 5IP7G 3PUXA 1Q86C 1CKNA 1DYQA 1D6EC 4XDXA 5E3FA 4RKBA 1EY6A 4LF6Q 1HZCA 1EQQA 1RF2D 4GNXA 3TEHB 2O4XA 1WTRA 4IURA 2KECA 2M2LA 3M9BA 4A3FG 4L5QA 3D4RA 4QMGA 4NP5A 1WCMB 5JPMC 3M4PA 4GN4B 3OMGA 1DOLA 1WI5A 2VY3A 3AU7A 4KJNA 1I94Q 5JJKA 4PMCA 1WCMH 4A93B 1BCPC 1UEAB 1JOKA 4LMQD 1C0AA 1TVXA 1XTCD 2NN6G 4A3MB 2FXQA 2WB1G 5A2QL 1UAPA 2DGYA 2K03A 4LF7L 4B9XA 4HTHA 1U0LA 3I70A 2SOBA 3QB3A 4X62Q 4DR4L 1I4PA 4G57A 4CBVA 4A3GG 3J81j 4XIGS 4EX5A 3NTKA 4HMJA 3RLOA 1TWAB 4RFBA 1VQMA 2OEOA 3IKJA 4H7BA 4C3HG 3S14H 3D31A 3EROA 3K0XA 1XNRL 1QVFA 3GTKH 5AJ3Q 4IFDI 5T1IA 5C3WA 3T1HQ 2SEBD 1B4OA 5GAEC 3PSIA 2AWNA 1TXYA 2JA6G 4PZ6A 3IRBA 3OWFA 1HUNA 2UXDL 2CH4A 3E6ZX 1Q8KA 4JI2Q 3MC0B 3L2PA 3GTQH 1WYDA 3OTOL 2XRQD 3M4OH 1NNXA 3T1YL 1VQGA 5CV5A 1CKMA 2F4VL 4DR2L 2X69A 4C3JH 5M3MB 1K8MA 4F8MA 2RDHA 3G71A 1I4RA 1J5EQ 2FMCA 3JAMi 4UP9A 3TDQA 3HOZG 1UE1A 5IOCA 4J6HA 1YITA 3UDGA 3OSOA 3BZKA 1P8LA 4RWSC 4RAUC 1Y69U 2ICEC 1IW7C 1U9RA
chains in the Genus database with same CATH topology
4A3KG 1HR0W 2VNUD 2PQAA 1E1TA 3J80c 4JI5L 2C35B 3GO5A 4DR3Q 4BY7G 4BBRG 1OXSC 4A3KH 4JI1L 5IYCG 2R7ZH 4GKJL 1N36L 2Q2HA 4P73A 3J7A5 1WFQA 2F3IA 4BY7H 5K36G 4DR1L 1L1OA 4P75A 3UDFA 3D0FA 2WAQE 3M3YH 3H3VH 1HR0Q 4YCWA 3CCUA 2I5HA 4GNXC 3CCJA 2AKWB 4LF4Q 3ER0A 1XPOA 1HNZL 2JA9A 5LMNL 1EYGA 4JV5L 2KHJA 1PH6A 1PYBA 1XJVA 4JI4L 3K7UC 3KYHC 3OW2A 3M4QA 1OXUA 2VUMH 4A3BH 1BKBA 2UUAQ 4RMFA 4LF9Q 3S2DH 4DV3Q 4NXNQ 1HZAA 1B8AA 1IBKQ 4DR5Q 4TVAB 4JI3Q 1MJCA 3E0EA 2BH2A 1LM0A 4JBJA 2I5LX 4IOCA 4GLVB 3CCVA 1OXXK 2GVAA 4LUVA 1HNXQ 3RLNA 1K83H 2K14A 2JEBI 4LF8Q 2UU9L 2PI2E 2CCZA 3PUVA 3PV0A 1I3QH 2BH8A 1HNWL 5IP7H 4DV2L 3CAMA 3KF8B 5GAHC 4B3RL 3CD6A 1KAWA 3PUZA 1LUZA 2N3SA 3CC7A 2ATWA 4AYBE 3CCSA 2E2IH 3I7FA 1N34Q 3TS2A 1L2FA 1CUKA 4JI6L 4LFCL 5GROA 4DV5L 4HJ8A 4A3JG 3A5ZB 3PO3H 1UE5A 1VQBA 1Z47A 2D62A 4GOPB 4A3JH 1OXVA 2JA5G 3CC2A 2XTIA 2JA7G 2JEAI 4JOIA 2JA5H 2JA7H 4MTNA 1E7ZA 1EQRA 1NBWA 2K4KA 2ZTDA 3M7NA 3CMAA 3NENA 2OQKA 1EOVA 3J7ZC 3RN2A 1HZ9A 4K0KQ 2KHIA 4PMWA 4WJ4A 2GVBA 2ZM6Q 2KCTA 2LXJA 3HKSA 2UXBQ 1XNQQ 4GOPC 4X6AH 4B3ML 1O7IA 1IBML 3S15H 4LF6L 2PQAB 3ERSX 3S1QH 4C2MH 2K5HA 2NVTH 1UWVA 4KHPQ 5HGQA 5IE8A 3RNUA 3CQZH 1IXRA 5FLMG 2HHHQ 1W3SA 1QUQA 4X66Q 1CKOA 2IY5B 5FLMH 1K73C 3KF6A 1I5FA 2NZOA 3FKIG 4AH6A 1I94L 4IJLA 1M1KC 3KFUA 4DV4Q 1HJPA 2EIFA 3FKIH 3L0OA 5IWAQ 2Z0SA 1PH3A 1KRTA 1NY4A 1U5KA 1S3OA 2R92G 1J6QA 5LMUQ 2IT1A 1YZ6A 1B70B 2PNHA 3H0GG 1JJGA 2R92H 2ZTEA 1D8LA 1K9MC 1GO3E 1NMGA 3H0GH 3K8AA 2NVQH 3AYHB 4X64Q 2UXCQ 3U58A 2EQSA 1YEZA 2Q2UA 4X62L 1EFWA 3GTLH 5JEAJ 4LF5L 3GTJH 1I50H 3ULPA 5GADC 1E24A 2A19A 1JB7A 1IL2A 3F8TA 1UE7A 3I55A 4DV6Q 4DV0Q 1XMQL 1Y1VG 3TREA 4QQBX 3J81c 3W1GA 3BU2A 2I5MX 2KBNA 1SE8A 3PO2G 2ALYB 1N9WA 1Y1VH 5GQOA 5C4JH 3UE0A 3PO2H 1VQ5A 3J80i 5AJ3L 4LWCA 4EQ5A 2VQFQ 2ZTCA 4P74A 3T1HL 1R9TH 4MNOA 4YHHQ 3KJOA 1PH1A 1X65A 2EXDA 4JI8Q 3UDIA 2K75A 4DUZL 4JYAL 3EBEA 4HIMA 1TWFH 3TRZA 4JI7Q 1Z9FA 4JI2L 1N33L 2WFWA 2Z6KA 2UUCQ 1S40A 1XPRA 3GTOH 3AQQA 3FHWA 1YIJA 3HOWG 3DLLA 3ULLA 1Q82C 1KHIA 1IBLL 1CSQA 3HOWH 1VQ9A 4A4IA 5LMNW 2AWOA 4JI0Q 3CXCA 3A0JA 1FJGL 3BZCA 3E9IA 4NB3A 1TWHH 1X3GA 4IPCA 4DV1L 4BBRH 4L5TA 1S72A 1GKHA 3PUWA 5IYCH 3VDYA 4B3SQ 4BA2I 4DR6L 1J5EL 4AQYQ 4UY8C 3G6EA 4GKKQ 1VS0A 4OO1G 1LTLA 4LFBL 4PG3A 2I0QA 1NJIC 4A3CG 1YHAA 1N32L 4YWLA 1X55A 1Q7YC 4DNIA 4A75A 2OWOA 4OO1I 4UP7A 1VQKA 3I4MG 1Q1EA 4A3CH 4GLXA 2ZJRA 2JE6I 1SR3A 4B3TQ 1QZHA 2ID0A 4XTCS 4JOIC 3JAMc 5JJIA 5IYBG 4HIDA 1AE3A 1Q81C 3CPWA 5C3EG 4HJ7A 4IPDA 1PH8A 2NVXH 3ICEA 1X9NA 4DR3L 2RHQB 4L5SA 4HIKA 2VS1A 3F2DA 1YBYA 1QUQB 5JEAG 4LFAQ 5FJ8G 3CCMA 4ALPA 4A3EG 2B63G 3KF6B 3CC4A 1GD7A 2CKZB 4A3EH 5FJ8H 5M5XH 1SN8A 2B63H 1HR0L 3I4NG 1EIFA 2CWAA 2QEXA 3AEVA 2WB1E 5M5YH 1PV4A 4LF4L 4QIWE 3KLWA 4BA1I 4O2DA 1NTGA 2E5LQ 3PIOA 1T9HA 4POFA 3RZOH 2OCEA 1KL9A 1RIPA 2VW9A 1Q1BA 4PZ8A 1PH4A 2OQ0A 1E1OA 4KLKA 2CFMA 2N8NA 1OXTA 3NEMA 2UUAL 4LF9L 2BA0A 1B7YB 4NXNL 3U4ZA 4DV3L 1MIUA 3G48A 4OONA 2JK8A 1IBKL 4DR5L 4JI3L 1K8GA 4POGA 2IHEA 2K50A 4YWMA 3HOYG 1A8VA 1DGSA 1K0RA 4QJFA 1VCIA 4DUYQ 3HOYH 1QVCA 2D0PA 2XGTA 2MQHA 4HJ5A 1HNXL 1X54A 4LNQA 1PHJA 1MKHA 3F2CA 3FP9A 3W1BA 1X6OA 2HIVA 4IO9A 4LF8L 3HOVG 2YTVA 5DLQE 1VQHA 2VQEQ 3HOVH 1A62A 3HOUG 2MNAA 3S17H 4MZ9A 1SMXA 4LF7Q 4DKAC 4IOAA 3HKZG 1NMFA 5EAYA 1XPUA 1UE6A 4APVA 1N34L 4DR4Q 2GN5A 1PH2A 3PF5A 4J15A 1JJCB 2NZHA 1XMOQ 1A0IA 4DV7Q 2D0OA 4GKJQ 3F1ZA 3CCEA 1CSPA 3KJPA 2UUBQ 1WCMG 1L1OB 3JC66 3RN5A 2LXKA 1XNRQ 4BBSG 4WJ3M 1SLJA 3NELA 4A93G 5ELNA 3GTPH 4Y7NH 2ZJQA 1EWIA 4X65Q 1PYSB 2V1CC 3CMEA 1FL0A 1ASZA 3I4OA 4A93H 5ELOA 2MFIA 4A3MG 5BR8Q 2HT1A 2H5XA 1OTCA 4K0KL 3MXNB 3U4VA 2UXDQ 1MJEA 4A3MH 2QGQA 3L7ZC 2B3GA 2IHFA 2ZM6L 1L1OC 4JBWA 3J81i 4HJAA 4OXPA 4BXXG 1PH7A 2YV5A 4AIMA 5C44G 1XNQL 2UXBL 3K80C 2RF4A 3OTOQ 1YVCA 3MEFA 3PGZA 3DM3A 3Q8DA 4BY1G 4ME3A 4P71A 5C44H 4BXXH 2OTJA 3AFQA 3T1YQ 2IX1A 3U50C 4LUOA 1V1QA 1VQLA 4BY1H 2F4VQ 3GTGH 4KHPL 2ES2A 1KQSA 4DR2Q 1X56A 2Y0SG 4YCVA 4DK6C 1SRUA 3TS0A 3A74A 2HHHL 1TWAH 4OX9Q 4X66L 2KENA 3G4SA 1HZBA 4DV4L 5HY6A 4NXMQ 5IWAL 3AFPA 3STBC 4YY3Q 4DR7Q 5IYDG 2B29A 5LMUL 1HH2P 2MO0A 1YHQA 5IYDH 1E3PA 4GS3A 5IT9c 3PF4A 1AE2A 1VQPA 1JJ2A 4A3LG 2HIXA 3NBHB 4O0AA 1KRSA 4X64L 2K5VA 4JI5Q 3PCOB 3CCRA 2E2HH 4A3LH 2UXCL 4DAYB 4JI1Q 3ZJYC 1N36Q 4A76A 3RLFA 1FVIA 1VQ8A 4HJ9A 3K7AH 5M3MG 4DR1Q 2YYZA 3CP0A 4DV6L 4DV0L 3EN2A 5M3MH 1QZGA 4JC0A 1X3FA 3PUYA 4LW1A 1HNZQ 1K8AC 5JJLA 5LMNQ 2VQFL 2R6GA 4JV5Q 4YHHL 2RCNA 4JI8L 2YTXA 2PI2A 4JI4Q 1IYJB 1AH9A 4JI7L 1XTDA 1RL2A 1Y1WG 1BBWA 2UUCL 1YJ9A 3I4MH 5M5WH 3S1RH 1TWCH 3GDEA 2R7ZG 2LSSA 1Y1WH 4PZ7A 2Q2IA 2ASBA 2AMCB 1BBUA 1Q46A 1VQEA 4FDBA 5IYBH 5C3EH 2VL6A 4JI0L 5IY0A 1BVSA 3CCQA 1EIYB 3CW2C 5M3FG 1SFOH 1VQOA 2AHOB 2VZAA 2RHSB 4B3SL 1C9OA 3EIVA 3H3VI 1V9PA 2F52A 5M3FH 1KIXA 4AQYL 3UE1A 2A1AA 1Q12A 2UU9Q 2JA8G 4GKKL 4RG1A 2HQLA 2JQOA 1GM5A 2JA8H 3S2HH 3KDFA 2OTLA 3W5OA 3I4NH 2KCMA 5C0XG 1HNWQ 2CWPA 2Q2TA 3HKZE 4DV2Q 1VQ6A 4HIOA 2VUMG 4A3BG 4Y52H 4R4TA 4KI0A 4B3RQ 1PA6A 5C0XI 3BJUA 3B6YA 4B3TL 1PVOA 1C7YA 4P72A 4OWTB 2ZJPA 1QVGA 1VQJA 1LYLA 3HOXG 1UEBA 4UP8A 3H15A 2L15A 4R4OA 4JI6Q 3LGJA 4R1JA 3STBD 2K52A 2N78A 5H1SE 3HOXH 4DV5Q 4LFCQ 4IFDJ 2K5NA 5GAGC 1VQIA 4C3IH 4LFAL 4R4IA 3UDXA 3CCLA 4JCVE 1PH5A 3WWVA 4R4CA 1H95A 1YJWA 2A8VA 4GN5A 4L5RC 1KXLA 5IP7G 2WAQG 1G291 1YI2A 3I56A 3K81C 3PUXA 1Q86C 1CKNA 2E5LL 1GVPA 4QL5A 3A5UA 2YU9H 3HOUH 4B3MQ 1IBMQ 4A3DG 1VQCA 4LF6Q 3S24A 1YJNA 1HZCA 1FGUA 4YCUA 1EQQA 4GNXA 4OWWB 4A3DH 1YHBA 1KD1C 3TEHB 2Y0SE 