4X6AJ

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4x6aJ00
2I10A 3MKLA 3LOCA 4IHWA 3H3VK 3JRBA 4D5FA 2E1OA 2XGCA 2CQXA 1A5JA 2O9LA 3JRCA 2LR8A 1ZR2A 3HM5A 5BNGA 5EG0B 2QCOA 3NARA 1WGXA 1MBFA 1RR7A 3TW6A 3LSJA 5E3NA 2LP0A 5K7ZA 1X58A 3JRAA 1BJZA 2DMPA 3D1NI 1NTCA 1I50J 2FX0A 5F0HA 2CUFA 2DA3A 2M34A 1OFCX 2ECBA 2W48A 3FIWA 2X9DA 4IHYA 2FJ1A 2L7ZA 4JX4A 1TWAJ 5JLXA 1TWCJ 5FKKA 5C44J 5C3EJ 3GTPJ 4M6VA 4A3DJ 1BA5A 2M8GX 1RESA 1ZK8A 2CJJA 3GTJJ 4JX5A 5IP6A 3L1PA 1MBHA 1XC5A 3K2AA 1MSEC 2L9RA 2ME0A 2M9HA 2MW8A 1Q1VA 5K7HA 2LY9A 3HKZN 2ELKA 2JJ7A 2JN6A 5EEAA 5M5WJ 3OSFA 3CDLA 1O4XA 1JUMA 2B63J 1FIAA 3CMYA 3DCFA 1QRYA 2R93J 4L5EA 4S0HB 1U9OA 3BTIA 1HF0A 2WV1A 3TP0A 3DEWA 1F36A 3PO2J 3OIOA 3BR3A 1CQTA 4A3CJ 3A03A 3VPRA 3ZQLA 2QF7A 1RKWA 3BT9A 3Q3SA 3PM1A 2XGDA 5IYBJ 1JT6A 1TWFJ 1T33A 3LSPA 4BY7J 3SDGA 2K9NA 3HBLA 4JP0A 1XG1A 3S15J 4M3BA 4GFBA 1X2NA 2HXOA 1LFBA 2P81A 1ITYA 3BQYA 2HI3A 1JUSA 3JRHA 1K83J 1OJLA 2E2HJ 4A3MJ 2E2IJ 1W0TA 2LK2A 4QSHA 3Q0UA 1JJ8C 1GT0C 3TEDA 3I4NJ 2Y31A 4XIDA 1LE8A 4FE7A 2DA7A 4XRSG 4A3GJ 1VI0A 5F0FA 2Y9YA 4A69C 2AHQA 4UUSB 3HGYA 1MNMC 1I6HJ 2DTZA 3JRGA 2JA5J 4M3FA 2FQ4A 2EZIA 4A3IJ 3RZOJ 4FE4A 1JJ6C 3HOWJ 1U8BA 4B1RA 5IP7J 2AO9A 1SANA 5IYCJ 2LTPA 3NAUA 2VI6A 2XPWA 1OCTC 4M3DA 5J1RA 1YRNB 5EG0A 1K61A 3IH4A 3F0CA 2O7OA 2DMNA 3ZQCA 3BTCA 3GTGJ 5IOYA 5IOZA 3M3YJ 4J19A 3A01B 4XRSA 1JKOC 1MH3A 2H8RA 2VUMJ 5J3LA 4C2MJ 2K40A 4V2GA 2JA8J 4CYCA 2JWTA 4DYQA 3BTLA 1RETA 1MBEA 5GPCA 2NVQJ 4G12A 1IV6A 4JYKA 2IEKA 1WPKA 1QPIA 1POGA 4MFDA 1QVTA 2HXIA 3A02A 3HOYJ 3ZQGA 3HB9A 1ZTRA 2R0QC 2MGQA 4EEFG 2G0EA 3LSGA 5C4XJ 3BR6A 3RZDJ 3FK7A 2XSDC 2NVXJ 3S17J 4IHVA 1AU7A 2R5YB 1IJWC 1T56A 2R7ZJ 3QPLA 3HOXJ 3S2DJ 3BR2A 3BQZA 3RQIA 1A6IA 2Y0SN 3S1MJ 4XK4A 5J1YA 1IRZA 3S1RJ 1VFCA 1PUFB 3JRFA 1BW5A 3G1MA 4FISA 1NK3P 3GTMJ 2DMQA 5J1UA 1JUPA 3WHBA 3WHCA 4ABZA 1TWGJ 1APLC 5IP9J 1WI3A 5M5XJ 1X2MA 2DA6A 5FKOA 4DZPA 2D5VA 4RDUA 3FISA 2L7FP 2PMZN 4LOCA 3SJMA 4A93J 1AKHA 4W1UA 2H1KA 3HEFA 1U78A 2DA4A 5FKLA 4DZJA 4DYCA 4UUSA 3OSGA 4RBOA 1D5YA 4QTRA 2L0KA 2R92J 9ANTA 4MFEA 3Q0WA 1P7IA 1JKPC 1QVUA 3BG5A 1RKTA 3IH2A 3TW7A 5E3OA 1U9NA 2VKEA 2YUSA 3OOUA 4B3AA 5GPAA 1YRNA 4BY1J 2LKXA 3JREA 4MIMA 3ZQIA 1B8IB 3HDDA 4Y52J 3I4MJ 5M3FJ 1UMQA 3IH3A 2DMUA 2CUEA 1MH4A 3FK6A 3E7LA 1TWHJ 1WH7A 1JGGA 4BBRJ 2WAQN 2EZKA 1WH5A 4XRMA 1GUUA 2K9SA 2DA2A 3BG3A 2E19A 1IG7A 1WCMJ 2VPRA 1FJLA 2MSYA 5EGOA 1TC3C 2ZB9A 1ZQ3P 1UG2A 2NS8A 2KDZA 3GTOJ 3S1NJ 1I3QJ 1JTYA 2XB5A 2IBDA 3JRDA 1UHSA 3QQAA 4AUXA 2ID3A 3JR9A 1DU6A 2EZHA 3H0GJ 1LFUP 3SFIA 1IUFA 4I6ZA 2R5YA 2LLKA 4FCYA 2MG4A 3RKQA 5EF6A 2R5ZB 2NOGA 1ETYA 4BKXA 2LD5A 1PUFA 3CQZJ 4D7NA 3ZQHA 2Y30A 2N8GA 1HOMA 5E3MA 2XPVA 1H89C 5E3LA 1HCRA 1GDTA 5F1JA 2YS9A 5HODA 1JKRC 3HOVJ 2DJNA 3GBGA 1E3OC 1IGNA 1BW6A 1W0UA 1HLVA 5JLWA 1ETQA 1ZR4A 1Y1WJ 3K7AJ 2TRTA 3GTKJ 1EF4A 1G2HA 1RPWA 3B6AA 4X1EA 4IHXA 2EQRA 2YU9J 1SFOJ 4QIWN 3S14J 2HOTA 1Z77A 2COBA 2LFBA 4Y7NJ 3ZOBA 5FLMJ 4A3EJ 2OF7A 1GVDA 1FTTA 1ETKA 5IYDJ 3LNQA 1B8IA 2LVSA 3B6CA 3FKIJ 2K9QA 1MSFC 3W6VA 4HNVA 1ETOA 2HYJA 4M3GA 2OPTA 1B72B 1ZKGA 3O8HA 4CYCB 3GTQJ 1AHDP 2O8KA 3BR5A 2FD5A 5GP9A 2HQ5A 4C3JJ 2M2EA 1ETXA 2GLOA 4C3IJ 2EZLA 4XICA 2ME6A 3LSRA 2EH3A 1JKQC 5M3MJ 1MBJA 1R9TJ 1FTZA 3C2BA 2Y9ZA 4BXXJ 1Z0XA 1JT0A 2GM4A 2DA5A 4UUTA 2M0CA 1ETVA 3ZQFA 1IDYA 3O8GA 1H88C 5F0CA 5FJ8J 2CQQA 2KT0A 5F27A 2EBIA 4FTHA 3Q0VA 2ID6A 3GTLJ 3BR1A 3S16J 2RAEA 4A3JJ 2DN0A 2JA7J 3S1QJ 3A01A 2HOAA 1MBKA 1FIPA 3MVPA 4M3EA 1F43A 1OCPA 2DMTA 2R5ZA 3UKGA 3CCYA 4B4CA 4V2FA 4A3FJ 1VF9A 1JTXA 2VKVA 3HOZJ 5M5YJ 1ETWA 3HGGA 5EYRA 1NK2P 1VNDA 2IAIA 1MBGA 5K7FA 5EZGA 3TP3A 4DYRA 2XPUA 2HOSA 3IV5A 2JMWA 3JRIA 4A3LJ 4C3HJ 2TCTA 2CRGA 2NS7A 2WB1N 4DW6A 4A3BJ 3G1OA 2E2JJ 1GV2A 2NVYJ 2Y2ZA 2DA1A 1IDZA 1ENHA 2GBYA 4D7MA 1AKHB 5DS9A 3HOUJ 5EDNA 3PO3J 4AYBN 4IEJA 1ORKA 4BBSJ 2X6OA 1P7JA 2XGEA 1S7EA 4NDLA 5F04A 2X48A 3G1LA 1H8AC 4W97A 2JK3A 1FEXA 1IC8A 3S2HJ 4I76A 5EZHA 2CU7A 3M4OJ 4X6AJ 4MO7A 4AC0A 3BTJA 5C4JJ 2XB0X 3MN2A 3BG9A 5FKNA 5IPAA 1B72A 1HDDC 2L7MP 1BL0A 2JA6J 4JX6A 1LE8B 1ZGWA 2XRLA 1DU0A 1Y1VJ 1GV5A 2HDDA 2NVTJ 4A3KJ 5DTDA 1HDPA 1XS9A 5EGOB 5F08A 2ECCA 3QPSA 5FKMA 3BR0A 4D5CA 5FLVA 4MLOA
chains in the Genus database with same CATH superfamily
2K5CA 1O7FA 3JRBA 3ROUA 4KIBA 2Z5UA 2CQXA 4Y33A 1A5JA 5DUKA 2EV0A 1X1PA 4OAZA 3JRCA 3L9FA 2LR8A 4NC8A 5LHHA 1MNDA 3BZ6A 3JAMK 2X1DA 2IS4A 3FBIB 1RR7A 4Q4ZF 3LSJA 4A12A 3FXUA 2BVMA 2FQ3A 5BMZA 1KYZA 3CP8A 2G7HA 5ILUA 3D1NI 3BCBA 2FX0A 1D1CA 1I5ZA 2FE3A 2M34A 1HC8A 1TT0A 2ECBA 2W48A 2X9DA 2XSJC 2H27A 2X6WA 4R1HA 3V7SA 1TWCJ 4A3DJ 2UZKA 1BA5A 3WE2A 1RESA 4IPAA 4I7HA 4GRIA 4JX5A 3L1PA 1MBHA 2HGCA 1KZHA 1ZN2A 3K2AA 5HLTA 4CH7A 4BE1A 2M9HA 2MW8A 2BXZA 1LDKB 2CW7A 5K7HA 3HKZN 2ELKA 2ISYA 2R7FA 4CCOA 5EEAA 3OYBA 3OSFA 3CDLA 2O3FA 3DCFA 2NRAC 2HOEA 3MZYA 4L5EA 3WG9A 4G6DA 2RC4A 2WV1A 3TP0A 1G8XA 1VQ9I 1ZHFA 1FPQA 1W36C 1IN7A 2F4IA 3EUKL 2STTA 1CQTA 4LG0B 3A03A 3M8FA 4CZCA 5DUIA 3KZYA 2MLKA 3I54A 3IP4B 3W2VA 1X3UA 2WAEA 3LA3A 1JT6A 1TWFJ 1Z7UA 1T33A 5DEQA 4ZDLA 4F3QA 1A6QA 3GZ5A 4E7LA 4JBAA 4ZH4F 3PUFA 1A35A 4KFCA 2ZJRF 1V5FA 2K9NA 3WTZA 1K78A 3IRQA 4CDGA 2HFHA 2HXOA 3TBIA 4GCVA 1U3EM 3RIRA 1H0MA 3CUQC 3ERMA 3JSOA 4MTDA 2E2HJ 4A3MJ 5DM6F 3IUOA 2KLOA 1GT0C 3IWZA 3I4NJ 2O5RA 4AYBA 1LE8A 1REPC 3CC7I 4XRSG 3K1PA 3G3ZA 3GO5A 2EIKH 3CTAA 3H9GA 2XUBA 5F0FA 2Y9YA 4Z2YA 2AHQA 2VT2A 2XRNA 3PSFA 2ZFWA 4UUSB 1I6HJ 2KRHA 4HLXA 2NS0A 1A31A 2FQ4A 1WJEA 1MJAA 2EZIA 2PQ8A 4KJZA 3HTSB 4LIVA 5E79C 1JJ6C 1XGOA 4B1RA 5IP7J 1PUEE 2NAZA 1SANA 2GXGA 3ASNH 5IYCJ 2LY1A 3NAUA 2H8WA 4RAGA 3KETA 3TL4X 1YYVA 3IH4A 1SC7A 4ETSA 3ZQCA 1K7AA 1OPCA 3IRRA 1EKEA 1XGMA 2L02A 1YW9A 2X6YA 3DQVC 5DCFA 3H1CA 3VB2A 5FRMA 3J7ZI 3EUHA 2Q1ZB 1JKOC 1MH3A 5J3LA 3TQNA 4V2GA 2JA8J 2EJRA 5GAGJ 3V8JA 2JWTA 3GFMA 4DYQA 1AA7A 3BTLA 4F91B 3DTEA 1TTYA 2JA2A 3D0SA 4BE2A 1MKMA 4AIKA 2VXZA 4XKWA 3K4CA 4NC6A 1JI8A 1Z7LA 5E20A 3I4PA 2RNJA 3V7RA 4BL0B 1BI0A 1POGA 3H0DA 2V6EA 1QVTA 4ZYDA 5E18F 3E6MA 3A02A 4A6EA 2OJED 1X1BA 3HB9A 1ZTRA 4G6TB 4HBLA 3GUDA 2CQ7A 2EA4A 2J5OA 3ERED 3L2UA 2XV4S 3FK7A 2CUJA 3S17J 2L4AA 4IHVA 2EA2A 2XF5A 3GMEA 3L7WA 3C3WA 5H6QA 1XMAA 2O61A 3CJTB 5IT3A 1SVOA 5HNFA 2DBBA 4ZDPA 3A2KA 1T56A 1D1AA 3SXYA 3GYHX 4U7BA 3S2DJ 3BR2A 1P4AA 1R71A 4KT5C 1VQNI 2P4WA 1VFCA 1RNLA 4P55A 3R0JA 3JRFA 1PUFB 3NWTA 4MQVA 3KP6A 3LFUA 3GTMJ 4ABZA 2MD5A 4KITB 3UR3C 5J4YA 1KQ8A 2O6GE 2BXYA 2VODA 1S29A 3U9GA 4WF2A 5BPDA 4DGWB 5TJJA 5FKOA 3FMRA 4DZPA 2D5VA 3VSKA 4HV6A 1U2WA 3QP5A 2L7FP 4BXFA 1FLIA 3F72A 3O6BB 2FEZA 4W1UA 4UXNA 3P5JA 3HEFA 3QYBA 2PMUA 1Y6IA 3TDUC 4DYCA 2V7FA 2OUMA 3IAM2 3OSGA 3HPHA 1AOYA 2L0KA 3CC2I 1UHMA 2BV6A 2DTRA 4MFEA 3Q0WA 3HOTA 1P7IA 5CVJA 1JKPC 3VYUB 4U0YA 3JW4A 1HQCA 4FHTA 1ON2A 4XL9A 3R0AA 5TRDA 1U9NA 2VKEA 2YUSA 2LYCA 3C18A 1G6NA 2QVOA 4M9SA 4MIMA 4LLGF 2HS5A 2DMUA 2CUEA 1MH4A 3FK6A 2OD5A 3S3NA 2HU9A 1QU3A 1FBQA 1PYVA 3HRSA 3HPGA 2WAQN 4A0YA 4HDVA 1KU3A 4BDZA 1P9QC 2DA2A 2M8EA 5LFAA 2VL8A 1LNWA 1WCMJ 2F5FA 1W4MA 4HPQA 3S3OA 3WTTC 5EGOA 1ZQ3P 1UG2A 4I09A 2V1UA 3CCVI 3E5UA 1JTYA 1K79A 2IBDA 2KQRA 4U7DA 2K86A 1QBJA 1TQMA 3QQAA 4AD9A 4BUPA 1YQAA 1B9NA 1S5LC 1OISA 4M9XA 4E6KG 1SFKA 1MJ9A 2CWEA 2P7VB 1DU6A 3H0GJ 4I2OA 3KP3A 4EQQA 2DO7A 2R7DA 3LSTA 4I0AA 3V7CA 4I6ZA 3CMAI 3COAC 6PAXA 2ZCWA 3TMOA 2EV6A 4GO1A 5D8LB 4FCYA 2MG4A 5EF6A 3N4MA 1MIJA 3BJAA 1WWXA 2EWNA 4D9JA 4PFPA 3K4LA 4RGUA 3LWFA 2W1OA 3IC7A 4YFKF 3G71I 5CVIA 4LB5A 2MBFA 1BR1A 1HOMA 4FX0A 2DQRA 3VSLA 2Y48A 1G3TA 3FXOA 1HCRA 1GDTA 2DFEA 3E0JB 4PJMA 1T2KA 2IT0A 2YS9A 1JKRC 1E3OC 3DTIA 3GBGA 1R22A 4FQGA 3SFZA 1IGNA 5IT9K 4PDKA 5B1AH 1YW7A 1D1BA 5GTIC 1XCBA 2RNGA 3K4NA 2KDOA 4A5NA 2TRTA 3AG2H 5HDNA 3OYLA 3GTKJ 3P9CA 3CD6I 2PLYA 1QZZA 2FOKA 1R49A 2BHYA 3H5NA 4IHSA 4E7JA 3H92A 3WG7H 4BYYA 3KFWX 2LFBA 4Y7NJ 1D0ZA 4ON0A 4R8HA 2LC2A 3ZOBA 4XN3A 2OF7A 5FLMJ 4A3EJ 3CCMI 1GVDA 1FTTA 3RJPA 1FX7A 1U5TC 3FKIJ 3PQKA 1VQKI 2PMZA 1GLNA 2RDPA 4IJAA 1DGWY 4M3GA 4RAZA 1D8KA 4WXCA 3GTQJ 1RC9A 1F5TA 3H35A 3ISPA 2C6YA 1E2XA 2ZNZA 5GP9A 2JTVA 4LJZF 1ETXA 1A36A 5GADJ 3WE3A 2EZLA 4XICA 1YIJI 3LQRA 3LSRA 4XORA 4XNFA 5DDGA 2KHMA 3S8PA 2F5VA 3RYPA 1UG0A 3W6KB 1FTZA 2LREA 2R7WA 5LHGA 2GM4A 2FUG2 5CKTA 4QPOA 3KYCB 3M8JA 3AL0C 2LMDA 1Z6TA 3EYYA 3O8GA 5HNHA 1BIBA 3OYGA 2CQQA 3BP8A 2DCEA 2KT0A 2Y75A 2VLAA 3Q0VA 4FTHA 3A1YA 3GTLJ 1XGSA 3BR1A 4A3JJ 3P7NA 3ZMSA 3BC8A 2HWVA 4N4OB 1R58A 1FIPA 3MVPA 2CV2A 4EJUA 3V4GA 2R5ZA 3L2VA 3UKGA 1FBSA 2K02A 3FXJA 2DOAA 4ESBA 1IF1A 5LRRA 2H09A 2GQQA 3JAMZ 4UHTA 2Q8KA 1CGPA 3L2QA 2OQGA 3CCEI 2HOSA 2IXSA 2JMWA 1WJFA 3QYEA 