4X6AJ

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4x6aJ00
1H89C 1IJWC 3DCFA 3ZQFA 2Y30A 4MFEA 4M3GA 4QIWN 1ORKA 1Q1VA 3MKLA 1VF9A 2CUFA 3FIWA 2JA6J 2XPVA 4M3BA 1EF4A 3S2HJ 3JRFA 3HOUJ 4W1UA 1U8BA 1W0TA 2ZB9A 2TCTA 2WV1A 3WHBA 3H0GJ 5GP9A 1BW5A 4FE7A 2WAQN 1HOMA 3FISA 3ZQCA 2LTPA 3MVPA 1RESA 3A03A 1MNMC 2ECCA 3LOCA 5E3OA 4JX5A 4Y7NJ 1I50J 4A3EJ 2R5YB 5IP7J 3W6VA 3JRHA 4A69C 3BR0A 1Y1VJ 3GTQJ 2EZLA 2VUMJ 1GUUA 2DN0A 1A6IA 3TW7A 1BL0A 1OCTC 5E3LA 2DMPA 5FLVA 4A3LJ 3BQYA 4I6ZA 1SFOJ 2H8RA 2L0KA 3A01B 4RBOA 4W97A 3B6AA 5F27A 4FISA 3BG3A 1MBFA 2HXOA 3TW6A 5E3MA 1JUMA 2X9DA 1IRZA 3C2BA 1TC3C 1IV6A 3S16J 1CQTA 1AKHB 4A93J 3E7LA 4G12A 5M5XJ 1WH5A 2YUSA 2XB0X 1WI3A 4A3JJ 5C4XJ 2Y2ZA 3BR1A 4BXXJ 2GBYA 3GTLJ 2HYJA 2HI3A 1GV5A 2DMUA 1OCPA 3JRAA 2NVYJ 3IH2A 2XSDC 3S15J 1WPKA 4V2FA 1TWGJ 1AKHA 1QPIA 5F0FA 2YS9A 1XS9A 2LVSA 2GM4A 3S1QJ 3K2AA 1ITYA 2L9RA 1FTTA 1JT6A 2KDZA 4A3CJ 1O4XA 2HXIA 1ZK8A 4MLOA 1H88C 3S2DJ 2FD5A 2YU9J 4IHVA 3IV5A 2E1OA 3HOVJ 3CQZJ 3HOXJ 3BR3A 1NK3P 1LFUP 3M3YJ 1ETYA 4J19A 5EZHA 1I6HJ 2KT0A 9ANTA 3RZOJ 2R92J 1MH3A 5EDNA 2M9HA 2LFBA 3HDDA 4D7NA 2JA7J 1RKTA 2EQRA 4C3JJ 3PO3J 2CU7A 1BJZA 5J3LA 2ME6A 1IC8A 2DJNA 4UUTA 3GTKJ 3BTIA 1JKQC 2L7MP 1IG7A 1HF0A 1JTYA 3OIOA 1FJLA 2R5ZB 5IOZA 1U78A 3S14J 3QQAA 3ZQHA 2DMNA 2E2IJ 1GVDA 2RAEA 3CMYA 1XC5A 3OOUA 2NVQJ 3I4MJ 3BTLA 4I76A 4NDLA 3GBGA 4HNVA 5GPCA 1WCMJ 1U9NA 2ID3A 2Y9ZA 1ZR2A 1ENHA 2EZIA 3HM5A 2XB5A 2K40A 1B72B 2HOTA 2VKEA 2DA7A 1F36A 4XIDA 2M8GX 3JRCA 1FTZA 1X2MA 3HGGA 3CDLA 1FIPA 3GTJJ 5F08A 4X6AJ 4JX4A 1MBKA 3JRBA 2QF7A 1RPWA 1SANA 5FKOA 4A3MJ 3A02A 4A3GJ 1QVUA 3LSRA 4BBRJ 1RKWA 2DA6A 3BG9A 2NOGA 5J1YA 4FE4A 1B72A 1ZQ3P 2XPWA 1G2HA 2CQXA 3ZQIA 3VPRA 1ETXA 2K9NA 2JWTA 5HODA 1HLVA 3HGYA 3BR5A 3PM1A 3ZOBA 3G1MA 3O8HA 4QTRA 1IUFA 5M5YJ 5C3EJ 3JREA 1UHSA 3TP0A 2R5YA 4M6VA 1ZTRA 1XG1A 5EZGA 4CYCB 2E2JJ 2PMZN 2EZKA 5K7FA 4M3FA 2Y9YA 4IHXA 2HOSA 1IDZA 3LNQA 2E2HJ 2XRLA 2R0QC 1JUSA 3BTJA 5F0CA 1JKOC 4IEJA 2MW8A 4B4CA 3D1NI 4DYRA 4A3DJ 4RDUA 3A01A 2JA5J 1P7IA 2JJ7A 2JN6A 3ZQGA 1P7JA 3CCYA 4XRSG 2NVTJ 4CYCA 1ETOA 3TP3A 2Y31A 5J1RA 4DYQA 1MBGA 3BR2A 2O9LA 1ZGWA 4C3IJ 5F0HA 3S1RJ 2DA5A 5IYDJ 2IEKA 4JYKA 2L7ZA 1TWFJ 3UKGA 1MBJA 2OF7A 1Z0XA 2DA3A 3JRIA 4A3IJ 2NS8A 3FKIJ 2Y0SN 1GV2A 3RZDJ 1DU0A 5IYBJ 3JRGA 3GTMJ 3BT9A 5FKMA 2AO9A 2R7ZJ 4AUXA 3RKQA 1I3QJ 5EEAA 2IAIA 5IP9J 5E3NA 1K83J 1MSEC 2DA4A 1OJLA 4D5CA 3BTCA 1OFCX 2R93J 3OSGA 1ZKGA 2O7OA 1T33A 2QCOA 4A3KJ 2CQQA 1BA5A 4ABZA 5FLMJ 5FKLA 5EG0B 2FJ1A 5BNGA 4XRMA 4V2GA 5DTDA 2O8KA 5DS9A 1RETA 5GPAA 1RR7A 1R9TJ 1JT0A 3NAUA 1B8IB 2VKVA 3FK7A 5K7ZA 3DEWA 1JJ8C 5M5WJ 2CUEA 1IDYA 5M3FJ 1QVTA 5M3MJ 4C2MJ 4BBSJ 2HQ5A 1D5YA 1HDDC 5EG0A 1FIAA 1LFBA 2DMTA 5J1UA 1H8AC 3B6CA 4D7MA 2IBDA 3MN2A 2JMWA 1VNDA 2DA1A 1ETWA 1ETQA 1NTCA 1B8IA 1VI0A 1TWCJ 4M3DA 5EGOB 2GLOA 2ECBA 1A5JA 2NS7A 5K7HA 2JA8J 5FJ8J 4A3FJ 1LE8B 2FX0A 1APLC 3I4NJ 1Z77A 2R5ZA 4M3EA 1JKPC 1QRYA 2VPRA 3ZQLA 5FKNA 2LD5A 5EGOA 1IGNA 1TWHJ 2ELKA 2MG4A 4L5EA 1DU6A 3JRDA 3LSGA 3H3VK 1MBHA 1LE8A 2TRTA 2HDDA 3TEDA 3PO2J 1ETVA 2LLKA 4X1EA 2XPUA 3SFIA 3GTPJ 2N8GA 4MFDA 1MSFC 4AYBN 2B63J 5IP6A 1JKRC 4IHYA 4MIMA 3JR9A 3OSFA 1T56A 2K9SA 4EEFG 4BY1J 2VI6A 4DW6A 3HOYJ 1X2NA 3RQIA 5EYRA 2X6OA 4JP0A 2M2EA 2XGEA 2COBA 4C3HJ 2D5VA 4D5FA 1S7EA 3K7AJ 3G1OA 4B1RA 2P81A 3LSJA 4JX6A 4BY7J 2LR8A 1UG2A 3O8GA 4AC0A 1AU7A 5F1JA 1X58A 5C44J 3HOWJ 4QSHA 1E3OC 4BKXA 2K9QA 2OPTA 3BQZA 2WB1N 5F04A 3S1MJ 3HB9A 2DMQA 4S0HB 1WH7A 2XGDA 2CRGA 2W48A 3HBLA 2DTZA 1GDTA 1UMQA 4Y52J 1JJ6C 4UUSB 5JLWA 4FCYA 3IH3A 3BR6A 3GTOJ 1JUPA 1AHDP 2E19A 4MO7A 3SJMA 3Q0VA 3SDGA 2JK3A 3HOZJ 4XRSA 1K61A 2ME0A 3G1LA 3Q0WA 5FKKA 5EF6A 3HKZN 4UUSA 3S17J 2X48A 2G0EA 2LK2A 3BG5A 1HDPA 4DYCA 2AHQA 4FTHA 2FQ4A 3M4OJ 1TWAJ 1HCRA 2M0CA 1ZR4A 1NK2P 3F0CA 4XICA 2EH3A 4LOCA 2LP0A 1POGA 1ETKA 1PUFB 2M34A 3LSPA 1JTXA 2I10A 2EBIA 3QPSA 4A3BJ 2LY9A 2EZHA 1JGGA 5IOYA 1U9OA 3QPLA 2H1KA 1YRNB 4GFBA 4IHWA 3GTGJ 5JLXA 1PUFA 1VFCA 5C4JJ 2CJJA 5IPAA 3NARA 2MGQA 1BW6A 2MSYA 1Y1WJ 2LKXA 2HOAA 4DZJA 5IYCJ 1F43A 4DZPA 4B3AA 3HEFA 3L1PA 1GT0C 1WGXA 1YRNA 4XK4A 3Q3SA 1MH4A 2XGCA 2ID6A 3S1NJ 2DA2A 3FK6A 1FEXA 1MBEA 2NVXJ 2L7FP 3WHCA 3IH4A 3Q0UA 1W0UA
chains in the Genus database with same CATH superfamily
5ERIA 3FWEA 2JRTA 2Y30A 5BMZA 3R60A 2LBFA 3W6KB 1VF9A 4IZZA 2L9SA 5E18F 3PNVA 3HIFA 3CJRB 3TBIA 4XLFA 2F4IA 3R61A 4O3MA 2KP6A 1S5LC 1LEAA 2VOOA 4LFUA 2L5QA 4II3A 3I5UA 1W0TA 2JVHA 4L18B 3CDHA 4Y13A 5IY5H 2NAZA 1ZARA 3RDIA 1TQMA 3W3CA 4PFOA 4FE7A 1Z9CA 3FISA 5LBQA 3ZQCA 5HDKA 2P7CB 4NHJA 2ISZA 3A03A 1MNMC 2ECCA 3LOCA 3VYRB 4Y7NJ 5LGUA 2R5YB 3ZN0A 5B1AH 2A6HF 3K4CA 1MDMB 4HLXA 3BR0A 2M30A 4U0YA 3L2CA 3H5AA 1BL0A 5E3LA 2DMPA 1OLTA 3L2WA 2VE9A 5FLVA 3V7RA 3MKYB 4PJ0C 4I02A 1HKQA 3OYDA 2J5PA 4RBOA 2DFEA 2BZTA 2BOLA 3OYMA 1W1WE 3B6AA 4XRFA 3TQNA 4HQEA 2KPMA 3HTSB 1I27A 1UB9A 1IN6A 3N97A 2HU9A 3C2BA 1D3YA 4MTDA 1FOYA 2VQCA 3F23A 2GXGA 1CQTA 1AKHB 4A93J 1DP7P 5H20A 1TW2A 1SAXA 5M5XJ 1WH5A 3F21A 2YUSA 2XB0X 1WI3A 1NH3A 3C7JA 3K6GA 5L3EA 4A3JJ 1ZG5A 2Y2ZA 4BXXJ 2GIVA 3DV8A 1BR4A 4UVAA 1D1BA 4NC7A 2R7WA 1OYIA 1OCPA 3JRAA 1XN7A 5FLXK 2NVYJ 2XSDC 2I8DA 1U5TA 1HSJA 2F48A 3MD2A 2LVSA 2VQHA 2W82A 4IX7A 2K7LA 5FO5A 2VKDA 2XASA 4BAYA 2HXIA 1PJRA 4MLOA 2UXXA 3EYYA 3BWGA 1BI1A 1T98A 4A0XA 5KHDA 1H88C 3PUBA 3S8PA 4G94A 3TOBA 5HDNA 3V42A 3KYLA 2FD5A 1Z91A 2IA1A 3WE2A 3RKWA 2E36A 3H1CA 2VL8A 3H35A 4D9JA 5J4VA 3HOXJ 4K2EA 1SFXA 4RAYA 1VQLI 3QRFF 3ASOH 2PG4A 1ETYA 5K5QA 4FASD 1FOKA 1ZAOA 2IW5A 3CCMI 3KYCB 2VODA 3OS1A 2CFOA 2KT0A 3CMEI 1Y39A 2BE5F 1XTAA 3RZOJ 3FZVA 2ESHA 2R4GA 5CQGA 3WTVC 2Z3YA 1J9IA 3J7AY 3DXJF 3CC4I 2LFBA 2OAZA 4D7NA 5LFAA 1PP7U 5L3BA 5HDGA 2RQPA 1A36A 2EQRA 5J8FA 4R8HA 1U8RA 3L09A 3DU6A 4BQQA 2QBYA 3ZPLA 2CU7A 3FBIB 5D8LB 3BZCA 1IC8A 1ZRCA 3S2WA 2Y48A 2DJNA 1C0WA 4G6DA 3BTIA 4D0PA 2WTEA 1IG7A 2NVUB 4FX0A 3DFGA 4KNYA 4I09A 1HXDA 1KONA 5IOZA 3HXLA 1EH7A 4P1WA 4CXFA 3S14J 2A61A 1AA7A 2NVQJ 2Y75A 4JK1X 3F22A 4KN7X 2HFHA 4NQWB 3I3LA 2A6EF 3T0YA 2MYSA 1Z1DA 2DYSH 2ID3A 1ZR2A 5TISC 1EA3A 1ENHA 1QO0D 2QVOA 2Y9ZA 2E34A 5LHIA 4ON0A 1PUEE 2HOTA 2VJ5A 3G71I 2ZCWA 3TO7A 3JAMZ 4B09A 3FHNA 2YX4A 1MJBA 2F4MB 1T2KA 4M9SA 4LGWA 5B5EC 2P5KA 4F93B 3E6DA 5KCMA 1BR1A 1V5FA 3LWFA 4HX7A 3OYIA 3CUQC 3ZMVA 2A68F 4BEHB 3AAFA 3IWZA 2Z2SB 2VBYA 3DBRB 1ZYRF 3U21A 2ZFWA 1HLVA 3LA2A 3BR5A 2QQ9A 1OQYA 2HKXA 3H3UA 3O8HA 4Q5SF 3P9KA 2K3PA 2UV1A 5M5YJ 4RAFA 1LDDA 1XSXA 4CYCB 2EZKA 2QSHX 4H4KC 4M3FA 4XORA 2HOSA 2DU9A 3NEUA 2QUFA 3I58A 3K70D 2B9SA 2XRLA 1JUSA 5D5XB 2EA4A 4QPOA 3RJPA 1XSDA 4IEJA 3D1NI 1R1TA 1TP4A 2DI3A 4CCMA 2F5VA 1KU9A 1OKRA 1W4MA 2L54A 4XL9A 4RDUA 1FLIA 2HVQA 2JN6A 2LKPA 3ZQGA 1P7JA 3H9JA 3CCYA 2QA4I 2DCEA 5GADJ 4IO9F 1R71A 4P9UA 4LD5A 1S7OA 4AU7A 1W7PB 3TP3A 4UVBA 1I3AA 3VEPA 2A69F 1IXSB 4CDGA 3BR2A 4EMSA 2O9LA 2LY1A 3S1RJ 4AIHA 3ZMTA 2DA5A 5IYDJ 2IPQX 4IQ4A 2L7ZA 3UKGA 1R22A 2K5CA 3F8FA 4A3IJ 2V4JC 4LK0F 3IAS2 2PQ8A 4FT8A 3EDPA 3RZDJ 2OTLI 1BI0A 4IXAA 1UELB 3K70C 3GTMJ 2MD0A 3K4LA 2R7ZJ 5BOXA 1H0MA 1V3FA 4M9XA 5E3NA 1P4XA 1USSA 4G6QA 1MSEC 3HSEA 3BTCA 2L3DA 1ZKGA 2O7OA 2A6TA 2DQLA 5D6FA 1X1CA 2QCOA 4I98B 2CQQA 1BA5A 1LJ9A 5EG0B 2FJ1A 3F8CA 2VB6A 1PP8F 3H36A 1QBJA 3QPHA 4ENNA 1F9NA 5DS9A 2HKOA 2R3SA 5GPAA 2M8EA 1RR7A 1WZ2A 2E60A 4CCNA 1T8IA 1B8IB 2VKVA 1EKEA 3E5QA 3KEQA 5L3CA 2CUEA 4DBRA 4F55A 1ZELA 3GLXA 4HEA2 4XR6A 5KVRA 1N78A 2HQ5A 3OOPA 1RRJA 1D5YA 1HDDC 5LRSA 2BXZA 2DK5A 2I5UA 5HS8A 4D7MA 4HX4A 2EIMH 3FXJA 1D8KA 1IAWA 2ZJPF 4EGZA 1DPUA 1FP2A 3K9TA 3HPGA 3VSLA 4V19K 2KIFA 4XN0A 2PJRB 5K7HA 4YIFA 1QHGA 4BDYA 3NWSA 3PFIA 3CCQI 3AG4H 2HVSA 3I4NJ 2VC0A 3KPHA 3D0SA 2CWEA 3TO6A 4JOMA 4XLAA 2R5ZA 2BY1A 1O7FA 4IPAA 1JKPC 2KJBA 3SZGA 2EV5A 5FKNA 4BL0B 2HQNA 2LD5A 5EGOA 4A0ZA 2DQRA 3E6BA 1FBQA 3AKZA 2DPUA 2E71A 3JRDA 3QYBA 3LSGA 4RS8A 4ZYAA 3CUQB 2OUMA 1VQ8I 4CZZA 3BJ6A 2XGXA 3K1NA 2M5WA 3VB2A 3LFKA 3ROUA 2LDUA 4BJ6C 2XIGA 5ILVA 1VQMI 2CYYA 4AYBN 4U0WA 2B63J 4PFPA 3N4MA 5IP6A 2OD5A 2X4HA 3FDYA 5IT3A 3JR9A 2HWVA 3OSFA 3BZKA 1T56A 3FXRA 1B4AA 3WGGA 4XSZF 3HOYJ 3RQIA 2JT1A 4RGRA 3J7YJ 2DFHA 4C3HJ 4EATA 2D5VA 4OIPF 4PUSA 4G7ZF 5ILSA 2BW3A 2H8WA 4Y3OA 3CCUI 1AU7A 3LSTA 5F1JA 2VONA 2DK8A 4LLLA 1E3OC 5J47A 2OPTA 3J7ZI 3S1MJ 1WQ2A 3KP2A 3ZMZA 2C6YA 4RB3C 4M73A 1D0XA 2WA0A 2W48A 4BACA 4Y52J 2DFFA 4OOIA 5JLWA 4CCKA 1K4TA 2UZKA 1CF7A 2V1XA 3RKYA 4E7SA 3C2GA 2BY3A 2QQ8A 2DT6A 3GZ6A 2W24A 3B73A 1FOXA 4KYWA 3VYTB 1ERDA 3WU2C 1ZREA 4RB2C 4WK8F 2H6CA 3HOZJ 4F91B 3ABUA 3H3ZA 2ME0A 5EF6A 4GO1A 2K3FA 2X48A 4HF1A 2E1CA 1HDPA 2Y69H 2B0LA 1G3YA 2E1MC 3E97A 5LD2C 1Z3XA 3E6CC 