3PO3G 3M9BA 4A3FG 1K3RA 2NVYH 4L5QA 1VQFA 1W2BA 1G6PA 2WP8J 4DUYL 4A3FH 1VQ4A 4QY7A 1PFSA 3M4PA 4GN4B 1WI5A 1P16A 2PMZE 2VY3A 3HFZB 5JJKA 1I94Q 5FLXc 2BA1A 2Z6KC 3CPFA 1WCMH 2E8GA 4KHZA 5IP9G 2R93G 4TQUS 2QA4A 4BBSH 2DUDA 2YTYA 3I2ZA 4IPHA 2NN6G 1C0AA 5IP9H 1PH9A 3F2BA 2R93H 2VQEL 2FXQA 2WB1G 5J3BA 2DGYA 3PIPA 2NN6I 4R4QA 4JBKA 4LF7L 3GTMH 1D7QA 2R7DA 3OYYA 1U0LA 4X62Q 2MO1A 4DR4L 2CQOA 4A3GG 4LF5Q 1I6HH 4AYBG 3J81j 4DV7L 4XIGS 4EX5A 1XMOL 3GD7A 4GN3B 5E7NA 3ULJA 3CF5A 1NE3A 2JJQA 3RLOA 1VQMA 1XMQQ 4A3GH 1X3EA 2UUBL 3S14H 3D31A 3K0XA 1XNRL 1SROA 4IFDG 4C3HH 1QVFA 1KC8C 3GTKH 3KOJA 4X65L 5AJ3Q 5C0XJ 3KDFB 4IFDI 4DK3C 1L0WA 3T1HQ 1A63A 2N49A 5GAEC 4JYAQ 3PSIA 2AWNA 1TXYA 5BR8L 4PZ6A 4DUZQ 2JA6G 1EUJA 3IRBA 3S1NH 2UXDL 4JBMA 1Q8KA 4UPAA 4JI2Q 1N33Q 2JA6H 3E9HA 4JG2A 3L2PA 3TQYA 3GTQH 1WYDA 3OTOL 1WOCA 1JE5A 1WJJA 1IBLQ 3M4OH 4DAMA 3RZDH 3T1YL 5C4XG 1M90C 1VQGA 4A3IG 1FJGQ 1CKMA 2IX0A 2F4VL 5C4XH 3SGIA 1E22A 3M85A 4C3JH 2R7FA 4DV1Q 4DR2L 1VQAA 4A3IH 1VQNA 4H02A 4DR6Q 3S1MH 1J5EQ 3G71A 1VQ7A 4GOPA 4OX9L 4GLAC 1IZ6A 4OWXB 4UP9A 3JAMi 1JT8A 4IJHA 3HOZG 4LFBQ 1N8RC 4NXML 1UE1A 1YNXA 1CKNB 1V43A 1YITA 3S16H 3HOZH 3RR5A 4YY3L 1N32Q 4QGUA 4DR7L 3UDGA 1TWGH 3BZKA 1G51A 1P8LA 4LUZA 1Y14B 2E2JH 4YWKA 4DPGA 4NPSA 4IPGA 1JMCA 1ASYA 1VQDA 4GNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K G;  1HR0 W;  2VNU D;  2PQA A;  1E1T A;  3J80 c;  4JI5 L;  2C35 B;  3GO5 A;  4DR3 Q;  4BY7 G;  4BBR G;  1OXS C;  4A3K H;  4JI1 L;  5IYC G;  2R7Z H;  4GKJ L;  1N36 L;  2Q2H A;  4P73 A;  3J7A 5;  1WFQ A;  2F3I A;  4BY7 H;  5K36 G;  4DR1 L;  1L1O A;  4P75 A;  3UDF A;  3D0F A;  2WAQ E;  3M3Y H;  3H3V H;  1HR0 Q;  4YCW A;  3CCU A;  2I5H A;  4GNX C;  3CCJ A;  2AKW B;  4LF4 Q;  3ER0 A;  1XPO A;  1HNZ L;  2JA9 A;  5LMN L;  1EYG A;  4JV5 L;  2KHJ A;  1PH6 A;  1PYB A;  1XJV A;  4JI4 L;  3K7U C;  3KYH C;  3OW2 A;  3M4Q A;  1OXU A;  2VUM H;  4A3B H;  1BKB A;  2UUA Q;  4RMF A;  4LF9 Q;  3S2D H;  4DV3 Q;  4NXN Q;  1HZA A;  1B8A A;  1IBK Q;  4DR5 Q;  4TVA B;  4JI3 Q;  1MJC A;  3E0E A;  2BH2 A;  1LM0 A;  4JBJ A;  2I5L X;  4IOC A;  4GLV B;  3CCV A;  1OXX K;  2GVA A;  4LUV A;  1HNX Q;  3RLN A;  1K83 H;  2K14 A;  2JEB I;  4LF8 Q;  2UU9 L;  2PI2 E;  2CCZ A;  3PUV A;  3PV0 A;  1I3Q H;  2BH8 A;  1HNW L;  5IP7 H;  4DV2 L;  3CAM A;  3KF8 B;  5GAH C;  4B3R L;  3CD6 A;  1KAW A;  3PUZ A;  1LUZ A;  2N3S A;  3CC7 A;  2ATW A;  4AYB E;  3CCS A;  2E2I H;  3I7F A;  1N34 Q;  3TS2 A;  1L2F A;  1CUK A;  4JI6 L;  4LFC L;  5GRO A;  4DV5 L;  4HJ8 A;  4A3J G;  3A5Z B;  3PO3 H;  1UE5 A;  1VQB A;  1Z47 A;  2D62 A;  4GOP B;  4A3J H;  1OXV A;  2JA5 G;  3CC2 A;  2XTI A;  2JA7 G;  2JEA I;  4JOI A;  2JA5 H;  2JA7 H;  4MTN A;  1E7Z A;  1EQR A;  1NBW A;  2K4K A;  2ZTD A;  3M7N A;  3CMA A;  3NEN A;  2OQK A;  1EOV A;  3J7Z C;  3RN2 A;  1HZ9 A;  4K0K Q;  2KHI A;  4PMW A;  4WJ4 A;  2GVB A;  2ZM6 Q;  2KCT A;  2LXJ A;  3HKS A;  2UXB Q;  1XNQ Q;  4GOP C;  4X6A H;  4B3M L;  1O7I A;  1IBM L;  3S15 H;  4LF6 L;  2PQA B;  3ERS X;  3S1Q H;  4C2M H;  2K5H A;  2NVT H;  1UWV A;  4KHP Q;  5HGQ A;  5IE8 A;  3RNU A;  3CQZ H;  1IXR A;  5FLM G;  2HHH Q;  1W3S A;  1QUQ A;  4X66 Q;  1CKO A;  2IY5 B;  5FLM H;  1K73 C;  3KF6 A;  1I5F A;  2NZO A;  3FKI G;  4AH6 A;  1I94 L;  4IJL A;  1M1K C;  3KFU A;  4DV4 Q;  1HJP A;  2EIF A;  3FKI H;  3L0O A;  5IWA Q;  2Z0S A;  1PH3 A;  1KRT A;  1NY4 A;  1U5K A;  1S3O A;  2R92 G;  1J6Q A;  5LMU Q;  2IT1 A;  1YZ6 A;  1B70 B;  2PNH A;  3H0G G;  1JJG A;  2R92 H;  2ZTE A;  1D8L A;  1K9M C;  1GO3 E;  1NMG A;  3H0G H;  3K8A A;  2NVQ H;  3AYH B;  4X64 Q;  2UXC Q;  3U58 A;  2EQS A;  1YEZ A;  2Q2U A;  4X62 L;  1EFW A;  3GTL H;  5JEA J;  4LF5 L;  3GTJ H;  1I50 H;  3ULP A;  5GAD C;  1E24 A;  2A19 A;  1JB7 A;  1IL2 A;  3F8T A;  1UE7 A;  3I55 A;  4DV6 Q;  4DV0 Q;  1XMQ L;  1Y1V G;  3TRE A;  4QQB X;  3J81 c;  3W1G A;  3BU2 A;  2I5M X;  2KBN A;  1SE8 A;  3PO2 G;  2ALY B;  1N9W A;  1Y1V H;  5GQO A;  5C4J H;  3UE0 A;  3PO2 H;  1VQ5 A;  3J80 i;  5AJ3 L;  4LWC A;  4EQ5 A;  2VQF Q;  2ZTC A;  4P74 A;  3T1H L;  1R9T H;  4MNO A;  4YHH Q;  3KJO A;  1PH1 A;  1X65 A;  2EXD A;  4JI8 Q;  3UDI A;  2K75 A;  4DUZ L;  4JYA L;  3EBE A;  4HIM A;  1TWF H;  3TRZ A;  4JI7 Q;  1Z9F A;  4JI2 L;  1N33 L;  2WFW A;  2Z6K A;  2UUC Q;  1S40 A;  1XPR A;  3GTO H;  3AQQ A;  3FHW A;  1YIJ A;  3HOW G;  3DLL A;  3ULL A;  1Q82 C;  1KHI A;  1IBL L;  1CSQ A;  3HOW H;  1VQ9 A;  4A4I A;  5LMN W;  2AWO A;  4JI0 Q;  3CXC A;  3A0J A;  1FJG L;  3BZC A;  3E9I A;  4NB3 A;  1TWH H;  1X3G A;  4IPC A;  4DV1 L;  4BBR H;  4L5T A;  1S72 A;  1GKH A;  3PUW A;  5IYC H;  3VDY A;  4B3S Q;  4BA2 I;  4DR6 L;  1J5E L;  4AQY Q;  4UY8 C;  3G6E A;  4GKK Q;  1VS0 A;  4OO1 G;  1LTL A;  4LFB L;  4PG3 A;  2I0Q A;  1NJI C;  4A3C G;  1YHA A;  1N32 L;  4YWL A;  1X55 A;  1Q7Y C;  4DNI A;  4A75 A;  2OWO A;  4OO1 I;  4UP7 A;  1VQK A;  3I4M G;  1Q1E A;  4A3C H;  4GLX A;  2ZJR A;  2JE6 I;  1SR3 A;  4B3T Q;  1QZH A;  2ID0 A;  4XTC S;  4JOI C;  3JAM c;  5JJI A;  5IYB G;  4HID A;  1AE3 A;  1Q81 C;  3CPW A;  5C3E G;  4HJ7 A;  4IPD A;  1PH8 A;  2NVX H;  3ICE A;  1X9N A;  4DR3 L;  2RHQ B;  4L5S A;  4HIK A;  2VS1 A;  3F2D A;  1YBY A;  1QUQ B;  5JEA G;  4LFA Q;  5FJ8 G;  3CCM A;  4ALP A;  4A3E G;  2B63 G;  3KF6 B;  3CC4 A;  1GD7 A;  2CKZ B;  4A3E H;  5FJ8 H;  5M5X H;  1SN8 A;  2B63 H;  1HR0 L;  3I4N G;  1EIF A;  2CWA A;  2QEX A;  3AEV A;  2WB1 E;  5M5Y H;  1PV4 A;  4LF4 L;  4QIW E;  3KLW A;  4BA1 I;  4O2D A;  1NTG A;  2E5L Q;  3PIO A;  1T9H A;  4POF A;  3RZO H;  2OCE A;  1KL9 A;  1RIP A;  2VW9 A;  1Q1B A;  4PZ8 A;  1PH4 A;  2OQ0 A;  1E1O A;  4KLK A;  2CFM A;  2N8N A;  1OXT A;  3NEM A;  2UUA L;  4LF9 L;  2BA0 A;  1B7Y B;  4NXN L;  3U4Z A;  4DV3 L;  1MIU A;  3G48 A;  4OON A;  2JK8 A;  1IBK L;  4DR5 L;  4JI3 L;  1K8G A;  4POG A;  2IHE A;  2K50 A;  4YWM A;  3HOY G;  1A8V A;  1DGS A;  1K0R A;  4QJF A;  1VCI A;  4DUY Q;  3HOY H;  1QVC A;  2D0P A;  2XGT A;  2MQH A;  4HJ5 A;  1HNX L;  1X54 A;  4LNQ A;  1PHJ A;  1MKH A;  3F2C A;  3FP9 A;  3W1B A;  1X6O A;  2HIV A;  4IO9 A;  4LF8 L;  3HOV G;  2YTV A;  5DLQ E;  1VQH A;  2VQE Q;  3HOV H;  1A62 A;  3HOU G;  2MNA A;  3S17 H;  4MZ9 A;  1SMX A;  4LF7 Q;  4DKA C;  4IOA A;  3HKZ G;  1NMF A;  5EAY A;  1XPU A;  1UE6 A;  4APV A;  1N34 L;  4DR4 Q;  2GN5 A;  1PH2 A;  3PF5 A;  4J15 A;  1JJC B;  2NZH A;  1XMO Q;  1A0I A;  4DV7 Q;  2D0O A;  4GKJ Q;  3F1Z A;  3CCE A;  1CSP A;  3KJP A;  2UUB Q;  1WCM G;  1L1O B;  3JC6 