5FB2A 4A3LJ 2R7TA 2Z3YA 3LMMA 3BZCA 1TBXA 1ODDA 1ZREA 1LDDA 3BJOA 2XDVA 3OOPA 1TW2A 5FGMA 5HDKA 2E2JJ 4M9ZA 4IL6C 2V26A 3WU1B 3RPUA 2IPQX 5TISC 1Z9CA 1KGSA 3HOUJ 3BG7A 3DU6A 4M6XA 3QODA 4AYBN 2LBFA 1Z3YA 1J0RA 1OYYA 4BQAA 4NDLA 3F8FA 3ZMUA 3TO9A 2QQ9A 3H5RA 4LIUA 4BHBA 4W97A 3T8RA 1SD6A 2JSCA 2DODA 4HNUA 5EZHA 4G7HF 4LMYA 4G7ZF 4XN0A 1UCRA 3M4OJ 4X6AJ 1RZ4A 4NNJA 4MO7A 1V54H 1KYWA 2NXNB 2MFZA 4L9NA 2RQQA 2A69F 1J9IA 2IGKA 3BG9A 3I5UA 1W1WE 4BQNA 1PP7U 3RPQA 1LE8B 3I53A 1ZGWA 3RPUD 5JVTA 2HDDA 1EJ9A 2V1DA 3HSEA 2EILH 5DTDA 4CZZA 2DT5A 2RV8A 1VQ5I 5F08A 1O3TA 5FLVA 1BJAA 2I10A 3MKLA 4IHWA 3H3VK 3WGIA 3L09A 3LAPA 1SMYF 3SDBA 1YJ9I 2QBYA 3FXRA 2O9LA 2F5EA 3I71A 1KA8A 3HM5A 4PK4A 3HL2A 2VT3A 1MBFA 2EV5A 3F8BA 2LP0A 2DT7B 5TGTA 5K7ZA 1X58A 3DEEA 3J7AY 4A5MA 2JPBA 1O3QA 3D5RC 3VYTB 4S05A 3OYAA 1YS6A 1I50J 4XLEA 3ESWB 4XQFA 4F93B 2CUFA 3U1DA 4QLCU 4ENNA 1S72I 2F4MB 4IHYA 2VASA 1TWAJ 5JLXA 5C44J 1F4KA 3GXOA 2DFIA 2NYXA 3KEOA 3VFZA 2CJJA 2JUGA 2LSOA 3HRTA 2ZXWH 5IP6A 1N75A 1Z21A 3CCSI 2L9RA 2ME0A 4AIDA 2LY9A 1FNNA 3QPTA 2JN6A 5M5WJ 3M07A 3ZP5A 1LQ1A 1QQIA 2EK5A 2ACJA 2PI0A 3ECOA 2MC4A 4S0HB 1U9OA 4LITA 1CF7B 3OY9A 1V3FA 1OCOH 2CYYA 3VWBA 2VJ5A 4WXDA 2R7QA 1XMKA 3A0BC 3ZQLA 1YJNI 4ZC3A 1LDJA 2ETHA 2FMYA 1P92A 5IYBJ 2F6CA 3OS2A 3HG9A 4G8XA 2IS2A 1ULYA 2QWWA 3D5SC 3SDGA 2JRMA 3BROA 3HBLA 1OR7A 1XG1A 2IA2A 3ZMZA 1X4OA 4GFBA 2VKDA 5K5QA 1LFBA 2UUZA 3MMYB 4I0BA 5FD5A 4II2A 4CO8A 3OS0A 4XM3A 2ZSHB 1NG7A 4QSHA 3OV8A 2CG4A 3VDXA 4B8XA 3TEDA 1JJ8C 2Y31A 1WVRA 1E17A 2CO5A 2DA7A 4HNTA 2LKSA 4YRVA 2XF6A 5CVUA 4M71A 5D8KB 1G3WA 4RA2A 5KVRA 3WTUC 2LH9A 1R36A 1ZG1A 4F52A 1YG2A 4E70A 2DYRH 3ASOH 3HGYA 3JRGA 2DXIA 2KKOA 4FE4A 2M87A 2V6CA 2AO9A 3OMYA 4YEJA 3J7YJ 4C9YA 4S04A 4Y17A 2XPWA 3C1DA 1Q1HA 2X51A 3MAJA 4IVNA 5LLQA 4M3DA 5J1RA 2EB7A 3OL4A 3HIFA 2M7AA 1WHUA 3GTGJ 4EJWA 5IOYA 5IOZA 5FD6A 1TW3A 1EV7A 3SEZA 4IRIA 1OMIA 4J19A 5D5WB 2F4OB 3A01B 1JHHA 2GXAA 2WBMA 2W82A 2VUMJ 4MQ9F 3EPZA 4LB6B 2CQNA 2QEXI 3DF8A 3U1KA 1EA3A 2OC6A 4E7HA 2ZMEC 1FOYA 1Y56A 3ONQA 2K7LA 2W57A 4G12A 3JSPA 5DD8A 1O3SA 2WY7Q 1WPKA 2KIFA 2EFQA 3N97A 2M30A 1GHCA 1U0JA 2X85A 3F6OA 2JVHA 1T39A 2R7VA 3VYSB 1YLFA 3OYKA 3PUBA 3REOA 2MGQA 5HLHA 3OYHA 2R0QC 1RRJA 3LSGA 3T1BA 1N25A 1T8IA 5KHDA 4DJAA 2XSDC 4M72A 3HZJA 4FX4A 2NVXJ 3DLAA 3IKVA 3DWLE 1AU7A 2I8DA 2R3SA 1ZYRF 1SMTA 2R7ZJ 5K5OA 4KN4X 4L9TA 1A04A 3P9KA 1UJ8A 2STWA 2Z99A 4XK4A 2JSPA 2R7UA 3S1RJ 1IZ1A 3GLLA 2QSHX 1WJCA 4L9JA 1OLTA 3G1MA 4FISA 1PVEA 2DMQA 2PJPA 2W24A 2X0LA 4BAYA 3OYIA 4BDYA 3HXLA 1T0FA 5IP9J 3C7JA 3PIOF 1WI3A 3OYFA 1DPRA 3VYRB 1X2MA 2OU2A 2QUFA 4U0WA 2HQNA 2P5LC 4LLLA 4LOCA 2PMZN 5J40A 5KCMA 3K1NA 3MWMA 4PGGA 1G3SA 4XLPF 3VODA 2Z16A 4XKCA 1R6RA 2V79A 1OKRA 1U78A 3OR2C 2A07F 4IF4A 5LRSA 1ZLKA 3OYNA 9ANTA 1ACIA 2D2WA 1XTAA 2E35A 3BY6A 2VQCA 3HRUA 4XRFA 2OA4A 3CP2A 2VOOA 1QVUA 5KAIC 4XKVA 1G4DA 4UB8C 2MABA 3LAJA 4PSXA 4CCLA 2F5DA 4N0BA 5E3OA 4B3AA 4B43A 4IO9F 2DW4A 1MDMB 1YRNA 1I6XA 4OU0A 4IRGA 4Y52J 2OQRA 1ZRDA 3I4MJ 3GLXA 5M3FJ 3IH3A 4HF0A 4YIFA 3LFKA 3H9QA 2EZKA 4CCJA 1WH5A 3ZMTA 1KQ9A 2NNYA 4Z6YA 3FF5A 3OL3A 1I3AA 4YIIA 3BG3A 2LF7A 3PSIA 4PJ0C 3FMSA 1HA8A 1FJLA 4PUSA 4GYGA 2NS8A 4LLNA 2ZJ2A 3IHUA 5F6FA 3CMMA 1OYIA 1XDSA 4ANJA 2M1BA 2YX7A 4RS8A 4ZTJA 3OYDA 1RUOA 5LHIA 1E0EA 5E17F 3NWSA 3M1CA 1B1BA 2LNBA 2PJRB 2A6TA 1N78A 5D4SA 3SZPA 1LFUP 2H6BA 5HS9A 1IUFA 2WC2A 2OTJI 2LLKA 2NVUB 2WV0A 3KZIC 2YU3A 2M0MA 2R5ZB 2V1XA 2NOGA 1ETYA 2H94A 2M4KA 1TQIA 4FETA 4RGRA 2Z33A 2XF7A 2RREA 3G73A 5D6FA 4U87A 3DEUA 1TP4A 3MD2A 3BJ6A 2Y30A 1YHQI 3RKYA 4YFXF 2VC1A 3A0HC 2GWRA 3RI4A 2A6HF 4IKFA 1YI2I 4JOMA 4ITVA 3RTRA 5F1JA 3HOVJ 5FLXK 1HKTA 4B3XA 2W85A 3HHHA 5FFXA 1HKQA 1HLVA 5E1ZB 5JLWA 4ENMA 5H20A 1CF7A 1LB2A 4XLAA 5JVGF 4ESJA 2LBFB 1IRGA 1XB4A 4LK1F 1LEAA 2HKOA 1EF4A 4RB3C 1ZRFA 5E8GA 1FYKA 3H3ZA 2FNAA 1BI2A 2HTJA 2JQ7A 2YU9J 3RDIA 4RAFA 5B66C 2HR3A 4RM2A 2COBA 1O7LA 1DGRM 2FSWA 2GA2A 3KEYA 1HW2A 1I1SA 5IYDJ 1B8IA 5HOOA 2LVSA 2ADUA 1OCRH 3DBLB 2A5YB 3IAS2 3QOEA 4BHPA 1QA6A 4C2UA 2OV7A 4N9HA 3W6VA 1YW8A 1G3YA 3ZR8X 1ETOA 2HYJA 5D5XB 5LEJA 3ABTA 3DKYA 3DPUA 3FMQA 2V1NA 4CYCB 1AHDP 3ZCOA 3QYFA 1FOKA 2HQ5A 3WTSC 2ZC2A 2XASA 4U88A 1MMDA 2W84A 4KISA 2GLOA 1S3JA 4L5IA 1EH7A 2P0WA 2ME6A 3M7GA 1R9TJ 3DBRB 2O03A 3QRFF 4BXXJ 5B3SH 1JT0A 1GXQA 4OINF 4I98B 2QBYB 3KYLA 3KP2A 1NG6A 1IDYA 1OCZH 1DP7P 3DKXA 3LSHA 3H3UA 1UB9A 5F0CA 2D45A 4E7ZA 2ID6A 3E5QA 2EFWA 2RAEA 3TGNA 1TL8A 2JA7J 2ZNYA 1FP2A 3A01A 2HVQA 1Y8QB 4RB1A 3ZMDA 1NH3A 1D5VA 4HV5A 4MTEA 3B02A 2E34A 2K9LA 4V2FA 1P4WA 1JTXA 3HOZJ 1UELB 2D1VA 1YE9A 4I01A 5EYRA 2CS3A 3JTGA 1MBGA 5EZGA 5GAEJ 2ZBKA 2XPUA 2HEOA 3LSKA 2HKXA 2P6TA 4YELA 3IV5A 4BQOA 3BLYA 3JRIA 2UXXA 2L4MA 4AWXB 2CRGA 2WB1N 5KNLA 3ABKH 2OTLI 1Z05A 3CUQB 1EH6A 5A2QK 1GV2A 4DNCA 4BACA 2Y2ZA 1QZEA 4HSTA 2VKHA 1IDZA 4OIQF 2XIGA 5L3EA 3PO3J 3E6DA 2XAQA 3I0TA 4BBSJ 2ZXJA 1P7JA 4A6DA 1S7EA 2EINH 1B59A 1FP1D 1H8AC 2W00A 3H5AA 1MJBA 3F8MA 4O3MA 1DQUA 1IC8A 2AXTC 3CDHA 2HTSA 2HQRA 4HA8A 3MCZA 1QPMA 1E3HA 3DLLF 1FC3A 2E5NA 2CFOA 1T08B 2X1EA 4AC0A 2OCCH 3BTJA 5EEGA 1WKMA 2IJLA 2BW3B 4OIPF 3T8TA 1HDDC 1K6OA 2KIUA 2FBIA 1J7KA 2PBIA 1Y1VJ 2K3PA 3QU3A 2Z9OA 1GV5A 2M5WA 3CLQA 2F5CA 3K2ZA 3PIPF 3HYIA 1HDPA 3OWTA 1GXPA 4P9UA 2GXBA 2FBHA 4Y4RA 5DCMB 3ZQ7A 3OYCA 5BOXA 1R4MB 2HZDA 4D5FA 1FYMA 2DYSH 4NQWB 1W5CC 2XGCA 4OMYA 2GA1A 1ZH5A 1ZR2A 1MDMA 2Y0MA 2QCOA 4HX4A 2P7CB 1LEBA 1WGXA 3EUHC 4NB5A 4EM0B 2VXDA 3TW6A 1LVAA 3JRAA 1ZRCA 2R7OA 4KN7X 1D8JA 1NTCA 1T98A 2PN6A 1QHHD 4BJ5C 4XMYA 1FBUA 1OFCX 1S6LA 4HEA2 3FIWA 1WZ2A 5C3EJ 5FKKA 3GTPJ 5D5VB 4M6VA 5JR3A 4UVBA 1ZK8A 2GZWA 2V9PA 1XC5A 3V8LA 4HQEA 2CFXA 1MSEC 2IGNA 5FROA 2R7SA 1OQYA 1Q1VA 4OMZA 3Q9VA 2EFOA 2JJ7A 3DTKA 3NRVA 5LEKA 1FSHA 1JUMA 1FIAA 2DJIA 2HQAA 2PJRA 4L18B 3CUOA 2R93J 3MKWB 3BTIA 4OIRF 1HBXG 5AONA 3GX4X 2DDAA 3PO2J 3BR3A 1ZELA 3WGGA 4A3CJ 4KUMA 4RGXA 3VPRA 2EIJH 3F8CA 3IWFA 2VQGA 2DK5A 2QF7A 1RKWA 4IOCF 5DM7F 3EETA 3PM1A 2XGDA 2DAOA 3OIPA 4XBFA 5H2FC 5KK1A 1D0YA 4RB0A 4BY7J 4G94A 4B47A 5D6EA 4D0PA 3KE2A 3F21A 4CGZA 3S15J 2GAUA 1X2NA 3F6VA 3CC4I 2VQLA 2X6XA 4F92B 4I02A 3BQYA 2HI3A 2ISZA 4HZFA 1K83J 1OJLA 2E2IJ 4F7ZA 2DOEA 4H4KC 1NHAA 3Q0UA 1PDNC 4FE7A 3L2RA 1MNEA 2VBYA 4L5JA 4CSWA 1YS7A 3EDPA 1HXDA 2ZSIB 3K4KA 2PX9A 4LD5A 3KLOA 4A0XA 2JA5J 4M3FA 3BZKA 2AQFA 1WSUA 4OOIA 5HLGA 4A3IJ 3MEXA 4HF1A 2L3DA 3HOWJ 3W6JB 1U8BA 3SZTA 1XSVA 4HYEA 2LTPA 1XCVA 2VI6A 1T38A 2FRHA 4P1WA 5JHUA 1YRNB 3KX2A 1L0OC 5EG0A 3F0CA 3J81K 2O7OA 3LSIA 3BTCA 1DP3A 5ED4A 1R1UA 2CMPA 3M3YJ 5J8CA 4IQ4A 4XRSA 1I1GA 5AIQA 5D5UB 4BGDA 5ICEA 4XLFA 2E7WA 4C2MJ 2HYGD 2FBKA 4CYCA 3K70D 4LG3A 1WJ5A 1ZG5A 3TO7A 3RSNA 3KP5A 5GPCA 3WODF 1IV6A 1IRXA 4WWCA 2KIQA 3S2WA 3HUGB 1QPIA 4MFDA 4AVZA 3BWGA 3ZQGA 2COMA 4Q48A 4A2UA 3CCRI 3FXLA 3FWEA 5C4XJ 4HX8A 3RZDJ 3RQ4A 1R7JA 4JQFA 1AWCA 1XDUA 5GAHJ 2PFBA 3AG4H 3CMEI 1IJWC 3F9KA 3QPLA 2IS6A 4XR6A 2MD0A 3MZ8A 4MNUA 1A6IA 2LKPA 2Y0SN 4IXAA 3RQIA 2IA1A 4F55A 2E1MB 3S1MJ 5J1YA 2XAJA 2E1CA 1NK3P 3DV8A 5J1UA 1JUPA 3WHBA 5J4VA 4PZJA 2CV1A 1APLC 1S9HA 3K1MA 4NC7A 1H9GA 3R61A 3KYDB 1MD0A 1ERDA 2IVMA 3CUQA 1MMNA 3G2BA 3SJMA 4EV0A 4A93J 1PP8F 1VZ0A 2JUCA 4KMFA 3ZPLA 3BPVA 3N05A 1BR2A 1FWZA 4WCGA 2H1KA 3J80K 2CW0F 4XOPA 5FKLA 4DZJA 1SD5A 1FYLA 5JHFA 2DFFA 3P9IA 1W36D 2OZUA 2E60A 2KIMA 2IW5A 2M7BA 3BG5A 1RKTA 3CLOA 3IH2A 5FLXZ 3FKJA 3F3XA 3TW7A 4EGZA 2DFHA 1IN5A 4ENKA 4IRHA 2B7EA 5GPAA 2WB1A 3ZQIA 3B73A 1B8IB 3EQLF 3AL0B 3SEQA 3UNGC 2BY0A 4DOZA 1R5GA 3F22A 1R00A 1YJWI 3K10A 4BBRJ 2BW3A 3DP7A 3LA7A 4XRMA 3I3LA 1GUUA 5K1YA 3W2AA 2K9SA 2E19A 2EIMH 1IG7A 4NHJA 1FT9A 3FXKA 1VQOI 4HX7A 1OCCH 2FOWA 3AKZA 2B0LA 2VPRA 4CYDA 4EM2A 3S32A 3MKZA 2VJIA 4HLYA 3CCQI 1BC7C 1MGTA 4KYWA 1BM9A 3KPHA 2KDZA 3GTOJ 4AIHA 5DCMA 2XB5A 3TKYA 3JRDA 2QSGX 4NQWA 2R7XA 3ZXSA 1UHSA 3Q5FA 5ICGA 4AUXA 1Y0NA 1D0XA 4KT6A 4ZJZA 4WK8F 1TNTA 2ID3A 1J59A 1ZLJA 2EZHA 4WXHA 3OIQA 5DD4A 3SFIA 3BG6A 1LJ9A 3MQ0A 1DUXC 3RKXA 2A6EF 3FDYA 1W5TA 3GZNB 2R5YA 3GW2A 2IGOA 2XAHA 2EFPA 3LQQA 2KRCA 5EEHA 3RKQA 4EMSA 2G9WA 3RYRA 3OS1A 1T95A 4J01A 4BKXA 1WI9A 3PQJA 1V5EA 2P5KA 2BE5F 4AU7A 5CVRA 1SFXA 2JZYA 2LD5A 1R1TA 3CQZJ 2OCEA 3L2CA 5IY5H 4D7NA 1HKSA 1HSJA 2N8GA 5HS8A 5E3MA 2QGUA 1S8NA 2IGMA 2RQPA 2XPVA 2R7RA 5E3LA 4K2EA 5F1RA 2IRFG 2FA5A 3HOSA 2CH0A 2WA0A 1D3YA 1MMGA 1BW6A 2XKPA 2VE9A 2V4JC 2K9MA 1IXSB 2M4GA 3M8EA 2BVLA 3MZHA 2F2EA 3F23A 1ZR4A 3QU6A 5CJ9A 1G2HA 5LBQA 4BQQA 1SD7A 4RGSA 4X1EA 1IUYA 2GOXB 4IHXA 2EQRA 1SFOJ 2HDCA 4QIWN 1MMSA 5A2QZ 2DDBA 4CXFA 4OWRB 5HS7A 3FXMA 1VQ7I 2ZXIA 4IHTA 2WTEA 2A05A 1ETKA 1RI7A 2MA3A 