4E7KA 1ZR4A 1LVKA 3F0CA 1G8XA 2CGPA 1BOAA 5CLSA 4XLPF 1POGA 2WWYA 5JVGF 2IP2A 1HSTA 3ABKH 3KP5A 2P7VB 2M34A 3LSPA 1WFXA 3LA3A 2I10A 2EBIA 1BIAA 3VOEA 5F6FA 5IT9K 4G9YA 2BVLA 4OIOF 1IZ1A 1ZRDA 1YJNI 1MD0A 2FUG2 1B1BA 3CP8A 3DPUA 3L00A 2HVRA 1WJBA 1K79A 2VT2A 1ZGAA 4HYEA 2STTA 2M3AA 2D1VA 3LA7A 4GFBA 1SFUA 2L9NA 2LH9A 4IHWA 1YQAA 5CVVA 5IPAA 5C4JJ 3L2VA 3FXLA 1DP3A 3G2BA 2HTSA 2OU2A 5EJCA 4FX4A 1I1GA 2F5DA 2RV8A 5D5WB 3PUFA 4DZPA 3GYHX 3UNGC 2OC6A 2KLOA 3S1NJ 2VQGA 2DA2A 3FK6A 3DBHB 2GA1A 4YG2F 3BDDA 3FXQA 3WHCA 2ELJA 1ZQ3P 1ETXA 3Q0UA 3WU1B 4L9TA 1H89C 4R1HA 2IGOA 2KZGA 4HSRA 3SFZA 4QIWN 3I54A 3G6EI 2M87A 3MCZA 1SFEA 2CUFA 2NRAC 1WVRA 4HNTA 3WTUC 3FIWA 2FMLA 2AXTC 4M3BA 2FBIA 1M1EB 2CV1A 5ICGA 2EB7A 3JRFA 4LG3A 3QOPA 2ZB9A 2WV1A 4M6XA 2WAQN 1TW3A 1R5ID 4LG0A 1OMIA 3MVPA 4A5MA 5E1ZB 3A0BC 1WSUA 3HZJA 1DPRA 3BP8A 5E3OA 4JX5A 5CVRA 4A3EJ 4B43A 3BROA 1JXSA 1E0EA 3PQKA 2O3FA 4ENMA 4B8XA 2EZLA 5H6QA 1D5VA 3KEYA 1OCTC 1SAUA 3S3OA 1P4WA 2ZXIA 1YJ9I 3GVAA 2F2EA 3X2QH 3BQYA 4I6ZA 1SFOJ 2H8RA 2ZNYA 1HW5A 1R58A 3A01B 4ZZLA 2G7HA 3RPQA 1UAAA 1QU3A 2HXOA 3TW6A 1MDMA 2X9DA 2XV4S 1XDUA 1IV6A 3S16J 1TBXA 4H0EA 2R7XA 5TJJA 2EV6A 3HG9A 2DXIA 4KT5C 3RTRA 2W00A 4I7HA 1O3RA 4E6KG 4GXOA 2HYJA 3AG1H 3U1KA 3AG2H 2OTJI 1R23A 1IRGA 1PVEA 2DMUA 3FXUA 5JHFA 2E1MB 4L5JA 2MFZA 4DNCA 2ZJ2A 1NHAA 1AKHA 3K4BA 2GM4A 1YYVA 2XAUA 1FTTA 1T38A 1JT6A 1P4AA 3RYPA 1PYVA 4PGGA 1YOVB 1ZHFA 1ZK8A 1S7AA 4PJLA 4BUPA 4I99C 4OAYA 1FSEA 3TL4X 3O2PE 2R7RA 1QNTA 3EYIA 1SVOA 4IHVA 2E35A 3HOVJ 2W1OA 3I53A 2GA2A 5GAHJ 4AVZA 2KQRA 1NK3P 1LFUP 1K4SA 3M3YJ 5JVTA 5EZHA 2ZFUA 4CYDA 2HZDA 2LREA 9ANTA 3FXKA 1MH3A 1V55H 2R92J 4F92B 2M9HA 3HDDA 3WTYC 1A6QA 1REPC 4ZDOA 3U1DA 4AIJA 4BE1A 2BVMA 2KJCA 2DPDA 1HC8A 1RKTA 4C3JJ 2H27A 1XPXA 1BJZA 3M1EA 2ZJQF 5E79C 3KLOA 1E3HA 1ZGJA 3DU5A 4UUTA 2XAHA 1O3QA 5ILUA 1JKQC 1T0FC 2L7MP 4EQQA 1HF0A 3J80K 1JTYA 4PSXA 1B9MA 1KU2A 4ZYDA 4E4HA 4N0BA 2QEXI 3HUGB 1FJLA 3WE3A 3H5RA 3VDXA 4ETSA 3C2HA 3MWMA 3ZQHA 2DMNA 3DLAA 2RAEA 3E6MA 2K4BA 3LSMA 4E7HA 1X3UA 3GBGA 2G9WA 3NWTA 5HS7A 4DJAA 1FYLA 1MGTA 4HNVA 4I2OA 4EJTA 1WCMJ 1U9NA 3RYRA 2EZIA 3M8FA 2KFDA 4EGYA 5TRDA 1HA8A 3GUDA 4PCQA 1R1VA 2K40A 2P6SA 4XOPA 1B72B 3KETA 2M8GX 3JRCA 1FTZA 3KZIC 4N9IA 2KIQA 2O61A 1TQPA 2P6TA 1MBKA 2QF7A 1QGPA 3JW4A 4NQWA 2ZO4A 4A3MJ 5CQEA 1YITI 4IHTA 1CGPA 3LSRA 3OYAA 1G59A 1RKWA 2DA6A 2KISA 3BG9A 3CCJI 2NOGA 4FE4A 2CFXA 1VQNI 3VPRA 4YFXF 2JUCA 3OWTA 2Z9OA 1T95A 1YI2I 2EIKH 4YELA 2K9NA 4OMZA 4Y4RA 1P92A 3PM1A 3F6VA 3ZOBA 3DLLF 2GOMA 1W7PD 2HDWA 5L3GA 2AQEA 3RIRA 3JREA 1UHSA 2LRDA 3BY6A 4KIBA 4OWRB 2Q0OA 4ESFA 1XGNA 3V7SA 2YU3A 4BEHA 1TT0A 2Y9YA 2BV6A 5LEJA 1IDZA 4AYBA 1USTA 4U7DA 2L01A 5L3FA 4BHCA 4DYRA 2VXZA 4A3DJ 1V4RA 3AG3H 2JA5J 1WWXA 4G7OF 4N4OB 1G4DA 3L2UA 4CICA 1S72I 4CYCA 2IGKA 4EJVA 3HOSA 2VQLA 2W57A 5J1RA 2OA4A 1MBGA 3H9GA 1ODDA 5DYMA 1IN8A 2LNBA 5F0HA 2R7DA 3M1CA 4BJTA 2H94A 2L02A 4JYKA 2DO7A 4Y17A 1TWFJ 1MKMA 1MBJA 5CKTA 3Q9VA 1XX5A 3FKIJ 1X3WB 2WBMA 4PDKA 3OR2C 1RUNA 1SFKA 1DU0A 3E0JB 1W7PA 2JPCA 3VYSB 2KIUA 3BT9A 5FKMA 2MC4A 2HZTA 2HYGD 1XCBA 5A2QK 1Z7UA 2IAIA 1Z6TA 4TV7A 5IP9J 3V7CA 1K83J 2HQAA 3OR1C 1OCCH 2MA3A 2PEXA 2W84A 1P2FA 1OFCX 1XGMA 3GW2A 3M8EA 4N4NB 2QLZA 2W4SA 1T33A 1XMAA 2WV0A 4B3XA 4UY8I 2DTRA 3GLLA 4ABZA 5FKLA 1Z67A 4HA8A 1OR7C 2RNJA 3A4CA 3GMEA 2OCEA 3E5XA 4X0GA 3CC7I 3IWFA 2GQQA 3KLNA 5K7ZA 3I4PA 2V9VA 2JVGA 3DEWA 4HLYA 3HJEA 5M5WJ 3PFYA 2CV0A 3S93A 5E1WA 5EG0A 1XSVA 3ZGKA 3D5RC 2PX9A 1KQ9A 2XRNA 3MN2A 1Z7LA 1VNDA 1ETWA 4EVIA 1NTCA 2LYCA 3C18A 1B8IA 3CMMA 4M3DA 3CD6I 2ECBA 1R49A 2X1EA 5FLXZ 4AVPA 1LB2A 1GHCA 3KP4A 1APLC 1BN5A 1KYZA 3F3XA 4P5OA 4CH7A 2ZNZA 2GXAA 5H2FC 4CCJA 2FBHA 4XQFA 2F6CA 1G3WA 3DKWA 1WJCA 4M3EA 1IUYA 4A6DA 1S9HA 3DKYA 2O03A 1UJ8A 5HLGA 3BCBA 1IGNA 2ELKA 3FM3A 2PJRA 2STWA 1YJWI 3H3VK 4CA0A 2BEOA 4R79A 1XMKA 4IKFA 1MBHA 4E7ZA 1F1ZA 2VC1A 3TEDA 2DLLA 3WGIA 4ESJA 3J81K 2LLKA 3QWLA 1Q1HA 5LGNA 4X1EA 4BHPA 4HDVA 1YX5A 3C1DA 3KZYA 1KU7A 4E7IA 3GTPJ 2N8GA 3OY9A 1VTNC 5FRNA 3IRRA 1JKRC 5DD8A 1BI2A 4MIMA 3HRTA 4RM3A 4U7BA 3DF8A 3CUQA 2O0YA 3H5NA 1MNEA 2O6GE 1FSHA 4NB5A 4XOTA 4DW6A 4ZYEA 2VT3A 3S32A 4HNUA 3I0TA 2LF8A 3DQVC 1J5YA 5LEKA 4C2UA 1WJFA 3OYJA 3GXOA 3LSJA 4BY7J 2CV2A 2K85A 1GVJA 2LR8A 1FC3A 4AC0A 1X58A 3HOWJ 4QSHA 2HDCA 2DT7B 5F04A 5HLIA 2EINH 2X1CA 1KQ8A 2WAQA 4ZJZA 5BS6A 5DCFA 2F4OB 5F64A 2XGDA 2IVMA 3E1SA 3GO5A 3HBLA 3KIOA 4UHTA 3COAC 2R7VA 2G7UA 3ZP5A 4UUSB 1WKMA 3RQ4A 2XHKA 4PGHA 4EM0B 1JHFA 4IRGA 3LAPA 2R7QA 3CJQB 1WI9A 3GTOJ 2UUZA 1DUXC 1VQKI 2ZMEC 4L9VA 5DM7F 3OYGA 3Q0VA 4C30A 2JK3A 3WTXC 1BR2A 1HKTA 5FKKA 3PSFA 1IV8A 1J59A 2NS0A 1DQUA 2ZSIB 1KYWA 4DGWB 4HDUA 5BPIA 2IS6A 1KQ0A 3TOAA 1Y0NA 1G3TA 2FQ4A 3GFIA 1IN7A 2EK5A 2X6YA 1TWAJ 2R7FA 1HCRA 1FY7A 2M0CA 4CO8A 4BQOA 1W36C 2CW8A 2ZKZA 3LMMA 3QPTA 2EH3A 4HZFA 3RPUD 2OZ6A 1WJAA 5ICEA 1R5HA 3RKXA 4KICA 1PUFB 2F5FA 3ECOA 1G3SA 5GTHC 2CMPA 2EZHA 3PNYA 3WGHA 2HNHA 5IOYA 2IRFG 2VJJA 3ZRGA 1VQ6I 1L0OC 5KAIC 3LAJA 5ICFA 2Q2EB 3W2AA 1K6YA 3ERMA 4NBQA 1V5EA 3K69A 4ZYGA 4YIRX 3DWLE 2CJJA 4E70A 3NARA 5B3SH 2A07F 4UB8C 2VLAA 2FMYA 3GEZA 1BM9A 4GCVA 1QQIA 3K10A 2QQAA 4KIFA 2WY8Q 3N05A 4XLCA 1F43A 1EJ9A 2PI0A 3L1PA 3OYCA 1WGXA 2QYOA 2HS5A 3QU6A 3CDIA 5D6EA 4DQ2A 2VBWA 4G8XA 1MBEA 2V1NA 2ZXHA 4GRIA 1F5TA 4CCOA 2ELHA 4RM2A 3JSOA 1LDJA 3RPUA 1IJWC 2DOAA 3ZQFA 2AS5F 4OU0A 2V6CA 1ORKA 2VJIA 3MKLA 5CVIA 2RVCA 1KZHA 5D4SA 3FBNB 1VZ0A 3BCAA 4EV0A 1RZ4A 1UZCA 1B6AA 2XPVA 4LIVA 1U6GA 1EF4A 3S2HJ 3HOUJ 3OYKA 4W1UA 5CJ9A 1U8BA 4WX9A 3QYFA 2TCTA 4HF2A 5GP9A 3JTGA 1ZN2A 1HOMA 2FNPA 4LIUA 3Q9SA 4E7JA 1RESA 1BC8C 1SMYF 3I64A 4CCLA 3W6VA 5J40A 3P9CA 1D1AA 4A69C 1R36A 3GTQJ 1IN4A 2CS3A 2X0LA 3I9V2 4LITA 3H9QA 3TW7A 1AWCA 1Z21A 4XM3A 3WG7H 3IKTA 2FOWA 4ZDPA 4CHUA 2L0KA 4BU2A 5H6RA 5TGTA 4YIIA 3ISPA 4FISA 4IF4A 1RNLA 3BG3A 2EV0A 3HRUA 1MBFA 3ZQ7A 1JUMA 1K78B 4BE2A 1IRZA 1TC3C 2ZMEB 4MHGA 3CESA 3I59B 2VE8A 5KK1A 3E7LA 4G12A 4M72A 1SVMA 2BGCA 4KT6A 3BJOA 3BR1A 1Y6IA 3TDUC 4HG2A 1IRFA 1GV5A 2HI3A 2KHMA 4RGUA 3OMYA 2BY2A 3FKJA 1I39A 1UFMA 3S15J 4N9HA 3EUHC 4V2FA 4B47A 2VXDA 1QPIA 5DM6F 5F0FA 2YS9A 2KMUA 1XS9A 2OBPA 2DODA 3K2AA 2L9RA 4MQVA 1RUOA 2KZVA 3D5SC 2PLYA 3A1YA 2XF5A 1DDNA 2ZXJA 2AXLA 2V79A 4JBAA 3S2DJ 2M4GA 3ECHA 2YU9J 2QSGX 3CCSI 1VQ9I 1IXRC 2OJED 1JGSA 2D45A 1WJEA 5GAEJ 1S29A 3CQZJ 3R0JA 3BR3A 3U2RA 3HHGA 3DPTA 4KN4X 2ISYA 1RIOH 2ZSHB 1I6HJ 2FOKA 1KU3A 3E5UA 2RNGA 3ZR8X 4HSTA 2X85A 2MLKA 4NNJA 4IJAA 3RCOA 4WXDA 1SEUA 3BOQA 1PDNC 2WC2A 4BQAA 3MMYB 2H1LA 3JSPA 4HOBA 2B7EA 2JSCA 1HW1A 1X19A 2Z1DA 2ME6A 3P5JA 2RKHA 4GYGA 1MJAA 3CF5F 1R6RA 1DGWY 1WJDA 3OIOA 5HVQC 2PN6A 2KDOA 2R5ZB 2K27A 3OL4A 2D2WA 3K4MA 3RSNA 1BI3A 1YTYA 1HQCA 3CP2A 3BLYA 3I4MJ 4I76A 3WU0A 2PMUA 3MZHA 1H9TA 3H0DA 2QSFX 1OCZH 3HM5A 4RB1A 2XB5A 3ABMH 4PJMA 1RR8C 3Q5FA 1T6SA 2VJ4A 2VKEA 4PJJA 3HUGA 3CCLI 3KZZA 2IXSA 3R4KA 5DUKA 2DW4A 2HTJA 1FYKA 3OYFA 2R7OA 2LKSA 3CDLA 3HGGA 4JX4A 3JRBA 2KRFA 4U0VA 1SANA 5FKOA 4A3GJ 1J7KA 5IT9Z 4BBRJ 2L4AA 4LJZF 2TDXA 1R7JA 1FBSA 3ZQQA 4KA4A 5HS9A 1B72A 2EFQA 2K02A 2JZYA 4OIQF 1G2HA 2CQXA 3ZQIA 2HPMA 1NG7A 4Z2YA 1QZEA 2HR3A 3TKYA 1Y0UA 3S3NA 3GFLA 2FSWA 5E1XA 2JWTA 5HODA 1IW7F 2BXYA 3HGYA 3CCRI 3G1MA 3DPLC 1VQOI 1EV7A 1IXCA 1FT9A 3SXYA 3W2VA 2CW7A 4OIRF 2KRCA 5C3EJ 4WWCA 3TP0A 1Z3YA 4XN3A 2R5YA 3MKWB 3ABLH 2XKOA 5HNFA 1FMVA 1XG1A 5EZGA 4AWXB 4KDPA 2PMZN 3WG9A 3IAM2 3OYEA 1R5GA 4XLHA 4IHXA 2K4JA 2L2OA 3LNQA 1XB4A 2E2HJ 2R0QC 1S3JA 3BTJA 5F0CA 1X1DA 4YFKF 1FP1D 4P96A 2MW8A 1FX7A 2QKLB 4MGRA 4DOZA 1SD5A 4XONA 3P9IA 4I0AA 1O3TA 3SZPA 1ZH5A 2JJ7A 4FHTA 2NVTJ 4XRSG 2X6WA 1ETOA 5HLHA 2Y31A 2RREA 1WHUA 3CLOA 3T5XA 1ZGWA 4C3IJ 3CJTB 3SDBA 1JE8A 1IN5A 2HEOA 2CUJA 4L0YB 2IEKA 5EEGA 2IA2A 1D0ZA 1SVLA 1X4PA 1Y56A 2OF7A 3KCCA 1Z0XA 2BYVE 2DA3A 1SMTA 3JRIA 1HBXG 2Y0SN 3IUOA 1GV2A 3GFMA 3V8LA 1U3EM 3FXOA 1A31A 2XF6A 3JRGA 4AUXA 2M7AA 2H6BA 4O5VA 5EEAA 2RDPA 1FMWA 1ON1A 3DKXA 1MMGA 2Z5UA 3DTEA 2DA4A 1OJLA 2VBXA 3FMSA 4D5CA 4UVCA 2FQ3A 1LEBA 1J75A 2R93J 3OSGA 2ZXWH 3G73A 2RQQA 4BE0A 4A3KJ 5DCMB 4J00A 5BNGA 2HPIA 3VWBA 4C9YA 2O8KA 4L5IA 1RETA 2X6XA 3HRMA 4HW0A 4BXUA 1R9TJ 1A35A 4QLCU 3FK7A 3FM5A 5J6XA 2R7UA 2DOEA 4I01A 3V8JA 5AONA 4JQFA 1XGOA 1FNNA 2P5VA 5M3FJ 3K4NA 4C2MJ 2P0WA 2VBZA 4BBSJ 5E17F 2A3SA 2DMTA 3K0LA 2V1UA 2R7TA 2IBDA 2JMWA 3R6SA 5KAFC 3L2RA 5B1BH 4F3QA 1ETQA 1ACIA 1TWCJ 2KRHA 3PQJA 1T0FA 2GLOA 3S3MA 1A5JA 5D5VB 2XAJA 5FJ8J 4LMYA 3BZ6A 1LE8B 2FX0A 1W5SA 2J5OA 1Z77A 2XAFA 2A5WA 3D5LA 1QRYA 2VPRA 1LVAA 3VFZA 2E5NA 4NC6A 2ZJRF 4ANJA 5D4RA 1I1SA 3HC7A 2LSOA 2Z16A 3M8JA 2TRTA 2OZUA 