6;  3RN5 A;  2LXK A;  1XNR Q;  4BBS G;  4WJ3 M;  1SLJ A;  3NEL A;  4A93 G;  5ELN A;  3GTP H;  4Y7N H;  2ZJQ A;  1EWI A;  4X65 Q;  1PYS B;  2V1C C;  3CME A;  1FL0 A;  1ASZ A;  3I4O A;  4A93 H;  5ELO A;  2MFI A;  4A3M G;  5BR8 Q;  2HT1 A;  2H5X A;  1OTC A;  4K0K L;  3MXN B;  3U4V A;  2UXD Q;  1MJE A;  4A3M H;  2QGQ A;  3L7Z C;  2B3G A;  2IHF A;  2ZM6 L;  1L1O C;  4JBW A;  3J81 i;  4HJA A;  4OXP A;  4BXX G;  1PH7 A;  2YV5 A;  4AIM A;  5C44 G;  1XNQ L;  2UXB L;  3K80 C;  2RF4 A;  3OTO Q;  1YVC A;  3MEF A;  3PGZ A;  3DM3 A;  3Q8D A;  4BY1 G;  4ME3 A;  4P71 A;  5C44 H;  4BXX H;  2OTJ A;  3AFQ A;  3T1Y Q;  2IX1 A;  3U50 C;  4LUO A;  1V1Q A;  1VQL A;  4BY1 H;  2F4V Q;  3GTG H;  4KHP L;  2ES2 A;  1KQS A;  4DR2 Q;  1X56 A;  2Y0S G;  4YCV A;  4DK6 C;  1SRU A;  3TS0 A;  3A74 A;  2HHH L;  1TWA H;  4OX9 Q;  4X66 L;  2KEN A;  3G4S A;  1HZB A;  4DV4 L;  5HY6 A;  4NXM Q;  5IWA L;  3AFP A;  3STB C;  4YY3 Q;  4DR7 Q;  5IYD G;  2B29 A;  5LMU L;  1HH2 P;  2MO0 A;  1YHQ A;  5IYD H;  1E3P A;  4GS3 A;  5IT9 c;  3PF4 A;  1AE2 A;  1VQP A;  1JJ2 A;  4A3L G;  2HIX A;  3NBH B;  4O0A A;  1KRS A;  4X64 L;  2K5V A;  4JI5 Q;  3PCO B;  3CCR A;  2E2H H;  4A3L H;  2UXC L;  4DAY B;  4JI1 Q;  3ZJY C;  1N36 Q;  4A76 A;  3RLF A;  1FVI A;  1VQ8 A;  4HJ9 A;  3K7A H;  5M3M G;  4DR1 Q;  2YYZ A;  3CP0 A;  4DV6 L;  4DV0 L;  3EN2 A;  5M3M H;  1QZG A;  4JC0 A;  1X3F A;  3PUY A;  4LW1 A;  1HNZ Q;  1K8A C;  5JJL A;  5LMN Q;  2VQF L;  2R6G A;  4JV5 Q;  4YHH L;  2RCN A;  4JI8 L;  2YTX A;  2PI2 A;  4JI4 Q;  1IYJ B;  1AH9 A;  4JI7 L;  1XTD A;  1RL2 A;  1Y1W G;  1BBW A;  2UUC L;  1YJ9 A;  3I4M H;  5M5W H;  3S1R H;  1TWC H;  3GDE A;  2R7Z G;  2LSS A;  1Y1W H;  4PZ7 A;  2Q2I A;  2ASB A;  2AMC B;  1BBU A;  1Q46 A;  1VQE A;  4FDB A;  5IYB H;  5C3E H;  2VL6 A;  4JI0 L;  5IY0 A;  1BVS A;  3CCQ A;  1EIY B;  3CW2 C;  5M3F G;  1SFO H;  1VQO A;  2AHO B;  2VZA A;  2RHS B;  4B3S L;  1C9O A;  3EIV A;  3H3V I;  1V9P A;  2F52 A;  5M3F H;  1KIX A;  4AQY L;  3UE1 A;  2A1A A;  1Q12 A;  2UU9 Q;  2JA8 G;  4GKK L;  4RG1 A;  2HQL A;  2JQO A;  1GM5 A;  2JA8 H;  3S2H H;  3KDF A;  2OTL A;  3W5O A;  3I4N H;  2KCM A;  5C0X G;  1HNW Q;  2CWP A;  2Q2T A;  3HKZ E;  4DV2 Q;  1VQ6 A;  4HIO A;  2VUM G;  4A3B G;  4Y52 H;  4R4T A;  4KI0 A;  4B3R Q;  1PA6 A;  5C0X I;  3BJU A;  3B6Y A;  4B3T L;  1PVO A;  1C7Y A;  4P72 A;  4OWT B;  2ZJP A;  1QVG A;  1VQJ A;  1LYL A;  3HOX G;  1UEB A;  4UP8 A;  3H15 A;  2L15 A;  4R4O A;  4JI6 Q;  3LGJ A;  4R1J A;  3STB D;  2K52 A;  2N78 A;  5H1S E;  3HOX H;  4DV5 Q;  4LFC Q;  4IFD J;  2K5N A;  5GAG C;  1VQI A;  4C3I H;  4LFA L;  4R4I A;  3UDX A;  3CCL A;  4JCV E;  1PH5 A;  3WWV A;  4R4C A;  1H95 A;  1YJW A;  2A8V A;  4GN5 A;  4L5R C;  1KXL A;  5IP7 G;  2WAQ G;  1G29 1;  1YI2 A;  3I56 A;  3K81 C;  3PUX A;  1Q86 C;  1CKN A;  2E5L L;  1GVP A;  4QL5 A;  3A5U A;  2YU9 H;  3HOU H;  4B3M Q;  1IBM Q;  4A3D G;  1VQC A;  4LF6 Q;  3S24 A;  1YJN A;  1HZC A;  1FGU A;  4YCU A;  1EQQ A;  4GNX A;  4OWW B;  4A3D H;  1YHB A;  1KD1 C;  3TEH B;  2Y0S E;  3PO3 G;  3M9B A;  4A3F G;  1K3R A;  2NVY H;  4L5Q A;  1VQF A;  1W2B A;  1G6P A;  2WP8 J;  4DUY L;  4A3F H;  1VQ4 A;  4QY7 A;  1PFS A;  3M4P A;  4GN4 B;  1WI5 A;  1P16 A;  2PMZ E;  2VY3 A;  3HFZ B;  5JJK A;  1I94 Q;  5FLX c;  2BA1 A;  2Z6K C;  3CPF A;  1WCM H;  2E8G A;  4KHZ A;  5IP9 G;  2R93 G;  4TQU S;  2QA4 A;  4BBS H;  2DUD A;  2YTY A;  3I2Z A;  4IPH A;  2NN6 G;  1C0A A;  5IP9 H;  1PH9 A;  3F2B A;  2R93 H;  2VQE L;  2FXQ A;  2WB1 G;  5J3B A;  2DGY A;  3PIP A;  2NN6 I;  4R4Q A;  4JBK A;  4LF7 L;  3GTM H;  1D7Q A;  2R7D A;  3OYY A;  1U0L A;  4X62 Q;  2MO1 A;  4DR4 L;  2CQO A;  4A3G G;  4LF5 Q;  1I6H H;  4AYB G;  3J81 j;  4DV7 L;  4XIG S;  4EX5 A;  1XMO L;  3GD7 A;  4GN3 B;  5E7N A;  3ULJ A;  3CF5 A;  1NE3 A;  2JJQ A;  3RLO A;  1VQM A;  1XMQ Q;  4A3G H;  1X3E A;  2UUB L;  3S14 H;  3D31 A;  3K0X A;  1XNR L;  1SRO A;  4IFD G;  4C3H H;  1QVF A;  1KC8 C;  3GTK H;  3KOJ A;  4X65 L;  5AJ3 Q;  5C0X J;  3KDF B;  4IFD I;  4DK3 C;  1L0W A;  3T1H Q;  1A63 A;  2N49 A;  5GAE C;  4JYA Q;  3PSI A;  2AWN A;  1TXY A;  5BR8 L;  4PZ6 A;  4DUZ Q;  2JA6 G;  1EUJ A;  3IRB A;  3S1N H;  2UXD L;  4JBM A;  1Q8K A;  4UPA A;  4JI2 Q;  1N33 Q;  2JA6 H;  3E9H A;  4JG2 A;  3L2P A;  3TQY A;  3GTQ H;  1WYD A;  3OTO L;  1WOC A;  1JE5 A;  1WJJ A;  1IBL Q;  3M4O H;  4DAM A;  3RZD H;  3T1Y L;  5C4X G;  1M90 C;  1VQG A;  4A3I G;  1FJG Q;  1CKM A;  2IX0 A;  2F4V L;  5C4X H;  3SGI A;  1E22 A;  3M85 A;  4C3J H;  2R7F A;  4DV1 Q;  4DR2 L;  1VQA A;  4A3I H;  1VQN A;  4H02 A;  4DR6 Q;  3S1M H;  1J5E Q;  3G71 A;  1VQ7 A;  4GOP A;  4OX9 L;  4GLA C;  1IZ6 A;  4OWX B;  4UP9 A;  3JAM i;  1JT8 A;  4IJH A;  3HOZ G;  4LFB Q;  1N8R C;  4NXM L;  1UE1 A;  1YNX A;  1CKN B;  1V43 A;  1YIT A;  3S16 H;  3HOZ H;  3RR5 A;  4YY3 L;  1N32 Q;  4QGU A;  4DR7 L;  3UDG A;  1TWG H;  3BZK A;  1G51 A;  1P8L A;  4LUZ A;  1Y14 B;  2E2J H;  4YWK A;  4DPG A;  4NPS A;  4IPG A;  1JMC A;  1ASY A;  1VQD A;  4GNX B; 
#chains in the Genus database with same CATH topology
 4QUF A;  1PTO C;  3QOJ A;  2R7Z B;  2HCC A;  1E1T A;  1STY A;  4DR3 Q;  5C3E B;  4A3K H;  3MEH A;  2R7Z H;  3V96 A;  3MFG A;  4HMI A;  4ZKB B;  2F3I A;  2F3V A;  5K36 H;  1LTT D;  2WAQ E;  4ZKC B;  1EWC A;  1E2V A;  4G7O C;  3C1E A;  5T1G A;  3CCJ A;  4LF4 Q;  3S2H B;  1WTV A;  2JA9 A;  1PH6 A;  1XJV A;  3KYH C;  1GHK A;  3M4Q A;  2FHT A;  1I4G A;  2UUA Q;  4LF9 Q;  1STG A;  4NXN Q;  1HZA A;  1B8A A;  5IIF A;  4TVA B;  3HOX B;  4JI3 Q;  1MJC A;  3E3X A;  1G2T A;  4JBJ A;  2I5L X;  2RVL A;  5ELF A;  1SE2 A;  4C3I B;  1GUS A;  2EY5 A;  4GLV B;  2EYJ A;  3NTH A;  2JYO A;  4LUV A;  2B2T C;  1HNX Q;  3OIP A;  4FNF A;  5LL6 X;  2DNC A;  3NSW A;  2K14 A;  3K5O A;  1IKL A;  3DWA A;  3PUV A;  3TSS A;  2YU9 B;  3NTI A;  5I2X A;  1GJX A;  2F1M A;  1LUZ A;  1L2F A;  2NVY B;  4JI6 L;  4G4K A;  1S5D D;  5NUC A;  3PO3 H;  1HXY D;  3T53 B;  4GOP B;  2JA5 G;  4A3J H;  1OXV A;  2E75 C;  4J8Q A;  2KQ3 A;  2NTS A;  4MTN A;  1NBW A;  1IKM A;  2K4K A;  3M7N A;  1DON A;  2OQK A;  2QEJ C;  3J7Z C;  4KJO A;  2OF1 A;  4PMW A;  1YNN C;  3S15 B;  2B2Y A;  1LTR D;  3HKS A;  4HCE A;  2UXB Q;  1SNQ A;  1AFP A;  2EY1 A;  4NMZ A;  4B3M L;  3S15 H;  2LFN A;  3S1Q H;  2NVT H;  1UWV A;  4AYB B;  2CVR A;  2F0S A;  5IE8 A;  1H9R A;  1CKO A;  2C5C A;  5FLM H;  1I5F A;  3JAM E;  2Q8T A;  3A56 A;  3R8B A;  1M1K C;  1I4X A;  4DV4 Q;  2EIF A;  2EXZ A;  2F0U A;  