3LNQA 3B6CA 1LUJB 2K9QA 4II3A 1U6GA 2VBXA 1MSFC 2V9KA 1Y8RB 4UB6C 1X1AA 3I64A 1X3WB 3T0YA 2OPTA 2O8KA 2K4JA 2FD5A 3BR5A 2O8XA 4RLQA 4UV8A 4DBRA 3TO6A 2DPDA 3PL8A 1RR8C 1EH8A 3GFJA 1X19A 2M2EA 2RN7A 2Q2EA 3M1EA 3I55I 1JHFA 3GEZA 2KPMA 3R4KA 2EH3A 4EM1A 1JKQC 5M3MJ 5K5RA 1MBJA 2DQLA 1HSTA 3H9JA 2Y9ZA 1Z0XA 1B4AA 2DA5A 2M0CA 5IT9Z 4KMUX 2QZ8A 3C2GA 3KZZA 2Z2SB 5FJ8J 5F27A 2WAFA 1IV8A 1SD4A 5DV5A 3S16J 2QENA 4RM3A 4ZYAA 4BXUA 1F1ZA 5J47A 2ZKZA 2YR2A 2HOAA 1F43A 2K4BA 4M3EA 3DPLC 4HSRA 4BNCA 1UHWA 2IA0A 3TOBA 4B4CA 4A3FJ 3CJNA 1MMAA 2OAZA 1VF9A 2PEXA 2VKVA 4BU2A 1ZGAA 1L3LA 5L3FA 1IO2A 2LG4A 3EUAA 1NK2P 3CDIA 3HGGA 4UUVA 2UXNA 5K7FA 3TP3A 4BJTA 2DK8A 3HUGA 1T6SA 2KJBA 1SFEA 2OBPA 4HQMA 1Y0UA 4C3HJ 1V4RA 2CQKA 2Y69H 3G1OA 3CJRB 1XD7A 4Y15A 4XLHA 2DA1A 3O2PE 4AM3A 4LFUA 1AKHB 5DS9A 4HG2A 4NUBA 5ILSA 4HOBA 4ZZDA 2YSRA 1J09A 2BEOA 1ORKA 2X6OA 5B5EC 5BPIA 2KP6A 2IS1A 3HSRA 3QWLA 4IOAF 2X48A 5LGUA 1Y39A 2VOPA 1FOXA 2CW8A 2M3AA 1K6YA 2JK3A 3PNVA 4P5OA 4HDUA 1FEXA 4CICA 1IN6A 3QAHA 4XLNF 1OR7C 3S2HJ 3GFLA 4ZDOA 3CCJI 4I76A 2ZO4A 1YTYA 2DOFA 3QPHA 1XSDA 2E71A 1KU9A 3JTHA 3FHNA 1U5TA 4WX9A 2HPMA 3PJRA 1RIOH 3RCOA 2XB0X 5IPAA 1XPXA 1B72A 2JA6J 4KICA 1IN4A 2EFNA 5E1XA 3I59B 4Q47A 1XSXA 2L5QA 3K6GA 3NEUA 4HRIA 2ZMEB 4KIFA 5LGNA 3SQNA 1LPQA 1R23A 3K4BA 1XS9A 2Y0SA 2IP2A 4AVPA 4D5CA 2BY3A 1YOVB 4MLOA 1S7AA 3LOCA 1W7PA 1UAAA 2E1OA 5FO5A 2GOMA 1IAWA 1WFXA 3I56I 1SAUA 1E3PA 2ELJA 5ERIA 4AIJA 2ZFUA 5BNGA 5EG0B 3ZQQA 3NARA 1FSEA 1FY7A 3BDDA 1QGPA 5LGTA 1ZARA 4UY8I 1SVLA 5E3NA 2JT1A 2VE8A 3L2WA 3ABUA 1BJZA 4YFNF 1IRFA 2DMPA 2XKOA 2W25A 4JK1X 5F0HA 2DA3A 1B9MA 2JPCA 3ABMH 3DXJF 3HSFA 1V5GA 2X1CA 2WY8Q 1USTA 4GGGA 3HTUA 2FJ1A 2L7ZA 4JX4A 1XMXA 4UVAA 1X4PA 3J81Z 2M8GX 2L54A 5HDGA 3GTJJ 2BYVE 4RLFA 2BOLA 2AS5F 1TNSA 1W7PD 2FMLA 2KRFA 1FOWA 2DT6A 4PSWA 3CCUI 2QYOA 1Z91A 4KIGA 3HJEA 4MEXF 1HW5A 1O4XA 2B63J 3M9AA 2UWMA 2QSFX 3CMYA 3ELKA 1TZLA 5J6XA 1S7OA 5CVVA 1QRYA 2E36A 2MYSA 1P6RA 2EPFA 3W2WA 1HF0A 4NBQA 1XN7A 4QPQA 1STZA 1KU7A 3DEWA 1F36A 3OIOA 4D1QA 4Q5SF 4E4HA 1LKXA 3BT9A 3Q3SA 1VTNC 1KU2A 2BZTA 3LSPA 1VQPI 3V42A 4XOTA 4JP0A 3D5LA 1Z67A 2MH2A 1WQ2A 4OIOF 4M3BA 1C0WA 1T0FC 1YFHA 2XROA 5E8IA 5DYMA 4IQJA 3S93A 2P81A 3DU5A 5CQEA 1BI1A 1ITYA 3ECHA 1VQ6I 4C30A 3E5XA 1JUSA 3JRHA 4EJOA 2AXLA 1W0TA 2LK2A 3CO7C 3DKWA 1SAXA 4O5VA 1TT5B 2VQHA 1WJDA 4XIDA 5JI6A 3ZN0A 2L01A 5CQGA 4A3GJ 4XSZF 5L3CA 1VI0A 1BC8C 1BBYA 4A69C 1MNMC 2DTZA 3KIOA 4U0VA 1VQMI 4PCQA 2VONA 2FU4A 2MH9A 3J7AO 3RZOJ 4P96A 2VB6A 3AG3H 2NNNA 2L9VA 4GDFA 1BIAA 1OCTC 2YPRA 4UV9A 1K61A 2TDXA 2DMNA 1YIOA 1R5ID 1X1CA 3J80Z 2Z1DA 3PFYA 1N77A 2KZVA 4DQ2A 2ZJQF 2QQ8A 2H8RA 3WGHA 1P2FA 2K40A 4B09A 2ZXHA 2CUZA 3RKWA 4EVIA 4XKBA 1SFUA 2ESNA 2RKHA 3KCCA 5ICFA 2XAFA 1GVJA 4C2TA 4BHCA 3F8NA 1RETA 1MBEA 2BY1A 4PJLA 2NVQJ 2MC3A 1USSA 3SHFA 4H0EA 4JYKA 2IEKA 3I9V2 3AG1H 3GFIA 3FZVA 2LRDA 2HVSA 1XGNA 2HXIA 5L3GA 3ULQB 1V55H 2K3FA 4E7IA 3HOYJ 2VJ4A 4EEFG 2BBYA 2G0EA 4G7OF 2UV1A 2OZ6A 2HYFA 3BR6A 3WU0A 2BGCA 3OYMA 3WTWC 4UVCA 4Y3OA 3QOPA 3FHZA 4B48A 2R5YB 2V9VA 3X2QH 4LG0A 4L0YB 2M45A 3HOXJ 1ZAOA 3OR1C 3BQZA 2E1MC 3IKTA 5D4RA 1OYWA 2QLZA 1IRZA 4YG2F 3KEQA 4RB2C 2ELHA 1BW5A 3JCUC 3WHCA 3DFGA 1TWGJ 2P8TA 1X1DA 3HKZA 2XAUA 3NQOA 2KMUA 3FM3A 2XGXA 5M5XJ 1WRJA 1TLHB 2DA6A 3L00A 1DDNA 2KFDA 1SEUA 4RDUA 3FISA 1MW7A 3TOAA 1RUNA 4BEHB 2QM3A 4MEYF 4B44A 2CGPA 3K69A 4ZYEA 4BS9A 1AKHA 3KP7A 2A3SA 2DPUA 4OAYA 1IW7F 3T5XA 2DA4A 4PJJA 4UUSA 4XLCA 4CCMA 3KLNA 4RBOA 1ZGJA 4QTRA 1D5YA 2R92J 3LL7A 1YITI 4XSXF 1P4XA 3LA2A 2A68F 1IN8A 4G9YA 2HVRA 1Z6RA 5F64A 3DPTA 4E7KA 2XVCA 3OOUA 3PFIA 1VQLI 1O3RA 4BY1J 2LKXA 3JREA 3HDDA 4L9VA 2D1HA 2Q0OA 3W3CA 4CA0A 2DI3A 1UMQA 1O57A 5CLSA 3PNTA 1YX3A 3E7LA 1TWHJ 1WH7A 1JGGA 3QP6A 1JGSA 1LVKA 4E7SA 2FNPA 3TDZC 4IZZA 2JRTA 3I59A 5GTHC 1VQ4I 3CCLI 3ML6A 4FASD 2ZMEA 3CJQB 2R4GA 4QWQA 2Q2EB 4BH9A 2QKMB 2MSYA 5EJCA 1TC3C 1DPUA 2ZB9A 2W4SA 3S1NJ 1I3QJ 3GCMA 3FM5A 4M74A 3ZRGA 2CSOA 2VJJA 4A0ZA 1IXCA 1X3ZB 3BCAA 3FBNB 4HW0A 2WADA 2ICWG 1BI3A 1FZPB 2BY2A 2LY2A 2XAGA 4ZZLA 3JR9A 3R60A 4HF2A 4YIRX 2LOOA 2K85A 4MHGA 3WU2C 3OYJA 2XC7A 5LD2C 5BQTA 1YX5A 2KL4A 2BHZA 3ZMVA 4UNOA 4CCKA 3CESA 1R4NB 4Y13A 4LK0F 4M73A 3G6EI 1SVMA 1Z3XA 1R5HA 1ONVA 3U2RA 2LF8A 1XX5A 5L3DA 3ZGKA 2QKLB 2G7UA 1PUFA 4RMNA 4KA4A 1J75A 3WTVC 4ENJA 2VC0A 4PFOA 3K9TA 3ZQHA 1K78B 4PGHA 2KISA 1UZCA 2B9SA 3MFKA 1K4SA 4DIQA 1H89C 1TQPA 3GWZA 3WTXC 3ZN1A 4KDPA 4EJTA 2L9SA 2E1NA 2ESHA 2QQAA 5H6RA 5HODA 2W7NA 1UFMA 3LSMA 2DJNA 4N4NB 4RAYA 2P6SA 3E1SA 1FMWA 1W0UA 4DBQA 1KQ0A 1WJBA 1ETQA 3CF5F 1Y1WJ 3K7AJ 3AFHA 5CYVA 4CCNA 1VQ8I 2HZTA 1RPWA 2CV0A 2J5PA 2O0YA 2ZJPF 3B6AA 3MKYB 2DU9A 1F9NA 1I27A 2VBZA 1QO0D 1BN5A 4LGWA 2RGVA 3S3MA 5KAFC 4O6JA 5ICCA 2KJCA 3S14J 2HOTA 1Z77A 4MGRA 2HDWA 5FFZA 2GIZA 2VPLA 2RVCA 1I39A 4IX7A 3E6BA 2XHKA 5E1WA 5HLIA 1U5TB 2YX4A 4HNVA 1G59A 3GVAA 4I99C 4PJNA 2AQEA 1B72B 1ZKGA 3O8HA 3BOQA 3HRMA 2I5UA 4TV7A 5CPRB 4C3JJ 1HW1A 2HNHA 5B1BH 4C3IJ 3WTYC 4ZTFA 4GXOA 1W7PB 3C2BA 3VEPA 2H1LA 2L7KA 4UUTA 1BR4A 2FXAA 2VN2A 2QQBA 2A5WA 2L9NA 1ETVA 2VIXA 3ZQFA 3IL2A 3AAFA 1H88C 2KZGA 3V8KA 2EBIA 2WAQA 5BS6A 2DN0A 5AIPA 5HVQC 4J00A 3S1QJ 3EYIA 3HC7A 1MBKA 2A61A 2K27A 1OCPA 2DMTA 4XONA 1MZBA 3A4CA 3H36A 2WWYA 3Q9SA 2GIVA 3BPXA 3CCYA 4CHUA 1QZYA 3VOEA 3GF2A 4EJVA 5M5YJ 1ETWA 1VNDA 2IAIA 4N9IA 3DBHB 1YO5C 4DYRA 3CZ6A 2PMHA 2PG4A 4EATA 3K4MA 1U8RA 1ZG3A 2FF4A 2TCTA 1J2XA 2NS7A 3ABLH 4DW6A 4V19K 4A3BJ 3SZGA 4ZYGA 2HPIA 3K4JA 1QHGA 2NVYJ 3SYTA 4BE0A 4G6QA 1ENHA 2GBYA 4ZYHA 4D7MA 3R6SA 3E97A 5J8FA 5EDNA 5FRNA 3O3KA 4FT8A 4IEJA 3E3VA 4BJ6C 1JE8A 3OYEA 5L3BA 1BOAA 2XGEA 4ASNA 2L2OA 1IXRC 3HHGA 3FX3A 5F04A 4X0GA 2F48A 2E5ZA 3G1LA 2X4HA 1J5YA 1ON1A 4HAMA 4M6YA 4L0ZB 2MLGA 3K0LA 2JVGA 3KP4A 2DLLA 1KONA 1WJAA 4KNYA 4ESFA 2QA4I 2VBWA 1M1EB 2CU7A 2H6CA 1LFPA 3CF2A 4EGYA 2NOJB 3PNYA 3G4SI 1PJRA 3U21A 5JFRA 3E6CC 3K70C 3GZ6A 5C4JJ 3I58A 3CO6C 3MN2A 1R1VA 3FXQA 1B6AA 5FKNA 4BEHA 1FMVA 1W5SA 2L7MP 4GYIA 1BL0A 4P9FA 4JX6A 1BOBA 4CUGA 2XRLA 1DU0A 2E7XA 5ILVA 2LDUA 1QNTA 2P5VA 1H9TA 4R79A 1Z1DA 2NVTJ 4A3KJ 3C2HA 5EGOB 2ECCA 3QPSA 5FKMA 1JXSA 3BR0A 1K4TA
chains in the Genus database with same CATH topology
2I10A 3MKLA 3LOCA 4IHWA 3H3VK 3JRBA 4D5FA 2E1OA 2XGCA 2CQXA 1A5JA 2O9LA 3JRCA 2LR8A 1ZR2A 3HM5A 5BNGA 5EG0B 2QCOA 3NARA 1WGXA 1MBFA 1RR7A 3TW6A 3LSJA 5E3NA 2LP0A 5K7ZA 1X58A 3JRAA 1BJZA 2DMPA 3D1NI 1NTCA 1I50J 2FX0A 5F0HA 2CUFA 2DA3A 2M34A 1OFCX 2ECBA 2W48A 3FIWA 2X9DA 4IHYA 2FJ1A 2L7ZA 4JX4A 1TWAJ 5JLXA 1TWCJ 5FKKA 5C44J 5C3EJ 3GTPJ 4M6VA 4A3DJ 1BA5A 2M8GX 1RESA 1ZK8A 2CJJA 3GTJJ 4JX5A 5IP6A 3L1PA 1MBHA 1XC5A 3K2AA 1MSEC 2L9RA 2ME0A 2M9HA 2MW8A 1Q1VA 5K7HA 2LY9A 3HKZN 2ELKA 2JJ7A 2JN6A 5EEAA 5M5WJ 3OSFA 3CDLA 1O4XA 1JUMA 2B63J 1FIAA 3CMYA 3DCFA 1QRYA 2R93J 4L5EA 4S0HB 1U9OA 3BTIA 1HF0A 2WV1A 3TP0A 3DEWA 1F36A 3PO2J 3OIOA 3BR3A 1CQTA 4A3CJ 3A03A 3VPRA 3ZQLA 2QF7A 1RKWA 3BT9A 3Q3SA 3PM1A 2XGDA 5IYBJ 1JT6A 1TWFJ 1T33A 3LSPA 4BY7J 3SDGA 2K9NA 3HBLA 4JP0A 1XG1A 3S15J 4M3BA 4GFBA 1X2NA 2HXOA 1LFBA 2P81A 1ITYA 3BQYA 2HI3A 1JUSA 3JRHA 1K83J 1OJLA 2E2HJ 4A3MJ 2E2IJ 1W0TA 2LK2A 4QSHA 3Q0UA 1JJ8C 1GT0C 3TEDA 3I4NJ 2Y31A 4XIDA 1LE8A 4FE7A 2DA7A 4XRSG 4A3GJ 1VI0A 5F0FA 2Y9YA 4A69C 2AHQA 4UUSB 3HGYA 1MNMC 1I6HJ 2DTZA 3JRGA 2JA5J 4M3FA 2FQ4A 2EZIA 4A3IJ 3RZOJ 4FE4A 1JJ6C 3HOWJ 1U8BA 4B1RA 5IP7J 2AO9A 1SANA 5IYCJ 2LTPA 3NAUA 2VI6A 2XPWA 1OCTC 4M3DA 5J1RA 1YRNB 5EG0A 1K61A 3IH4A 3F0CA 2O7OA 2DMNA 3ZQCA 3BTCA 3GTGJ 5IOYA 5IOZA 3M3YJ 4J19A 3A01B 4XRSA 1JKOC 1MH3A 2H8RA 2VUMJ 5J3LA 4C2MJ 2K40A 4V2GA 2JA8J 4CYCA 2JWTA 4DYQA 3BTLA 1RETA 1MBEA 5GPCA 2NVQJ 4G12A 1IV6A 4JYKA 2IEKA 1WPKA 1QPIA 1POGA 4MFDA 1QVTA 2HXIA 3A02A 3HOYJ 3ZQGA 3HB9A 1ZTRA 2R0QC 2MGQA 4EEFG 2G0EA 3LSGA 5C4XJ 3BR6A 3RZDJ 3FK7A 2XSDC 2NVXJ 3S17J 4IHVA 1AU7A 2R5YB 1IJWC 1T56A 2R7ZJ 3QPLA 3HOXJ 3S2DJ 3BR2A 3BQZA 3RQIA 1A6IA 2Y0SN 3S1MJ 4XK4A 5J1YA 1IRZA 3S1RJ 1VFCA 1PUFB 3JRFA 1BW5A 3G1MA 4FISA 1NK3P 3GTMJ 2DMQA 5J1UA 1JUPA 3WHBA 3WHCA 4ABZA 1TWGJ 1APLC 5IP9J 1WI3A 5M5XJ 1X2MA 2DA6A 5FKOA 4DZPA 2D5VA 4RDUA 3FISA 2L7FP 2PMZN 4LOCA 3SJMA 4A93J 1AKHA 4W1UA 2H1KA 3HEFA 1U78A 2DA4A 5FKLA 4DZJA 4DYCA 4UUSA 3OSGA 4RBOA 1D5YA 4QTRA 2L0KA 2R92J 9ANTA 4MFEA 3Q0WA 1P7IA 1JKPC 1QVUA 3BG5A 1RKTA 3IH2A 3TW7A 5E3OA 1U9NA 2VKEA 2YUSA 3OOUA 4B3AA 5GPAA 1YRNA 4BY1J 2LKXA 3JREA 4MIMA 3ZQIA 1B8IB 3HDDA 4Y52J 3I4MJ 5M3FJ 1UMQA 3IH3A 2DMUA 2CUEA 1MH4A 3FK6A 3E7LA 1TWHJ 1WH7A 1JGGA 4BBRJ 2WAQN 2EZKA 1WH5A 4XRMA 1GUUA 2K9SA 2DA2A 3BG3A 2E19A 1IG7A 1WCMJ 2VPRA 1FJLA 2MSYA 5EGOA 1TC3C 2ZB9A 1ZQ3P 1UG2A 2NS8A 