5JR3A 2HDDA 3R0AA 2A05A 4LG0B 3PO2J 1ETVA 1XDSA 3DEUA 3GF2A 4AIKA 4RLQA 3A0HC 2XPUA 3EETA 3HYIA 2IJLA 1LUJB 2XAQA 2HQRA 2LG4A 3BG6A 1R00A 2XUBA 2HYFA 4UV8A 1ONVA 2XF7A 2JA2A 1U0JA 5J8CA 2DYRH 2FU4A 3J7AO 4ZDLA 3SQNA 2QZ8A 4BY1J 2W85A 2W25A 3IKVA 4II2A 1X2NA 4PZJA 4JP0A 1YS7A 2M2EA 2XGEA 2Y0MA 4G6TB 4E7LA 1MMNA 4D5FA 1R1UA 1S7EA 3C3WA 5DDGA 5CPRB 2V1DA 2P81A 4HBLA 4JX6A 2JUGA 3J80Z 1UG2A 2HOEA 3ABTA 4ZC3A 1LQ1A 1OYWA 4BKXA 3BJAA 1RI7A 1OCOH 1KGSA 2WB1N 4PSWA 2X51A 3HB9A 1N75A 1BOBA 2WY7Q 3SYTA 4RB0A 4S0HB 3OS2A 1WH7A 2M0MA 3CMAI 1GDTA 3LQRA 1UMQA 4OINF 3CLQA 4QWQA 1JJ6C 1BBYA 4IVNA 3OYNA 3CF2A 4FCYA 1MNDA 3IH3A 3W6JB 2E19A 1W5CC 4AIDA 4MO7A 1MW7A 5BQTA 1U5TC 3SJMA 3SDGA 3K4JA 3M9AA 1WJ5A 1K61A 2LC2A 3MQ0A 4WXCA 3CO7C 3Q0WA 2UXNA 2XDVA 4RAGA 3E3VA 3HKZN 4MQ9F 4UUSA 4LB5A 3IRQA 3BG5A 2E1NA 5K5OA 4DYCA 2AHQA 1SC7A 4FTHA 4XBFA 3M4OJ 2QKMB 4WXHA 1LNWA 3ZMDA 3GZNB 3FMRA 2D1HA 4XICA 3JAMK 2DOFA 1S6LA 4EM1A 2IS4A 3T8RA 1JTXA 1VQ4I 4A3BJ 5K1YA 1BC7C 1TZLA 1Z05A 4M6YA 1OPCA 1OR7A 3QPLA 1DGRM 3PL8A 1YRNB 2IA0A 3GTGJ 5GTIC 3QOEA 1PUFA 3WODF 1XGSA 1VFCA 2NYXA 2DDAA 1YHQI 5CYVA 2RC4A 2P4WA 2JQ7A 4EJUA 2MSYA 4KITB 1IRXA 5J4YA 4DZJA 1X1AA 1YW7A 5IYCJ 3MFKA 3WTWC 2CQ7A 4CGZA 3HHHA 2LBFB 1BIBA 3HEFA 1GT0C 4XK4A 2Q2EA 3ML6A 3Q3SA 3TGNA 3MEXA 1MH4A 2JSPA 2VN2A 2XGCA 2ID6A 3O3KA 4XKBA 2VPLA 1FEXA 5EEHA 2NVXJ 1JI8A 1D0YA 4UV9A 1AHDP 3IH4A 5HLTA 1W0UA 2QM3A 4KMFA 3EPZA 3F8NA 3LL7A 3FF5A 3DCFA 3ASNH 5A2QZ 4MFEA 3HOTA 4M3GA 2DFIA 1Q1VA 3B02A 4GGGA 5JFRA 4Z6YA 3OYLA 2JA6J 2CUZA 3PJRA 1SD6A 1YO5C 4F52A 4U88A 2IS2A 1WRJA 3VYUB 2FNAA 1QA6A 4IRIA 1MMSA 1YE9A 3DTKA 3AFHA 1ZLJA 5AIPA 3M7GA 3H0GJ 3WHBA 3CCEI 4D1QA 4LLNA 3VODA 1BW5A 3QP6A 2LTPA 2X1DA 3GWZA 3F9KA 4UUVA 3KP6A 3MZ8A 1I50J 4XLNF 5F1RA 3L9FA 4MEYF 5IP7J 5DUIA 3L2QA 3JRHA 3F6OA 1VQPI 3GCMA 5CVJA 1OCRH 1RC9A 1Y1VJ 2LF7A 3DP7A 2VUMJ 1GUUA 3OYBA 2DN0A 1A6IA 2CH0A 2PFBA 2YSRA 3CZ6A 3IHUA 4PK4A 3WTSC 1FWZA 4A3LJ 1N77A 4EJWA 4IRHA 2WAFA 1N25A 1G6NA 5E8GA 4F7ZA 4J01A 1W36D 2NNNA 4W97A 2GOXB 3RI4A 5F27A 1U2WA 4M74A 3V8KA 3PNTA 4MNUA 4CUGA 2KL4A 2EFNA 5E3MA 2EFWA 1V54H 4HAMA 3DTIA 1U5TB 3QYEA 2M1BA 4U87A 2AQFA 2L7KA 3FHZA 4BGDA 1W5TA 1VQ7I 5L3DA 2P8TA 2XROA 5C4XJ 2GBYA 3GTLJ 4LLGF 2PMHA 3NQOA 5FD5A 4HF0A 4B44A 1T39A 3ZMUA 1K78A 3FX3A 4HV6A 1LKXA 1YIOA 2PMZA 2ZMEA 3ESWB 1WPKA 3G3ZA 3IH2A 1TWGJ 3I59A 3J81Z 5DV5A 3S1QJ 1ITYA 2KDZA 4A3CJ 1ON2A 1O4XA 4ENKA 4RGXA 4Q47A 3CUOA 1OISA 2IT0A 1MJ9A 3PIPF 1F4KA 3SEQA 5LHHA 3LQQA 4WCGA 4Q4ZF 2E1OA 3IV5A 4XKWA 5ICCA 3JCUC 4Q48A 5JHUA 2DBBA 2QBYB 4J19A 1YW8A 1TNTA 1J0RA 1MMAA 5LRRA 2V6EA 4XKCA 1MZBA 5D5UB 1B9NA 1QHHD 3KX2A 2YPRA 2Y0SA 4CSWA 5EDNA 3VSKA 4KISA 4A2UA 2ACJA 1LDKB 2CQNA 2JA7J 4C2TA 3PIOF 3U9GA 1X4OA 1Y8QB 2FEZA 3ZN1A 4YEJA 3WTTC 3PO3J 3M07A 5J3LA 1FOWA 3GTKJ 3QODA 3OIQA 3ONQA 4IHSA 1U78A 2WADA 3CCVI 1YG2A 2ICWG 5DD4A 3QQAA 2YX7A 4B48A 2E2IJ 1GVDA 4KMUX 5FB2A 1XC5A 3OOUA 3CMYA 2K9MA 4O6JA 3A2KA 4PJNA 3BTLA 4NDLA 5GPCA 4YFNF 1O7LA 3I71A 4MTEA 1GLNA 4ESBA 4BQNA 2DA7A 1F36A 2H09A 4XIDA 4LK1F 1QZZA 3K1MA 2E7XA 1X2MA 2IGMA 4ASNA 3BC8A 1FIPA 4BYYA 3GTJJ 5F08A 4X6AJ 2MH2A 2FRHA 2MABA 1RPWA 2FXAA 1HKSA 3A02A 2Z33A 1EH6A 1QVUA 4DIQA 1I5ZA 2V9KA 3HPHA 5J1YA 5E8IA 4XMYA 3I56I 2F5EA 2XPWA 3L7WA 4ZTFA 5E20A 5FRMA 2CSOA 1FYMA 2LMDA 2QGUA 5FROA 3JTHA 4A12A 3SEZA 1D1CA 3OV8A 2BBYA 2Q8KA 2FA5A 4HX8A 2ZC2A 2HGCA 1FPQA 3MAJA 3HSRA 4M9ZA 2XKPA 1O57A 4QTRA 1ULYA 4UXNA 1IUFA 1E17A 2ETHA 3KYDB 2OQGA 1I6XA 4M6VA 1ZTRA 2E2JJ 1SD7A 5K7FA 4NC8A 1ZG3A 4LB6B 3EQLF 2RGVA 3K4KA 4BH9A 1JKOC 2GIZA 1A04A 2M45A 4B4CA 2UWMA 1GXQA 1B59A 3OYHA 3A01A 1HW2A 1P7IA 5LHGA 2JPBA 1H9GA 3BG7A 5KNLA 1TNSA 2XC7A 4KUMA 1K7AA 3KEOA 3SZTA 2JRMA 2W7NA 4A0YA 4DYQA 3CTAA 3LFUA 2NNYA 3KP3A 4ITVA 3T8TA 4BJ5C 2ADUA 3F8BA 3PSIA 1VQ5I 4L0ZB 4RGSA 2NOJB 5K5RA 3EUHA 1P9QC 2WB1A 2YR2A 3K2ZA 2NS8A 2EFPA 2GAUA 4ZYHA 1FBUA 4S05A 1UG0A 5IYBJ 2AO9A 3RKQA 4OAZA 1I3QJ 1UHMA 4KIGA 3DBLB 1EH8A 4P55A 1P6RA 3GX4X 3F8MA 2QWWA 5LGTA 3EUKL 2COMA 1XD7A 3QP5A 4G7HF 3AL0C 2EPFA 4RAZA 5FGMA 4EM2A 5FD6A 5FLMJ 3GFJA 2EFOA 4YRVA 4XRMA 4V2GA 4DBQA 5DTDA 3HL2A 2BY0A 2BHZA 1J09A 1O3SA 3REOA 3FXMA 1X3ZB 3V4GA 1TTYA 3HKZA 1JT0A 4IL6C 3NAUA 1X1BA 3TO9A 3G4SI 4FETA 4FQGA 2VIXA 1T08B 5HNHA 1STZA 4RMNA 1JJ8C 1XMXA 3H92A 2FF4A 1IDYA 2XVCA 4BDZA 1QVTA 1D8JA 5M3MJ 5DCMA 1FIAA 2O8XA 1LFBA 4HQMA 5J1UA 3B6CA 1H8AC 2XAGA 3HRSA 1FZPB 1NG6A 1BJAA 2GXBA 3LSKA 1TT5B 2DDBA 2KKOA 3SHFA 2DA1A 5GAGJ 4HRIA 4ZTJA 4Y33A 1VI0A 1IO2A 5EGOB 2NS7A 2JA8J 4A3FJ 2OQRA 4BNCA 2Z99A 3QU3A 4CZCA 1Y8RB 2K9LA 1XCVA 2E7WA 3GZ5A 2DAOA 1L3LA 3DEEA 3ZQLA 3T1BA 2ZBKA 3CJNA 2QQBA 4ZZDA 1IF1A 2L4MA 1TWHJ 2MG4A 4L5EA 1DU6A 3UR3C 4M71A 1LE8A 2CO5A 3LSIA 4I0BA 3TDZC 3ZXSA 1LFPA 1MMDA 2QENA 3I55I 1S8NA 3EUAA 4OMYA 3SFIA 1MSFC 4MFDA 1K6OA 2GWRA 3ERED 1GXPA 4IHYA 1QPMA 2BW3B 2DT5A 2ESNA 2MBFA 2CG4A 5AIQA 2CQKA 5D8KB 2K9SA 4UNOA 4XNFA 6PAXA 2V9PA 4EEFG 4GYIA 2VI6A 4EJOA 2VASA 2EIJH 3ELKA 5EYRA 2X6OA 2EILH 4A6EA 2FE3A 2EA2A 2COBA 2DJIA 4XSXF 4KFCA 4KJZA 1E3PA 5BPDA 1J2XA 1X1PA 3K7AJ 4IOAF 1UHWA 3G1OA 4B1RA 4AM3A 5B66C 4P9FA 1CF7B 3O8GA 2EJRA 5C44J 1R4NB 2JTVA 2K9QA 1Z6RA 2VKHA 2M7BA 1YX3A 3BQZA 1QZYA 2E5ZA 1ZLKA 2DMQA 4ZH4F 1YLFA 3MZYA 4L9NA 3TMOA 2L9VA 2CRGA 2DTZA 3KP7A 3KFWX 2PJPA 5FFZA 2BHYA 1YW9A 2MC3A 1MIJA 2F5CA 1YS6A 3BR6A 1OYYA 2OCCH 2K86A 1JUPA 1JHHA 3ZCOA 2IS1A 2A5YB 1ZRFA 3FMQA 2OV7A 3K1PA 3OS0A 1ZG1A 4XRSA 3G1LA 4RLFA 4IOCF 2PBIA 1YIJI 3S17J 3IC7A 4BHBA 2G0EA 2LK2A 5ED4A 3AL0B 3OL3A 3O6BB 4RA2A 1TL8A 3IP4B 1YFHA 5LLQA 1NK2P 4A5NA 4LOCA 2LP0A 4HPQA 3P7NA 1ETKA 4HV5A 3LSHA 3BPXA 3ULQB 2O5RA 2NXNB 1TQIA 2MH9A 4AD9A 2EWNA 3QPSA 1UCRA 1KA8A 2LY9A 2IGNA 2MLGA 1JGGA 3HSFA 3IL2A 2Q1ZB 4WF2A 2CW0F 3BPVA 1U9OA 2V26A 2P5LC 4GDFA 2H1KA 2XSJC 1E2XA 3OIPA 3NRVA 2VOPA 5JLXA 3W2WA 5CVUA 4BS9A 3MKZA 2KIMA 2FBKA 4NUBA 2MGQA 4UB6C 4XKVA 1BW6A 4L9JA 1LPQA 1Y1WJ 1TLHB 2LKXA 2WAEA 4IQJA 5JI6A 2HOAA 4QPQA 4S04A 2R7SA 2LOOA 5HOOA 3CO6C 1SD4A 4B3AA 2LY2A 3F72A 1YRNA 3WTZA 2RN7A 2MD5A 4BXFA 3CC2I 1V5GA 3ZMSA 4ENJA 3QAHA 1AOYA 2V7FA 4MEXF 1R4MB 4XLEA 2M4KA 2L7FP 3KE2A 5DEQA 3HTUA 4Y15A 2GZWA 5FFXA
chains in the Genus database with same CATH topology
1H89C 1IJWC 3DCFA 3ZQFA 2Y30A 4MFEA 4M3GA 4QIWN 1ORKA 1Q1VA 3MKLA 1VF9A 2CUFA 3FIWA 2JA6J 2XPVA 4M3BA 1EF4A 3S2HJ 3JRFA 3HOUJ 4W1UA 1U8BA 1W0TA 2ZB9A 2TCTA 2WV1A 3WHBA 3H0GJ 5GP9A 1BW5A 4FE7A 2WAQN 1HOMA 3FISA 3ZQCA 2LTPA 3MVPA 1RESA 3A03A 1MNMC 2ECCA 3LOCA 5E3OA 4JX5A 4Y7NJ 1I50J 4A3EJ 2R5YB 5IP7J 3W6VA 3JRHA 4A69C 3BR0A 1Y1VJ 3GTQJ 2EZLA 2VUMJ 1GUUA 2DN0A 1A6IA 3TW7A 1BL0A 1OCTC 5E3LA 2DMPA 5FLVA 4A3LJ 3BQYA 4I6ZA 1SFOJ 2H8RA 2L0KA 3A01B 4RBOA 4W97A 3B6AA 5F27A 4FISA 3BG3A 1MBFA 2HXOA 3TW6A 5E3MA 1JUMA 2X9DA 1IRZA 3C2BA 1TC3C 1IV6A 3S16J 1CQTA 1AKHB 4A93J 3E7LA 4G12A 5M5XJ 1WH5A 2YUSA 2XB0X 1WI3A 4A3JJ 5C4XJ 2Y2ZA 3BR1A 4BXXJ 2GBYA 3GTLJ 2HYJA 2HI3A 1GV5A 2DMUA 1OCPA 3JRAA 2NVYJ 3IH2A 2XSDC 3S15J 1WPKA 4V2FA 1TWGJ 1AKHA 1QPIA 5F0FA 2YS9A 1XS9A 2LVSA 2GM4A 3S1QJ 3K2AA 1ITYA 2L9RA 1FTTA 1JT6A 2KDZA 4A3CJ 1O4XA 2HXIA 1ZK8A 4MLOA 1H88C 3S2DJ 2FD5A 2YU9J 4IHVA 3IV5A 2E1OA 3HOVJ 3CQZJ 3HOXJ 3BR3A 1NK3P 1LFUP 3M3YJ 1ETYA 4J19A 5EZHA 1I6HJ 2KT0A 9ANTA 3RZOJ 2R92J 1MH3A 5EDNA 2M9HA 2LFBA 3HDDA 4D7NA 2JA7J 1RKTA 2EQRA 4C3JJ 3PO3J 2CU7A 1BJZA 5J3LA 2ME6A 1IC8A 2DJNA 4UUTA 3GTKJ 3BTIA 1JKQC 2L7MP 1IG7A 1HF0A 1JTYA 3OIOA 1FJLA 2R5ZB 5IOZA 1U78A 3S14J 3QQAA 3ZQHA 2DMNA 2E2IJ 1GVDA 2RAEA 3CMYA 1XC5A 3OOUA 2NVQJ 3I4MJ 3BTLA 4I76A 4NDLA 3GBGA 4HNVA 5GPCA 1WCMJ 1U9NA 2ID3A 2Y9ZA 1ZR2A 1ENHA 2EZIA 3HM5A 2XB5A 2K40A 1B72B 2HOTA 2VKEA 2DA7A 1F36A 4XIDA 2M8GX 3JRCA 1FTZA 1X2MA 3HGGA 3CDLA 1FIPA 3GTJJ 5F08A 4X6AJ 4JX4A 1MBKA 3JRBA 2QF7A 1RPWA 1SANA 5FKOA 4A3MJ 3A02A 4A3GJ 1QVUA 3LSRA 4BBRJ 1RKWA 2DA6A 3BG9A 2NOGA 5J1YA 4FE4A 1B72A 1ZQ3P 2XPWA 1G2HA 2CQXA 3ZQIA 3VPRA 1ETXA 2K9NA 2JWTA 5HODA 1HLVA 3HGYA 3BR5A 3PM1A 3ZOBA 3G1MA 3O8HA 4QTRA 1IUFA 5M5YJ 5C3EJ 3JREA 1UHSA 3TP0A 2R5YA 4M6VA 1ZTRA 1XG1A 5EZGA 4CYCB 2E2JJ 2PMZN 2EZKA 5K7FA 4M3FA 2Y9YA 4IHXA 2HOSA 1IDZA 3LNQA 2E2HJ 2XRLA 2R0QC 1JUSA 3BTJA 5F0CA 1JKOC 4IEJA 2MW8A 4B4CA 3D1NI 4DYRA 4A3DJ 4RDUA 3A01A 2JA5J 1P7IA 2JJ7A 2JN6A 3ZQGA 1P7JA 3CCYA 4XRSG 2NVTJ 4CYCA 1ETOA 3TP3A 2Y31A 5J1RA 4DYQA 1MBGA 3BR2A 2O9LA 1ZGWA 4C3IJ 5F0HA 3S1RJ 2DA5A 5IYDJ 2IEKA 4JYKA 2L7ZA 1TWFJ 3UKGA 1MBJA 2OF7A 1Z0XA 2DA3A 3JRIA 4A3IJ 2NS8A 3FKIJ 2Y0SN 1GV2A 3RZDJ 1DU0A 5IYBJ 3JRGA 3GTMJ 3BT9A 5FKMA 2AO9A 2R7ZJ 4AUXA 3RKQA 1I3QJ 5EEAA 2IAIA 5IP9J 5E3NA 1K83J 1MSEC 2DA4A 1OJLA 4D5CA 3BTCA 1OFCX 2R93J 3OSGA 1ZKGA 2O7OA 1T33A 