3FKI H;  4DK1 A;  1NY4 A;  1S3O A;  4QF4 A;  5LMU Q;  1RTO A;  1YZ6 A;  1B70 B;  2F0P A;  3DWQ A;  3BDL A;  2AQ3 B;  1GO3 E;  3H0G H;  2NVQ H;  4H0L C;  2EQS A;  1EFW A;  2A6H D;  5JEA J;  4XQJ A;  1BOS A;  3SE0 A;  3ULP A;  5ELC A;  1ENF A;  1SDF A;  3F8T A;  1QNU A;  1XMQ L;  2A6E D;  2KBN A;  1JCK B;  2FJ2 A;  1Y1V H;  5GQO A;  5C4J H;  3PO2 H;  2EOT A;  4I7Z C;  1TWG B;  3KJO A;  4JYA L;  1EQT A;  2IX3 A;  2E2J B;  2H4O A;  3DUZ A;  2KVM A;  4IUN A;  1N33 L;  1F9P A;  2WFW A;  3AQQ A;  3FHW A;  2PNR C;  3DLL A;  3ULL A;  3F2U A;  1Q82 C;  4TRD A;  1EY4 A;  1JR0 D;  1VQ9 A;  3VA7 A;  1X3G A;  4DV1 L;  5IYC H;  4DR6 L;  1O7L A;  4AQY Q;  4UY8 C;  2B8G A;  3N52 A;  4G7Z C;  1XX8 A;  3BVG A;  4UP7 A;  1Q1E A;  4ZAI A;  2VUM B;  3MXN A;  4A3B B;  4MN3 A;  2EYL A;  4LAA A;  1HCZ A;  4JOI C;  4IQZ A;  5IYB G;  1AE3 A;  3IAY A;  3K58 A;  1NR4 A;  2B2V A;  1QUQ B;  4F88 A;  5JEA G;  4XXE A;  1K83 B;  1JC7 A;  4G7H C;  2QF7 A;  5FJ8 H;  1HR0 L;  4FF1 A;  3BDC A;  4JW0 A;  2PO4 A;  3TZU A;  2E5L Q;  1RIP A;  3GQB A;  1IYV A;  2EY6 A;  1PH4 A;  1E1O A;  2QDB A;  4LK1 C;  3NEM A;  1B7Y B;  1IBK L;  3G48 A;  4OON A;  3S17 H;  3HOY G;  1PRT F;  2K50 A;  1STA A;  4KY5 A;  5G3L D;  4DUY Q;  2MQH A;  1ZYR D;  2JA7 B;  1PHJ A;  3K57 A;  3FP9 A;  3P20 A;  3R93 A;  3SXH A;  2JN4 A;  3L3O C;  2OXP A;  1I4Q A;  2WB1 B;  1SMX A;  4QIW B;  1A3T A;  2XN9 C;  5IOD A;  1BCP B;  2K33 A;  1NMF A;  4C2M B;  4APV A;  4XQQ A;  2M9V A;  1N34 L;  1PFN A;  1PH2 A;  3TN2 A;  4PNY A;  2D0O A;  4GKJ Q;  1WCM G;  3FDT A;  4K6L A;  1LAC A;  3RN5 A;  2Z9H A;  3QJY A;  4A93 G;  5ELN A;  1V1O A;  1EWI A;  3KLS X;  4X65 Q;  1I4H A;  4QUC A;  4A3M G;  5BR8 Q;  4B9W A;  2HT1 A;  4QCL A;  2R92 B;  2ZM6 L;  2IHF A;  3J81 i;  3IFT A;  2YV5 A;  3K80 C;  2RF4 A;  4BXX H;  1AEX A;  1I50 B;  1KQS A;  1B3Q A;  1X56 A;  5COY A;  4DK6 C;  3A54 A;  1HTP A;  1M8A A;  2L4N A;  2CW0 C;  2KEN A;  4RGN A;  5EJW A;  3G4S A;  1HZB A;  3C46 A;  4FF3 A;  2F0I A;  4DR7 Q;  2B29 A;  3I90 A;  4N9T A;  5IYD H;  1E3P A;  4GS3 A;  1KLG D;  1JJ2 A;  4O0A A;  4X64 L;  2K5V A;  5I2Y A;  4A3L H;  2UXC L;  2E2H H;  1QCB D;  4JI1 Q;  3S9W A;  4A76 A;  1FVI A;  1MSH A;  4OEM B;  5M3M G;  5BN4 A;  4DV6 L;  4DV0 L;  1PTO B;  3SVM A;  1Q90 A;  3NP8 A;  1CK1 A;  1HNZ Q;  1K8A C;  1PTO H;  2IL8 A;  5LMN Q;  3A8J E;  2R6G A;  1ZEQ X;  4YHH L;  4JI8 L;  1V8Q A;  4JI4 Q;  4Z9C B;  1CHP D;  1AH9 A;  4JI7 L;  2RA4 A;  2EYM A;  1XTD A;  2EYP A;  2WIN B;  1IL8 A;  2AUK A;  3TP7 A;  5M5W H;  2R7Z G;  4PZ7 A;  1BCP D;  1MGS A;  3URY A;  2VL6 A;  2B2U A;  5IY0 A;  3CCQ A;  1EIY B;  3CW2 C;  3L9A X;  5M5X B;  2B63 B;  1VQO A;  2RHS B;  5M3F H;  5M5Y B;  3UE1 A;  1Q12 A;  4GKK L;  2JQO A;  2VB3 X;  2KCM A;  1HNW Q;  3HKZ E;  1VQ6 A;  4HIO A;  4R4T A;  1W6J A;  2A68 C;  4P72 A;  3HOX G;  2DJG C;  2L15 A;  5H1S E;  4C3I G;  5CV4 A;  3NUC A;  5GAG C;  3UDX A;  5EKI A;  2L12 A;  2HQE A;  4JCV E;  1LO5 D;  1Y8N B;  4OL7 A;  1LTS D;  4FXK C;  5DNF A;  4GN5 A;  1G29 1;  5LHY 1;  5D3D A;  3D4W A;  4YIJ A;  3SEB A;  3MTS A;  1K0S A;  4K14 A;  3J81 E;  3A5U A;  3HOU H;  3R3O A;  1QNK A;  1GHJ A;  1IBM Q;  1YJN A;  1FGU A;  4IUU A;  1FNU A;  4A3D H;  3PO3 G;  3KUP A;  1K3R A;  1G6P A;  1BO0 A;  3OW7 A;  4QY7 A;  4EQP A;  2A73 B;  5AFW A;  1KDB A;  3CPF A;  1IW7 D;  4OHJ A;  1SJH D;  1PTO D;  4CHT B;  5HGT A;  2QA4 A;  2YTY A;  3I2Z A;  5IP9 H;  1PH9 A;  2R93 H;  2VQE L;  3O13 A;  2NN6 I;  2I07 B;  3GTM H;  5DEH A;  4Q5V A;  3FRP B;  5C44 B;  3K5L A;  3OHX C;  2R7D A;  3OYY A;  4ID6 A;  3GTG B;  4LF5 Q;  5IGC A;  4AYB G;  1XMO L;  4DV7 L;  5E7N A;  1WTO A;  2JJQ A;  1U4L A;  2EE1 A;  2R61 A;  3D3R A;  1QE6 A;  1KC8 C;  3KOJ A;  1WD1 A;  4IFD H;  1LT6 D;  3MXP A;  5FO9 B;  1A63 A;  4M8A A;  5EQ0 A;  5E4W C;  1B53 A;  2Z6B A;  4JBM A;  4UPA A;  3E9H A;  4JG2 A;  1EOT A;  1WOC A;  3MA2 B;  3DHQ A;  1JE5 A;  1WJJ A;  2F0N A;  2PQE A;  2SNS A;  1B9M A;  1FJG Q;  2IX0 A;  5C4X H;  3M85 A;  4A3I H;  4XYQ A;  3A7L A;  1JE4 A;  1VQA A;  3EFX D;  2XSC A;  3S1M H;  4OX9 L;  5C5M A;  4GOP A;  2H1E A;  1IZ6 A;  1SXT A;  1JT8 A;  4LFB Q;  1G91 A;  3S16 H;  4QGU A;  4RGT A;  1G51 A;  3DM1 A;  1CZW A;  3J80 L;  4V19 0;  5CGK A;  1VQD A;  1STN A;  4MTK A;  2C35 B;  2AQ1 B;  3I4L A;  5J39 A;  5IYC G;  1N36 L;  1D1K A;  3J7A 5;  4BY7 H;  3U9S A;  4DR1 L;  1L1O A;  1YNN D;  5CBE E;  2EY2 A;  3D0F A;  2DNE A;  1WVL A;  3BYT B;  3HZX A;  3CCU A;  4GNX C;  2JA8 B;  1F9R A;  2BDN A;  4RCO A;  5C0X H;  2F0M A;  2XIW A;  3NXW A;  4DV3 Q;  4DR5 Q;  4IOC A;  2FFK B;  5JOB A;  1OXX K;  2GVA A;  3MWY W;  4X3T A;  4K2K A;  4LF8 Q;  2UU9 L;  4ULL A;  2CCZ A;  3PV0 A;  2WAQ B;  2BH8 A;  3P75 A;  4DV2 L;  3A8I E;  3KF8 B;  1O7Z A;  3CD6 A;  3CC7 A;  1JOQ A;  3I73 A;  3I7F A;  3TS2 A;  4CDF C;  1CUK A;  2Z4H A;  4LFC L;  4DV5 L;  1PFB A;  4XT3 B;  4HJ8 A;  3U9O A;  3A5Z B;  2NWG A;  4BS9 A;  5FLX L;  1VQB A;  1Z47 A;  2JA7 G;  2KED A;  3CC2 A;  1QIL A;  1EOV A;  3RN2 A;  4K0K Q;  5FOB B;  4WJ4 A;  2GVB A;  4CJ0 B;  2LXJ A;  2RKS A;  2B39 A;  4LF6 L;  2L55 A;  5C4H A;  3ERS X;  1RCV D;  1EYD A;  4MIU A;  3N6R A;  3S14 B;  2WKD A;  3RNU A;  3A8K E;  1DCZ A;  3SK6 A;  3ND9 A;  2EYH A;  1QUQ A;  2IY5 B;  4IUQ A;  3MXG A;  4DU9 A;  1EU4 A;  2NZO A;  5DM7 3;  3GTK B;  1I94 L;  4IJL A;  3VR6 A;  2L9H A;  2E74 C;  1ESF A;  1HJP A;  5BN5 A;  2MJ8 A;  1RKN A;  1PH3 A;  1HPC A;  2F03 A;  2EPB A;  1U5K A;  1JWS D;  2R92 G;  2HDM A;  3C1F A;  5J22 A;  2PNH A;  3GTQ B;  2NTT A;  1NMG A;  3OPO A;  3LNN A;  4NW2 A;  1EEI D;  3M4O B;  1TKW B;  4X62 L;  1PRT C;  5IGB A;  3GTJ H;  4C3J B;  5GAD C;  1E24 A;  1DZ1 A;  2M00 A;  3D6C A;  1AZQ A;  3J81 c;  3W1G A;  3BU2 A;  2J0T D;  4QQB X;  1J8I A;  1N9W A;  1CZG A;  3UE0 A;  2BE5 C;  4ZYS A;  5AJ3 L;  2WII B;  3QR8 A;  2VQF Q;  2ZTC A;  4P74 A;  2SDF A;  3T1H L;  2PW7 A;  3ERQ A;  1X65 A;  2EXD A;  3UDI A;  2K75 A;  4HIM A;  1QG7 A;  1TWF H;  3TRZ A;  1Z9F A;  4EGV A;  4JI2 L;  4R9W A;  2UUC Q;  4FO2 A;  4PV1 C;  4EVO A;  3GTO H;  3NE5 B;  1YIJ A;  5LL6 S;  2KEE A;  4A3K B;  1A3V A;  1H9J A;  5D65 A;  1CSQ A;  3HOW H;  4JI0 Q;  3CXC A;  2Z1C A;  3BZC A;  3E9I A;  1TWH H;  5ISR A;  4BBR H;  4B3S Q;  1GKH A;  3VDY A;  4OEL B;  4ZLT F;  2P5Z X;  1WTQ A;  3Q22 A;  1J5E L;  1EZ8 A;  3LX0 A;  3G6E A;  1VS0 A;  4OO1 G;  4PG3 A;  2I0Q A;  1BQQ T;  1NJI C;  1Y8O B;  4A3C G;  3PIP 3;  2XWB B;  1YHA