2KDZA 3GTOJ 3S1NJ 1I3QJ 1JTYA 2XB5A 2IBDA 3JRDA 1UHSA 3QQAA 4AUXA 2ID3A 3JR9A 1DU6A 2EZHA 3H0GJ 1LFUP 3SFIA 1IUFA 4I6ZA 2R5YA 2LLKA 4FCYA 2MG4A 3RKQA 5EF6A 2R5ZB 2NOGA 1ETYA 4BKXA 2LD5A 1PUFA 3CQZJ 4D7NA 3ZQHA 2Y30A 2N8GA 1HOMA 5E3MA 2XPVA 1H89C 5E3LA 1HCRA 1GDTA 5F1JA 2YS9A 5HODA 1JKRC 3HOVJ 2DJNA 3GBGA 1E3OC 1IGNA 1BW6A 1W0UA 1HLVA 5JLWA 1ETQA 1ZR4A 1Y1WJ 3K7AJ 2TRTA 3GTKJ 1EF4A 1G2HA 1RPWA 3B6AA 4X1EA 4IHXA 2EQRA 2YU9J 1SFOJ 4QIWN 3S14J 2HOTA 1Z77A 2COBA 2LFBA 4Y7NJ 3ZOBA 5FLMJ 4A3EJ 2OF7A 1GVDA 1FTTA 1ETKA 5IYDJ 3LNQA 1B8IA 2LVSA 3B6CA 3FKIJ 2K9QA 1MSFC 3W6VA 4HNVA 1ETOA 2HYJA 4M3GA 2OPTA 1B72B 1ZKGA 3O8HA 4CYCB 3GTQJ 1AHDP 2O8KA 3BR5A 2FD5A 5GP9A 2HQ5A 4C3JJ 2M2EA 1ETXA 2GLOA 4C3IJ 2EZLA 4XICA 2ME6A 3LSRA 2EH3A 1JKQC 5M3MJ 1MBJA 1R9TJ 1FTZA 3C2BA 2Y9ZA 4BXXJ 1Z0XA 1JT0A 2GM4A 2DA5A 4UUTA 2M0CA 1ETVA 3ZQFA 1IDYA 3O8GA 1H88C 5F0CA 5FJ8J 2CQQA 2KT0A 5F27A 2EBIA 4FTHA 3Q0VA 2ID6A 3GTLJ 3BR1A 3S16J 2RAEA 4A3JJ 2DN0A 2JA7J 3S1QJ 3A01A 2HOAA 1MBKA 1FIPA 3MVPA 4M3EA 1F43A 1OCPA 2DMTA 2R5ZA 3UKGA 3CCYA 4B4CA 4V2FA 4A3FJ 1VF9A 1JTXA 2VKVA 3HOZJ 5M5YJ 1ETWA 3HGGA 5EYRA 1NK2P 1VNDA 2IAIA 1MBGA 5K7FA 5EZGA 3TP3A 4DYRA 2XPUA 2HOSA 3IV5A 2JMWA 3JRIA 4A3LJ 4C3HJ 2TCTA 2CRGA 2NS7A 2WB1N 4DW6A 4A3BJ 3G1OA 2E2JJ 1GV2A 2NVYJ 2Y2ZA 2DA1A 1IDZA 1ENHA 2GBYA 4D7MA 1AKHB 5DS9A 3HOUJ 5EDNA 3PO3J 4AYBN 4IEJA 1ORKA 4BBSJ 2X6OA 1P7JA 2XGEA 1S7EA 4NDLA 5F04A 2X48A 3G1LA 1H8AC 4W97A 2JK3A 1FEXA 1IC8A 3S2HJ 4I76A 5EZHA 2CU7A 3M4OJ 4X6AJ 4MO7A 4AC0A 3BTJA 5C4JJ 2XB0X 3MN2A 3BG9A 5FKNA 5IPAA 1B72A 1HDDC 2L7MP 1BL0A 2JA6J 4JX6A 1LE8B 1ZGWA 2XRLA 1DU0A 1Y1VJ 1GV5A 2HDDA 2NVTJ 4A3KJ 5DTDA 1HDPA 1XS9A 5EGOB 5F08A 2ECCA 3QPSA 5FKMA 3BR0A 4D5CA 5FLVA 4MLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I10 A;  3MKL A;  3LOC A;  4IHW A;  3H3V K;  3JRB A;  4D5F A;  2E1O A;  2XGC A;  2CQX A;  1A5J A;  2O9L A;  3JRC A;  2LR8 A;  1ZR2 A;  3HM5 A;  5BNG A;  5EG0 B;  2QCO A;  3NAR A;  1WGX A;  1MBF A;  1RR7 A;  3TW6 A;  3LSJ A;  5E3N A;  2LP0 A;  5K7Z A;  1X58 A;  3JRA A;  1BJZ A;  2DMP A;  3D1N I;  1NTC A;  1I50 J;  2FX0 A;  5F0H A;  2CUF A;  2DA3 A;  2M34 A;  1OFC X;  2ECB A;  2W48 A;  3FIW A;  2X9D A;  4IHY A;  2FJ1 A;  2L7Z A;  4JX4 A;  1TWA J;  5JLX A;  1TWC J;  5FKK A;  5C44 J;  5C3E J;  3GTP J;  4M6V A;  4A3D J;  1BA5 A;  2M8G X;  1RES A;  1ZK8 A;  2CJJ A;  3GTJ J;  4JX5 A;  5IP6 A;  3L1P A;  1MBH A;  1XC5 A;  3K2A A;  1MSE C;  2L9R A;  2ME0 A;  2M9H A;  2MW8 A;  1Q1V A;  5K7H A;  2LY9 A;  3HKZ N;  2ELK A;  2JJ7 A;  2JN6 A;  5EEA A;  5M5W J;  3OSF A;  3CDL A;  1O4X A;  1JUM A;  2B63 J;  1FIA A;  3CMY A;  3DCF A;  1QRY A;  2R93 J;  4L5E A;  4S0H B;  1U9O A;  3BTI A;  1HF0 A;  2WV1 A;  3TP0 A;  3DEW A;  1F36 A;  3PO2 J;  3OIO A;  3BR3 A;  1CQT A;  4A3C J;  3A03 A;  3VPR A;  3ZQL A;  2QF7 A;  1RKW A;  3BT9 A;  3Q3S A;  3PM1 A;  2XGD A;  5IYB J;  1JT6 A;  1TWF J;  1T33 A;  3LSP A;  4BY7 J;  3SDG A;  2K9N A;  3HBL A;  4JP0 A;  1XG1 A;  3S15 J;  4M3B A;  4GFB A;  1X2N A;  2HXO A;  1LFB A;  2P81 A;  1ITY A;  3BQY A;  2HI3 A;  1JUS A;  3JRH A;  1K83 J;  1OJL A;  2E2H J;  4A3M J;  2E2I J;  1W0T A;  2LK2 A;  4QSH A;  3Q0U A;  1JJ8 C;  1GT0 C;  3TED A;  3I4N J;  2Y31 A;  4XID A;  1LE8 A;  4FE7 A;  2DA7 A;  4XRS G;  4A3G J;  1VI0 A;  5F0F A;  2Y9Y A;  4A69 C;  2AHQ A;  4UUS B;  3HGY A;  1MNM C;  1I6H J;  2DTZ A;  3JRG A;  2JA5 J;  4M3F A;  2FQ4 A;  2EZI A;  4A3I J;  3RZO J;  4FE4 A;  1JJ6 C;  3HOW J;  1U8B A;  4B1R A;  5IP7 J;  2AO9 A;  1SAN A;  5IYC J;  2LTP A;  3NAU A;  2VI6 A;  2XPW A;  1OCT C;  4M3D A;  5J1R A;  1YRN B;  5EG0 A;  1K61 A;  3IH4 A;  3F0C A;  2O7O A;  2DMN A;  3ZQC A;  3BTC A;  3GTG J;  5IOY A;  5IOZ A;  3M3Y J;  4J19 A;  3A01 B;  4XRS A;  1JKO C;  1MH3 A;  2H8R A;  2VUM J;  5J3L A;  4C2M J;  2K40 A;  4V2G A;  2JA8 J;  4CYC A;  2JWT A;  4DYQ A;  3BTL A;  1RET A;  1MBE A;  5GPC A;  2NVQ J;  4G12 A;  1IV6 A;  4JYK A;  2IEK A;  1WPK A;  1QPI A;  1POG A;  4MFD A;  1QVT A;  2HXI A;  3A02 A;  3HOY J;  3ZQG A;  3HB9 A;  1ZTR A;  2R0Q C;  2MGQ A;  4EEF G;  2G0E A;  3LSG A;  5C4X J;  3BR6 A;  3RZD J;  3FK7 A;  2XSD C;  2NVX J;  3S17 J;  4IHV A;  1AU7 A;  2R5Y B;  1IJW C;  1T56 A;  2R7Z J;  3QPL A;  3HOX J;  3S2D J;  3BR2 A;  3BQZ A;  3RQI A;  1A6I A;  2Y0S N;  3S1M J;  4XK4 A;  5J1Y A;  1IRZ A;  3S1R J;  1VFC A;  1PUF B;  3JRF A;  1BW5 A;  3G1M A;  4FIS A;  1NK3 P;  3GTM J;  2DMQ A;  5J1U A;  1JUP A;  3WHB A;  3WHC A;  4ABZ A;  1TWG J;  1APL C;  5IP9 J;  1WI3 A;  5M5X J;  1X2M A;  2DA6 A;  5FKO A;  4DZP A;  2D5V A;  4RDU A;  3FIS A;  2L7F P;  2PMZ N;  4LOC A;  3SJM A;  4A93 J;  1AKH A;  4W1U A;  2H1K A;  3HEF A;  1U78 A;  2DA4 A;  5FKL A;  4DZJ A;  4DYC A;  4UUS A;  3OSG A;  4RBO A;  1D5Y A;  4QTR A;  2L0K A;  2R92 J;  9ANT A;  4MFE A;  3Q0W A;  1P7I A;  1JKP C;  1QVU A;  3BG5 A;  1RKT A;  3IH2 A;  3TW7 A;  5E3O A;  1U9N A;  2VKE A;  2YUS A;  3OOU A;  4B3A A;  5GPA A;  1YRN A;  4BY1 J;  2LKX A;  3JRE A;  4MIM A;  3ZQI A;  1B8I B;  3HDD A;  4Y52 J;  3I4M J;  5M3F J;  1UMQ A;  3IH3 A;  2DMU A;  2CUE A;  1MH4 A;  3FK6 A;  3E7L A;  1TWH J;  1WH7 A;  1JGG A;  4BBR J;  2WAQ N;  2EZK A;  1WH5 A;  4XRM A;  1GUU A;  2K9S A;  2DA2 A;  3BG3 A;  2E19 A;  1IG7 A;  1WCM J;  2VPR A;  1FJL A;  2MSY A;  5EGO A;  1TC3 C;  2ZB9 A;  1ZQ3 P;  1UG2 A;  2NS8 A;  2KDZ A;  3GTO J;  3S1N J;  1I3Q J;  1JTY A;  2XB5 A;  2IBD A;  3JRD A;  1UHS A;  3QQA A;  4AUX A;  2ID3 A;  3JR9 A;  1DU6 A;  2EZH A;  3H0G J;  1LFU P;  3SFI A;  1IUF A;  4I6Z A;  2R5Y A;  2LLK A;  4FCY A;  2MG4 A;  3RKQ A;  5EF6 A;  2R5Z B;  2NOG A;  1ETY A;  4BKX A;  2LD5 A;  1PUF A;  3CQZ J;  4D7N A;  3ZQH A;  2Y30 A;  2N8G A;  1HOM A;  5E3M A;  2XPV A;  1H89 C;  5E3L A;  1HCR A;  1GDT A;  5F1J A;  2YS9 A;  5HOD A;  1JKR C;  3HOV J;  2DJN A;  3GBG A;  1E3O C;  1IGN A;  1BW6 A;  1W0U A;  1HLV A;  5JLW A;  1ETQ A;  1ZR4 A;  1Y1W J;  3K7A J;  2TRT A;  3GTK J;  1EF4 A;  1G2H A;  1RPW A;  3B6A A;  4X1E A;  4IHX A;  2EQR A;  2YU9 J;  1SFO J;  4QIW N;  3S14 J;  2HOT A;  1Z77 A;  2COB A;  2LFB A;  4Y7N J;  3ZOB A;  5FLM J;  4A3E J;  2OF7 A;  1GVD A;  1FTT A;  1ETK A;  5IYD J;  3LNQ A;  1B8I A;  2LVS A;  3B6C A;  3FKI J;  2K9Q A;  1MSF C;  3W6V A;  4HNV A;  1ETO A;  2HYJ A;  4M3G A;  2OPT A;  1B72 B;  1ZKG A;  3O8H A;  4CYC B;  3GTQ J;  1AHD P;  2O8K A;  3BR5 A;  2FD5 A;  5GP9 A;  2HQ5 A;  4C3J J;  2M2E A;  1ETX A;  2GLO A;  4C3I J;  2EZL A;  4XIC A;  2ME6 A;  3LSR A;  2EH3 A;  1JKQ C;  5M3M J;  1MBJ A;  1R9T J;  1FTZ A;  3C2B A;  2Y9Z A;  4BXX J;  1Z0X A;  1JT0 A;  2GM4 A;  2DA5 A;  4UUT A;  2M0C A;  1ETV A;  3ZQF A;  1IDY A;  3O8G A;  1H88 C;  5F0C A;  5FJ8 J;  2CQQ A;  2KT0 A;  5F27 A;  2EBI A;  4FTH A;  3Q0V A;  2ID6 A;  3GTL J;  3BR1 A;  3S16 J;  2RAE A;  4A3J J;  2DN0 A;  2JA7 J;  3S1Q J;  3A01 A;  2HOA A;  1MBK A;  1FIP A;  3MVP A;  4M3E A;  1F43 A;  1OCP A;  2DMT A;  2R5Z A;  3UKG A;  3CCY A;  4B4C A;  4V2F A;  4A3F J;  1VF9 A;  1JTX A;  2VKV A;  3HOZ J;  5M5Y J;  1ETW A;  3HGG A;  5EYR A;  1NK2 P;  1VND A;  2IAI A;  1MBG A;  5K7F A;  5EZG A;  3TP3 A;  4DYR A;  2XPU A;  2HOS A;  3IV5 A;  2JMW A;  3JRI A;  4A3L J;  4C3H J;  2TCT A;  2CRG A;  2NS7 A;  2WB1 N;  4DW6 A;  4A3B J;  3G1O A;  2E2J J;  1GV2 A;  2NVY J;  2Y2Z A;  2DA1 A;  1IDZ A;  1ENH A;  2GBY A;  4D7M A;  1AKH B;  5DS9 A;  3HOU J;  5EDN A;  3PO3 J;  4AYB N;  4IEJ A;  1ORK A;  4BBS J;  2X6O A;  1P7J A;  2XGE A;  1S7E A;  4NDL A;  5F04 A;  2X48 A;  3G1L A;  1H8A C;  4W97 A;  2JK3 A;  1FEX A;  1IC8 A;  3S2H J;  4I76 A;  5EZH A;  2CU7 A;  3M4O J;  4X6A J;  4MO7 A;  4AC0 A;  3BTJ A;  5C4J J;  2XB0 X;  3MN2 A;  3BG9 A;  5FKN A;  5IPA A;  1B72 A;  1HDD C;  2L7M P;  1BL0 A;  2JA6 J;  4JX6 A;  1LE8 B;  1ZGW A;  2XRL A;  1DU0 A;  1Y1V J;  1GV5 A;  2HDD A;  2NVT J;  4A3K J;  5DTD A;  1HDP A;  1XS9 A;  5EGO B;  5F08 A;  2ECC A;  3QPS A;  5FKM A;  3BR0 A;  4D5C A;  5FLV A;  4MLO A; 
#chains in the Genus database with same CATH topology