2QCOA 4A3KJ 2CQQA 1BA5A 4ABZA 5FLMJ 5FKLA 5EG0B 2FJ1A 5BNGA 4XRMA 4V2GA 5DTDA 2O8KA 5DS9A 1RETA 5GPAA 1RR7A 1R9TJ 1JT0A 3NAUA 1B8IB 2VKVA 3FK7A 5K7ZA 3DEWA 1JJ8C 5M5WJ 2CUEA 1IDYA 5M3FJ 1QVTA 5M3MJ 4C2MJ 4BBSJ 2HQ5A 1D5YA 1HDDC 5EG0A 1FIAA 1LFBA 2DMTA 5J1UA 1H8AC 3B6CA 4D7MA 2IBDA 3MN2A 2JMWA 1VNDA 2DA1A 1ETWA 1ETQA 1NTCA 1B8IA 1VI0A 1TWCJ 4M3DA 5EGOB 2GLOA 2ECBA 1A5JA 2NS7A 5K7HA 2JA8J 5FJ8J 4A3FJ 1LE8B 2FX0A 1APLC 3I4NJ 1Z77A 2R5ZA 4M3EA 1JKPC 1QRYA 2VPRA 3ZQLA 5FKNA 2LD5A 5EGOA 1IGNA 1TWHJ 2ELKA 2MG4A 4L5EA 1DU6A 3JRDA 3LSGA 3H3VK 1MBHA 1LE8A 2TRTA 2HDDA 3TEDA 3PO2J 1ETVA 2LLKA 4X1EA 2XPUA 3SFIA 3GTPJ 2N8GA 4MFDA 1MSFC 4AYBN 2B63J 5IP6A 1JKRC 4IHYA 4MIMA 3JR9A 3OSFA 1T56A 2K9SA 4EEFG 4BY1J 2VI6A 4DW6A 3HOYJ 1X2NA 3RQIA 5EYRA 2X6OA 4JP0A 2M2EA 2XGEA 2COBA 4C3HJ 2D5VA 4D5FA 1S7EA 3K7AJ 3G1OA 4B1RA 2P81A 3LSJA 4JX6A 4BY7J 2LR8A 1UG2A 3O8GA 4AC0A 1AU7A 5F1JA 1X58A 5C44J 3HOWJ 4QSHA 1E3OC 4BKXA 2K9QA 2OPTA 3BQZA 2WB1N 5F04A 3S1MJ 3HB9A 2DMQA 4S0HB 1WH7A 2XGDA 2CRGA 2W48A 3HBLA 2DTZA 1GDTA 1UMQA 4Y52J 1JJ6C 4UUSB 5JLWA 4FCYA 3IH3A 3BR6A 3GTOJ 1JUPA 1AHDP 2E19A 4MO7A 3SJMA 3Q0VA 3SDGA 2JK3A 3HOZJ 4XRSA 1K61A 2ME0A 3G1LA 3Q0WA 5FKKA 5EF6A 3HKZN 4UUSA 3S17J 2X48A 2G0EA 2LK2A 3BG5A 1HDPA 4DYCA 2AHQA 4FTHA 2FQ4A 3M4OJ 1TWAJ 1HCRA 2M0CA 1ZR4A 1NK2P 3F0CA 4XICA 2EH3A 4LOCA 2LP0A 1POGA 1ETKA 1PUFB 2M34A 3LSPA 1JTXA 2I10A 2EBIA 3QPSA 4A3BJ 2LY9A 2EZHA 1JGGA 5IOYA 1U9OA 3QPLA 2H1KA 1YRNB 4GFBA 4IHWA 3GTGJ 5JLXA 1PUFA 1VFCA 5C4JJ 2CJJA 5IPAA 3NARA 2MGQA 1BW6A 2MSYA 1Y1WJ 2LKXA 2HOAA 4DZJA 5IYCJ 1F43A 4DZPA 4B3AA 3HEFA 3L1PA 1GT0C 1WGXA 1YRNA 4XK4A 3Q3SA 1MH4A 2XGCA 2ID6A 3S1NJ 2DA2A 3FK6A 1FEXA 1MBEA 2NVXJ 2L7FP 3WHCA 3IH4A 3Q0UA 1W0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H89 C;  1IJW C;  3DCF A;  3ZQF A;  2Y30 A;  4MFE A;  4M3G A;  4QIW N;  1ORK A;  1Q1V A;  3MKL A;  1VF9 A;  2CUF A;  3FIW A;  2JA6 J;  2XPV A;  4M3B A;  1EF4 A;  3S2H J;  3JRF A;  3HOU J;  4W1U A;  1U8B A;  1W0T A;  2ZB9 A;  2TCT A;  2WV1 A;  3WHB A;  3H0G J;  5GP9 A;  1BW5 A;  4FE7 A;  2WAQ N;  1HOM A;  3FIS A;  3ZQC A;  2LTP A;  3MVP A;  1RES A;  3A03 A;  1MNM C;  2ECC A;  3LOC A;  5E3O A;  4JX5 A;  4Y7N J;  1I50 J;  4A3E J;  2R5Y B;  5IP7 J;  3W6V A;  3JRH A;  4A69 C;  3BR0 A;  1Y1V J;  3GTQ J;  2EZL A;  2VUM J;  1GUU A;  2DN0 A;  1A6I A;  3TW7 A;  1BL0 A;  1OCT C;  5E3L A;  2DMP A;  5FLV A;  4A3L J;  3BQY A;  4I6Z A;  1SFO J;  2H8R A;  2L0K A;  3A01 B;  4RBO A;  4W97 A;  3B6A A;  5F27 A;  4FIS A;  3BG3 A;  1MBF A;  2HXO A;  3TW6 A;  5E3M A;  1JUM A;  2X9D A;  1IRZ A;  3C2B A;  1TC3 C;  1IV6 A;  3S16 J;  1CQT A;  1AKH B;  4A93 J;  3E7L A;  4G12 A;  5M5X J;  1WH5 A;  2YUS A;  2XB0 X;  1WI3 A;  4A3J J;  5C4X J;  2Y2Z A;  3BR1 A;  4BXX J;  2GBY A;  3GTL J;  2HYJ A;  2HI3 A;  1GV5 A;  2DMU A;  1OCP A;  3JRA A;  2NVY J;  3IH2 A;  2XSD C;  3S15 J;  1WPK A;  4V2F A;  1TWG J;  1AKH A;  1QPI A;  5F0F A;  2YS9 A;  1XS9 A;  2LVS A;  2GM4 A;  3S1Q J;  3K2A A;  1ITY A;  2L9R A;  1FTT A;  1JT6 A;  2KDZ A;  4A3C J;  1O4X A;  2HXI A;  1ZK8 A;  4MLO A;  1H88 C;  3S2D J;  2FD5 A;  2YU9 J;  4IHV A;  3IV5 A;  2E1O A;  3HOV J;  3CQZ J;  3HOX J;  3BR3 A;  1NK3 P;  1LFU P;  3M3Y J;  1ETY A;  4J19 A;  5EZH A;  1I6H J;  2KT0 A;  9ANT A;  3RZO J;  2R92 J;  1MH3 A;  5EDN A;  2M9H A;  2LFB A;  3HDD A;  4D7N A;  2JA7 J;  1RKT A;  2EQR A;  4C3J J;  3PO3 J;  2CU7 A;  1BJZ A;  5J3L A;  2ME6 A;  1IC8 A;  2DJN A;  4UUT A;  3GTK J;  3BTI A;  1JKQ C;  2L7M P;  1IG7 A;  1HF0 A;  1JTY A;  3OIO A;  1FJL A;  2R5Z B;  5IOZ A;  1U78 A;  3S14 J;  3QQA A;  3ZQH A;  2DMN A;  2E2I J;  1GVD A;  2RAE A;  3CMY A;  1XC5 A;  3OOU A;  2NVQ J;  3I4M J;  3BTL A;  4I76 A;  4NDL A;  3GBG A;  4HNV A;  5GPC A;  1WCM J;  1U9N A;  2ID3 A;  2Y9Z A;  1ZR2 A;  1ENH A;  2EZI A;  3HM5 A;  2XB5 A;  2K40 A;  1B72 B;  2HOT A;  2VKE A;  2DA7 A;  1F36 A;  4XID A;  2M8G X;  3JRC A;  1FTZ A;  1X2M A;  3HGG A;  3CDL A;  1FIP A;  3GTJ J;  5F08 A;  4X6A J;  4JX4 A;  1MBK A;  3JRB A;  2QF7 A;  1RPW A;  1SAN A;  5FKO A;  4A3M J;  3A02 A;  4A3G J;  1QVU A;  3LSR A;  4BBR J;  1RKW A;  2DA6 A;  3BG9 A;  2NOG A;  5J1Y A;  4FE4 A;  1B72 A;  1ZQ3 P;  2XPW A;  1G2H A;  2CQX A;  3ZQI A;  3VPR A;  1ETX A;  2K9N A;  2JWT A;  5HOD A;  1HLV A;  3HGY A;  3BR5 A;  3PM1 A;  3ZOB A;  3G1M A;  3O8H A;  4QTR A;  1IUF A;  5M5Y J;  5C3E J;  3JRE A;  1UHS A;  3TP0 A;  2R5Y A;  4M6V A;  1ZTR A;  1XG1 A;  5EZG A;  4CYC B;  2E2J J;  2PMZ N;  2EZK A;  5K7F A;  4M3F A;  2Y9Y A;  4IHX A;  2HOS A;  1IDZ A;  3LNQ A;  2E2H J;  2XRL A;  2R0Q C;  1JUS A;  3BTJ A;  5F0C A;  1JKO C;  4IEJ A;  2MW8 A;  4B4C A;  3D1N I;  4DYR A;  4A3D J;  4RDU A;  3A01 A;  2JA5 J;  1P7I A;  2JJ7 A;  2JN6 A;  3ZQG A;  1P7J A;  3CCY A;  4XRS G;  2NVT J;  4CYC A;  1ETO A;  3TP3 A;  2Y31 A;  5J1R A;  4DYQ A;  1MBG A;  3BR2 A;  2O9L A;  1ZGW A;  4C3I J;  5F0H A;  3S1R J;  2DA5 A;  5IYD J;  2IEK A;  4JYK A;  2L7Z A;  1TWF J;  3UKG A;  1MBJ A;  2OF7 A;  1Z0X A;  2DA3 A;  3JRI A;  4A3I J;  2NS8 A;  3FKI J;  2Y0S N;  1GV2 A;  3RZD J;  1DU0 A;  5IYB J;  3JRG A;  3GTM J;  3BT9 A;  5FKM A;  2AO9 A;  2R7Z J;  4AUX A;  3RKQ A;  1I3Q J;  5EEA A;  2IAI A;  5IP9 J;  5E3N A;  1K83 J;  1MSE C;  2DA4 A;  1OJL A;  4D5C A;  3BTC A;  1OFC X;  2R93 J;  3OSG A;  1ZKG A;  2O7O A;  1T33 A;  2QCO A;  4A3K J;  2CQQ A;  1BA5 A;  4ABZ A;  5FLM J;  5FKL A;  5EG0 B;  2FJ1 A;  5BNG A;  4XRM A;  4V2G A;  5DTD A;  2O8K A;  5DS9 A;  1RET A;  5GPA A;  1RR7 A;  1R9T J;  1JT0 A;  3NAU A;  1B8I B;  2VKV A;  3FK7 A;  5K7Z A;  3DEW A;  1JJ8 C;  5M5W J;  2CUE A;  1IDY A;  5M3F J;  1QVT A;  5M3M J;  4C2M J;  4BBS J;  2HQ5 A;  1D5Y A;  1HDD C;  5EG0 A;  1FIA A;  1LFB A;  2DMT A;  5J1U A;  1H8A C;  3B6C A;  4D7M A;  2IBD A;  3MN2 A;  2JMW A;  1VND A;  2DA1 A;  1ETW A;  1ETQ A;  1NTC A;  1B8I A;  1VI0 A;  1TWC J;  4M3D A;  5EGO B;  2GLO A;  2ECB A;  1A5J A;  2NS7 A;  5K7H A;  2JA8 J;  5FJ8 J;  4A3F J;  1LE8 B;  2FX0 A;  1APL C;  3I4N J;  1Z77 A;  2R5Z A;  4M3E A;  1JKP C;  1QRY A;  2VPR A;  3ZQL A;  5FKN A;  2LD5 A;  5EGO A;  1IGN A;  1TWH J;  2ELK A;  2MG4 A;  4L5E A;  1DU6 A;  3JRD A;  3LSG A;  3H3V K;  1MBH A;  1LE8 A;  2TRT A;  2HDD A;  3TED A;  3PO2 J;  1ETV A;  2LLK A;  4X1E A;  2XPU A;  3SFI A;  3GTP J;  2N8G A;  4MFD A;  1MSF C;  4AYB N;  2B63 J;  5IP6 A;  1JKR C;  4IHY A;  4MIM A;  3JR9 A;  3OSF A;  1T56 A;  2K9S A;  4EEF G;  4BY1 J;  2VI6 A;  4DW6 A;  3HOY J;  1X2N A;  3RQI A;  5EYR A;  2X6O A;  4JP0 A;  2M2E A;  2XGE A;  2COB A;  4C3H J;  2D5V A;  4D5F A;  1S7E A;  3K7A J;  3G1O A;  4B1R A;  2P81 A;  3LSJ A;  4JX6 A;  4BY7 J;  2LR8 A;  1UG2 A;  3O8G A;  4AC0 A;  1AU7 A;  5F1J A;  1X58 A;  5C44 J;  3HOW J;  4QSH A;  1E3O C;  4BKX A;  2K9Q A;  2OPT A;  3BQZ A;  2WB1 N;  5F04 A;  3S1M J;  3HB9 A;  2DMQ A;  4S0H B;  1WH7 A;  2XGD A;  2CRG A;  2W48 A;  3HBL A;  2DTZ A;  1GDT A;  1UMQ A;  4Y52 J;  1JJ6 C;  4UUS B;  5JLW A;  4FCY A;  3IH3 A;  3BR6 A;  3GTO J;  1JUP A;  1AHD P;  2E19 A;  4MO7 A;  3SJM A;  3Q0V A;  3SDG A;  2JK3 A;  3HOZ J;  4XRS A;  1K61 A;  2ME0 A;  3G1L A;  3Q0W A;  5FKK A;  5EF6 A;  3HKZ N;  4UUS A;  3S17 J;  2X48 A;  2G0E A;  2LK2 A;  3BG5 A;  1HDP A;  4DYC A;  2AHQ A;  4FTH A;  2FQ4 A;  3M4O J;  1TWA J;  1HCR A;  2M0C A;  1ZR4 A;  1NK2 P;  3F0C A;  4XIC A;  2EH3 A;  4LOC A;  2LP0 A;  1POG A;  1ETK A;  1PUF B;  2M34 A;  3LSP A;  1JTX A;  2I10 A;  2EBI A;  3QPS A;  4A3B J;  2LY9 A;  2EZH A;  1JGG A;  5IOY A;  1U9O A;  3QPL A;  2H1K A;  1YRN B;  4GFB A;  4IHW A;  3GTG J;  5JLX A;  1PUF A;  1VFC A;  5C4J J;  2CJJ A;  5IPA A;  3NAR A;  2MGQ A;  1BW6 A;  2MSY A;  1Y1W J;  2LKX A;  2HOA A;  4DZJ A;  5IYC J;  1F43 A;  4DZP A;  4B3A A;  3HEF A;  3L1P A;  1GT0 C;  1WGX A;  1YRN A;  4XK4 A;  3Q3S A;  1MH4 A;  2XGC A;  2ID6 A;  3S1N J;  2DA2 A;  3FK6 A;  1FEX A;  1MBE A;  2NVX J;  2L7F P;  3WHC A;  3IH4 A;  3Q0U A;  1W0U A; 
#chains in the Genus database with same CATH topology