A;  1VQK A;  4CGY B;  3MXU A;  4GLX A;  2JE6 I;  3H3V C;  2K6A A;  5J1Z A;  1SR3 A;  4B3T Q;  1QZH A;  4XTC S;  4HID A;  5F2D A;  2O2L D;  1Q81 C;  2PW5 A;  1NCV A;  1X9N A;  3VR4 A;  4DR3 L;  1EY9 A;  4ZCK A;  5A2Q E;  1X32 A;  3CCM A;  2B63 G;  1CI3 M;  3KF6 B;  1CM9 A;  1GD7 A;  1NUC A;  1B44 D;  4A3E H;  1ET6 A;  1LTB D;  4DNT B;  4FXD A;  1EIF A;  2CWA A;  5K5P A;  4LF4 L;  4XQN A;  4DK0 A;  5I6Y A;  3KLW A;  5FO8 B;  1NTG A;  3RZO H;  2OCE A;  1KL9 A;  3D6W A;  4X3K A;  4PZ8 A;  5C5L A;  2CW0 D;  3HRZ C;  4FF2 A;  5KND A;  2CFM A;  2N8N A;  1OXT A;  2EVB A;  2UUA L;  4LF9 L;  4NXN L;  5KNB A;  1MIU A;  4JI3 L;  4DGZ A;  3PO3 B;  1CHQ D;  1MSG A;  4A3J B;  1AP0 A;  2D0P A;  1A3U A;  1PMR A;  1HNX L;  1EYC A;  4LNQ A;  1MKH A;  4FXG C;  5FK9 C;  3VYT A;  4IO9 A;  3KLS A;  3KBX A;  4KMU C;  4F87 A;  4OIK A;  1NSN S;  2WAC A;  3HOV H;  3HOU G;  2MNA A;  3HP3 A;  4KN7 C;  1MHW C;  4IOA A;  3Q6S A;  3S1Q B;  3MAQ A;  3MFY A;  3SK8 A;  1XPU A;  1UE6 A;  2NVT B;  2K5W A;  3PF5 A;  2NZH A;  1ONL A;  1A0I A;  1TS2 A;  2A69 D;  2KUM A;  3KJP A;  2UUB Q;  1L1O B;  1NR2 A;  2G9D A;  4WJ3 M;  1EY8 A;  2F0E A;  3FKI B;  3GTP H;  3DWP A;  1FL0 A;  5ELO A;  1TU2 B;  2WKC A;  1WD0 A;  3U4V A;  4M1U B;  2QGQ A;  2B2T A;  2EYO A;  3H0G B;  3VR5 A;  2NVQ B;  2UXB L;  5C44 G;  3HS0 C;  3W2D A;  1YVC A;  5I6W A;  4Y52 H;  1HRJ A;  4KY6 A;  3AFQ A;  3QOL A;  2BOS A;  3U50 C;  1VQL A;  1S4Z A;  4BY1 H;  1S5F D;  2ES2 A;  1STB A;  4YCV A;  3OMC A;  2R3Z A;  1Y1V B;  5C4J B;  2F0D A;  3PO2 B;  1R4Q B;  1ROD A;  4DV4 L;  5HY6 A;  4NXM Q;  3STB C;  4MHE A;  3E5S A;  4YY3 Q;  2B2V C;  5IT9 L;  3QWN A;  5LMU L;  4HAE A;  2K28 A;  1AE2 A;  1VQP A;  2HIX A;  1ILP A;  4JI5 Q;  3T16 A;  3CCR A;  3H91 A;  4DAY B;  1YNJ C;  5A35 A;  3K7A H;  1EWH A;  2IJ0 A;  3H94 A;  1ZXT A;  2EJM A;  3CP0 A;  4JC0 A;  5E4X A;  2N55 A;  2L0C A;  5JJL A;  5JVG 3;  4HSV A;  4JV5 Q;  4V0B A;  2XVS A;  3S1R H;  1TWC H;  3GDE A;  1WTH A;  1Y1W H;  4ODG A;  2Q2I A;  2EZV A;  4FDB A;  1BVS A;  1SFO H;  2LS0 1;  2DY8 A;  3HGB A;  1RTN A;  1C9O A;  3EIV A;  4AQY L;  1G8Z D;  1QJO A;  2JA8 G;  3A55 A;  3DEP A;  2HQL A;  3I4N H;  4N8X 1;  3W5O A;  5C0X G;  2CWP A;  4K5V A;  2D9U A;  4KI0 A;  4B3R Q;  4RKL A;  1PA6 A;  4OIJ A;  3B6Y A;  5CV8 A;  5CYU A;  1MBY A;  3S17 B;  1QVG A;  3BG3 A;  1IHZ A;  3H15 A;  3J7A F;  5KIX A;  4R1J A;  2K52 A;  5CR3 A;  1M4V A;  2NYZ D;  1TY2 A;  4R4C A;  1H95 A;  2L11 A;  2VXW A;  3J7A V;  4WOR A;  4L5R C;  2WAQ G;  4KY7 A;  2PZU A;  1EZ6 A;  1ICW A;  2K1B A;  2E5L L;  1XYI A;  1EQV A;  1GVP A;  3D4D A;  4HCS A;  4QL5 A;  1BXT A;  2HCI A;  3WOE A;  1VQC A;  3HKZ B;  5EKL A;  3S24 A;  4YCU A;  2L1B A;  1KD1 C;  2Y0S E;  1H9K A;  4EQO A;  1AW7 A;  1UUP A;  2WP8 J;  4DUY L;  4A3F H;  2PMZ E;  3SK4 A;  1Q3L A;  2BA1 A;  2Z6K C;  5FLX c;  4KHZ A;  1L0X B;  2DN8 A;  4O1N A;  4TQU S;  4BBS H;  2DUD A;  1KAA A;  3Q23 A;  5J3B A;  3PIP A;  2AUJ D;  2EDG A;  1HQR D;  1D7Q A;  1DOM A;  1I6H B;  2GA4 B;  2MO1 A;  2CQO A;  1XWE A;  1I6H H;  4FVM A;  1BUV T;  4N8F A;  3TP8 A;  4GN3 B;  4A3G H;  2RSO A;  4IUV A;  3CF5 A;  4GKJ L;  1B3A A;  4C3H H;  4ZUI A;  1PRT B;  3BDO A;  4X65 L;  3KDF B;  4DK3 C;  3PIO 3;  5BR8 L;  4DUZ Q;  3S1N H;  1EUJ A;  1K8O A;  2F4I A;  2JA6 H;  3KF8 A;  1PXU A;  3NHH A;  3TQY A;  3KLR A;  1ET9 A;  2E2H B;  4U68 A;  1IBL Q;  2J7Z A;  1J9O A;  1A2T A;  4DAM A;  1PLF A;  3RZD H;  5FKA C;  1M90 C;  4C3J G;  3SGI A;  2IW3 A;  2R7F A;  1VQN A;  4H02 A;  1VQ7 A;  3BVZ A;  4GLA C;  1VF7 A;  4IJH A;  1N8R C;  1YNX A;  1V43 A;  3HOZ H;  1N32 Q;  2RSN A;  3RR5 A;  1E0B A;  4DR7 L;  2KHS A;  2Z8L A;  1Y14 B;  5M5W B;  1EY5 A;  4IPG A;  1JMC A;  1ASY A;  2NUC A;  1PZJ D;  4A3K G;  1D1I A;  1HR0 W;  2VNU D;  3GO5 A;  4BBR G;  1OXS C;  1B9N A;  4JI1 L;  4FP5 D;  4P73 A;  5K36 G;  3IFD A;  2K32 A;  2PZT A;  5M3F B;  4P75 A;  3UDF A;  3M3Y H;  2EJG C;  3H3V H;  2X6L A;  1RJT A;  3MZ5 A;  4YCW A;  1F2M A;  4XT1 B;  1LV9 A;  1RD9 D;  1LT3 D;  3ER0 A;  5EKK A;  1XPO A;  1HNZ L;  5LMN L;  1KAB A;  1PYB A;  1V1P B;  4JI4 L;  4CJ1 B;  1OXU A;  3MHB A;  1BKB A;  1F77 A;  5EBD A;  3E0E A;  4WFN 3;  5ELD A;  1BR9 A;  1X3Q A;  2A6H C;  2CH4 W;  4RGO S;  1PRT D;  1DD2 A;  5IGF A;  1I3Q H;  1DXM A;  1HNW L;  1T5E A;  5IGD A;  3HOU B;  3CAM A;  5GAH C;  1B1Z A;  1VMP A;  4A3D B;  2D5D A;  5JPN C;  4R8I A;  2WV6 D;  1PZK D;  5GRO A;  1TII D;  3VYU A;  4CKC A;  4A3J G;  4UDU C;  2F0Q A;  1VF5 C;  1ZKO A;  2D62 A;  4IUT A;  1JIC A;  2JA5 H;  1HFG A;  1B50 A;  1II3 A;  2R93 B;  3KK7 A;  1ML0 D;  2B8F A;  3GTM B;  2KA7 A;  1XNQ Q;  4GOP C;  4X6A H;  1IBM L;  1L0Y B;  2PQA B;  1ILQ A;  4KHP Q;  3SDZ A;  2FMM A;  3NK9 A;  5HGQ A;  4H13 C;  1STE A;  3CQZ H;  1IXR A;  5FLM G;  2HHH Q;  1W3S A;  4X66 Q;  3KF6 A;  3FKI G;  2F0O A;  4AH6 A;  3KFU A;  4DN4 M;  5IWA Q;  2Z0S A;  1BDO A;  2QIL A;  1KRT A;  1J6Q A;  3H0G G;  2E2D C;  1SNM A;  2F3W A;  5L37 A;  1FNW A;  3AYH B;  2HUG A;  2ZT9 C;  1YEZ A;  3GTL H;  4LF5 L;  5C4X B;  3T13 A;  4A3I B;  2A19 A;  4K8I A;  1UE7 A;  3S1M B;  1Y1V G;  3TRE A;  1HHV A;  1SE8 A;  3PO2 G;  3ND8 A;  3ZYY X;  2ALY B;  1KLU D;  2ZXR A;  1R9T B;  1VQ5 A;  3S16 B;  3J80 i;  4EQ5 A;  1TQO A;  3NPP A;  1R9T H;  2JEA I;  5DM6 3;  4DNR B;  1LT5 D;  2NBF A;  2QKI C;  4LJZ C;  1XPR A;  1SMY C;  3X3M A;  4DAP A;  2K05 A;  4KD4 A;  1KHI A;  5KNC A;  3WDN A;  4DFA A;  1FD7 D;  2K04 A;  4BY7 B;  5LMN W;  2AWO A;  4UHV A;  3A0J A;  2AQ2 B;  1FJG L;  4NB3 A;  4IPC A;  4L5T A;  1D5M C;  1JOO A;  3PUW A;  1K28 A;  1S72 A;  1HA5 A;  2G5D A;  1SNP A;  3DMU A;  1LTL A;  4LFB L;  2B2W A;  1G6Z A;  1C4Q A;  4YWL A;  4DNI A;  5KRU A;  4A75 A;  2OWO A;  4OO1 I;  4TKO B;  3ITP A;  2ZJR A;  2ID0 A;  2ENB A;  3CPW A;  1PH8 A;  4IPD A;  2NVX H;  3ICE A;  4L5S A;  4FF4 A;  3F2D A;  1AN8 A;  4HN7 A;  5FJ8 G;  4LFA Q;  1I6V C;  4ALP A;  3T56 B;  5JEA H;  1SN8 A;  1A6X A;  3I4N G;  4IN3 A;  5DAU A;  2MUY A;  3PIO A;  1F2Z A;  1Q1B A;  1A15 A;  2OQ0 A;  4DF7 A;  3J7Y W;  2BA0 A;  1TR5 A;  3U4Z A;  4KN4 C;  4DV3 L;  4POG A;  2JK8 A;  1Y8P B;  4DR5 L;  4YWM A;  4KTA A;  4QJF A;  1K0R A;  4DAY A;  1VCI A;  3HOY H;  1QVC A;  4RGM A;  3LWE A;  1X54 A;  3OIQ A;  1O7Y A;  4LF8 L;  5DLQ E;  1VQH A;  3T4A C;  1YNJ D;  1A62 A;  4LF7 Q;  4ME5 A;  3NWS A;  3HKZ G;  5EAY A;  1CA6 A;  4N9P A;  5D14 A;  4DR4 Q;  4S3S A;  1O78 A;  4J15 A;  5CV9 