 2K5C A;  1O7F A;  3JRB A;  3ROU A;  4KIB A;  2Z5U A;  2CQX A;  4Y33 A;  1A5J A;  5DUK A;  2EV0 A;  1X1P A;  4OAZ A;  3JRC A;  3L9F A;  2LR8 A;  4NC8 A;  5LHH A;  1MND A;  3BZ6 A;  3JAM K;  2X1D A;  2IS4 A;  3FBI B;  1RR7 A;  4Q4Z F;  3LSJ A;  4A12 A;  3FXU A;  2BVM A;  2FQ3 A;  5BMZ A;  1KYZ A;  3CP8 A;  2G7H A;  5ILU A;  3D1N I;  3BCB A;  2FX0 A;  1D1C A;  1I5Z A;  2FE3 A;  2M34 A;  1HC8 A;  1TT0 A;  2ECB A;  2W48 A;  2X9D A;  2XSJ C;  2H27 A;  2X6W A;  4R1H A;  3V7S A;  1TWC J;  4A3D J;  2UZK A;  1BA5 A;  3WE2 A;  1RES A;  4IPA A;  4I7H A;  4GRI A;  4JX5 A;  3L1P A;  1MBH A;  2HGC A;  1KZH A;  1ZN2 A;  3K2A A;  5HLT A;  4CH7 A;  4BE1 A;  2M9H A;  2MW8 A;  2BXZ A;  1LDK B;  2CW7 A;  5K7H A;  3HKZ N;  2ELK A;  2ISY A;  2R7F A;  4CCO A;  5EEA A;  3OYB A;  3OSF A;  3CDL A;  2O3F A;  3DCF A;  2NRA C;  2HOE A;  3MZY A;  4L5E A;  3WG9 A;  4G6D A;  2RC4 A;  2WV1 A;  3TP0 A;  1G8X A;  1VQ9 I;  1ZHF A;  1FPQ A;  1W36 C;  1IN7 A;  2F4I A;  3EUK L;  2STT A;  1CQT A;  4LG0 B;  3A03 A;  3M8F A;  4CZC A;  5DUI A;  3KZY A;  2MLK A;  3I54 A;  3IP4 B;  3W2V A;  1X3U A;  2WAE A;  3LA3 A;  1JT6 A;  1TWF J;  1Z7U A;  1T33 A;  5DEQ A;  4ZDL A;  4F3Q A;  1A6Q A;  3GZ5 A;  4E7L A;  4JBA A;  4ZH4 F;  3PUF A;  1A35 A;  4KFC A;  2ZJR F;  1V5F A;  2K9N A;  3WTZ A;  1K78 A;  3IRQ A;  4CDG A;  2HFH A;  2HXO A;  3TBI A;  4GCV A;  1U3E M;  3RIR A;  1H0M A;  3CUQ C;  3ERM A;  3JSO A;  4MTD A;  2E2H J;  4A3M J;  5DM6 F;  3IUO A;  2KLO A;  1GT0 C;  3IWZ A;  3I4N J;  2O5R A;  4AYB A;  1LE8 A;  1REP C;  3CC7 I;  4XRS G;  3K1P A;  3G3Z A;  3GO5 A;  2EIK H;  3CTA A;  3H9G A;  2XUB A;  5F0F A;  2Y9Y A;  4Z2Y A;  2AHQ A;  2VT2 A;  2XRN A;  3PSF A;  2ZFW A;  4UUS B;  1I6H J;  2KRH A;  4HLX A;  2NS0 A;  1A31 A;  2FQ4 A;  1WJE A;  1MJA A;  2EZI A;  2PQ8 A;  4KJZ A;  3HTS B;  4LIV A;  5E79 C;  1JJ6 C;  1XGO A;  4B1R A;  5IP7 J;  1PUE E;  2NAZ A;  1SAN A;  2GXG A;  3ASN H;  5IYC J;  2LY1 A;  3NAU A;  2H8W A;  4RAG A;  3KET A;  3TL4 X;  1YYV A;  3IH4 A;  1SC7 A;  4ETS A;  3ZQC A;  1K7A A;  1OPC A;  3IRR A;  1EKE A;  1XGM A;  2L02 A;  1YW9 A;  2X6Y A;  3DQV C;  5DCF A;  3H1C A;  3VB2 A;  5FRM A;  3J7Z I;  3EUH A;  2Q1Z B;  1JKO C;  1MH3 A;  5J3L A;  3TQN A;  4V2G A;  2JA8 J;  2EJR A;  5GAG J;  3V8J A;  2JWT A;  3GFM A;  4DYQ A;  1AA7 A;  3BTL A;  4F91 B;  3DTE A;  1TTY A;  2JA2 A;  3D0S A;  4BE2 A;  1MKM A;  4AIK A;  2VXZ A;  4XKW A;  3K4C A;  4NC6 A;  1JI8 A;  1Z7L A;  5E20 A;  3I4P A;  2RNJ A;  3V7R A;  4BL0 B;  1BI0 A;  1POG A;  3H0D A;  2V6E A;  1QVT A;  4ZYD A;  5E18 F;  3E6M A;  3A02 A;  4A6E A;  2OJE D;  1X1B A;  3HB9 A;  1ZTR A;  4G6T B;  4HBL A;  3GUD A;  2CQ7 A;  2EA4 A;  2J5O A;  3ERE D;  3L2U A;  2XV4 S;  3FK7 A;  2CUJ A;  3S17 J;  2L4A A;  4IHV A;  2EA2 A;  2XF5 A;  3GME A;  3L7W A;  3C3W A;  5H6Q A;  1XMA A;  2O61 A;  3CJT B;  5IT3 A;  1SVO A;  5HNF A;  2DBB A;  4ZDP A;  3A2K A;  1T56 A;  1D1A A;  3SXY A;  3GYH X;  4U7B A;  3S2D J;  3BR2 A;  1P4A A;  1R71 A;  4KT5 C;  1VQN I;  2P4W A;  1VFC A;  1RNL A;  4P55 A;  3R0J A;  3JRF A;  1PUF B;  3NWT A;  4MQV A;  3KP6 A;  3LFU A;  3GTM J;  4ABZ A;  2MD5 A;  4KIT B;  3UR3 C;  5J4Y A;  1KQ8 A;  2O6G E;  2BXY A;  2VOD A;  1S29 A;  3U9G A;  4WF2 A;  5BPD A;  4DGW B;  5TJJ A;  5FKO A;  3FMR A;  4DZP A;  2D5V A;  3VSK A;  4HV6 A;  1U2W A;  3QP5 A;  2L7F P;  4BXF A;  1FLI A;  3F72 A;  3O6B B;  2FEZ A;  4W1U A;  4UXN A;  3P5J A;  3HEF A;  3QYB A;  2PMU A;  1Y6I A;  3TDU C;  4DYC A;  2V7F A;  2OUM A;  3IAM 2;  3OSG A;  3HPH A;  1AOY A;  2L0K A;  3CC2 I;  1UHM A;  2BV6 A;  2DTR A;  4MFE A;  3Q0W A;  3HOT A;  1P7I A;  5CVJ A;  1JKP C;  3VYU B;  4U0Y A;  3JW4 A;  1HQC A;  4FHT A;  1ON2 A;  4XL9 A;  3R0A A;  5TRD A;  1U9N A;  2VKE A;  2YUS A;  2LYC A;  3C18 A;  1G6N A;  2QVO A;  4M9S A;  4MIM A;  4LLG F;  2HS5 A;  2DMU A;  2CUE A;  1MH4 A;  3FK6 A;  2OD5 A;  3S3N A;  2HU9 A;  1QU3 A;  1FBQ A;  1PYV A;  3HRS A;  3HPG A;  2WAQ N;  4A0Y A;  4HDV A;  1KU3 A;  4BDZ A;  1P9Q C;  2DA2 A;  2M8E A;  5LFA A;  2VL8 A;  1LNW A;  1WCM J;  2F5F A;  1W4M A;  4HPQ A;  3S3O A;  3WTT C;  5EGO A;  1ZQ3 P;  1UG2 A;  4I09 A;  2V1U A;  3CCV I;  3E5U A;  1JTY A;  1K79 A;  2IBD A;  2KQR A;  4U7D A;  2K86 A;  1QBJ A;  1TQM A;  3QQA A;  4AD9 A;  4BUP A;  1YQA A;  1B9N A;  1S5L C;  1OIS A;  4M9X A;  4E6K G;  1SFK A;  1MJ9 A;  2CWE A;  2P7V B;  1DU6 A;  3H0G J;  4I2O A;  3KP3 A;  4EQQ A;  2DO7 A;  2R7D A;  3LST A;  4I0A A;  3V7C A;  4I6Z A;  3CMA I;  3COA C;  6PAX A;  2ZCW A;  3TMO A;  2EV6 A;  4GO1 A;  5D8L B;  4FCY A;  2MG4 A;  5EF6 A;  3N4M A;  1MIJ A;  3BJA A;  1WWX A;  2EWN A;  4D9J A;  4PFP A;  3K4L A;  4RGU A;  3LWF A;  2W1O A;  3IC7 A;  4YFK F;  3G71 I;  5CVI A;  4LB5 A;  2MBF A;  1BR1 A;  1HOM A;  4FX0 A;  2DQR A;  3VSL A;  2Y48 A;  1G3T A;  3FXO A;  1HCR A;  1GDT A;  2DFE A;  3E0J B;  4PJM A;  1T2K A;  2IT0 A;  2YS9 A;  1JKR C;  1E3O C;  3DTI A;  3GBG A;  1R22 A;  4FQG A;  3SFZ A;  1IGN A;  5IT9 K;  4PDK A;  5B1A H;  1YW7 A;  1D1B A;  5GTI C;  1XCB A;  2RNG A;  3K4N A;  2KDO A;  4A5N A;  2TRT A;  3AG2 H;  5HDN A;  3OYL A;  3GTK J;  3P9C A;  3CD6 I;  2PLY A;  1QZZ A;  2FOK A;  1R49 A;  2BHY A;  3H5N A;  4IHS A;  4E7J A;  3H92 A;  3WG7 H;  4BYY A;  3KFW X;  2LFB A;  4Y7N J;  1D0Z A;  4ON0 A;  4R8H A;  2LC2 A;  3ZOB A;  4XN3 A;  2OF7 A;  5FLM J;  4A3E J;  3CCM I;  1GVD A;  1FTT A;  3RJP A;  1FX7 A;  1U5T C;  3FKI J;  3PQK A;  1VQK I;  2PMZ A;  1GLN A;  2RDP A;  4IJA A;  1DGW Y;  4M3G A;  4RAZ A;  1D8K A;  4WXC A;  3GTQ J;  1RC9 A;  1F5T A;  3H35 A;  3ISP A;  2C6Y A;  1E2X A;  2ZNZ A;  5GP9 A;  2JTV A;  4LJZ F;  1ETX A;  1A36 A;  5GAD J;  3WE3 A;  2EZL A;  4XIC A;  1YIJ I;  3LQR A;  3LSR A;  4XOR A;  4XNF A;  5DDG A;  2KHM A;  3S8P A;  2F5V A;  3RYP A;  1UG0 A;  3W6K B;  1FTZ A;  2LRE A;  2R7W A;  5LHG A;  2GM4 A;  2FUG 2;  5CKT A;  4QPO A;  3KYC B;  3M8J A;  3AL0 C;  2LMD A;  1Z6T A;  3EYY A;  3O8G A;  5HNH A;  1BIB A;  3OYG A;  2CQQ A;  3BP8 A;  2DCE A;  2KT0 A;  2Y75 A;  2VLA A;  3Q0V A;  4FTH A;  3A1Y A;  3GTL J;  1XGS A;  3BR1 A;  4A3J J;  3P7N A;  3ZMS A;  3BC8 A;  2HWV A;  4N4O B;  1R58 A;  1FIP A;  3MVP A;  2CV2 A;  4EJU A;  3V4G A;  2R5Z A;  3L2V A;  3UKG A;  1FBS A;  2K02 A;  3FXJ A;  2DOA A;  4ESB A;  1IF1 A;  5LRR A;  2H09 A;  2GQQ A;  3JAM Z;  4UHT A;  2Q8K A;  1CGP A;  3L2Q A;  2OQG A;  3CCE I;  2HOS A;  2IXS A;  2JMW A;  1WJF A;  3QYE A;  5FB2 A;  4A3L J;  2R7T A;  2Z3Y A;  3LMM A;  3BZC A;  1TBX A;  1ODD A;  1ZRE A;  1LDD A;  3BJO A;  2XDV A;  3OOP A;  1TW2 A;  5FGM A;  5HDK A;  2E2J J;  4M9Z A;  4IL6 C;  2V26 A;  3WU1 B;  3RPU A;  2IPQ X;  5TIS C;  1Z9C A;  1KGS A;  3HOU J;  3BG7 A;  3DU6 A;  4M6X A;  3QOD A;  4AYB N;  2LBF A;  1Z3Y A;  1J0R A;  1OYY A;  4BQA A;  4NDL A;  3F8F A;  3ZMU A;  3TO9 A;  2QQ9 A;  3H5R A;  4LIU A;  4BHB A;  4W97 A;  3T8R A;  1SD6 A;  2JSC A;  2DOD A;  4HNU A;  5EZH A;  4G7H F;  4LMY A;  4G7Z F;  4XN0 A;  1UCR A;  3M4O J;  4X6A J;  1RZ4 A;  4NNJ A;  4MO7 A;  1V54 H;  1KYW A;  2NXN B;  2MFZ A;  4L9N A;  2RQQ A;  2A69 F;  1J9I A;  2IGK A;  3BG9 A;  3I5U A;  1W1W E;  4BQN A;  1PP7 U;  3RPQ A;  1LE8 B;  3I53 A;  1ZGW A;  3RPU D;  5JVT A;  2HDD A;  1EJ9 A;  2V1D A;  3HSE A;  2EIL H;  5DTD A;  4CZZ A;  2DT5 A;  2RV8 A;  1VQ5 I;  5F08 A;  1O3T A;  5FLV A;  1BJA A;  2I10 A;  3MKL A;  4IHW A;  3H3V K;  3WGI A;  3L09 A;  3LAP A;  1SMY F;  3SDB A;  1YJ9 I;  2QBY A;  3FXR A;  2O9L A;  2F5E A;  3I71 A;  1KA8 A;  3HM5 A;  4PK4 A;  3HL2 A;  2VT3 A;  1MBF A;  2EV5 A;  3F8B A;  2LP0 A;  2DT7 B;  5TGT A;  5K7Z A;  1X58 A;  3DEE A;  3J7A Y;  4A5M A;  2JPB A;  1O3Q A;  3D5R C;  3VYT B;  4S05 A;  3OYA A;  1YS6 A;  1I50 J;  4XLE A;  3ESW B;  4XQF A;  4F93 B;  2CUF A;  3U1D A;  4QLC U;  4ENN A;  1S72 I;  2F4M B;  4IHY A;  2VAS A;  1TWA J;  5JLX A;  5C44 J;  1F4K A;  3GXO A;  2DFI A;  2NYX A;  3KEO A;  3VFZ A;  2CJJ A;  2JUG A;  2LSO A;  3HRT A;  2ZXW H;  5IP6 A;  1N75 A;  1Z21 A;  3CCS I;  2L9R A;  2ME0 A;  4AID A;  2LY9 A;  1FNN A;  3QPT A;  2JN6 A;  5M5W J;  3M07 A;  3ZP5 A;  1LQ1 A;  1QQI A;  2EK5 A;  2ACJ A;  2PI0 A;  3ECO A;  2MC4 A;  4S0H B;  1U9O A;  4LIT A;  1CF7 B;  3OY9 A;  1V3F A;  1OCO H;  2CYY A;  3VWB A;  2VJ5 A;  4WXD A;  2R7Q A;  1XMK A;  3A0B C;  3ZQL A;  1YJN I;  4ZC3 A;  1LDJ A;  2ETH A;  2FMY A;  1P92 A;  5IYB J;  2F6C A;  3OS2 A;  3HG9 A;  4G8X A;  2IS2 A;  1ULY A;  2QWW A;  3D5S C;  3SDG A;  2JRM A;  3BRO A;  3HBL A;  1OR7 A;  1XG1 A;  2IA2 A;  3ZMZ A;  1X4O A;  4GFB A;  2VKD A;  5K5Q A;  1LFB A;  2UUZ A;  3MMY B;  4I0B A;  5FD5 A;  4II2 A;  4CO8 A;  3OS0 A;  4XM3 A;  2ZSH B;  1NG7 A;  4QSH A;  3OV8 A;  2CG4 A;  3VDX A;  4B8X A;  3TED A;  1JJ8 C;  2Y31 A;  1WVR A;  1E17 A;  2CO5 A;  2DA7 A;  4HNT A;  2LKS A;  4YRV A;  2XF6 A;  5CVU A;  4M71 A;  5D8K B;  1G3W A;  4RA2 A;  5KVR A;  3WTU C;  2LH9 A;  1R36 A;  1ZG1 A;  4F52 A;  1YG2 A;  4E70 A;  2DYR H;  3ASO H;  3HGY A;  3JRG A;  2DXI A;  2KKO A;  4FE4 A;  2M87 A;  2V6C A;  2AO9 A;  3OMY A;  4YEJ A;  3J7Y J;  4C9Y