 5ERI A;  3FWE A;  2JRT A;  2Y30 A;  5BMZ A;  3R60 A;  2LBF A;  3W6K B;  1VF9 A;  4IZZ A;  2L9S A;  5E18 F;  3PNV A;  3HIF A;  3CJR B;  3TBI A;  4XLF A;  2F4I A;  3R61 A;  4O3M A;  2KP6 A;  1S5L C;  1LEA A;  2VOO A;  4LFU A;  2L5Q A;  4II3 A;  3I5U A;  1W0T A;  2JVH A;  4L18 B;  3CDH A;  4Y13 A;  5IY5 H;  2NAZ A;  1ZAR A;  3RDI A;  1TQM A;  3W3C A;  4PFO A;  4FE7 A;  1Z9C A;  3FIS A;  5LBQ A;  3ZQC A;  5HDK A;  2P7C B;  4NHJ A;  2ISZ A;  3A03 A;  1MNM C;  2ECC A;  3LOC A;  3VYR B;  4Y7N J;  5LGU A;  2R5Y B;  3ZN0 A;  5B1A H;  2A6H F;  3K4C A;  1MDM B;  4HLX A;  3BR0 A;  2M30 A;  4U0Y A;  3L2C A;  3H5A A;  1BL0 A;  5E3L A;  2DMP A;  1OLT A;  3L2W A;  2VE9 A;  5FLV A;  3V7R A;  3MKY B;  4PJ0 C;  4I02 A;  1HKQ A;  3OYD A;  2J5P A;  4RBO A;  2DFE A;  2BZT A;  2BOL A;  3OYM A;  1W1W E;  3B6A A;  4XRF A;  3TQN A;  4HQE A;  2KPM A;  3HTS B;  1I27 A;  1UB9 A;  1IN6 A;  3N97 A;  2HU9 A;  3C2B A;  1D3Y A;  4MTD A;  1FOY A;  2VQC A;  3F23 A;  2GXG A;  1CQT A;  1AKH B;  4A93 J;  1DP7 P;  5H20 A;  1TW2 A;  1SAX A;  5M5X J;  1WH5 A;  3F21 A;  2YUS A;  2XB0 X;  1WI3 A;  1NH3 A;  3C7J A;  3K6G A;  5L3E A;  4A3J J;  1ZG5 A;  2Y2Z A;  4BXX J;  2GIV A;  3DV8 A;  1BR4 A;  4UVA A;  1D1B A;  4NC7 A;  2R7W A;  1OYI A;  1OCP A;  3JRA A;  1XN7 A;  5FLX K;  2NVY J;  2XSD C;  2I8D A;  1U5T A;  1HSJ A;  2F48 A;  3MD2 A;  2LVS A;  2VQH A;  2W82 A;  4IX7 A;  2K7L A;  5FO5 A;  2VKD A;  2XAS A;  4BAY A;  2HXI A;  1PJR A;  4MLO A;  2UXX A;  3EYY A;  3BWG A;  1BI1 A;  1T98 A;  4A0X A;  5KHD A;  1H88 C;  3PUB A;  3S8P A;  4G94 A;  3TOB A;  5HDN A;  3V42 A;  3KYL A;  2FD5 A;  1Z91 A;  2IA1 A;  3WE2 A;  3RKW A;  2E36 A;  3H1C A;  2VL8 A;  3H35 A;  4D9J A;  5J4V A;  3HOX J;  4K2E A;  1SFX A;  4RAY A;  1VQL I;  3QRF F;  3ASO H;  2PG4 A;  1ETY A;  5K5Q A;  4FAS D;  1FOK A;  1ZAO A;  2IW5 A;  3CCM I;  3KYC B;  2VOD A;  3OS1 A;  2CFO A;  2KT0 A;  3CME I;  1Y39 A;  2BE5 F;  1XTA A;  3RZO J;  3FZV A;  2ESH A;  2R4G A;  5CQG A;  3WTV C;  2Z3Y A;  1J9I A;  3J7A Y;  3DXJ F;  3CC4 I;  2LFB A;  2OAZ A;  4D7N A;  5LFA A;  1PP7 U;  5L3B A;  5HDG A;  2RQP A;  1A36 A;  2EQR A;  5J8F A;  4R8H A;  1U8R A;  3L09 A;  3DU6 A;  4BQQ A;  2QBY A;  3ZPL A;  2CU7 A;  3FBI B;  5D8L B;  3BZC A;  1IC8 A;  1ZRC A;  3S2W A;  2Y48 A;  2DJN A;  1C0W A;  4G6D A;  3BTI A;  4D0P A;  2WTE A;  1IG7 A;  2NVU B;  4FX0 A;  3DFG A;  4KNY A;  4I09 A;  1HXD A;  1KON A;  5IOZ A;  3HXL A;  1EH7 A;  4P1W A;  4CXF A;  3S14 J;  2A61 A;  1AA7 A;  2NVQ J;  2Y75 A;  4JK1 X;  3F22 A;  4KN7 X;  2HFH A;  4NQW B;  3I3L A;  2A6E F;  3T0Y A;  2MYS A;  1Z1D A;  2DYS H;  2ID3 A;  1ZR2 A;  5TIS C;  1EA3 A;  1ENH A;  1QO0 D;  2QVO A;  2Y9Z A;  2E34 A;  5LHI A;  4ON0 A;  1PUE E;  2HOT A;  2VJ5 A;  3G71 I;  2ZCW A;  3TO7 A;  3JAM Z;  4B09 A;  3FHN A;  2YX4 A;  1MJB A;  2F4M B;  1T2K A;  4M9S A;  4LGW A;  5B5E C;  2P5K A;  4F93 B;  3E6D A;  5KCM A;  1BR1 A;  1V5F A;  3LWF A;  4HX7 A;  3OYI A;  3CUQ C;  3ZMV A;  2A68 F;  4BEH B;  3AAF A;  3IWZ A;  2Z2S B;  2VBY A;  3DBR B;  1ZYR F;  3U21 A;  2ZFW A;  1HLV A;  3LA2 A;  3BR5 A;  2QQ9 A;  1OQY A;  2HKX A;  3H3U A;  3O8H A;  4Q5S F;  3P9K A;  2K3P A;  2UV1 A;  5M5Y J;  4RAF A;  1LDD A;  1XSX A;  4CYC B;  2EZK A;  2QSH X;  4H4K C;  4M3F A;  4XOR A;  2HOS A;  2DU9 A;  3NEU A;  2QUF A;  3I58 A;  3K70 D;  2B9S A;  2XRL A;  1JUS A;  5D5X B;  2EA4 A;  4QPO A;  3RJP A;  1XSD A;  4IEJ A;  3D1N I;  1R1T A;  1TP4 A;  2DI3 A;  4CCM A;  2F5V A;  1KU9 A;  1OKR A;  1W4M A;  2L54 A;  4XL9 A;  4RDU A;  1FLI A;  2HVQ A;  2JN6 A;  2LKP A;  3ZQG A;  1P7J A;  3H9J A;  3CCY A;  2QA4 I;  2DCE A;  5GAD J;  4IO9 F;  1R71 A;  4P9U A;  4LD5 A;  1S7O A;  4AU7 A;  1W7P B;  3TP3 A;  4UVB A;  1I3A A;  3VEP A;  2A69 F;  1IXS B;  4CDG A;  3BR2 A;  4EMS A;  2O9L A;  2LY1 A;  3S1R J;  4AIH A;  3ZMT A;  2DA5 A;  5IYD J;  2IPQ X;  4IQ4 A;  2L7Z A;  3UKG A;  1R22 A;  2K5C A;  3F8F A;  4A3I J;  2V4J C;  4LK0 F;  3IAS 2;  2PQ8 A;  4FT8 A;  3EDP A;  3RZD J;  2OTL I;  1BI0 A;  4IXA A;  1UEL B;  3K70 C;  3GTM J;  2MD0 A;  3K4L A;  2R7Z J;  5BOX A;  1H0M A;  1V3F A;  4M9X A;  5E3N A;  1P4X A;  1USS A;  4G6Q A;  1MSE C;  3HSE A;  3BTC A;  2L3D A;  1ZKG A;  2O7O A;  2A6T A;  2DQL A;  5D6F A;  1X1C A;  2QCO A;  4I98 B;  2CQQ A;  1BA5 A;  1LJ9 A;  5EG0 B;  2FJ1 A;  3F8C A;  2VB6 A;  1PP8 F;  3H36 A;  1QBJ A;  3QPH A;  4ENN A;  1F9N A;  5DS9 A;  2HKO A;  2R3S A;  5GPA A;  2M8E A;  1RR7 A;  1WZ2 A;  2E60 A;  4CCN A;  1T8I A;  1B8I B;  2VKV A;  1EKE A;  3E5Q A;  3KEQ A;  5L3C A;  2CUE A;  4DBR A;  4F55 A;  1ZEL A;  3GLX A;  4HEA 2;  4XR6 A;  5KVR A;  1N78 A;  2HQ5 A;  3OOP A;  1RRJ A;  1D5Y A;  1HDD C;  5LRS A;  2BXZ A;  2DK5 A;  2I5U A;  5HS8 A;  4D7M A;  4HX4 A;  2EIM H;  3FXJ A;  1D8K A;  1IAW A;  2ZJP F;  4EGZ A;  1DPU A;  1FP2 A;  3K9T A;  3HPG A;  3VSL A;  4V19 K;  2KIF A;  4XN0 A;  2PJR B;  5K7H A;  4YIF A;  1QHG A;  4BDY A;  3NWS A;  3PFI A;  3CCQ I;  3AG4 H;  2HVS A;  3I4N J;  2VC0 A;  3KPH A;  3D0S A;  2CWE A;  3TO6 A;  4JOM A;  4XLA A;  2R5Z A;  2BY1 A;  1O7F A;  4IPA A;  1JKP C;  2KJB A;  3SZG A;  2EV5 A;  5FKN A;  4BL0 B;  2HQN A;  2LD5 A;  5EGO A;  4A0Z A;  2DQR A;  3E6B A;  1FBQ A;  3AKZ A;  2DPU A;  2E71 A;  3JRD A;  3QYB A;  3LSG A;  4RS8 A;  4ZYA A;  3CUQ B;  2OUM A;  1VQ8 I;  4CZZ A;  3BJ6 A;  2XGX A;  3K1N A;  2M5W A;  3VB2 A;  3LFK A;  3ROU A;  2LDU A;  4BJ6 C;  2XIG A;  5ILV A;  1VQM I;  2CYY A;  4AYB N;  4U0W A;  2B63 J;  4PFP A;  3N4M A;  5IP6 A;  2OD5 A;  2X4H A;  3FDY A;  5IT3 A;  3JR9 A;  2HWV A;  3OSF A;  3BZK A;  1T56 A;  3FXR A;  1B4A A;  3WGG A;  4XSZ F;  3HOY J;  3RQI A;  2JT1 A;  4RGR A;  3J7Y J;  2DFH A;  4C3H J;  4EAT A;  2D5V A;  4OIP F;  4PUS A;  4G7Z F;  5ILS A;  2BW3 A;  2H8W A;  4Y3O A;  3CCU I;  1AU7 A;  3LST A;  5F1J A;  2VON A;  2DK8 A;  4LLL A;  1E3O C;  5J47 A;  2OPT A;  3J7Z I;  3S1M J;  1WQ2 A;  3KP2 A;  3ZMZ A;  2C6Y A;  4RB3 C;  4M73 A;  1D0X A;  2WA0 A;  2W48 A;  4BAC A;  4Y52 J;  2DFF A;  4OOI A;  5JLW A;  4CCK A;  1K4T A;  2UZK A;  1CF7 A;  2V1X A;  3RKY A;  4E7S A;  3C2G A;  2BY3 A;  2QQ8 A;  2DT6 A;  3GZ6 A;  2W24 A;  3B73 A;  1FOX A;  4KYW A;  3VYT B;  1ERD A;  3WU2 C;  1ZRE A;  4RB2 C;  4WK8 F;  2H6C A;  3HOZ J;  4F91 B;  3ABU A;  3H3Z A;  2ME0 A;  5EF6 A;  4GO1 A;  2K3F A;  2X48 A;  4HF1 A;  2E1C A;  1HDP A;  2Y69 H;  2B0L A;  1G3Y A;  2E1M C;  3E97 A;  5LD2 C;  1Z3X A;  3E6C C;  4E7K A;  1ZR4 A;  1LVK A;  3F0C A;  1G8X A;  2CGP A;  1BOA A;  5CLS A;  4XLP F;  1POG A;  2WWY A;  5JVG F;  2IP2 A;  1HST A;  3ABK H;  3KP5 A;  2P7V B;  2M34 A;  3LSP A;  1WFX A;  3LA3 A;  2I10 A;  2EBI A;  1BIA A;  3VOE A;  5F6F A;  5IT9 K;  4G9Y A;  2BVL A;  4OIO F;  1IZ1 A;  1ZRD A;  1YJN I;  1MD0 A;  2FUG 2;  1B1B A;  3CP8 A;  3DPU A;  3L00 A;  2HVR A;  1WJB A;  1K79 A;  2VT2 A;  1ZGA A;  4HYE A;  2STT A;  2M3A A;  2D1V A;  3LA7 A;  4GFB A;  1SFU A;  2L9N A;  2LH9 A;  4IHW A;  1YQA A;  5CVV A;  5IPA A;  5C4J J;  3L2V A;  3FXL A;  1DP3 A;  3G2B A;  2HTS A;  2OU2 A;  5EJC A;  4FX4 A;  1I1G A;  2F5D A;  2RV8 A;  5D5W B;  3PUF A;  4DZP A;  3GYH X;  3UNG C;  2OC6 A;  2KLO A;  3S1N J;  2VQG A;  2DA2 A;  3FK6 A;  3DBH B;  2GA1 A;  4YG2 F;  3BDD A;  3FXQ A;  3WHC A;  2ELJ A;  1ZQ3 P;  1ETX A;  3Q0U A;  3WU1 B;  4L9T A;  1H89 C;  4R1H A;  2IGO A;  2KZG A;  4HSR A;  3SFZ A;  4QIW N;  3I54 A;  3G6E I;  2M87 A;  3MCZ A;  1SFE A;  2CUF A;  2NRA C;  1WVR A;  4HNT A;  3WTU C;  3FIW A;  2FML A;  2AXT C;  4M3B A;  2FBI A;  1M1E B;  2CV1 A;  5ICG A;  2EB7 A;  3JRF A;  4LG3 A;  3QOP A;  2ZB9 A;  2WV1 A;  4M6X A;  2WAQ N;  1TW3 A;  1R5I D;  4LG0 A;  1OMI A;  3MVP A;  4A5M A;  5E1Z B;  3A0B C;  1WSU A;  3HZJ A;  1DPR A;  3BP8 A;  5E3O A;  4JX5 A;  5CVR A;  4A3E J;  4B43 A;  3BRO A;  1JXS A;  1E0E A;  3PQK A;  2O3F A;  4ENM A;  4B8X A;  2EZL A;  5H6Q A;  1D5V A;  3KEY A;  1OCT C;  1SAU A;  3S3O A;  1P4W A;  2ZXI A;  1YJ9 I;  3GVA A;  2F2E A;  3X2Q H;  3BQY A;  4I6Z A;  1SFO J;  2H8R A;  2ZNY A;  1HW5 A;  1R58 A;  3A01 B;  4ZZL A;  2G7H A;  3RPQ A;  1UAA A;  1QU3 A;  2HXO A;  3TW6 A;  1MDM A;  2X9D A;  2XV4 S;  1XDU A;  1IV6 A;  3S16 J;  1TBX A;  4H0E A;  2R7X A;  5TJJ A;  2EV6 A;  3HG9 A;  2DXI A;  4KT5 C;  3RTR A;  2W00 A;  4I7H A;  1O3R A;  4E6K G;  4GXO A;  2HYJ A;  3AG1 H;  3U1K A;  3AG2 H;  2OTJ I;  1R23 A;  1IRG A;  1PVE A;  2DMU A;  3FXU A;  5JHF A;  2E1M B;  4L5J A;  2MFZ A;  4DNC A;  2ZJ2 A;  1NHA A;  1AKH A;  3K4B A;  2GM4 A;  1YYV A;  2XAU A;  1FTT A;  1T38 A;  1JT6 A;  1P4A A;  3RYP A;  1PYV A;  4PGG A;  1YOV B;  1ZHF A;  1ZK8 A;  1S7A A;  4PJL A;  4BUP A;  4I99 C;  4OAY A;  1FSE A;  3TL4 X;  3O2P E;  2R7R A;  1QNT A;  3EYI A;  1SVO A;  4IHV A;  2E35 A;  3HOV J;  2W1O A;  3I53 A;  2GA2 A;  5GAH J;  4AVZ A;  2KQR A;  1NK3 P;  1LFU P;  1K4S A;  3M3Y J;  5JVT A;  5EZH A;  2ZFU A;  4CYD A;  2HZD A;  2LRE A;  9ANT A;  3FXK A;  1MH3 A;  1V55 H;  2R92 J;  4F92 B;  2M9H A;  3HDD A;  3WTY C;  1A6Q A;  1REP C;  4ZDO A;  3U1D A;  4AIJ A;  4BE1 A;  2BVM A;  2KJC A;  2DPD