A;  3FPP A;  3WOF A;  2LY7 A;  4KKS A;  4Y7N B;  1C48 A;  2LXK A;  1XNR Q;  4BBS G;  4Y7N H;  3J80 E;  2ZXO A;  2V1C C;  1SYB A;  3CME A;  4A93 H;  3I4O A;  1CT1 D;  2MFI A;  2H5X A;  4K0K L;  2UXD Q;  2RQX A;  4A3M H;  3L7Z C;  2B3G A;  3Q24 A;  2N88 A;  4JBW A;  4KK7 A;  4BXX G;  4AIM A;  2MP1 A;  5FO7 B;  3OTO Q;  3Q8D A;  1GUG A;  2O5J C;  2OTJ A;  3T1Y Q;  3GTJ B;  4LUO A;  1V1Q A;  2F4V Q;  2NZ1 D;  4DR2 Q;  4DA2 A;  1B2T A;  3TS0 A;  1SRU A;  1E2Z A;  3NQT A;  1STH A;  2NB0 A;  3A74 A;  4K5W A;  3K5N A;  1TWA H;  5JVH 3;  2O5I C;  4HR7 B;  1PZI D;  5COR A;  1TWF B;  5IYD G;  1RHP A;  1HH2 P;  1YHQ A;  3GTO B;  4A3L G;  1KRS A;  3HOW B;  2C9O A;  4KHV A;  3PCO B;  1ENC A;  2KCN A;  1EIG A;  4O42 A;  1GOZ A;  3TP5 A;  2KJX A;  3ZJY C;  1TWH B;  4BBR B;  5EPK A;  1SYF A;  1F2Y A;  3EN2 A;  2X6G A;  1K3B C;  5M3M H;  3Q0A A;  1CQF A;  4NDX A;  1EY0 A;  4LW1 A;  4L8J A;  4CDE C;  5C4Z A;  2VQF L;  1FNV A;  2RCN A;  5ELB A;  2YTX A;  4KKT A;  3I4M B;  3G6J B;  3JAM L;  5FLX E;  1JOR A;  1BBW A;  2UUC L;  1YJ9 A;  1SE4 A;  4WRD A;  3I4M H;  2ASB A;  1SJE D;  4P2C B;  5C3E H;  4JI0 L;  4F7X A;  5M3F G;  4A3E B;  2AHO B;  4B3S L;  2B2Y C;  4C1N K;  2F52 A;  3P1H A;  1KIX A;  2A1A A;  5C6A A;  5CBA E;  3SHL A;  3S2H H;  3KDF A;  2OTL A;  1H9S B;  3RZO B;  2Q2T A;  1BF4 A;  1R4P B;  5C0X I;  1H9M A;  3BJU A;  4B3T L;  1C7Y A;  3AB9 A;  1VQJ A;  1U4R A;  4UP8 A;  4JI6 Q;  3LGJ A;  2N78 A;  3HOX H;  4IFD J;  2K5N A;  4JK1 C;  1VQI A;  4C3I H;  1SND A;  3WWV A;  4RHR A;  1YJW A;  2A8V A;  1KXL A;  1TS5 A;  3HOV B;  1YI2 A;  2EJF C;  3I56 A;  3K81 C;  3R2I A;  3EA6 A;  5E1F A;  2BDO A;  4CJ2 C;  2JP1 A;  5G3L F;  2YU9 H;  3C3L A;  1EIH A;  1BBX C;  1JWM D;  4B3M Q;  4A3D G;  2F0T A;  4QB4 A;  2K7V A;  1LT4 D;  2RDF A;  4OWW B;  1YHB A;  3BVM A;  3VYR A;  1SEB D;  2NVY H;  1W2B A;  1VQF A;  1VQ4 A;  1PFS A;  3GTP B;  1P16 A;  3HFZ B;  3V2T A;  4R8N A;  2E8G A;  4CDC C;  5IP9 G;  2R93 G;  4CDD C;  4IPH A;  1KDA A;  5CV6 A;  1GUT A;  3T51 B;  3F2B A;  3K0Y A;  3RMH A;  4R4Q A;  1V1P A;  4JBK A;  3GP7 A;  1CFM A;  3GV6 A;  3W3A A;  4BY1 B;  2G9H D;  3GD7 A;  5IGE A;  2OT2 A;  3ULJ A;  1KTK A;  1LLR D;  1NE3 A;  1XMQ Q;  1X3E A;  2L5T A;  2Y0S B;  2UUB L;  5KYI A;  1SRO A;  4IAL A;  4IFD G;  1D5X C;  1GUW A;  1AZP A;  2TMP A;  2A68 D;  5C0X J;  2PMZ B;  3OWE B;  1L0W A;  2N49 A;  4JYA Q;  2ZXP A;  1TS3 A;  1N33 Q;  4C56 C;  2XRS D;  4WJW A;  3PQI A;  4ZUJ A;  1GXD C;  5C4X G;  1LTG D;  3K7A B;  4A3I G;  2JSO A;  1E22 A;  4DV1 Q;  1C8C A;  1SYD A;  2F0V A;  1MD2 D;  4UAI A;  4DR6 Q;  1F2L A;  3OOC A;  1U4M A;  3QIA A;  4OWX B;  1HTL D;  1XXG A;  3H09 A;  4NXM L;  1CKN B;  2EYF A;  4YY3 L;  2HDL A;  2JXM B;  1TT2 A;  1TWG H;  5KGU A;  1VMC A;  2E2J H;  1ESR A;  1JB3 A;  4IUP A;  4LUZ A;  3S1R B;  4YWK A;  1TWC B;  4NPS A;  4DPG A;  1Y1W B;  4TSS A;  4GNX B;  4DXG A;  2PQA A;  1SYE A;  3J80 c;  4JI5 L;  2MGS A;  4BY7 G;  4U67 3;  2Q2H A;  3DXJ C;  1SFO B;  1WFQ A;  1SYG A;  4PQX A;  3PMF A;  4DXF A;  5ELE A;  4C1N I;  1HR0 Q;  1GUO A;  2I5H A;  2AKW B;  1PDQ A;  3I4N B;  1BCP F;  3VR3 A;  1EYG A;  4JV5 L;  2KHJ A;  3FEW X;  3K7U C;  3OW2 A;  3S2D B;  2CQA A;  2VUM H;  4A3B H;  3NWT A;  4RMF A;  1G2S A;  3S2D H;  1IBK Q;  1FYC A;  3R2T A;  2CHB D;  2BH2 A;  1LM0 A;  1DM0 B;  5IGG A;  3CCV A;  3TZD A;  1GUN A;  2HD3 A;  3RLN A;  1K83 H;  4RHS A;  2JEB I;  4X3U A;  2F0J A;  2PI2 E;  1D5Z C;  3VR2 A;  2MHV A;  2BCO A;  2Q8I B;  5IP7 H;  2F0H A;  2E2I B;  4B3R L;  4GZY C;  1KAW A;  3PUZ A;  2N3S A;  5BN3 A;  2ATW A;  4AYB E;  2A74 C;  2Z4I A;  3CCS A;  3NBH A;  2E2I H;  1N34 Q;  3CHB D;  2VB2 X;  2I46 A;  3NBI A;  3ONA B;  3BYY B;  1PFM A;  4A3F B;  1UNS A;  4EQN A;  1X3P A;  3TME A;  5IT9 E;  3M7G A;  3CRK C;  1UE5 A;  1SBB B;  3DEO A;  4I7A A;  4CKE A;  3K5M A;  1WTW A;  3M4Y A;  2XTI A;  5M9O A;  4BBS B;  2ICI A;  4JOI A;  4XYO A;  1SMY D;  2JA7 H;  1E7Z A;  1EQR A;  2IPK D;  2ZTD A;  3CMA A;  2KCC A;  3NEN A;  3V05 A;  1HZ9 A;  4L6T B;  2KHI A;  4NKL A;  2ZM6 Q;  2NN6 H;  2KCT A;  2XNA C;  1O7I A;  4C2M H;  1F9S A;  1PTO F;  1O80 A;  4BWG B;  2K5H A;  4A3G B;  3I8Z A;  1CA5 A;  3MVV A;  2K01 A;  4K2L A;  4C3H B;  1D2B A;  1K73 C;  3CU7 A;  3L0O A;  4IZ8 A;  3S1N B;  2DJF C;  2XWJ B;  4RA8 A;  2JA6 B;  2IT1 A;  2B2U C;  1JJG A;  1VDZ A;  2R92 H;  2IWH A;  1RDP D;  2ZTE A;  1D8L A;  1K9M C;  1KNE A;  3K8A A;  2DY7 A;  2MPM A;  3RZD B;  4X64 Q;  2UXC Q;  3U58 A;  2Q2U A;  4JVZ A;  2F0L A;  4RH6 A;  3TP6 A;  1I50 H;  1EYA A;  3J81 L;  1JB7 A;  3FVQ A;  1IL2 A;  4HSP A;  3I55 A;  4DV6 Q;  4DV0 Q;  2QW7 A;  1KDC A;  1SSO A;  2I5M X;  1KNA A;  2RCF A;  3HOZ B;  4LWC A;  3CRL C;  2Q8R E;  1PH1 A;  4MNO A;  4YHH Q;  4JI8 Q;  3G7L A;  4J1M A;  4DUZ L;  4FYD A;  3EBE A;  3IL8 A;  4JI7 Q;  3GV3 A;  4X3S A;  1LAB A;  2Z6K A;  1S40 A;  4Q0F A;  1DOK A;  3HOW G;  1IBL L;  4A4I A;  1BNZ A;  2PZW A;  3M3Y B;  3SR1 A;  4BA2 I;  1EY7 A;  4L63 B;  4GKK Q;  1QWY A;  2A69 C;  1EU3 A;  1HUM A;  2LKV A;  4OO1 H;  1N32 L;  1X55 A;  2V4D A;  1Q7Y C;  3I4M G;  1FR3 A;  4A3C H;  3UI2 A;  4KD3 A;  5JJI A;  3JAM c;  2RBM A;  5C3E G;  1S5E D;  4HJ7 A;  4PMB A;  2RHQ B;  4HIK A;  2VS1 A;  1YBY A;  1OO9 B;  4A3E G;  3CC4 A;  3TBI B;  4K8J A;  2CKZ B;  5M5X H;  2B63 H;  3AEV A;  2QEX A;  1I3Q B;  1Q8I A;  2WB1 E;  5M5Y H;  1PV4 A;  4QIW E;  3EVQ A;  4BA1 I;  4O2D A;  3QO2 A;  3QG1 A;  1T9H A;  5TSS A;  4POF A;  3EQL C;  5JJZ A;  2VW9 A;  1S5C D;  2A5H A;  2A6E C;  3H6M A;  1JQY D;  4ZRZ A;  2D2C C;  4B08 A;  1DJR D;  4KLK A;  4RCN A;  2F0W A;  3X3N A;  2F0F A;  4JPB W;  2BE5 D;  1K8G A;  2IHE A;  5I4D A;  1HFN A;  1A8V A;  1DGS A;  1SE3 A;  3HG9 A;  4DAV A;  2XGT A;  4ILW A;  5D3I B;  4HJ5 A;  2JA5 B;  2E76 C;  3K6O A;  3F2C A;  3W1B A;  1X6O A;  1Z7T A;  2F0K A;  3RD4 A;  2HIV A;  2FIN B;  3HOV G;  2YTV A;  4OGQ C;  2VQE Q;  1TS4 A;  2PYK A;  1ENA A;  4HED A;  4KKU A;  5EPJ A;  4MZ9 A;  4E6I A;  3C2P A;  4DKA C;  1CTM A;  5CC4 A;  2RDG A;  5JAV A;  3HEJ A;  3BZD B;  4KV6 A;  2GN5 A;  1SNO A;  1A2U A;  1JJC B;  1XMO Q;  4DV7 Q;  3CQZ B;  2PPB C;  3EJI A;  1Z6H A;  1EFI D;  3F1Z A;  1CSP A;  2QCP X;  3CCE A;  3JC6 6;  1SLJ A;  1NAP A;  3NEL A;  2ZJQ A;  4K6D A;  3BS1 A;  1PYS B;  1HA6 A;  1ASZ A;  4ABN A;  3I72 A;  1H9S A;  4CKB A;  3MXN B;  1OTC A;  1MJE A;  1MI2 A;  5KYL A;  1L1O C;  4HJA A;  2LMC B;  3FPU B;  4OXP A;  1PH7 A;  