A;  4S04 A;  4Y17 A;  2XPW A;  3C1D A;  1Q1H A;  2X51 A;  3MAJ A;  4IVN A;  5LLQ A;  4M3D A;  5J1R A;  2EB7 A;  3OL4 A;  3HIF A;  2M7A A;  1WHU A;  3GTG J;  4EJW A;  5IOY A;  5IOZ A;  5FD6 A;  1TW3 A;  1EV7 A;  3SEZ A;  4IRI A;  1OMI A;  4J19 A;  5D5W B;  2F4O B;  3A01 B;  1JHH A;  2GXA A;  2WBM A;  2W82 A;  2VUM J;  4MQ9 F;  3EPZ A;  4LB6 B;  2CQN A;  2QEX I;  3DF8 A;  3U1K A;  1EA3 A;  2OC6 A;  4E7H A;  2ZME C;  1FOY A;  1Y56 A;  3ONQ A;  2K7L A;  2W57 A;  4G12 A;  3JSP A;  5DD8 A;  1O3S A;  2WY7 Q;  1WPK A;  2KIF A;  2EFQ A;  3N97 A;  2M30 A;  1GHC A;  1U0J A;  2X85 A;  3F6O A;  2JVH A;  1T39 A;  2R7V A;  3VYS B;  1YLF A;  3OYK A;  3PUB A;  3REO A;  2MGQ A;  5HLH A;  3OYH A;  2R0Q C;  1RRJ A;  3LSG A;  3T1B A;  1N25 A;  1T8I A;  5KHD A;  4DJA A;  2XSD C;  4M72 A;  3HZJ A;  4FX4 A;  2NVX J;  3DLA A;  3IKV A;  3DWL E;  1AU7 A;  2I8D A;  2R3S A;  1ZYR F;  1SMT A;  2R7Z J;  5K5O A;  4KN4 X;  4L9T A;  1A04 A;  3P9K A;  1UJ8 A;  2STW A;  2Z99 A;  4XK4 A;  2JSP A;  2R7U A;  3S1R J;  1IZ1 A;  3GLL A;  2QSH X;  1WJC A;  4L9J A;  1OLT A;  3G1M A;  4FIS A;  1PVE A;  2DMQ A;  2PJP A;  2W24 A;  2X0L A;  4BAY A;  3OYI A;  4BDY A;  3HXL A;  1T0F A;  5IP9 J;  3C7J A;  3PIO F;  1WI3 A;  3OYF A;  1DPR A;  3VYR B;  1X2M A;  2OU2 A;  2QUF A;  4U0W A;  2HQN A;  2P5L C;  4LLL A;  4LOC A;  2PMZ N;  5J40 A;  5KCM A;  3K1N A;  3MWM A;  4PGG A;  1G3S A;  4XLP F;  3VOD A;  2Z16 A;  4XKC A;  1R6R A;  2V79 A;  1OKR A;  1U78 A;  3OR2 C;  2A07 F;  4IF4 A;  5LRS A;  1ZLK A;  3OYN A;  9ANT A;  1ACI A;  2D2W A;  1XTA A;  2E35 A;  3BY6 A;  2VQC A;  3HRU A;  4XRF A;  2OA4 A;  3CP2 A;  2VOO A;  1QVU A;  5KAI C;  4XKV A;  1G4D A;  4UB8 C;  2MAB A;  3LAJ A;  4PSX A;  4CCL A;  2F5D A;  4N0B A;  5E3O A;  4B3A A;  4B43 A;  4IO9 F;  2DW4 A;  1MDM B;  1YRN A;  1I6X A;  4OU0 A;  4IRG A;  4Y52 J;  2OQR A;  1ZRD A;  3I4M J;  3GLX A;  5M3F J;  3IH3 A;  4HF0 A;  4YIF A;  3LFK A;  3H9Q A;  2EZK A;  4CCJ A;  1WH5 A;  3ZMT A;  1KQ9 A;  2NNY A;  4Z6Y A;  3FF5 A;  3OL3 A;  1I3A A;  4YII A;  3BG3 A;  2LF7 A;  3PSI A;  4PJ0 C;  3FMS A;  1HA8 A;  1FJL A;  4PUS A;  4GYG A;  2NS8 A;  4LLN A;  2ZJ2 A;  3IHU A;  5F6F A;  3CMM A;  1OYI A;  1XDS A;  4ANJ A;  2M1B A;  2YX7 A;  4RS8 A;  4ZTJ A;  3OYD A;  1RUO A;  5LHI A;  1E0E A;  5E17 F;  3NWS A;  3M1C A;  1B1B A;  2LNB A;  2PJR B;  2A6T A;  1N78 A;  5D4S A;  3SZP A;  1LFU P;  2H6B A;  5HS9 A;  1IUF A;  2WC2 A;  2OTJ I;  2LLK A;  2NVU B;  2WV0 A;  3KZI C;  2YU3 A;  2M0M A;  2R5Z B;  2V1X A;  2NOG A;  1ETY A;  2H94 A;  2M4K A;  1TQI A;  4FET A;  4RGR A;  2Z33 A;  2XF7 A;  2RRE A;  3G73 A;  5D6F A;  4U87 A;  3DEU A;  1TP4 A;  3MD2 A;  3BJ6 A;  2Y30 A;  1YHQ I;  3RKY A;  4YFX F;  2VC1 A;  3A0H C;  2GWR A;  3RI4 A;  2A6H F;  4IKF A;  1YI2 I;  4JOM A;  4ITV A;  3RTR A;  5F1J A;  3HOV J;  5FLX K;  1HKT A;  4B3X A;  2W85 A;  3HHH A;  5FFX A;  1HKQ A;  1HLV A;  5E1Z B;  5JLW A;  4ENM A;  5H20 A;  1CF7 A;  1LB2 A;  4XLA A;  5JVG F;  4ESJ A;  2LBF B;  1IRG A;  1XB4 A;  4LK1 F;  1LEA A;  2HKO A;  1EF4 A;  4RB3 C;  1ZRF A;  5E8G A;  1FYK A;  3H3Z A;  2FNA A;  1BI2 A;  2HTJ A;  2JQ7 A;  2YU9 J;  3RDI A;  4RAF A;  5B66 C;  2HR3 A;  4RM2 A;  2COB A;  1O7L A;  1DGR M;  2FSW A;  2GA2 A;  3KEY A;  1HW2 A;  1I1S A;  5IYD J;  1B8I A;  5HOO A;  2LVS A;  2ADU A;  1OCR H;  3DBL B;  2A5Y B;  3IAS 2;  3QOE A;  4BHP A;  1QA6 A;  4C2U A;  2OV7 A;  4N9H A;  3W6V A;  1YW8 A;  1G3Y A;  3ZR8 X;  1ETO A;  2HYJ A;  5D5X B;  5LEJ A;  3ABT A;  3DKY A;  3DPU A;  3FMQ A;  2V1N A;  4CYC B;  1AHD P;  3ZCO A;  3QYF A;  1FOK A;  2HQ5 A;  3WTS C;  2ZC2 A;  2XAS A;  4U88 A;  1MMD A;  2W84 A;  4KIS A;  2GLO A;  1S3J A;  4L5I A;  1EH7 A;  2P0W A;  2ME6 A;  3M7G A;  1R9T J;  3DBR B;  2O03 A;  3QRF F;  4BXX J;  5B3S H;  1JT0 A;  1GXQ A;  4OIN F;  4I98 B;  2QBY B;  3KYL A;  3KP2 A;  1NG6 A;  1IDY A;  1OCZ H;  1DP7 P;  3DKX A;  3LSH A;  3H3U A;  1UB9 A;  5F0C A;  2D45 A;  4E7Z A;  2ID6 A;  3E5Q A;  2EFW A;  2RAE A;  3TGN A;  1TL8 A;  2JA7 J;  2ZNY A;  1FP2 A;  3A01 A;  2HVQ A;  1Y8Q B;  4RB1 A;  3ZMD A;  1NH3 A;  1D5V A;  4HV5 A;  4MTE A;  3B02 A;  2E34 A;  2K9L A;  4V2F A;  1P4W A;  1JTX A;  3HOZ J;  1UEL B;  2D1V A;  1YE9 A;  4I01 A;  5EYR A;  2CS3 A;  3JTG A;  1MBG A;  5EZG A;  5GAE J;  2ZBK A;  2XPU A;  2HEO A;  3LSK A;  2HKX A;  2P6T A;  4YEL A;  3IV5 A;  4BQO A;  3BLY A;  3JRI A;  2UXX A;  2L4M A;  4AWX B;  2CRG A;  2WB1 N;  5KNL A;  3ABK H;  2OTL I;  1Z05 A;  3CUQ B;  1EH6 A;  5A2Q K;  1GV2 A;  4DNC A;  4BAC A;  2Y2Z A;  1QZE A;  4HST A;  2VKH A;  1IDZ A;  4OIQ F;  2XIG A;  5L3E A;  3PO3 J;  3E6D A;  2XAQ A;  3I0T A;  4BBS J;  2ZXJ A;  1P7J A;  4A6D A;  1S7E A;  2EIN H;  1B59 A;  1FP1 D;  1H8A C;  2W00 A;  3H5A A;  1MJB A;  3F8M A;  4O3M A;  1DQU A;  1IC8 A;  2AXT C;  3CDH A;  2HTS A;  2HQR A;  4HA8 A;  3MCZ A;  1QPM A;  1E3H A;  3DLL F;  1FC3 A;  2E5N A;  2CFO A;  1T08 B;  2X1E A;  4AC0 A;  2OCC H;  3BTJ A;  5EEG A;  1WKM A;  2IJL A;  2BW3 B;  4OIP F;  3T8T A;  1HDD C;  1K6O A;  2KIU A;  2FBI A;  1J7K A;  2PBI A;  1Y1V J;  2K3P A;  3QU3 A;  2Z9O A;  1GV5 A;  2M5W A;  3CLQ A;  2F5C A;  3K2Z A;  3PIP F;  3HYI A;  1HDP A;  3OWT A;  1GXP A;  4P9U A;  2GXB A;  2FBH A;  4Y4R A;  5DCM B;  3ZQ7 A;  3OYC A;  5BOX A;  1R4M B;  2HZD A;  4D5F A;  1FYM A;  2DYS H;  4NQW B;  1W5C C;  2XGC A;  4OMY A;  2GA1 A;  1ZH5 A;  1ZR2 A;  1MDM A;  2Y0M A;  2QCO A;  4HX4 A;  2P7C B;  1LEB A;  1WGX A;  3EUH C;  4NB5 A;  4EM0 B;  2VXD A;  3TW6 A;  1LVA A;  3JRA A;  1ZRC A;  2R7O A;  4KN7 X;  1D8J A;  1NTC A;  1T98 A;  2PN6 A;  1QHH D;  4BJ5 C;  4XMY A;  1FBU A;  1OFC X;  1S6L A;  4HEA 2;  3FIW A;  1WZ2 A;  5C3E J;  5FKK A;  3GTP J;  5D5V B;  4M6V A;  5JR3 A;  4UVB A;  1ZK8 A;  2GZW A;  2V9P A;  1XC5 A;  3V8L A;  4HQE A;  2CFX A;  1MSE C;  2IGN A;  5FRO A;  2R7S A;  1OQY A;  1Q1V A;  4OMZ A;  3Q9V A;  2EFO A;  2JJ7 A;  3DTK A;  3NRV A;  5LEK A;  1FSH A;  1JUM A;  1FIA A;  2DJI A;  2HQA A;  2PJR A;  4L18 B;  3CUO A;  2R93 J;  3MKW B;  3BTI A;  4OIR F;  1HBX G;  5AON A;  3GX4 X;  2DDA A;  3PO2 J;  3BR3 A;  1ZEL A;  3WGG A;  4A3C J;  4KUM A;  4RGX A;  3VPR A;  2EIJ H;  3F8C A;  3IWF A;  2VQG A;  2DK5 A;  2QF7 A;  1RKW A;  4IOC F;  5DM7 F;  3EET A;  3PM1 A;  2XGD A;  2DAO A;  3OIP A;  4XBF A;  5H2F C;  5KK1 A;  1D0Y A;  4RB0 A;  4BY7 J;  4G94 A;  4B47 A;  5D6E A;  4D0P A;  3KE2 A;  3F21 A;  4CGZ A;  3S15 J;  2GAU A;  1X2N A;  3F6V A;  3CC4 I;  2VQL A;  2X6X A;  4F92 B;  4I02 A;  3BQY A;  2HI3 A;  2ISZ A;  4HZF A;  1K83 J;  1OJL A;  2E2I J;  4F7Z A;  2DOE A;  4H4K C;  1NHA A;  3Q0U A;  1PDN C;  4FE7 A;  3L2R A;  1MNE A;  2VBY A;  4L5J A;  4CSW A;  1YS7 A;  3EDP A;  1HXD A;  2ZSI B;  3K4K A;  2PX9 A;  4LD5 A;  3KLO A;  4A0X A;  2JA5 J;  4M3F A;  3BZK A;  2AQF A;  1WSU A;  4OOI A;  5HLG A;  4A3I J;  3MEX A;  4HF1 A;  2L3D A;  3HOW J;  3W6J B;  1U8B A;  3SZT A;  1XSV A;  4HYE A;  2LTP A;  1XCV A;  2VI6 A;  1T38 A;  2FRH A;  4P1W A;  5JHU A;  1YRN B;  3KX2 A;  1L0O C;  5EG0 A;  3F0C A;  3J81 K;  2O7O A;  3LSI A;  3BTC A;  1DP3 A;  5ED4 A;  1R1U A;  2CMP A;  3M3Y J;  5J8C A;  4IQ4 A;  4XRS A;  1I1G A;  5AIQ A;  5D5U B;  4BGD A;  5ICE A;  4XLF A;  2E7W A;  4C2M J;  2HYG D;  2FBK A;  4CYC A;  3K70 D;  4LG3 A;  1WJ5 A;  1ZG5 A;  3TO7 A;  3RSN A;  3KP5 A;  5GPC A;  3WOD F;  1IV6 A;  1IRX A;  4WWC A;  2KIQ A;  3S2W A;  3HUG B;  1QPI A;  4MFD A;  4AVZ A;  3BWG A;  3ZQG A;  2COM A;  4Q48 A;  4A2U A;  3CCR I;  3FXL A;  3FWE A;  5C4X J;  4HX8 A;  3RZD J;  3RQ4 A;  1R7J A;  4JQF A;  1AWC A;  1XDU A;  5GAH J;  2PFB A;  3AG4 H;  3CME I;  1IJW C;  3F9K A;  3QPL A;  2IS6 A;  4XR6 A;  2MD0 A;  3MZ8 A;  4MNU A;  1A6I A;  2LKP A;  2Y0S N;  4IXA A;  3RQI A;  2IA1 A;  4F55 A;  2E1M B;  3S1M J;  5J1Y A;  2XAJ A;  2E1C A;  1NK3 P;  3DV8 A;  5J1U A;  1JUP A;  3WHB A;  5J4V A;  4PZJ A;  2CV1 A;  1APL C;  1S9H A;  3K1M A;  4NC7 A;  1H9G A;  3R61 A;  3KYD B;  1MD0 A;  1ERD A;  2IVM A;  3CUQ A;  1MMN A;  3G2B A;  3SJM A;  4EV0 A;  4A93 J;  1PP8 F;  1VZ0 A;  2JUC A;  4KMF A;  3ZPL A;  3BPV A;  3N05 A;  1BR2 A;  1FWZ A;  4WCG A;  2H1K A;  3J80 K;  2CW0 F;  4XOP A;  5FKL A;  4DZJ A;  1SD5 A;  1FYL A;  5JHF A;  2DFF A;  3P9I A;  1W36 D;  2OZU A;  2E60 A;  2KIM A;  2IW5 A;  2M7B A;  3BG5 A;  1RKT A;  3CLO A;  3IH2 A;  5FLX Z;  3FKJ A;  3F3X A;  3TW7 A;  4EGZ A;  2DFH A;  1IN5 A;  4ENK A;  4IRH A;  2B7E A;  5GPA A;  2WB1 A;  3ZQI A;  3B73 A;  1B8I B;  3EQL F;  3AL0 B;  3SEQ A;  3UNG C;  2BY0 A;  4DOZ A;  