A;  1HC8 A;  1RKT A;  4C3J J;  2H27 A;  1XPX A;  1BJZ A;  3M1E A;  2ZJQ F;  5E79 C;  3KLO A;  1E3H A;  1ZGJ A;  3DU5 A;  4UUT A;  2XAH A;  1O3Q A;  5ILU A;  1JKQ C;  1T0F C;  2L7M P;  4EQQ A;  1HF0 A;  3J80 K;  1JTY A;  4PSX A;  1B9M A;  1KU2 A;  4ZYD A;  4E4H A;  4N0B A;  2QEX I;  3HUG B;  1FJL A;  3WE3 A;  3H5R A;  3VDX A;  4ETS A;  3C2H A;  3MWM A;  3ZQH A;  2DMN A;  3DLA A;  2RAE A;  3E6M A;  2K4B A;  3LSM A;  4E7H A;  1X3U A;  3GBG A;  2G9W A;  3NWT A;  5HS7 A;  4DJA A;  1FYL A;  1MGT A;  4HNV A;  4I2O A;  4EJT A;  1WCM J;  1U9N A;  3RYR A;  2EZI A;  3M8F A;  2KFD A;  4EGY A;  5TRD A;  1HA8 A;  3GUD A;  4PCQ A;  1R1V A;  2K40 A;  2P6S A;  4XOP A;  1B72 B;  3KET A;  2M8G X;  3JRC A;  1FTZ A;  3KZI C;  4N9I A;  2KIQ A;  2O61 A;  1TQP A;  2P6T A;  1MBK A;  2QF7 A;  1QGP A;  3JW4 A;  4NQW A;  2ZO4 A;  4A3M J;  5CQE A;  1YIT I;  4IHT A;  1CGP A;  3LSR A;  3OYA A;  1G59 A;  1RKW A;  2DA6 A;  2KIS A;  3BG9 A;  3CCJ I;  2NOG A;  4FE4 A;  2CFX A;  1VQN I;  3VPR A;  4YFX F;  2JUC A;  3OWT A;  2Z9O A;  1T95 A;  1YI2 I;  2EIK H;  4YEL A;  2K9N A;  4OMZ A;  4Y4R A;  1P92 A;  3PM1 A;  3F6V A;  3ZOB A;  3DLL F;  2GOM A;  1W7P D;  2HDW A;  5L3G A;  2AQE A;  3RIR A;  3JRE A;  1UHS A;  2LRD A;  3BY6 A;  4KIB A;  4OWR B;  2Q0O A;  4ESF A;  1XGN A;  3V7S A;  2YU3 A;  4BEH A;  1TT0 A;  2Y9Y A;  2BV6 A;  5LEJ A;  1IDZ A;  4AYB A;  1UST A;  4U7D A;  2L01 A;  5L3F A;  4BHC A;  4DYR A;  2VXZ A;  4A3D J;  1V4R A;  3AG3 H;  2JA5 J;  1WWX A;  4G7O F;  4N4O B;  1G4D A;  3L2U A;  4CIC A;  1S72 I;  4CYC A;  2IGK A;  4EJV A;  3HOS A;  2VQL A;  2W57 A;  5J1R A;  2OA4 A;  1MBG A;  3H9G A;  1ODD A;  5DYM A;  1IN8 A;  2LNB A;  5F0H A;  2R7D A;  3M1C A;  4BJT A;  2H94 A;  2L02 A;  4JYK A;  2DO7 A;  4Y17 A;  1TWF J;  1MKM A;  1MBJ A;  5CKT A;  3Q9V A;  1XX5 A;  3FKI J;  1X3W B;  2WBM A;  4PDK A;  3OR2 C;  1RUN A;  1SFK A;  1DU0 A;  3E0J B;  1W7P A;  2JPC A;  3VYS B;  2KIU A;  3BT9 A;  5FKM A;  2MC4 A;  2HZT A;  2HYG D;  1XCB A;  5A2Q K;  1Z7U A;  2IAI A;  1Z6T A;  4TV7 A;  5IP9 J;  3V7C A;  1K83 J;  2HQA A;  3OR1 C;  1OCC H;  2MA3 A;  2PEX A;  2W84 A;  1P2F A;  1OFC X;  1XGM A;  3GW2 A;  3M8E A;  4N4N B;  2QLZ A;  2W4S A;  1T33 A;  1XMA A;  2WV0 A;  4B3X A;  4UY8 I;  2DTR A;  3GLL A;  4ABZ A;  5FKL A;  1Z67 A;  4HA8 A;  1OR7 C;  2RNJ A;  3A4C A;  3GME A;  2OCE A;  3E5X A;  4X0G A;  3CC7 I;  3IWF A;  2GQQ A;  3KLN A;  5K7Z A;  3I4P A;  2V9V A;  2JVG A;  3DEW A;  4HLY A;  3HJE A;  5M5W J;  3PFY A;  2CV0 A;  3S93 A;  5E1W A;  5EG0 A;  1XSV A;  3ZGK A;  3D5R C;  2PX9 A;  1KQ9 A;  2XRN A;  3MN2 A;  1Z7L A;  1VND A;  1ETW A;  4EVI A;  1NTC A;  2LYC A;  3C18 A;  1B8I A;  3CMM A;  4M3D A;  3CD6 I;  2ECB A;  1R49 A;  2X1E A;  5FLX Z;  4AVP A;  1LB2 A;  1GHC A;  3KP4 A;  1APL C;  1BN5 A;  1KYZ A;  3F3X A;  4P5O A;  4CH7 A;  2ZNZ A;  2GXA A;  5H2F C;  4CCJ A;  2FBH A;  4XQF A;  2F6C A;  1G3W A;  3DKW A;  1WJC A;  4M3E A;  1IUY A;  4A6D A;  1S9H A;  3DKY A;  2O03 A;  1UJ8 A;  5HLG A;  3BCB A;  1IGN A;  2ELK A;  3FM3 A;  2PJR A;  2STW A;  1YJW I;  3H3V K;  4CA0 A;  2BEO A;  4R79 A;  1XMK A;  4IKF A;  1MBH A;  4E7Z A;  1F1Z A;  2VC1 A;  3TED A;  2DLL A;  3WGI A;  4ESJ A;  3J81 K;  2LLK A;  3QWL A;  1Q1H A;  5LGN A;  4X1E A;  4BHP A;  4HDV A;  1YX5 A;  3C1D A;  3KZY A;  1KU7 A;  4E7I A;  3GTP J;  2N8G A;  3OY9 A;  1VTN C;  5FRN A;  3IRR A;  1JKR C;  5DD8 A;  1BI2 A;  4MIM A;  3HRT A;  4RM3 A;  4U7B A;  3DF8 A;  3CUQ A;  2O0Y A;  3H5N A;  1MNE A;  2O6G E;  1FSH A;  4NB5 A;  4XOT A;  4DW6 A;  4ZYE A;  2VT3 A;  3S32 A;  4HNU A;  3I0T A;  2LF8 A;  3DQV C;  1J5Y A;  5LEK A;  4C2U A;  1WJF A;  3OYJ A;  3GXO A;  3LSJ A;  4BY7 J;  2CV2 A;  2K85 A;  1GVJ A;  2LR8 A;  1FC3 A;  4AC0 A;  1X58 A;  3HOW J;  4QSH A;  2HDC A;  2DT7 B;  5F04 A;  5HLI A;  2EIN H;  2X1C A;  1KQ8 A;  2WAQ A;  4ZJZ A;  5BS6 A;  5DCF A;  2F4O B;  5F64 A;  2XGD A;  2IVM A;  3E1S A;  3GO5 A;  3HBL A;  3KIO A;  4UHT A;  3COA C;  2R7V A;  2G7U A;  3ZP5 A;  4UUS B;  1WKM A;  3RQ4 A;  2XHK A;  4PGH A;  4EM0 B;  1JHF A;  4IRG A;  3LAP A;  2R7Q A;  3CJQ B;  1WI9 A;  3GTO J;  2UUZ A;  1DUX C;  1VQK I;  2ZME C;  4L9V A;  5DM7 F;  3OYG A;  3Q0V A;  4C30 A;  2JK3 A;  3WTX C;  1BR2 A;  1HKT A;  5FKK A;  3PSF A;  1IV8 A;  1J59 A;  2NS0 A;  1DQU A;  2ZSI B;  1KYW A;  4DGW B;  4HDU A;  5BPI A;  2IS6 A;  1KQ0 A;  3TOA A;  1Y0N A;  1G3T A;  2FQ4 A;  3GFI A;  1IN7 A;  2EK5 A;  2X6Y A;  1TWA J;  2R7F A;  1HCR A;  1FY7 A;  2M0C A;  4CO8 A;  4BQO A;  1W36 C;  2CW8 A;  2ZKZ A;  3LMM A;  3QPT A;  2EH3 A;  4HZF A;  3RPU D;  2OZ6 A;  1WJA A;  5ICE A;  1R5H A;  3RKX A;  4KIC A;  1PUF B;  2F5F A;  3ECO A;  1G3S A;  5GTH C;  2CMP A;  2EZH A;  3PNY A;  3WGH A;  2HNH A;  5IOY A;  2IRF G;  2VJJ A;  3ZRG A;  1VQ6 I;  1L0O C;  5KAI C;  3LAJ A;  5ICF A;  2Q2E B;  3W2A A;  1K6Y A;  3ERM A;  4NBQ A;  1V5E A;  3K69 A;  4ZYG A;  4YIR X;  3DWL E;  2CJJ A;  4E70 A;  3NAR A;  5B3S H;  2A07 F;  4UB8 C;  2VLA A;  2FMY A;  3GEZ A;  1BM9 A;  4GCV A;  1QQI A;  3K10 A;  2QQA A;  4KIF A;  2WY8 Q;  3N05 A;  4XLC A;  1F43 A;  1EJ9 A;  2PI0 A;  3L1P A;  3OYC A;  1WGX A;  2QYO A;  2HS5 A;  3QU6 A;  3CDI A;  5D6E A;  4DQ2 A;  2VBW A;  4G8X A;  1MBE A;  2V1N A;  2ZXH A;  4GRI A;  1F5T A;  4CCO A;  2ELH A;  4RM2 A;  3JSO A;  1LDJ A;  3RPU A;  1IJW C;  2DOA A;  3ZQF A;  2AS5 F;  4OU0 A;  2V6C A;  1ORK A;  2VJI A;  3MKL A;  5CVI A;  2RVC A;  1KZH A;  5D4S A;  3FBN B;  1VZ0 A;  3BCA A;  4EV0 A;  1RZ4 A;  1UZC A;  1B6A A;  2XPV A;  4LIV A;  1U6G A;  1EF4 A;  3S2H J;  3HOU J;  3OYK A;  4W1U A;  5CJ9 A;  1U8B A;  4WX9 A;  3QYF A;  2TCT A;  4HF2 A;  5GP9 A;  3JTG A;  1ZN2 A;  1HOM A;  2FNP A;  4LIU A;  3Q9S A;  4E7J A;  1RES A;  1BC8 C;  1SMY F;  3I64 A;  4CCL A;  3W6V A;  5J40 A;  3P9C A;  1D1A A;  4A69 C;  1R36 A;  3GTQ J;  1IN4 A;  2CS3 A;  2X0L A;  3I9V 2;  4LIT A;  3H9Q A;  3TW7 A;  1AWC A;  1Z21 A;  4XM3 A;  3WG7 H;  3IKT A;  2FOW A;  4ZDP A;  4CHU A;  2L0K A;  4BU2 A;  5H6R A;  5TGT A;  4YII A;  3ISP A;  4FIS A;  4IF4 A;  1RNL A;  3BG3 A;  2EV0 A;  3HRU A;  1MBF A;  3ZQ7 A;  1JUM A;  1K78 B;  4BE2 A;  1IRZ A;  1TC3 C;  2ZME B;  4MHG A;  3CES A;  3I59 B;  2VE8 A;  5KK1 A;  3E7L A;  4G12 A;  4M72 A;  1SVM A;  2BGC A;  4KT6 A;  3BJO A;  3BR1 A;  1Y6I A;  3TDU C;  4HG2 A;  1IRF A;  1GV5 A;  2HI3 A;  2KHM A;  4RGU A;  3OMY A;  2BY2 A;  3FKJ A;  1I39 A;  1UFM A;  3S15 J;  4N9H A;  3EUH C;  4V2F A;  4B47 A;  2VXD A;  1QPI A;  5DM6 F;  5F0F A;  2YS9 A;  2KMU A;  1XS9 A;  2OBP A;  2DOD A;  3K2A A;  2L9R A;  4MQV A;  1RUO A;  2KZV A;  3D5S C;  2PLY A;  3A1Y A;  2XF5 A;  1DDN A;  2ZXJ A;  2AXL A;  2V79 A;  4JBA A;  3S2D J;  2M4G A;  3ECH A;  2YU9 J;  2QSG X;  3CCS I;  1VQ9 I;  1IXR C;  2OJE D;  1JGS A;  2D45 A;  1WJE A;  5GAE J;  1S29 A;  3CQZ J;  3R0J A;  3BR3 A;  3U2R A;  3HHG A;  3DPT A;  4KN4 X;  2ISY A;  1RIO H;  2ZSH B;  1I6H J;  2FOK A;  1KU3 A;  3E5U A;  2RNG A;  3ZR8 X;  4HST A;  2X85 A;  2MLK A;  4NNJ A;  4IJA A;  3RCO A;  4WXD A;  1SEU A;  3BOQ A;  1PDN C;  2WC2 A;  4BQA A;  3MMY B;  2H1L A;  3JSP A;  4HOB A;  2B7E A;  2JSC A;  1HW1 A;  1X19 A;  2Z1D A;  2ME6 A;  3P5J A;  2RKH A;  4GYG A;  1MJA A;  3CF5 F;  1R6R A;  1DGW Y;  1WJD A;  3OIO A;  5HVQ C;  2PN6 A;  2KDO A;  2R5Z B;  2K27 A;  3OL4 A;  2D2W A;  3K4M A;  3RSN A;  1BI3 A;  1YTY A;  1HQC A;  3CP2 A;  3BLY A;  3I4M J;  4I76 A;  3WU0 A;  2PMU A;  3MZH A;  1H9T A;  3H0D A;  2QSF X;  1OCZ H;  3HM5 A;  4RB1 A;  2XB5 A;  3ABM H;  4PJM A;  1RR8 C;  3Q5F A;  1T6S A;  2VJ4 A;  2VKE A;  4PJJ A;  3HUG A;  3CCL I;  3KZZ A;  2IXS A;  3R4K A;  5DUK A;  2DW4 A;  2HTJ A;  1FYK A;  3OYF A;  2R7O A;  2LKS A;  3CDL A;  3HGG A;  4JX4 A;  3JRB A;  2KRF A;  4U0V A;  1SAN A;  5FKO A;  4A3G J;  1J7K A;  5IT9 Z;  4BBR J;  2L4A A;  4LJZ F;  2TDX A;  1R7J A;  1FBS A;  3ZQQ A;  4KA4 A;  5HS9 A;  1B72 A;  2EFQ A;  2K02 A;  2JZY A;  4OIQ F;  1G2H A;  2CQX A;  3ZQI A;  2HPM A;  1NG7 A;  4Z2Y A;  1QZE A;  2HR3 A;  3TKY A;  1Y0U A;  3S3N A;  3GFL A;  2FSW A;  5E1X A;  2JWT A;  5HOD A;  1IW7 F;  2BXY A;  3HGY A;  3CCR I;  3G1M A;  3DPL C;  1VQO I;  1EV7 A;  1IXC A;  1FT9 A;  3SXY A;  3W2V A;  2CW7 A;  4OIR F;  2KRC A;  5C3E J;  4WWC A;  3TP0 A;  1Z3Y A;  4XN3 A;  2R5Y A;  3MKW B;  3ABL H;  2XKO A;  5HNF A;  1FMV A;  1XG1 A;  5EZG A;  4AWX B;  4KDP A;  2PMZ N;  3WG9 A;  3IAM 2;  3OYE A;  1R5G A;  4XLH A;  4IHX A;  2K4J A;  2L2O A;  3LNQ A;  1XB4 A;  2E2H J;  2R0Q C;  1S3J A;  3BTJ A;  5F0C A;  1X1D A;  