1XNQ L;  1E2W A;  3MEF A;  3PGZ A;  1EEF D;  3DM3 A;  4BY1 G;  4ME3 A;  4P71 A;  5C44 H;  3GTL B;  3KBG A;  2B2W C;  2IX1 A;  3GTG H;  4KHP L;  2Y0S G;  2J4X A;  1IYU A;  2HHH L;  4OX9 Q;  4X66 L;  4ZQ3 A;  5IWA L;  4K5X A;  3AFP A;  3CKI B;  3NQI A;  1CQV A;  2MO0 A;  1ZYR C;  3PF4 A;  5IT9 c;  3SK5 A;  2K5D A;  3NBH B;  3I3C A;  1SYC A;  2PCF B;  1N36 Q;  3LWU A;  1QOH A;  3RLF A;  1VQ8 A;  4HJ9 A;  4DR1 Q;  2YYZ A;  1HQM C;  2SNM A;  3D8G A;  1QZG A;  1X3F A;  1U4P A;  1W6K A;  3E0J A;  3PUY A;  5EBC A;  1ICF B;  1LTI D;  5I9P A;  3K59 A;  1JWU D;  2PI2 A;  1IYJ B;  1F9Q A;  3VYS A;  3AMU A;  2QDL A;  1WTP A;  1RL2 A;  2TSS A;  1Y1W G;  1WTX A;  1SAP A;  3VA5 A;  2NVX B;  2LSS A;  5EPL A;  2AMC B;  1BBU A;  1Q46 A;  1VQE A;  2K5Q A;  4I65 A;  5IYB H;  1S5B D;  2VZA A;  1TY0 A;  3H3V I;  1V9P A;  1SNC A;  2UU9 Q;  5HUR A;  1FGB D;  3RUZ A;  4RG1 A;  1GM5 A;  2F0G A;  4H44 C;  2JA8 H;  1EL0 A;  1T5X D;  2VUM G;  4A3B G;  4DV2 Q;  1PYW D;  3P7J A;  5CMD A;  3A7A B;  3FMC A;  1PVO A;  4OWT B;  2ZJP A;  1LYL A;  1UEB A;  5C3X A;  4R4O A;  5I9O A;  4DV5 Q;  4LFC Q;  3STB D;  3I91 A;  4ZK9 B;  3HOY B;  1LTA D;  2KOL A;  4LFA L;  4R4I A;  3CCL A;  5EGT A;  1PH5 A;  1QB5 D;  5CV7 A;  5KEE A;  5IP7 G;  3PUX A;  1Q86 C;  1CKN A;  1DYQ A;  1D6E C;  4XDX A;  5E3F A;  4RKB A;  1EY6 A;  4LF6 Q;  1HZC A;  1EQQ A;  1RF2 D;  4GNX A;  3TEH B;  2O4X A;  1WTR A;  4IUR A;  2KEC A;  2M2L A;  3M9B A;  4A3F G;  4L5Q A;  3D4R A;  4QMG A;  4NP5 A;  1WCM B;  5JPM C;  3M4P A;  4GN4 B;  3OMG A;  1DOL A;  1WI5 A;  2VY3 A;  3AU7 A;  4KJN A;  1I94 Q;  5JJK A;  4PMC A;  1WCM H;  4A93 B;  1BCP C;  1UEA B;  1JOK A;  4LMQ D;  1C0A A;  1TVX A;  1XTC D;  2NN6 G;  4A3M B;  2FXQ A;  2WB1 G;  5A2Q L;  1UAP A;  2DGY A;  2K03 A;  4LF7 L;  4B9X A;  4HTH A;  1U0L A;  3I70 A;  2SOB A;  3QB3 A;  4X62 Q;  4DR4 L;  1I4P A;  4G57 A;  4CBV A;  4A3G G;  3J81 j;  4XIG S;  4EX5 A;  3NTK A;  4HMJ A;  3RLO A;  1TWA B;  4RFB A;  1VQM A;  2OEO A;  3IKJ A;  4H7B A;  4C3H G;  3S14 H;  3D31 A;  3ERO A;  3K0X A;  1XNR L;  1QVF A;  3GTK H;  5AJ3 Q;  4IFD I;  5T1I A;  5C3W A;  3T1H Q;  2SEB D;  1B4O A;  5GAE C;  3PSI A;  2AWN A;  1TXY A;  2JA6 G;  4PZ6 A;  3IRB A;  3OWF A;  1HUN A;  2UXD L;  2CH4 A;  3E6Z X;  1Q8K A;  4JI2 Q;  3MC0 B;  3L2P A;  3GTQ H;  1WYD A;  3OTO L;  2XRQ D;  3M4O H;  1NNX A;  3T1Y L;  1VQG A;  5CV5 A;  1CKM A;  2F4V L;  4DR2 L;  2X69 A;  4C3J H;  5M3M B;  1K8M A;  4F8M A;  2RDH A;  3G71 A;  1I4R A;  1J5E Q;  2FMC A;  3JAM i;  4UP9 A;  3TDQ A;  3HOZ G;  1UE1 A;  5IOC A;  4J6H A;  1YIT A;  3UDG A;  3OSO A;  3BZK A;  1P8L A;  4RWS C;  4RAU C;  1Y69 U;  2ICE C;  1IW7 C;  1U9R A; 
#chains in the Genus database with same CATH homology
 4A3K G;  1HR0 W;  2VNU D;  2PQA A;  1E1T A;  3J80 c;  4JI5 L;  2C35 B;  3GO5 A;  4DR3 Q;  4BY7 G;  4BBR G;  1OXS C;  4A3K H;  4JI1 L;  5IYC G;  2R7Z H;  4GKJ L;  1N36 L;  2Q2H A;  4P73 A;  3J7A 5;  1WFQ A;  2F3I A;  4BY7 H;  5K36 G;  4DR1 L;  1L1O A;  4P75 A;  3UDF A;  3D0F A;  2WAQ E;  3M3Y H;  3H3V H;  1HR0 Q;  4YCW A;  3CCU A;  2I5H A;  4GNX C;  3CCJ A;  2AKW B;  4LF4 Q;  3ER0 A;  1XPO A;  1HNZ L;  2JA9 A;  5LMN L;  1EYG A;  4JV5 L;  2KHJ A;  1PH6 A;  1PYB A;  1XJV A;  4JI4 L;  3K7U C;  3KYH C;  3OW2 A;  3M4Q A;  1OXU A;  2VUM H;  4A3B H;  1BKB A;  2UUA Q;  4RMF A;  4LF9 Q;  3S2D H;  4DV3 Q;  4NXN Q;  1HZA A;  1B8A A;  1IBK Q;  4DR5 Q;  4TVA B;  4JI3 Q;  1MJC A;  3E0E A;  2BH2 A;  1LM0 A;  4JBJ A;  2I5L X;  4IOC A;  4GLV B;  3CCV A;  1OXX K;  2GVA A;  4LUV A;  1HNX Q;  3RLN A;  1K83 H;  2K14 A;  2JEB I;  4LF8 Q;  2UU9 L;  2PI2 E;  2CCZ A;  3PUV A;  3PV0 A;  1I3Q H;  2BH8 A;  1HNW L;  5IP7 H;  4DV2 L;  3CAM A;  3KF8 B;  5GAH C;  4B3R L;  3CD6 A;  1KAW A;  3PUZ A;  1LUZ A;  2N3S A;  3CC7 A;  2ATW A;  4AYB E;  3CCS A;  2E2I H;  3I7F A;  1N34 Q;  3TS2 A;  1L2F A;  1CUK A;  4JI6 L;  4LFC L;  5GRO A;  4DV5 L;  4HJ8 A;  4A3J G;  3A5Z B;  3PO3 H;  1UE5 A;  1VQB A;  1Z47 A;  2D62 A;  4GOP B;  4A3J H;  1OXV A;  2JA5 G;  3CC2 A;  2XTI A;  2JA7 G;  2JEA I;  4JOI A;  2JA5 H;  2JA7 H;  4MTN A;  1E7Z A;  1EQR A;  1NBW A;  2K4K A;  2ZTD A;  3M7N A;  3CMA A;  3NEN A;  2OQK A;  1EOV A;  3J7Z C;  3RN2 A;  1HZ9 A;  4K0K Q;  2KHI A;  4PMW A;  4WJ4 A;  2GVB A;  2ZM6 Q;  2KCT A;  2LXJ A;  3HKS A;  2UXB Q;  1XNQ Q;  4GOP C;  4X6A H;  4B3M L;  1O7I A;  1IBM L;  3S15 H;  4LF6 L;  2PQA B;  3ERS X;  3S1Q H;  4C2M H;  2K5H A;  2NVT H;  1UWV A;  4KHP Q;  5HGQ A;  5IE8 A;  3RNU A;  3CQZ H;  1IXR A;  5FLM G;  2HHH Q;  1W3S A;  1QUQ A;  4X66 Q;  1CKO A;  2IY5 B;  5FLM H;  1K73 C;  3KF6 A;  1I5F A;  2NZO A;  3FKI G;  4AH6 A;  1I94 L;  4IJL A;  1M1K C;  3KFU A;  4DV4 Q;  1HJP A;  2EIF A;  3FKI H;  3L0O A;  5IWA Q;  2Z0S A;  1PH3 A;  1KRT A;  1NY4 A;  1U5K A;  1S3O A;  2R92 G;  1J6Q A;  5LMU Q;  2IT1 A;  1YZ6 A;  1B70 B;  2PNH A;  3H0G G;  1JJG A;  2R92 H;  2ZTE A;  1D8L A;  1K9M C;  1GO3 E;  1NMG A;  3H0G H;  3K8A A;  2NVQ H;  3AYH B;  4X64 Q;  2UXC Q;  3U58 A;  2EQS A;  1YEZ A;  2Q2U A;  4X62 L;  1EFW A;  3GTL H;  5JEA J;  4LF5 L;  3GTJ H;  1I50 H;  3ULP A;  5GAD C;  1E24 A;  2A19 A;  1JB7 A;  1IL2 A;  3F8T A;  1UE7 A;  3I55 A;  4DV6 Q;  4DV0 Q;  1XMQ L;  1Y1V G;  3TRE A;  4QQB X;  3J81 c;  3W1G A;  3BU2 A;  2I5M X;  2KBN A;  1SE8 A;  3PO2 G;  2ALY B;  1N9W A;  1Y1V H;  5GQO A;  5C4J H;  3UE0 A;  3PO2 H;  1VQ5 A;  3J80 i;  5AJ3 L;  4LWC A;  4EQ5 A;  2VQF Q;  2ZTC A;  4P74 A;  3T1H L;  1R9T H;  4MNO A;  4YHH Q;  3KJO A;  1PH1 A;  1X65 A;  2EXD A;  4JI8 Q;  3UDI A;  2K75 A;  4DUZ L;  4JYA L;  3EBE A;  4HIM A;  1TWF H;  3TRZ A;  4JI7 Q;  1Z9F A;  4JI2 L;  1N33 L;  2WFW A;  2Z6K A;  2UUC Q;  1S40 A;  1XPR A;  3GTO H;  3AQQ A;  3FHW A;  1YIJ A;  3HOW G;  3DLL A;  3ULL A;  1Q82 C;  1KHI A;  1IBL L;  1CSQ A;  3HOW H;  1VQ9 A;  4A4I A;  5LMN W;  2AWO A;  4JI0 Q;  3CXC A;  3A0J A;  1FJG L;  3BZC A;  3E9I A;  4NB3 A;  1TWH H;  1X3G A;  4IPC A;  4DV1 L;  4BBR H;  4L5T A;  1S72 A;  1GKH A;  3PUW A;  5IYC H;  3VDY A;  4B3S Q;  4BA2 I;  4DR6 L;  1J5E L;  4AQY Q;  4UY8 C;  3G6E A;  4GKK Q;  1VS0 A;  4OO1 G;  1LTL A;  4LFB L;  4PG3 A;  2I0Q A;  1NJI C;  4A3C G;  1YHA A;  1N32 L;  4YWL A;  1X55 A;  1Q7Y C;  4DNI A;  4A75 A;  2OWO A;  4OO1 I;  4UP7 A;  1VQK A;  3I4M G;  1Q1E A;  4A3C H;  4GLX A;  2ZJR A;  2JE6 I;  1SR3 A;  4B3T Q;  1QZH A;  2ID0 A;  4XTC S;  4JOI C;  3JAM c;  5JJI A;  5IYB G;  4HID A;  1AE3 A;  1Q81 C;  3CPW A;  5C3E G;  