1R5G A;  3F22 A;  1R00 A;  1YJW I;  3K10 A;  4BBR J;  2BW3 A;  3DP7 A;  3LA7 A;  4XRM A;  3I3L A;  1GUU A;  5K1Y A;  3W2A A;  2K9S A;  2E19 A;  2EIM H;  1IG7 A;  4NHJ A;  1FT9 A;  3FXK A;  1VQO I;  4HX7 A;  1OCC H;  2FOW A;  3AKZ A;  2B0L A;  2VPR A;  4CYD A;  4EM2 A;  3S32 A;  3MKZ A;  2VJI A;  4HLY A;  3CCQ I;  1BC7 C;  1MGT A;  4KYW A;  1BM9 A;  3KPH A;  2KDZ A;  3GTO J;  4AIH A;  5DCM A;  2XB5 A;  3TKY A;  3JRD A;  2QSG X;  4NQW A;  2R7X A;  3ZXS A;  1UHS A;  3Q5F A;  5ICG A;  4AUX A;  1Y0N A;  1D0X A;  4KT6 A;  4ZJZ A;  4WK8 F;  1TNT A;  2ID3 A;  1J59 A;  1ZLJ A;  2EZH A;  4WXH A;  3OIQ A;  5DD4 A;  3SFI A;  3BG6 A;  1LJ9 A;  3MQ0 A;  1DUX C;  3RKX A;  2A6E F;  3FDY A;  1W5T A;  3GZN B;  2R5Y A;  3GW2 A;  2IGO A;  2XAH A;  2EFP A;  3LQQ A;  2KRC A;  5EEH A;  3RKQ A;  4EMS A;  2G9W A;  3RYR A;  3OS1 A;  1T95 A;  4J01 A;  4BKX A;  1WI9 A;  3PQJ A;  1V5E A;  2P5K A;  2BE5 F;  4AU7 A;  5CVR A;  1SFX A;  2JZY A;  2LD5 A;  1R1T A;  3CQZ J;  2OCE A;  3L2C A;  5IY5 H;  4D7N A;  1HKS A;  1HSJ A;  2N8G A;  5HS8 A;  5E3M A;  2QGU A;  1S8N A;  2IGM A;  2RQP A;  2XPV A;  2R7R A;  5E3L A;  4K2E A;  5F1R A;  2IRF G;  2FA5 A;  3HOS A;  2CH0 A;  2WA0 A;  1D3Y A;  1MMG A;  1BW6 A;  2XKP A;  2VE9 A;  2V4J C;  2K9M A;  1IXS B;  2M4G A;  3M8E A;  2BVL A;  3MZH A;  2F2E A;  3F23 A;  1ZR4 A;  3QU6 A;  5CJ9 A;  1G2H A;  5LBQ A;  4BQQ A;  1SD7 A;  4RGS A;  4X1E A;  1IUY A;  2GOX B;  4IHX A;  2EQR A;  1SFO J;  2HDC A;  4QIW N;  1MMS A;  5A2Q Z;  2DDB A;  4CXF A;  4OWR B;  5HS7 A;  3FXM A;  1VQ7 I;  2ZXI A;  4IHT A;  2WTE A;  2A05 A;  1ETK A;  1RI7 A;  2MA3 A;  3LNQ A;  3B6C A;  1LUJ B;  2K9Q A;  4II3 A;  1U6G A;  2VBX A;  1MSF C;  2V9K A;  1Y8R B;  4UB6 C;  1X1A A;  3I64 A;  1X3W B;  3T0Y A;  2OPT A;  2O8K A;  2K4J A;  2FD5 A;  3BR5 A;  2O8X A;  4RLQ A;  4UV8 A;  4DBR A;  3TO6 A;  2DPD A;  3PL8 A;  1RR8 C;  1EH8 A;  3GFJ A;  1X19 A;  2M2E A;  2RN7 A;  2Q2E A;  3M1E A;  3I55 I;  1JHF A;  3GEZ A;  2KPM A;  3R4K A;  2EH3 A;  4EM1 A;  1JKQ C;  5M3M J;  5K5R A;  1MBJ A;  2DQL A;  1HST A;  3H9J A;  2Y9Z A;  1Z0X A;  1B4A A;  2DA5 A;  2M0C A;  5IT9 Z;  4KMU X;  2QZ8 A;  3C2G A;  3KZZ A;  2Z2S B;  5FJ8 J;  5F27 A;  2WAF A;  1IV8 A;  1SD4 A;  5DV5 A;  3S16 J;  2QEN A;  4RM3 A;  4ZYA A;  4BXU A;  1F1Z A;  5J47 A;  2ZKZ A;  2YR2 A;  2HOA A;  1F43 A;  2K4B A;  4M3E A;  3DPL C;  4HSR A;  4BNC A;  1UHW A;  2IA0 A;  3TOB A;  4B4C A;  4A3F J;  3CJN A;  1MMA A;  2OAZ A;  1VF9 A;  2PEX A;  2VKV A;  4BU2 A;  1ZGA A;  1L3L A;  5L3F A;  1IO2 A;  2LG4 A;  3EUA A;  1NK2 P;  3CDI A;  3HGG A;  4UUV A;  2UXN A;  5K7F A;  3TP3 A;  4BJT A;  2DK8 A;  3HUG A;  1T6S A;  2KJB A;  1SFE A;  2OBP A;  4HQM A;  1Y0U A;  4C3H J;  1V4R A;  2CQK A;  2Y69 H;  3G1O A;  3CJR B;  1XD7 A;  4Y15 A;  4XLH A;  2DA1 A;  3O2P E;  4AM3 A;  4LFU A;  1AKH B;  5DS9 A;  4HG2 A;  4NUB A;  5ILS A;  4HOB A;  4ZZD A;  2YSR A;  1J09 A;  2BEO A;  1ORK A;  2X6O A;  5B5E C;  5BPI A;  2KP6 A;  2IS1 A;  3HSR A;  3QWL A;  4IOA F;  2X48 A;  5LGU A;  1Y39 A;  2VOP A;  1FOX A;  2CW8 A;  2M3A A;  1K6Y A;  2JK3 A;  3PNV A;  4P5O A;  4HDU A;  1FEX A;  4CIC A;  1IN6 A;  3QAH A;  4XLN F;  1OR7 C;  3S2H J;  3GFL A;  4ZDO A;  3CCJ I;  4I76 A;  2ZO4 A;  1YTY A;  2DOF A;  3QPH A;  1XSD A;  2E71 A;  1KU9 A;  3JTH A;  3FHN A;  1U5T A;  4WX9 A;  2HPM A;  3PJR A;  1RIO H;  3RCO A;  2XB0 X;  5IPA A;  1XPX A;  1B72 A;  2JA6 J;  4KIC A;  1IN4 A;  2EFN A;  5E1X A;  3I59 B;  4Q47 A;  1XSX A;  2L5Q A;  3K6G A;  3NEU A;  4HRI A;  2ZME B;  4KIF A;  5LGN A;  3SQN A;  1LPQ A;  1R23 A;  3K4B A;  1XS9 A;  2Y0S A;  2IP2 A;  4AVP A;  4D5C A;  2BY3 A;  1YOV B;  4MLO A;  1S7A A;  3LOC A;  1W7P A;  1UAA A;  2E1O A;  5FO5 A;  2GOM A;  1IAW A;  1WFX A;  3I56 I;  1SAU A;  1E3P A;  2ELJ A;  5ERI A;  4AIJ A;  2ZFU A;  5BNG A;  5EG0 B;  3ZQQ A;  3NAR A;  1FSE A;  1FY7 A;  3BDD A;  1QGP A;  5LGT A;  1ZAR A;  4UY8 I;  1SVL A;  5E3N A;  2JT1 A;  2VE8 A;  3L2W A;  3ABU A;  1BJZ A;  4YFN F;  1IRF A;  2DMP A;  2XKO A;  2W25 A;  4JK1 X;  5F0H A;  2DA3 A;  1B9M A;  2JPC A;  3ABM H;  3DXJ F;  3HSF A;  1V5G A;  2X1C A;  2WY8 Q;  1UST A;  4GGG A;  3HTU A;  2FJ1 A;  2L7Z A;  4JX4 A;  1XMX A;  4UVA A;  1X4P A;  3J81 Z;  2M8G X;  2L54 A;  5HDG A;  3GTJ J;  2BYV E;  4RLF A;  2BOL A;  2AS5 F;  1TNS A;  1W7P D;  2FML A;  2KRF A;  1FOW A;  2DT6 A;  4PSW A;  3CCU I;  2QYO A;  1Z91 A;  4KIG A;  3HJE A;  4MEX F;  1HW5 A;  1O4X A;  2B63 J;  3M9A A;  2UWM A;  2QSF X;  3CMY A;  3ELK A;  1TZL A;  5J6X A;  1S7O A;  5CVV A;  1QRY A;  2E36 A;  2MYS A;  1P6R A;  2EPF A;  3W2W A;  1HF0 A;  4NBQ A;  1XN7 A;  4QPQ A;  1STZ A;  1KU7 A;  3DEW A;  1F36 A;  3OIO A;  4D1Q A;  4Q5S F;  4E4H A;  1LKX A;  3BT9 A;  3Q3S A;  1VTN C;  1KU2 A;  2BZT A;  3LSP A;  1VQP I;  3V42 A;  4XOT A;  4JP0 A;  3D5L A;  1Z67 A;  2MH2 A;  1WQ2 A;  4OIO F;  4M3B A;  1C0W A;  1T0F C;  1YFH A;  2XRO A;  5E8I A;  5DYM A;  4IQJ A;  3S93 A;  2P81 A;  3DU5 A;  5CQE A;  1BI1 A;  1ITY A;  3ECH A;  1VQ6 I;  4C30 A;  3E5X A;  1JUS A;  3JRH A;  4EJO A;  2AXL A;  1W0T A;  2LK2 A;  3CO7 C;  3DKW A;  1SAX A;  4O5V A;  1TT5 B;  2VQH A;  1WJD A;  4XID A;  5JI6 A;  3ZN0 A;  2L01 A;  5CQG A;  4A3G J;  4XSZ F;  5L3C A;  1VI0 A;  1BC8 C;  1BBY A;  4A69 C;  1MNM C;  2DTZ A;  3KIO A;  4U0V A;  1VQM I;  4PCQ A;  2VON A;  2FU4 A;  2MH9 A;  3J7A O;  3RZO J;  4P96 A;  2VB6 A;  3AG3 H;  2NNN A;  2L9V A;  4GDF A;  1BIA A;  1OCT C;  2YPR A;  4UV9 A;  1K61 A;  2TDX A;  2DMN A;  1YIO A;  1R5I D;  1X1C A;  3J80 Z;  2Z1D A;  3PFY A;  1N77 A;  2KZV A;  4DQ2 A;  2ZJQ F;  2QQ8 A;  2H8R A;  3WGH A;  1P2F A;  2K40 A;  4B09 A;  2ZXH A;  2CUZ A;  3RKW A;  4EVI A;  4XKB A;  1SFU A;  2ESN A;  2RKH A;  3KCC A;  5ICF A;  2XAF A;  1GVJ A;  4C2T A;  4BHC A;  3F8N A;  1RET A;  1MBE A;  2BY1 A;  4PJL A;  2NVQ J;  2MC3 A;  1USS A;  3SHF A;  4H0E A;  4JYK A;  2IEK A;  3I9V 2;  3AG1 H;  3GFI A;  3FZV A;  2LRD A;  2HVS A;  1XGN A;  2HXI A;  5L3G A;  3ULQ B;  1V55 H;  2K3F A;  4E7I A;  3HOY J;  2VJ4 A;  4EEF G;  2BBY A;  2G0E A;  4G7O F;  2UV1 A;  2OZ6 A;  2HYF A;  3BR6 A;  3WU0 A;  2BGC A;  3OYM A;  3WTW C;  4UVC A;  4Y3O A;  3QOP A;  3FHZ A;  4B48 A;  2R5Y B;  2V9V A;  3X2Q H;  4LG0 A;  4L0Y B;  2M45 A;  3HOX J;  1ZAO A;  3OR1 C;  3BQZ A;  2E1M C;  3IKT A;  5D4R A;  1OYW A;  2QLZ A;  1IRZ A;  4YG2 F;  3KEQ A;  4RB2 C;  2ELH A;  1BW5 A;  3JCU C;  3WHC A;  3DFG A;  1TWG J;  2P8T A;  1X1D A;  3HKZ A;  2XAU A;  3NQO A;  2KMU A;  3FM3 A;  2XGX A;  5M5X J;  1WRJ A;  1TLH B;  2DA6 A;  3L00 A;  1DDN A;  2KFD A;  1SEU A;  4RDU A;  3FIS A;  1MW7 A;  3TOA A;  1RUN A;  4BEH B;  2QM3 A;  4MEY F;  4B44 A;  2CGP A;  3K69 A;  4ZYE A;  4BS9 A;  1AKH A;  3KP7 A;  2A3S A;  2DPU A;  4OAY A;  1IW7 F;  3T5X A;  2DA4 A;  4PJJ A;  4UUS A;  4XLC A;  4CCM A;  3KLN A;  4RBO A;  1ZGJ A;  4QTR A;  1D5Y A;  2R92 J;  3LL7 A;  1YIT I;  4XSX F;  1P4X A;  3LA2 A;  2A68 F;  1IN8 A;  4G9Y A;  2HVR A;  1Z6R A;  5F64 A;  3DPT A;  4E7K A;  2XVC A;  3OOU A;  3PFI A;  1VQL I;  1O3R A;  4BY1 J;  2LKX A;  3JRE A;  3HDD A;  4L9V A;  2D1H A;  2Q0O A;  3W3C A;  4CA0 A;  2DI3 A;  1UMQ A;  1O57 A;  5CLS A;  3PNT A;  1YX3 A;  3E7L A;  1TWH J;  1WH7 A;  1JGG A;  3QP6 A;  1JGS A;  1LVK A;  4E7S A;  2FNP A;  3TDZ C;  4IZZ A;  2JRT A;  3I59 A;  5GTH C;  1VQ4 I;  3CCL I;  3ML6 A;  4FAS D;  2ZME A;  3CJQ B;  2R4G A;  4QWQ A;  2Q2E B;  4BH9 A;  2QKM B;  2MSY A;  5EJC A;  1TC3 C;  1DPU A;  2ZB9 A;  2W4S A;  3S1N J;  1I3Q J;  3GCM A;  3FM5 A;  4M74 A;  3ZRG A;  2CSO A;  2VJJ A;  4A0Z A;  1IXC A;  1X3Z B;  3BCA A;  3FBN B;  4HW0 A;  2WAD A;  2ICW G;  1BI3 A;  1FZP B;  2BY2 A;  2LY2 A;  2XAG A;  4ZZL A;  3JR9 A;  3R60 A;  4HF2 A;  4YIR X;  2LOO A;  2K85 A;  4MHG A;  3WU2 C;  3OYJ A;  2XC7 A;  5LD2 C;  5BQT A;  1YX5 A;  2KL4 A;  2BHZ A;  3ZMV A;  4UNO A;  4CCK A;  3CES A;  1R4N B;  4Y13 A;  4LK0 F;  4M73 A;  3G6E I;  1SVM A;  1Z3X A;  1R5H A;  1ONV A;  3U2R A;  2LF8 A;  1XX5 A;  5L3D A;  3ZGK A;  2QKL B;  2G7U A;  1PUF A;  4RMN A;  4KA4 A;  1J75 A;  3WTV C;  4ENJ A;  2VC0 A;  4PFO A;  3K9T A;  3ZQH A;  1K78 B;  4PGH A;  2KIS A;  1UZC A;  2B9S A;  3MFK A;  1K4S A;  4DIQ A;  1H89 C;  1TQP A;  3GWZ A;  3WTX C;  3ZN1 A;  4KDP A;  4EJT A;  2L9S A;  2E1N A;  2ESH A;  2QQA A;  5H6R A;  5HOD A;  2W7N A;  1UFM A;  3LSM A;  2DJN A;  4N4N B;  4RAY A;  2P6S A;  3E1S A;  1FMW A;  1W0U A;  4DBQ A;  1KQ0 A;  1WJB A;  1ETQ A;  3CF5 F;  1Y1W J;  3K7A J;  3AFH A;  5CYV A;  4CCN A;  1VQ8 I;  2HZT