4YFK F;  1FP1 D;  4P96 A;  2MW8 A;  1FX7 A;  2QKL B;  4MGR A;  4DOZ A;  1SD5 A;  4XON A;  3P9I A;  4I0A A;  1O3T A;  3SZP A;  1ZH5 A;  2JJ7 A;  4FHT A;  2NVT J;  4XRS G;  2X6W A;  1ETO A;  5HLH A;  2Y31 A;  2RRE A;  1WHU A;  3CLO A;  3T5X A;  1ZGW A;  4C3I J;  3CJT B;  3SDB A;  1JE8 A;  1IN5 A;  2HEO A;  2CUJ A;  4L0Y B;  2IEK A;  5EEG A;  2IA2 A;  1D0Z A;  1SVL A;  1X4P A;  1Y56 A;  2OF7 A;  3KCC A;  1Z0X A;  2BYV E;  2DA3 A;  1SMT A;  3JRI A;  1HBX G;  2Y0S N;  3IUO A;  1GV2 A;  3GFM A;  3V8L A;  1U3E M;  3FXO A;  1A31 A;  2XF6 A;  3JRG A;  4AUX A;  2M7A A;  2H6B A;  4O5V A;  5EEA A;  2RDP A;  1FMW A;  1ON1 A;  3DKX A;  1MMG A;  2Z5U A;  3DTE A;  2DA4 A;  1OJL A;  2VBX A;  3FMS A;  4D5C A;  4UVC A;  2FQ3 A;  1LEB A;  1J75 A;  2R93 J;  3OSG A;  2ZXW H;  3G73 A;  2RQQ A;  4BE0 A;  4A3K J;  5DCM B;  4J00 A;  5BNG A;  2HPI A;  3VWB A;  4C9Y A;  2O8K A;  4L5I A;  1RET A;  2X6X A;  3HRM A;  4HW0 A;  4BXU A;  1R9T J;  1A35 A;  4QLC U;  3FK7 A;  3FM5 A;  5J6X A;  2R7U A;  2DOE A;  4I01 A;  3V8J A;  5AON A;  4JQF A;  1XGO A;  1FNN A;  2P5V A;  5M3F J;  3K4N A;  4C2M J;  2P0W A;  2VBZ A;  4BBS J;  5E17 F;  2A3S A;  2DMT A;  3K0L A;  2V1U A;  2R7T A;  2IBD A;  2JMW A;  3R6S A;  5KAF C;  3L2R A;  5B1B H;  4F3Q A;  1ETQ A;  1ACI A;  1TWC J;  2KRH A;  3PQJ A;  1T0F A;  2GLO A;  3S3M A;  1A5J A;  5D5V B;  2XAJ A;  5FJ8 J;  4LMY A;  3BZ6 A;  1LE8 B;  2FX0 A;  1W5S A;  2J5O A;  1Z77 A;  2XAF A;  2A5W A;  3D5L A;  1QRY A;  2VPR A;  1LVA A;  3VFZ A;  2E5N A;  4NC6 A;  2ZJR F;  4ANJ A;  5D4R A;  1I1S A;  3HC7 A;  2LSO A;  2Z16 A;  3M8J A;  2TRT A;  2OZU A;  5JR3 A;  2HDD A;  3R0A A;  2A05 A;  4LG0 B;  3PO2 J;  1ETV A;  1XDS A;  3DEU A;  3GF2 A;  4AIK A;  4RLQ A;  3A0H C;  2XPU A;  3EET A;  3HYI A;  2IJL A;  1LUJ B;  2XAQ A;  2HQR A;  2LG4 A;  3BG6 A;  1R00 A;  2XUB A;  2HYF A;  4UV8 A;  1ONV A;  2XF7 A;  2JA2 A;  1U0J A;  5J8C A;  2DYR H;  2FU4 A;  3J7A O;  4ZDL A;  3SQN A;  2QZ8 A;  4BY1 J;  2W85 A;  2W25 A;  3IKV A;  4II2 A;  1X2N A;  4PZJ A;  4JP0 A;  1YS7 A;  2M2E A;  2XGE A;  2Y0M A;  4G6T B;  4E7L A;  1MMN A;  4D5F A;  1R1U A;  1S7E A;  3C3W A;  5DDG A;  5CPR B;  2V1D A;  2P81 A;  4HBL A;  4JX6 A;  2JUG A;  3J80 Z;  1UG2 A;  2HOE A;  3ABT A;  4ZC3 A;  1LQ1 A;  1OYW A;  4BKX A;  3BJA A;  1RI7 A;  1OCO H;  1KGS A;  2WB1 N;  4PSW A;  2X51 A;  3HB9 A;  1N75 A;  1BOB A;  2WY7 Q;  3SYT A;  4RB0 A;  4S0H B;  3OS2 A;  1WH7 A;  2M0M A;  3CMA I;  1GDT A;  3LQR A;  1UMQ A;  4OIN F;  3CLQ A;  4QWQ A;  1JJ6 C;  1BBY A;  4IVN A;  3OYN A;  3CF2 A;  4FCY A;  1MND A;  3IH3 A;  3W6J B;  2E19 A;  1W5C C;  4AID A;  4MO7 A;  1MW7 A;  5BQT A;  1U5T C;  3SJM A;  3SDG A;  3K4J A;  3M9A A;  1WJ5 A;  1K61 A;  2LC2 A;  3MQ0 A;  4WXC A;  3CO7 C;  3Q0W A;  2UXN A;  2XDV A;  4RAG A;  3E3V A;  3HKZ N;  4MQ9 F;  4UUS A;  4LB5 A;  3IRQ A;  3BG5 A;  2E1N A;  5K5O A;  4DYC A;  2AHQ A;  1SC7 A;  4FTH A;  4XBF A;  3M4O J;  2QKM B;  4WXH A;  1LNW A;  3ZMD A;  3GZN B;  3FMR A;  2D1H A;  4XIC A;  3JAM K;  2DOF A;  1S6L A;  4EM1 A;  2IS4 A;  3T8R A;  1JTX A;  1VQ4 I;  4A3B J;  5K1Y A;  1BC7 C;  1TZL A;  1Z05 A;  4M6Y A;  1OPC A;  1OR7 A;  3QPL A;  1DGR M;  3PL8 A;  1YRN B;  2IA0 A;  3GTG J;  5GTI C;  3QOE A;  1PUF A;  3WOD F;  1XGS A;  1VFC A;  2NYX A;  2DDA A;  1YHQ I;  5CYV A;  2RC4 A;  2P4W A;  2JQ7 A;  4EJU A;  2MSY A;  4KIT B;  1IRX A;  5J4Y A;  4DZJ A;  1X1A A;  1YW7 A;  5IYC J;  3MFK A;  3WTW C;  2CQ7 A;  4CGZ A;  3HHH A;  2LBF B;  1BIB A;  3HEF A;  1GT0 C;  4XK4 A;  2Q2E A;  3ML6 A;  3Q3S A;  3TGN A;  3MEX A;  1MH4 A;  2JSP A;  2VN2 A;  2XGC A;  2ID6 A;  3O3K A;  4XKB A;  2VPL A;  1FEX A;  5EEH A;  2NVX J;  1JI8 A;  1D0Y A;  4UV9 A;  1AHD P;  3IH4 A;  5HLT A;  1W0U A;  2QM3 A;  4KMF A;  3EPZ A;  3F8N A;  3LL7 A;  3FF5 A;  3DCF A;  3ASN H;  5A2Q Z;  4MFE A;  3HOT A;  4M3G A;  2DFI A;  1Q1V A;  3B02 A;  4GGG A;  5JFR A;  4Z6Y A;  3OYL A;  2JA6 J;  2CUZ A;  3PJR A;  1SD6 A;  1YO5 C;  4F52 A;  4U88 A;  2IS2 A;  1WRJ A;  3VYU B;  2FNA A;  1QA6 A;  4IRI A;  1MMS A;  1YE9 A;  3DTK A;  3AFH A;  1ZLJ A;  5AIP A;  3M7G A;  3H0G J;  3WHB A;  3CCE I;  4D1Q A;  4LLN A;  3VOD A;  1BW5 A;  3QP6 A;  2LTP A;  2X1D A;  3GWZ A;  3F9K A;  4UUV A;  3KP6 A;  3MZ8 A;  1I50 J;  4XLN F;  5F1R A;  3L9F A;  4MEY F;  5IP7 J;  5DUI A;  3L2Q A;  3JRH A;  3F6O A;  1VQP I;  3GCM A;  5CVJ A;  1OCR H;  1RC9 A;  1Y1V J;  2LF7 A;  3DP7 A;  2VUM J;  1GUU A;  3OYB A;  2DN0 A;  1A6I A;  2CH0 A;  2PFB A;  2YSR A;  3CZ6 A;  3IHU A;  4PK4 A;  3WTS C;  1FWZ A;  4A3L J;  1N77 A;  4EJW A;  4IRH A;  2WAF A;  1N25 A;  1G6N A;  5E8G A;  4F7Z A;  4J01 A;  1W36 D;  2NNN A;  4W97 A;  2GOX B;  3RI4 A;  5F27 A;  1U2W A;  4M74 A;  3V8K A;  3PNT A;  4MNU A;  4CUG A;  2KL4 A;  2EFN A;  5E3M A;  2EFW A;  1V54 H;  4HAM A;  3DTI A;  1U5T B;  3QYE A;  2M1B A;  4U87 A;  2AQF A;  2L7K A;  3FHZ A;  4BGD A;  1W5T A;  1VQ7 I;  5L3D A;  2P8T A;  2XRO A;  5C4X J;  2GBY A;  3GTL J;  4LLG F;  2PMH A;  3NQO A;  5FD5 A;  4HF0 A;  4B44 A;  1T39 A;  3ZMU A;  1K78 A;  3FX3 A;  4HV6 A;  1LKX A;  1YIO A;  2PMZ A;  2ZME A;  3ESW B;  1WPK A;  3G3Z A;  3IH2 A;  1TWG J;  3I59 A;  3J81 Z;  5DV5 A;  3S1Q J;  1ITY A;  2KDZ A;  4A3C J;  1ON2 A;  1O4X A;  4ENK A;  4RGX A;  4Q47 A;  3CUO A;  1OIS A;  2IT0 A;  1MJ9 A;  3PIP F;  1F4K A;  3SEQ A;  5LHH A;  3LQQ A;  4WCG A;  4Q4Z F;  2E1O A;  3IV5 A;  4XKW A;  5ICC A;  3JCU C;  4Q48 A;  5JHU A;  2DBB A;  2QBY B;  4J19 A;  1YW8 A;  1TNT A;  1J0R A;  1MMA A;  5LRR A;  2V6E A;  4XKC A;  1MZB A;  5D5U B;  1B9N A;  1QHH D;  3KX2 A;  2YPR A;  2Y0S A;  4CSW A;  5EDN A;  3VSK A;  4KIS A;  4A2U A;  2ACJ A;  1LDK B;  2CQN A;  2JA7 J;  4C2T A;  3PIO F;  3U9G A;  1X4O A;  1Y8Q B;  2FEZ A;  3ZN1 A;  4YEJ A;  3WTT C;  3PO3 J;  3M07 A;  5J3L A;  1FOW A;  3GTK J;  3QOD A;  3OIQ A;  3ONQ A;  4IHS A;  1U78 A;  2WAD A;  3CCV I;  1YG2 A;  2ICW G;  5DD4 A;  3QQA A;  2YX7 A;  4B48 A;  2E2I J;  1GVD A;  4KMU X;  5FB2 A;  1XC5 A;  3OOU A;  3CMY A;  2K9M A;  4O6J A;  3A2K A;  4PJN A;  3BTL A;  4NDL A;  5GPC A;  4YFN F;  1O7L A;  3I71 A;  4MTE A;  1GLN A;  4ESB A;  4BQN A;  2DA7 A;  1F36 A;  2H09 A;  4XID A;  4LK1 F;  1QZZ A;  3K1M A;  2E7X A;  1X2M A;  2IGM A;  4ASN A;  3BC8 A;  1FIP A;  4BYY A;  3GTJ J;  5F08 A;  4X6A J;  2MH2 A;  2FRH A;  2MAB A;  1RPW A;  2FXA A;  1HKS A;  3A02 A;  2Z33 A;  1EH6 A;  1QVU A;  4DIQ A;  1I5Z A;  2V9K A;  3HPH A;  5J1Y A;  5E8I A;  4XMY A;  3I56 I;  2F5E A;  2XPW A;  3L7W A;  4ZTF A;  5E20 A;  5FRM A;  2CSO A;  1FYM A;  2LMD A;  2QGU A;  5FRO A;  3JTH A;  4A12 A;  3SEZ A;  1D1C A;  3OV8 A;  2BBY A;  2Q8K A;  2FA5 A;  4HX8 A;  2ZC2 A;  2HGC A;  1FPQ A;  3MAJ A;  3HSR A;  4M9Z A;  2XKP A;  1O57 A;  4QTR A;  1ULY A;  4UXN A;  1IUF A;  1E17 A;  2ETH A;  3KYD B;  2OQG A;  1I6X A;  4M6V A;  1ZTR A;  2E2J J;  1SD7 A;  5K7F A;  4NC8 A;  1ZG3 A;  4LB6 B;  3EQL F;  2RGV A;  3K4K A;  4BH9 A;  1JKO C;  2GIZ A;  1A04 A;  2M45 A;  4B4C A;  2UWM A;  1GXQ A;  1B59 A;  3OYH A;  3A01 A;  1HW2 A;  1P7I A;  5LHG A;  2JPB A;  1H9G A;  3BG7 A;  5KNL A;  1TNS A;  2XC7 A;  4KUM A;  1K7A A;  3KEO A;  3SZT A;  2JRM A;  2W7N A;  4A0Y A;  4DYQ A;  3CTA A;  3LFU A;  2NNY A;  3KP3 A;  4ITV A;  3T8T A;  4BJ5 C;  2ADU A;  3F8B A;  3PSI A;  1VQ5 I;  4L0Z B;  4RGS A;  2NOJ B;  5K5R A;  3EUH A;  1P9Q C;  2WB1 A;  2YR2 A;  3K2Z A;  2NS8 A;  2EFP A;  2GAU A;  4ZYH A;  1FBU A;  4S05 A;  1UG0 A;  5IYB J;  2AO9 A;  3RKQ A;  4OAZ A;  1I3Q J;  1UHM A;  4KIG A;  3DBL B;  1EH8 A;  4P55 A;  1P6R A;  3GX4 X;  3F8M A;  2QWW A;  5LGT A;  3EUK L;  2COM A;  1XD7 A;  3QP5 A;  4G7H F;  3AL0 C;  2EPF A;  4RAZ A;  5FGM A;  4EM2 A;  5FD6 A;  5FLM J;  3GFJ A;  2EFO A;  4YRV A;  4XRM A;  4V2G A;  4DBQ A;  5DTD A;  3HL2 A;  2BY0 A;  2BHZ A;  1J09 A;  1O3S A;  3REO A;  3FXM A;  1X3Z B;  3V4G A;  1TTY A;  3HKZ A;  1JT0 A;  4IL6 C;  3NAU A;  1X1B A;  3TO9 A;  3G4S I;  4FET A;  4FQG A;  2VIX A;  1T08 B;  5HNH A;  1STZ A;  4RMN A;  1JJ8 C;  1XMX A;  3H92 A;  2FF4 A;  1IDY A;  2XVC A;  4BDZ A;  1QVT A;  1D8J A;  5M3M J;  5DCM A;  1FIA A;  2O8X A;  1LFB A;  4HQM A;  5J1U A;  3B6C A;  1H8A C;  2XAG A;  3HRS A;  1FZP B;  1NG6 A;  1BJA A;  2GXB A;  3LSK A;  1TT5 B;  2DDB A;  2KKO A;  3SHF A;  2DA1 A;  5GAG J;  4HRI A;  4ZTJ A;  4Y33 A;  1VI0 A;  1IO2 A;  5EGO B;  2NS7 A;  2JA8 J;  4A3F J;  2OQR A;  4BNC A;  2Z99 A;  3QU3 A;  4CZC A;  1Y8R B;  2K9L A;  1XCV A;  2E7W A;  3GZ5 A;  2DAO A;  1L3L A;  3DEE A;  3ZQL A;  3T1B A;  2ZBK