4HJ7 A;  4IPD A;  1PH8 A;  2NVX H;  3ICE A;  1X9N A;  4DR3 L;  2RHQ B;  4L5S A;  4HIK A;  2VS1 A;  3F2D A;  1YBY A;  1QUQ B;  5JEA G;  4LFA Q;  5FJ8 G;  3CCM A;  4ALP A;  4A3E G;  2B63 G;  3KF6 B;  3CC4 A;  1GD7 A;  2CKZ B;  4A3E H;  5FJ8 H;  5M5X H;  1SN8 A;  2B63 H;  1HR0 L;  3I4N G;  1EIF A;  2CWA A;  2QEX A;  3AEV A;  2WB1 E;  5M5Y H;  1PV4 A;  4LF4 L;  4QIW E;  3KLW A;  4BA1 I;  4O2D A;  1NTG A;  2E5L Q;  3PIO A;  1T9H A;  4POF A;  3RZO H;  2OCE A;  1KL9 A;  1RIP A;  2VW9 A;  1Q1B A;  4PZ8 A;  1PH4 A;  2OQ0 A;  1E1O A;  4KLK A;  2CFM A;  2N8N A;  1OXT A;  3NEM A;  2UUA L;  4LF9 L;  2BA0 A;  1B7Y B;  4NXN L;  3U4Z A;  4DV3 L;  1MIU A;  3G48 A;  4OON A;  2JK8 A;  1IBK L;  4DR5 L;  4JI3 L;  1K8G A;  4POG A;  2IHE A;  2K50 A;  4YWM A;  3HOY G;  1A8V A;  1DGS A;  1K0R A;  4QJF A;  1VCI A;  4DUY Q;  3HOY H;  1QVC A;  2D0P A;  2XGT A;  2MQH A;  4HJ5 A;  1HNX L;  1X54 A;  4LNQ A;  1PHJ A;  1MKH A;  3F2C A;  3FP9 A;  3W1B A;  1X6O A;  2HIV A;  4IO9 A;  4LF8 L;  3HOV G;  2YTV A;  5DLQ E;  1VQH A;  2VQE Q;  3HOV H;  1A62 A;  3HOU G;  2MNA A;  3S17 H;  4MZ9 A;  1SMX A;  4LF7 Q;  4DKA C;  4IOA A;  3HKZ G;  1NMF A;  5EAY A;  1XPU A;  1UE6 A;  4APV A;  1N34 L;  4DR4 Q;  2GN5 A;  1PH2 A;  3PF5 A;  4J15 A;  1JJC B;  2NZH A;  1XMO Q;  1A0I A;  4DV7 Q;  2D0O A;  4GKJ Q;  3F1Z A;  3CCE A;  1CSP A;  3KJP A;  2UUB Q;  1WCM G;  1L1O B;  3JC6 6;  3RN5 A;  2LXK A;  1XNR Q;  4BBS G;  4WJ3 M;  1SLJ A;  3NEL A;  4A93 G;  5ELN A;  3GTP H;  4Y7N H;  2ZJQ A;  1EWI A;  4X65 Q;  1PYS B;  2V1C C;  3CME A;  1FL0 A;  1ASZ A;  3I4O A;  4A93 H;  5ELO A;  2MFI A;  4A3M G;  5BR8 Q;  2HT1 A;  2H5X A;  1OTC A;  4K0K L;  3MXN B;  3U4V A;  2UXD Q;  1MJE A;  4A3M H;  2QGQ A;  3L7Z C;  2B3G A;  2IHF A;  2ZM6 L;  1L1O C;  4JBW A;  3J81 i;  4HJA A;  4OXP A;  4BXX G;  1PH7 A;  2YV5 A;  4AIM A;  5C44 G;  1XNQ L;  2UXB L;  3K80 C;  2RF4 A;  3OTO Q;  1YVC A;  3MEF A;  3PGZ A;  3DM3 A;  3Q8D A;  4BY1 G;  4ME3 A;  4P71 A;  5C44 H;  4BXX H;  2OTJ A;  3AFQ A;  3T1Y Q;  2IX1 A;  3U50 C;  4LUO A;  1V1Q A;  1VQL A;  4BY1 H;  2F4V Q;  3GTG H;  4KHP L;  2ES2 A;  1KQS A;  4DR2 Q;  1X56 A;  2Y0S G;  4YCV A;  4DK6 C;  1SRU A;  3TS0 A;  3A74 A;  2HHH L;  1TWA H;  4OX9 Q;  4X66 L;  2KEN A;  3G4S A;  1HZB A;  4DV4 L;  5HY6 A;  4NXM Q;  5IWA L;  3AFP A;  3STB C;  4YY3 Q;  4DR7 Q;  5IYD G;  2B29 A;  5LMU L;  1HH2 P;  2MO0 A;  1YHQ A;  5IYD H;  1E3P A;  4GS3 A;  5IT9 c;  3PF4 A;  1AE2 A;  1VQP A;  1JJ2 A;  4A3L G;  2HIX A;  3NBH B;  4O0A A;  1KRS A;  4X64 L;  2K5V A;  4JI5 Q;  3PCO B;  3CCR A;  2E2H H;  4A3L H;  2UXC L;  4DAY B;  4JI1 Q;  3ZJY C;  1N36 Q;  4A76 A;  3RLF A;  1FVI A;  1VQ8 A;  4HJ9 A;  3K7A H;  5M3M G;  4DR1 Q;  2YYZ A;  3CP0 A;  4DV6 L;  4DV0 L;  3EN2 A;  5M3M H;  1QZG A;  4JC0 A;  1X3F A;  3PUY A;  4LW1 A;  1HNZ Q;  1K8A C;  5JJL A;  5LMN Q;  2VQF L;  2R6G A;  4JV5 Q;  4YHH L;  2RCN A;  4JI8 L;  2YTX A;  2PI2 A;  4JI4 Q;  1IYJ B;  1AH9 A;  4JI7 L;  1XTD A;  1RL2 A;  1Y1W G;  1BBW A;  2UUC L;  1YJ9 A;  3I4M H;  5M5W H;  3S1R H;  1TWC H;  3GDE A;  2R7Z G;  2LSS A;  1Y1W H;  4PZ7 A;  2Q2I A;  2ASB A;  2AMC B;  1BBU A;  1Q46 A;  1VQE A;  4FDB A;  5IYB H;  5C3E H;  2VL6 A;  4JI0 L;  5IY0 A;  1BVS A;  3CCQ A;  1EIY B;  3CW2 C;  5M3F G;  1SFO H;  1VQO A;  2AHO B;  2VZA A;  2RHS B;  4B3S L;  1C9O A;  3EIV A;  3H3V I;  1V9P A;  2F52 A;  5M3F H;  1KIX A;  4AQY L;  3UE1 A;  2A1A A;  1Q12 A;  2UU9 Q;  2JA8 G;  4GKK L;  4RG1 A;  2HQL A;  2JQO A;  1GM5 A;  2JA8 H;  3S2H H;  3KDF A;  2OTL A;  3W5O A;  3I4N H;  2KCM A;  5C0X G;  1HNW Q;  2CWP A;  2Q2T A;  3HKZ E;  4DV2 Q;  1VQ6 A;  4HIO A;  2VUM G;  4A3B G;  4Y52 H;  4R4T A;  4KI0 A;  4B3R Q;  1PA6 A;  5C0X I;  3BJU A;  3B6Y A;  4B3T L;  1PVO A;  1C7Y A;  4P72 A;  4OWT B;  2ZJP A;  1QVG A;  1VQJ A;  1LYL A;  3HOX G;  1UEB A;  4UP8 A;  3H15 A;  2L15 A;  4R4O A;  4JI6 Q;  3LGJ A;  4R1J A;  3STB D;  2K52 A;  2N78 A;  5H1S E;  3HOX H;  4DV5 Q;  4LFC Q;  4IFD J;  2K5N A;  5GAG C;  1VQI A;  4C3I H;  4LFA L;  4R4I A;  3UDX A;  3CCL A;  4JCV E;  1PH5 A;  3WWV A;  4R4C A;  1H95 A;  1YJW A;  2A8V A;  4GN5 A;  4L5R C;  1KXL A;  5IP7 G;  2WAQ G;  1G29 1;  1YI2 A;  3I56 A;  3K81 C;  3PUX A;  1Q86 C;  1CKN A;  2E5L L;  1GVP A;  4QL5 A;  3A5U A;  2YU9 H;  3HOU H;  4B3M Q;  1IBM Q;  4A3D G;  1VQC A;  4LF6 Q;  3S24 A;  1YJN A;  1HZC A;  1FGU A;  4YCU A;  1EQQ A;  4GNX A;  4OWW B;  4A3D H;  1YHB A;  1KD1 C;  3TEH B;  2Y0S E;  3PO3 G;  3M9B A;  4A3F G;  1K3R A;  2NVY H;  4L5Q A;  1VQF A;  1W2B A;  1G6P A;  2WP8 J;  4DUY L;  4A3F H;  1VQ4 A;  4QY7 A;  1PFS A;  3M4P A;  4GN4 B;  1WI5 A;  1P16 A;  2PMZ E;  2VY3 A;  3HFZ B;  5JJK A;  1I94 Q;  5FLX c;  2BA1 A;  2Z6K C;  3CPF A;  1WCM H;  2E8G A;  4KHZ A;  5IP9 G;  2R93 G;  4TQU S;  2QA4 A;  4BBS H;  2DUD A;  2YTY A;  3I2Z A;  4IPH A;  2NN6 G;  1C0A A;  5IP9 H;  1PH9 A;  3F2B A;  2R93 H;  2VQE L;  2FXQ A;  2WB1 G;  5J3B A;  2DGY A;  3PIP A;  2NN6 I;  4R4Q A;  4JBK A;  4LF7 L;  3GTM H;  1D7Q A;  2R7D A;  3OYY A;  1U0L A;  4X62 Q;  2MO1 A;  4DR4 L;  2CQO A;  4A3G G;  4LF5 Q;  1I6H H;  4AYB G;  3J81 j;  4DV7 L;  4XIG S;  4EX5 A;  1XMO L;  3GD7 A;  4GN3 B;  5E7N A;  3ULJ A;  3CF5 A;  1NE3 A;  2JJQ A;  3RLO A;  1VQM A;  1XMQ Q;  4A3G H;  1X3E A;  2UUB L;  3S14 H;  3D31 A;  3K0X A;  1XNR L;  1SRO A;  4IFD G;  4C3H H;  1QVF A;  1KC8 C;  3GTK H;  3KOJ A;  4X65 L;  5AJ3 Q;  5C0X J;  3KDF B;  4IFD I;  4DK3 C;  1L0W A;  3T1H Q;  1A63 A;  2N49 A;  5GAE C;  4JYA Q;  3PSI A;  2AWN A;  1TXY A;  5BR8 L;  4PZ6 A;  4DUZ Q;  2JA6 G;  1EUJ A;  3IRB A;  3S1N H;  2UXD L;  4JBM A;  1Q8K A;  4UPA A;  4JI2 Q;  1N33 Q;  2JA6 H;  3E9H A;  4JG2 A;  3L2P A;  3TQY A;  3GTQ H;  1WYD A;  3OTO L;  1WOC A;  1JE5 A;  1WJJ A;  1IBL Q;  3M4O H;  4DAM A;  3RZD H;  3T1Y L;  5C4X G;  1M90 C;  1VQG A;  4A3I G;  1FJG Q;  1CKM A;  2IX0 A;  2F4V L;  5C4X H;  3SGI A;  1E22 A;  3M85 A;  4C3J H;  2R7F A;  4DV1 Q;  4DR2 L;  1VQA A;  4A3I H;  1VQN A;  4H02 A;  4DR6 Q;  3S1M H;  1J5E Q;  3G71 A;  1VQ7 A;  4GOP A;  4OX9 L;  4GLA C;  1IZ6 A;  4OWX B;  4UP9 A;  3JAM i;  1JT8 A;  4IJH A;  3HOZ G;  4LFB Q;  1N8R C;  4NXM L;  1UE1 A;  1YNX A;  1CKN B;  1V43 A;  1YIT A;  3S16 H;  3HOZ H;  3RR5 A;  4YY3 L;  1N32 Q;  4QGU A;  4DR7 L;  3UDG A;  1TWG H;  3BZK A;  1G51 A;  1P8L A;  4LUZ A;  1Y14 B;  2E2J H;  4YWK A;  4DPG A;  4NPS A;  4IPG A;  1JMC A;  1ASY A;  1VQD A;  4GNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...