A;  1RPW A;  2CV0 A;  2J5P A;  2O0Y A;  2ZJP F;  3B6A A;  3MKY B;  2DU9 A;  1F9N A;  1I27 A;  2VBZ A;  1QO0 D;  1BN5 A;  4LGW A;  2RGV A;  3S3M A;  5KAF C;  4O6J A;  5ICC A;  2KJC A;  3S14 J;  2HOT A;  1Z77 A;  4MGR A;  2HDW A;  5FFZ A;  2GIZ A;  2VPL A;  2RVC A;  1I39 A;  4IX7 A;  3E6B A;  2XHK A;  5E1W A;  5HLI A;  1U5T B;  2YX4 A;  4HNV A;  1G59 A;  3GVA A;  4I99 C;  4PJN A;  2AQE A;  1B72 B;  1ZKG A;  3O8H A;  3BOQ A;  3HRM A;  2I5U A;  4TV7 A;  5CPR B;  4C3J J;  1HW1 A;  2HNH A;  5B1B H;  4C3I J;  3WTY C;  4ZTF A;  4GXO A;  1W7P B;  3C2B A;  3VEP A;  2H1L A;  2L7K A;  4UUT A;  1BR4 A;  2FXA A;  2VN2 A;  2QQB A;  2A5W A;  2L9N A;  1ETV A;  2VIX A;  3ZQF A;  3IL2 A;  3AAF A;  1H88 C;  2KZG A;  3V8K A;  2EBI A;  2WAQ A;  5BS6 A;  2DN0 A;  5AIP A;  5HVQ C;  4J00 A;  3S1Q J;  3EYI A;  3HC7 A;  1MBK A;  2A61 A;  2K27 A;  1OCP A;  2DMT A;  4XON A;  1MZB A;  3A4C A;  3H36 A;  2WWY A;  3Q9S A;  2GIV A;  3BPX A;  3CCY A;  4CHU A;  1QZY A;  3VOE A;  3GF2 A;  4EJV A;  5M5Y J;  1ETW A;  1VND A;  2IAI A;  4N9I A;  3DBH B;  1YO5 C;  4DYR A;  3CZ6 A;  2PMH A;  2PG4 A;  4EAT A;  3K4M A;  1U8R A;  1ZG3 A;  2FF4 A;  2TCT A;  1J2X A;  2NS7 A;  3ABL H;  4DW6 A;  4V19 K;  4A3B J;  3SZG A;  4ZYG A;  2HPI A;  3K4J A;  1QHG A;  2NVY J;  3SYT A;  4BE0 A;  4G6Q A;  1ENH A;  2GBY A;  4ZYH A;  4D7M A;  3R6S A;  3E97 A;  5J8F A;  5EDN A;  5FRN A;  3O3K A;  4FT8 A;  4IEJ A;  3E3V A;  4BJ6 C;  1JE8 A;  3OYE A;  5L3B A;  1BOA A;  2XGE A;  4ASN A;  2L2O A;  1IXR C;  3HHG A;  3FX3 A;  5F04 A;  4X0G A;  2F48 A;  2E5Z A;  3G1L A;  2X4H A;  1J5Y A;  1ON1 A;  4HAM A;  4M6Y A;  4L0Z B;  2MLG A;  3K0L A;  2JVG A;  3KP4 A;  2DLL A;  1KON A;  1WJA A;  4KNY A;  4ESF A;  2QA4 I;  2VBW A;  1M1E B;  2CU7 A;  2H6C A;  1LFP A;  3CF2 A;  4EGY A;  2NOJ B;  3PNY A;  3G4S I;  1PJR A;  3U21 A;  5JFR A;  3E6C C;  3K70 C;  3GZ6 A;  5C4J J;  3I58 A;  3CO6 C;  3MN2 A;  1R1V A;  3FXQ A;  1B6A A;  5FKN A;  4BEH A;  1FMV A;  1W5S A;  2L7M P;  4GYI A;  1BL0 A;  4P9F A;  4JX6 A;  1BOB A;  4CUG A;  2XRL A;  1DU0 A;  2E7X A;  5ILV A;  2LDU A;  1QNT A;  2P5V A;  1H9T A;  4R79 A;  1Z1D A;  2NVT J;  4A3K J;  3C2H A;  5EGO B;  2ECC A;  3QPS A;  5FKM A;  1JXS A;  3BR0 A;  1K4T A; 
#chains in the Genus database with same CATH homology
 2I10 A;  3MKL A;  3LOC A;  4IHW A;  3H3V K;  3JRB A;  4D5F A;  2E1O A;  2XGC A;  2CQX A;  1A5J A;  2O9L A;  3JRC A;  2LR8 A;  1ZR2 A;  3HM5 A;  5BNG A;  5EG0 B;  2QCO A;  3NAR A;  1WGX A;  1MBF A;  1RR7 A;  3TW6 A;  3LSJ A;  5E3N A;  2LP0 A;  5K7Z A;  1X58 A;  3JRA A;  1BJZ A;  2DMP A;  3D1N I;  1NTC A;  1I50 J;  2FX0 A;  5F0H A;  2CUF A;  2DA3 A;  2M34 A;  1OFC X;  2ECB A;  2W48 A;  3FIW A;  2X9D A;  4IHY A;  2FJ1 A;  2L7Z A;  4JX4 A;  1TWA J;  5JLX A;  1TWC J;  5FKK A;  5C44 J;  5C3E J;  3GTP J;  4M6V A;  4A3D J;  1BA5 A;  2M8G X;  1RES A;  1ZK8 A;  2CJJ A;  3GTJ J;  4JX5 A;  5IP6 A;  3L1P A;  1MBH A;  1XC5 A;  3K2A A;  1MSE C;  2L9R A;  2ME0 A;  2M9H A;  2MW8 A;  1Q1V A;  5K7H A;  2LY9 A;  3HKZ N;  2ELK A;  2JJ7 A;  2JN6 A;  5EEA A;  5M5W J;  3OSF A;  3CDL A;  1O4X A;  1JUM A;  2B63 J;  1FIA A;  3CMY A;  3DCF A;  1QRY A;  2R93 J;  4L5E A;  4S0H B;  1U9O A;  3BTI A;  1HF0 A;  2WV1 A;  3TP0 A;  3DEW A;  1F36 A;  3PO2 J;  3OIO A;  3BR3 A;  1CQT A;  4A3C J;  3A03 A;  3VPR A;  3ZQL A;  2QF7 A;  1RKW A;  3BT9 A;  3Q3S A;  3PM1 A;  2XGD A;  5IYB J;  1JT6 A;  1TWF J;  1T33 A;  3LSP A;  4BY7 J;  3SDG A;  2K9N A;  3HBL A;  4JP0 A;  1XG1 A;  3S15 J;  4M3B A;  4GFB A;  1X2N A;  2HXO A;  1LFB A;  2P81 A;  1ITY A;  3BQY A;  2HI3 A;  1JUS A;  3JRH A;  1K83 J;  1OJL A;  2E2H J;  4A3M J;  2E2I J;  1W0T A;  2LK2 A;  4QSH A;  3Q0U A;  1JJ8 C;  1GT0 C;  3TED A;  3I4N J;  2Y31 A;  4XID A;  1LE8 A;  4FE7 A;  2DA7 A;  4XRS G;  4A3G J;  1VI0 A;  5F0F A;  2Y9Y A;  4A69 C;  2AHQ A;  4UUS B;  3HGY A;  1MNM C;  1I6H J;  2DTZ A;  3JRG A;  2JA5 J;  4M3F A;  2FQ4 A;  2EZI A;  4A3I J;  3RZO J;  4FE4 A;  1JJ6 C;  3HOW J;  1U8B A;  4B1R A;  5IP7 J;  2AO9 A;  1SAN A;  5IYC J;  2LTP A;  3NAU A;  2VI6 A;  2XPW A;  1OCT C;  4M3D A;  5J1R A;  1YRN B;  5EG0 A;  1K61 A;  3IH4 A;  3F0C A;  2O7O A;  2DMN A;  3ZQC A;  3BTC A;  3GTG J;  5IOY A;  5IOZ A;  3M3Y J;  4J19 A;  3A01 B;  4XRS A;  1JKO C;  1MH3 A;  2H8R A;  2VUM J;  5J3L A;  4C2M J;  2K40 A;  4V2G A;  2JA8 J;  4CYC A;  2JWT A;  4DYQ A;  3BTL A;  1RET A;  1MBE A;  5GPC A;  2NVQ J;  4G12 A;  1IV6 A;  4JYK A;  2IEK A;  1WPK A;  1QPI A;  1POG A;  4MFD A;  1QVT A;  2HXI A;  3A02 A;  3HOY J;  3ZQG A;  3HB9 A;  1ZTR A;  2R0Q C;  2MGQ A;  4EEF G;  2G0E A;  3LSG A;  5C4X J;  3BR6 A;  3RZD J;  3FK7 A;  2XSD C;  2NVX J;  3S17 J;  4IHV A;  1AU7 A;  2R5Y B;  1IJW C;  1T56 A;  2R7Z J;  3QPL A;  3HOX J;  3S2D J;  3BR2 A;  3BQZ A;  3RQI A;  1A6I A;  2Y0S N;  3S1M J;  4XK4 A;  5J1Y A;  1IRZ A;  3S1R J;  1VFC A;  1PUF B;  3JRF A;  1BW5 A;  3G1M A;  4FIS A;  1NK3 P;  3GTM J;  2DMQ A;  5J1U A;  1JUP A;  3WHB A;  3WHC A;  4ABZ A;  1TWG J;  1APL C;  5IP9 J;  1WI3 A;  5M5X J;  1X2M A;  2DA6 A;  5FKO A;  4DZP A;  2D5V A;  4RDU A;  3FIS A;  2L7F P;  2PMZ N;  4LOC A;  3SJM A;  4A93 J;  1AKH A;  4W1U A;  2H1K A;  3HEF A;  1U78 A;  2DA4 A;  5FKL A;  4DZJ A;  4DYC A;  4UUS A;  3OSG A;  4RBO A;  1D5Y A;  4QTR A;  2L0K A;  2R92 J;  9ANT A;  4MFE A;  3Q0W A;  1P7I A;  1JKP C;  1QVU A;  3BG5 A;  1RKT A;  3IH2 A;  3TW7 A;  5E3O A;  1U9N A;  2VKE A;  2YUS A;  3OOU A;  4B3A A;  5GPA A;  1YRN A;  4BY1 J;  2LKX A;  3JRE A;  4MIM A;  3ZQI A;  1B8I B;  3HDD A;  4Y52 J;  3I4M J;  5M3F J;  1UMQ A;  3IH3 A;  2DMU A;  2CUE A;  1MH4 A;  3FK6 A;  3E7L A;  1TWH J;  1WH7 A;  1JGG A;  4BBR J;  2WAQ N;  2EZK A;  1WH5 A;  4XRM A;  1GUU A;  2K9S A;  2DA2 A;  3BG3 A;  2E19 A;  1IG7 A;  1WCM J;  2VPR A;  1FJL A;  2MSY A;  5EGO A;  1TC3 C;  2ZB9 A;  1ZQ3 P;  1UG2 A;  2NS8 A;  2KDZ A;  3GTO J;  3S1N J;  1I3Q J;  1JTY A;  2XB5 A;  2IBD A;  3JRD A;  1UHS A;  3QQA A;  4AUX A;  2ID3 A;  3JR9 A;  1DU6 A;  2EZH A;  3H0G J;  1LFU P;  3SFI A;  1IUF A;  4I6Z A;  2R5Y A;  2LLK A;  4FCY A;  2MG4 A;  3RKQ A;  5EF6 A;  2R5Z B;  2NOG A;  1ETY A;  4BKX A;  2LD5 A;  1PUF A;  3CQZ J;  4D7N A;  3ZQH A;  2Y30 A;  2N8G A;  1HOM A;  5E3M A;  2XPV A;  1H89 C;  5E3L A;  1HCR A;  1GDT A;  5F1J A;  2YS9 A;  5HOD A;  1JKR C;  3HOV J;  2DJN A;  3GBG A;  1E3O C;  1IGN A;  1BW6 A;  1W0U A;  1HLV A;  5JLW A;  1ETQ A;  1ZR4 A;  1Y1W J;  3K7A J;  2TRT A;  3GTK J;  1EF4 A;  1G2H A;  1RPW A;  3B6A A;  4X1E A;  4IHX A;  2EQR A;  2YU9 J;  1SFO J;  4QIW N;  3S14 J;  2HOT A;  1Z77 A;  2COB A;  2LFB A;  4Y7N J;  3ZOB A;  5FLM J;  4A3E J;  2OF7 A;  1GVD A;  1FTT A;  1ETK A;  5IYD J;  3LNQ A;  1B8I A;  2LVS A;  3B6C A;  3FKI J;  2K9Q A;  1MSF C;  3W6V A;  4HNV A;  1ETO A;  2HYJ A;  4M3G A;  2OPT A;  1B72 B;  1ZKG A;  3O8H A;  4CYC B;  3GTQ J;  1AHD P;  2O8K A;  3BR5 A;  2FD5 A;  5GP9 A;  2HQ5 A;  4C3J J;  2M2E A;  1ETX A;  2GLO A;  4C3I J;  2EZL A;  4XIC A;  2ME6 A;  3LSR A;  2EH3 A;  1JKQ C;  5M3M J;  1MBJ A;  1R9T J;  1FTZ A;  3C2B A;  2Y9Z A;  4BXX J;  1Z0X A;  1JT0 A;  2GM4 A;  2DA5 A;  4UUT A;  2M0C A;  1ETV A;  3ZQF A;  1IDY A;  3O8G A;  1H88 C;  5F0C A;  5FJ8 J;  2CQQ A;  2KT0 A;  5F27 A;  2EBI A;  4FTH A;  3Q0V A;  2ID6 A;  3GTL J;  3BR1 A;  3S16 J;  2RAE A;  4A3J J;  2DN0 A;  2JA7 J;  3S1Q J;  3A01 A;  2HOA A;  1MBK A;  1FIP A;  3MVP A;  4M3E A;  1F43 A;  1OCP A;  2DMT A;  2R5Z A;  3UKG A;  3CCY A;  4B4C A;  4V2F A;  4A3F J;  1VF9 A;  1JTX A;  2VKV A;  3HOZ J;  5M5Y J;  1ETW A;  3HGG A;  5EYR A;  1NK2 P;  1VND A;  2IAI A;  1MBG A;  5K7F A;  5EZG A;  3TP3 A;  4DYR A;  2XPU A;  2HOS A;  3IV5 A;  2JMW A;  3JRI A;  4A3L J;  4C3H J;  2TCT A;  2CRG A;  2NS7 A;  2WB1 N;  4DW6 A;  4A3B J;  3G1O A;  2E2J J;  1GV2 A;  2NVY J;  2Y2Z A;  2DA1 A;  1IDZ A;  1ENH A;  2GBY A;  4D7M A;  1AKH B;  5DS9 A;  3HOU J;  5EDN A;  3PO3 J;  4AYB N;  4IEJ A;  1ORK A;  4BBS J;  2X6O A;  1P7J A;  2XGE A;  1S7E A;  4NDL A;  5F04 A;  2X48 A;  3G1L A;  1H8A C;  4W97 A;  2JK3 A;  1FEX A;  1IC8 A;  3S2H J;  4I76 A;  5EZH A;  2CU7 A;  3M4O J;  4X6A J;  4MO7 A;  4AC0 A;  3BTJ A;  5C4J J;  2XB0 X;  3MN2 A;  3BG9 A;  5FKN A;  5IPA A;  1B72 A;  1HDD C;  2L7M P;  1BL0 A;  2JA6 J;  4JX6 A;  1LE8 B;  1ZGW A;  2XRL A;  1DU0 A;  1Y1V J;  1GV5 A;  2HDD A;  2NVT J;  4A3K J;  5DTD A;  1HDP A;  1XS9 A;  5EGO B;  5F08 A;  2ECC A;  3QPS A;  5FKM A;  3BR0 A;  4D5C A;  5FLV A;  4MLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...