A;  3CJN A;  2QQB A;  4ZZD A;  1IF1 A;  2L4M A;  1TWH J;  2MG4 A;  4L5E A;  1DU6 A;  3UR3 C;  4M71 A;  1LE8 A;  2CO5 A;  3LSI A;  4I0B A;  3TDZ C;  3ZXS A;  1LFP A;  1MMD A;  2QEN A;  3I55 I;  1S8N A;  3EUA A;  4OMY A;  3SFI A;  1MSF C;  4MFD A;  1K6O A;  2GWR A;  3ERE D;  1GXP A;  4IHY A;  1QPM A;  2BW3 B;  2DT5 A;  2ESN A;  2MBF A;  2CG4 A;  5AIQ A;  2CQK A;  5D8K B;  2K9S A;  4UNO A;  4XNF A;  6PAX A;  2V9P A;  4EEF G;  4GYI A;  2VI6 A;  4EJO A;  2VAS A;  2EIJ H;  3ELK A;  5EYR A;  2X6O A;  2EIL H;  4A6E A;  2FE3 A;  2EA2 A;  2COB A;  2DJI A;  4XSX F;  4KFC A;  4KJZ A;  1E3P A;  5BPD A;  1J2X A;  1X1P A;  3K7A J;  4IOA F;  1UHW A;  3G1O A;  4B1R A;  4AM3 A;  5B66 C;  4P9F A;  1CF7 B;  3O8G A;  2EJR A;  5C44 J;  1R4N B;  2JTV A;  2K9Q A;  1Z6R A;  2VKH A;  2M7B A;  1YX3 A;  3BQZ A;  1QZY A;  2E5Z A;  1ZLK A;  2DMQ A;  4ZH4 F;  1YLF A;  3MZY A;  4L9N A;  3TMO A;  2L9V A;  2CRG A;  2DTZ A;  3KP7 A;  3KFW X;  2PJP A;  5FFZ A;  2BHY A;  1YW9 A;  2MC3 A;  1MIJ A;  2F5C A;  1YS6 A;  3BR6 A;  1OYY A;  2OCC H;  2K86 A;  1JUP A;  1JHH A;  3ZCO A;  2IS1 A;  2A5Y B;  1ZRF A;  3FMQ A;  2OV7 A;  3K1P A;  3OS0 A;  1ZG1 A;  4XRS A;  3G1L A;  4RLF A;  4IOC F;  2PBI A;  1YIJ I;  3S17 J;  3IC7 A;  4BHB A;  2G0E A;  2LK2 A;  5ED4 A;  3AL0 B;  3OL3 A;  3O6B B;  4RA2 A;  1TL8 A;  3IP4 B;  1YFH A;  5LLQ A;  1NK2 P;  4A5N A;  4LOC A;  2LP0 A;  4HPQ A;  3P7N A;  1ETK A;  4HV5 A;  3LSH A;  3BPX A;  3ULQ B;  2O5R A;  2NXN B;  1TQI A;  2MH9 A;  4AD9 A;  2EWN A;  3QPS A;  1UCR A;  1KA8 A;  2LY9 A;  2IGN A;  2MLG A;  1JGG A;  3HSF A;  3IL2 A;  2Q1Z B;  4WF2 A;  2CW0 F;  3BPV A;  1U9O A;  2V26 A;  2P5L C;  4GDF A;  2H1K A;  2XSJ C;  1E2X A;  3OIP A;  3NRV A;  2VOP A;  5JLX A;  3W2W A;  5CVU A;  4BS9 A;  3MKZ A;  2KIM A;  2FBK A;  4NUB A;  2MGQ A;  4UB6 C;  4XKV A;  1BW6 A;  4L9J A;  1LPQ A;  1Y1W J;  1TLH B;  2LKX A;  2WAE A;  4IQJ A;  5JI6 A;  2HOA A;  4QPQ A;  4S04 A;  2R7S A;  2LOO A;  5HOO A;  3CO6 C;  1SD4 A;  4B3A A;  2LY2 A;  3F72 A;  1YRN A;  3WTZ A;  2RN7 A;  2MD5 A;  4BXF A;  3CC2 I;  1V5G A;  3ZMS A;  4ENJ A;  3QAH A;  1AOY A;  2V7F A;  4MEX F;  1R4M B;  4XLE A;  2M4K A;  2L7F P;  3KE2 A;  5DEQ A;  3HTU A;  4Y15 A;  2GZW A;  5FFX A; 
#chains in the Genus database with same CATH homology
 1H89 C;  1IJW C;  3DCF A;  3ZQF A;  2Y30 A;  4MFE A;  4M3G A;  4QIW N;  1ORK A;  1Q1V A;  3MKL A;  1VF9 A;  2CUF A;  3FIW A;  2JA6 J;  2XPV A;  4M3B A;  1EF4 A;  3S2H J;  3JRF A;  3HOU J;  4W1U A;  1U8B A;  1W0T A;  2ZB9 A;  2TCT A;  2WV1 A;  3WHB A;  3H0G J;  5GP9 A;  1BW5 A;  4FE7 A;  2WAQ N;  1HOM A;  3FIS A;  3ZQC A;  2LTP A;  3MVP A;  1RES A;  3A03 A;  1MNM C;  2ECC A;  3LOC A;  5E3O A;  4JX5 A;  4Y7N J;  1I50 J;  4A3E J;  2R5Y B;  5IP7 J;  3W6V A;  3JRH A;  4A69 C;  3BR0 A;  1Y1V J;  3GTQ J;  2EZL A;  2VUM J;  1GUU A;  2DN0 A;  1A6I A;  3TW7 A;  1BL0 A;  1OCT C;  5E3L A;  2DMP A;  5FLV A;  4A3L J;  3BQY A;  4I6Z A;  1SFO J;  2H8R A;  2L0K A;  3A01 B;  4RBO A;  4W97 A;  3B6A A;  5F27 A;  4FIS A;  3BG3 A;  1MBF A;  2HXO A;  3TW6 A;  5E3M A;  1JUM A;  2X9D A;  1IRZ A;  3C2B A;  1TC3 C;  1IV6 A;  3S16 J;  1CQT A;  1AKH B;  4A93 J;  3E7L A;  4G12 A;  5M5X J;  1WH5 A;  2YUS A;  2XB0 X;  1WI3 A;  4A3J J;  5C4X J;  2Y2Z A;  3BR1 A;  4BXX J;  2GBY A;  3GTL J;  2HYJ A;  2HI3 A;  1GV5 A;  2DMU A;  1OCP A;  3JRA A;  2NVY J;  3IH2 A;  2XSD C;  3S15 J;  1WPK A;  4V2F A;  1TWG J;  1AKH A;  1QPI A;  5F0F A;  2YS9 A;  1XS9 A;  2LVS A;  2GM4 A;  3S1Q J;  3K2A A;  1ITY A;  2L9R A;  1FTT A;  1JT6 A;  2KDZ A;  4A3C J;  1O4X A;  2HXI A;  1ZK8 A;  4MLO A;  1H88 C;  3S2D J;  2FD5 A;  2YU9 J;  4IHV A;  3IV5 A;  2E1O A;  3HOV J;  3CQZ J;  3HOX J;  3BR3 A;  1NK3 P;  1LFU P;  3M3Y J;  1ETY A;  4J19 A;  5EZH A;  1I6H J;  2KT0 A;  9ANT A;  3RZO J;  2R92 J;  1MH3 A;  5EDN A;  2M9H A;  2LFB A;  3HDD A;  4D7N A;  2JA7 J;  1RKT A;  2EQR A;  4C3J J;  3PO3 J;  2CU7 A;  1BJZ A;  5J3L A;  2ME6 A;  1IC8 A;  2DJN A;  4UUT A;  3GTK J;  3BTI A;  1JKQ C;  2L7M P;  1IG7 A;  1HF0 A;  1JTY A;  3OIO A;  1FJL A;  2R5Z B;  5IOZ A;  1U78 A;  3S14 J;  3QQA A;  3ZQH A;  2DMN A;  2E2I J;  1GVD A;  2RAE A;  3CMY A;  1XC5 A;  3OOU A;  2NVQ J;  3I4M J;  3BTL A;  4I76 A;  4NDL A;  3GBG A;  4HNV A;  5GPC A;  1WCM J;  1U9N A;  2ID3 A;  2Y9Z A;  1ZR2 A;  1ENH A;  2EZI A;  3HM5 A;  2XB5 A;  2K40 A;  1B72 B;  2HOT A;  2VKE A;  2DA7 A;  1F36 A;  4XID A;  2M8G X;  3JRC A;  1FTZ A;  1X2M A;  3HGG A;  3CDL A;  1FIP A;  3GTJ J;  5F08 A;  4X6A J;  4JX4 A;  1MBK A;  3JRB A;  2QF7 A;  1RPW A;  1SAN A;  5FKO A;  4A3M J;  3A02 A;  4A3G J;  1QVU A;  3LSR A;  4BBR J;  1RKW A;  2DA6 A;  3BG9 A;  2NOG A;  5J1Y A;  4FE4 A;  1B72 A;  1ZQ3 P;  2XPW A;  1G2H A;  2CQX A;  3ZQI A;  3VPR A;  1ETX A;  2K9N A;  2JWT A;  5HOD A;  1HLV A;  3HGY A;  3BR5 A;  3PM1 A;  3ZOB A;  3G1M A;  3O8H A;  4QTR A;  1IUF A;  5M5Y J;  5C3E J;  3JRE A;  1UHS A;  3TP0 A;  2R5Y A;  4M6V A;  1ZTR A;  1XG1 A;  5EZG A;  4CYC B;  2E2J J;  2PMZ N;  2EZK A;  5K7F A;  4M3F A;  2Y9Y A;  4IHX A;  2HOS A;  1IDZ A;  3LNQ A;  2E2H J;  2XRL A;  2R0Q C;  1JUS A;  3BTJ A;  5F0C A;  1JKO C;  4IEJ A;  2MW8 A;  4B4C A;  3D1N I;  4DYR A;  4A3D J;  4RDU A;  3A01 A;  2JA5 J;  1P7I A;  2JJ7 A;  2JN6 A;  3ZQG A;  1P7J A;  3CCY A;  4XRS G;  2NVT J;  4CYC A;  1ETO A;  3TP3 A;  2Y31 A;  5J1R A;  4DYQ A;  1MBG A;  3BR2 A;  2O9L A;  1ZGW A;  4C3I J;  5F0H A;  3S1R J;  2DA5 A;  5IYD J;  2IEK A;  4JYK A;  2L7Z A;  1TWF J;  3UKG A;  1MBJ A;  2OF7 A;  1Z0X A;  2DA3 A;  3JRI A;  4A3I J;  2NS8 A;  3FKI J;  2Y0S N;  1GV2 A;  3RZD J;  1DU0 A;  5IYB J;  3JRG A;  3GTM J;  3BT9 A;  5FKM A;  2AO9 A;  2R7Z J;  4AUX A;  3RKQ A;  1I3Q J;  5EEA A;  2IAI A;  5IP9 J;  5E3N A;  1K83 J;  1MSE C;  2DA4 A;  1OJL A;  4D5C A;  3BTC A;  1OFC X;  2R93 J;  3OSG A;  1ZKG A;  2O7O A;  1T33 A;  2QCO A;  4A3K J;  2CQQ A;  1BA5 A;  4ABZ A;  5FLM J;  5FKL A;  5EG0 B;  2FJ1 A;  5BNG A;  4XRM A;  4V2G A;  5DTD A;  2O8K A;  5DS9 A;  1RET A;  5GPA A;  1RR7 A;  1R9T J;  1JT0 A;  3NAU A;  1B8I B;  2VKV A;  3FK7 A;  5K7Z A;  3DEW A;  1JJ8 C;  5M5W J;  2CUE A;  1IDY A;  5M3F J;  1QVT A;  5M3M J;  4C2M J;  4BBS J;  2HQ5 A;  1D5Y A;  1HDD C;  5EG0 A;  1FIA A;  1LFB A;  2DMT A;  5J1U A;  1H8A C;  3B6C A;  4D7M A;  2IBD A;  3MN2 A;  2JMW A;  1VND A;  2DA1 A;  1ETW A;  1ETQ A;  1NTC A;  1B8I A;  1VI0 A;  1TWC J;  4M3D A;  5EGO B;  2GLO A;  2ECB A;  1A5J A;  2NS7 A;  5K7H A;  2JA8 J;  5FJ8 J;  4A3F J;  1LE8 B;  2FX0 A;  1APL C;  3I4N J;  1Z77 A;  2R5Z A;  4M3E A;  1JKP C;  1QRY A;  2VPR A;  3ZQL A;  5FKN A;  2LD5 A;  5EGO A;  1IGN A;  1TWH J;  2ELK A;  2MG4 A;  4L5E A;  1DU6 A;  3JRD A;  3LSG A;  3H3V K;  1MBH A;  1LE8 A;  2TRT A;  2HDD A;  3TED A;  3PO2 J;  1ETV A;  2LLK A;  4X1E A;  2XPU A;  3SFI A;  3GTP J;  2N8G A;  4MFD A;  1MSF C;  4AYB N;  2B63 J;  5IP6 A;  1JKR C;  4IHY A;  4MIM A;  3JR9 A;  3OSF A;  1T56 A;  2K9S A;  4EEF G;  4BY1 J;  2VI6 A;  4DW6 A;  3HOY J;  1X2N A;  3RQI A;  5EYR A;  2X6O A;  4JP0 A;  2M2E A;  2XGE A;  2COB A;  4C3H J;  2D5V A;  4D5F A;  1S7E A;  3K7A J;  3G1O A;  4B1R A;  2P81 A;  3LSJ A;  4JX6 A;  4BY7 J;  2LR8 A;  1UG2 A;  3O8G A;  4AC0 A;  1AU7 A;  5F1J A;  1X58 A;  5C44 J;  3HOW J;  4QSH A;  1E3O C;  4BKX A;  2K9Q A;  2OPT A;  3BQZ A;  2WB1 N;  5F04 A;  3S1M J;  3HB9 A;  2DMQ A;  4S0H B;  1WH7 A;  2XGD A;  2CRG A;  2W48 A;  3HBL A;  2DTZ A;  1GDT A;  1UMQ A;  4Y52 J;  1JJ6 C;  4UUS B;  5JLW A;  4FCY A;  3IH3 A;  3BR6 A;  3GTO J;  1JUP A;  1AHD P;  2E19 A;  4MO7 A;  3SJM A;  3Q0V A;  3SDG A;  2JK3 A;  3HOZ J;  4XRS A;  1K61 A;  2ME0 A;  3G1L A;  3Q0W A;  5FKK A;  5EF6 A;  3HKZ N;  4UUS A;  3S17 J;  2X48 A;  2G0E A;  2LK2 A;  3BG5 A;  1HDP A;  4DYC A;  2AHQ A;  4FTH A;  2FQ4 A;  3M4O J;  1TWA J;  1HCR A;  2M0C A;  1ZR4 A;  1NK2 P;  3F0C A;  4XIC A;  2EH3 A;  4LOC A;  2LP0 A;  1POG A;  1ETK A;  1PUF B;  2M34 A;  3LSP A;  1JTX A;  2I10 A;  2EBI A;  3QPS A;  4A3B J;  2LY9 A;  2EZH A;  1JGG A;  5IOY A;  1U9O A;  3QPL A;  2H1K A;  1YRN B;  4GFB A;  4IHW A;  3GTG J;  5JLX A;  1PUF A;  1VFC A;  5C4J J;  2CJJ A;  5IPA A;  3NAR A;  2MGQ A;  1BW6 A;  2MSY A;  1Y1W J;  2LKX A;  2HOA A;  4DZJ A;  5IYC J;  1F43 A;  4DZP A;  4B3A A;  3HEF A;  3L1P A;  1GT0 C;  1WGX A;  1YRN A;  4XK4 A;  3Q3S A;  1MH4 A;  2XGC A;  2ID6 A;  3S1N J;  2DA2 A;  3FK6 A;  1FEX A;  1MBE A;  2NVX J;  2L7F P;  3WHC A;  3IH4 A;  3Q0U A;  1W0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...