4X6AJ

Crystal structure of yeast rna polymerase ii encountering oxidative cyclopurine dna lesions
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of RNA polymerase II bypass of oxidative cyclopurine DNA lesions.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription/dna
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4x6aJ00
1ETQA 3E7LA 1UMQA 3BR1A 4DZJA 3WHCA 1XC5A 5K7ZA 3JRDA 1UG2A 4MLOA 5FKLA 1JKOC 3M3YJ 3S1RJ 1TWAJ 2R5YB 2DA2A 4C3IJ 3HEFA 2EBIA 1A5JA 2DMNA 5IP6A 2Y31A 3OIOA 2LFBA 5M5YJ 2HXOA 2HI3A 4D7NA 2DA3A 3RQIA 3LSJA 1JUPA 3A01B 5HODA 4A3GJ 4DYCA 1PUFB 1QVTA 4FE4A 2O8KA 1HF0A 4M3GA 2B63J 2Y9ZA 4A3JJ 1Y1VJ 5J1RA 1MSFC 4D5FA 1YRNA 1H89C 1WPKA 2L0KA 2XGEA 2E19A 1POGA 2DN0A 2YUSA 3Q0VA 5F08A 4C3HJ 5M3MJ 2R5ZB 9ANTA 2L7ZA 1AU7A 2DMQA 4DW6A 3BR6A 2CUFA 2R7ZJ 2DA1A 4UUSB 3HOVJ 4XICA 4CYCA 2PMZN 2X6OA 4A3IJ 2HOTA 4X1EA 2KT0A 4ABZA 1MBHA 1TWHJ 4M3FA 1MNMC 5IOZA 4G12A 2NS8A 3FKIJ 5FJ8J 3ZQCA 3W6VA 5F1JA 2FQ4A 5GP9A 2K40A 3S2HJ 2N8GA 5IPAA 1ETXA 2E2IJ 2W48A 4DZPA 1WCMJ 2DJNA 4A3CJ 4BBRJ 2CUEA 2TRTA 5IOYA 1DU0A 3LOCA 4LOCA 3RKQA 1K61A 5FLVA 2DTZA 2O7OA 2R0QC 3L1PA 1GV5A 1NK3P 1RPWA 3HB9A 2QF7A 2WB1N 3Q0WA 3HOWJ 1VI0A 1G2HA 3C2BA 5DS9A 5EGOA 4RBOA 3LNQA 3JRAA 1UHSA 4FE7A 4MO7A 2MSYA 5M3FJ 4XIDA 5EYRA 3DEWA 2JA5J 3TP3A 5F0CA 1JJ6C 1JTYA 4QSHA 1AKHB 3PO3J 1FIAA 5FKMA 1ZR4A 1JKRC 1GUUA 3DCFA 4D5CA 4I76A 4XK4A 3GTLJ 1Q1VA 3HBLA 1JTXA 3GTQJ 1BA5A 4MIMA 1ETOA 4BY7J 2M0CA 3CQZJ 3O8HA 2Y0SN 1OFCX 3M4OJ 1SFOJ 2CU7A 1HLVA 2CJJA 3HGYA 2NOGA 5E3LA 2XPWA 3G1MA 5IYBJ 2R5YA 4A3KJ 4BXXJ 1LFUP 3H0GJ 5E3MA 3HM5A 4W1UA 3CDLA 2VKVA 1OCTC 3A01A 3IV5A 1VF9A 4L5EA 5IYDJ 3ZQLA 3MVPA 1MBGA 2JA8J 1HDDC 1JGGA 4A3BJ 3BG9A 2MGQA 2D5VA 5DTDA 1RR7A 2DA6A 2NS7A 2JA6J 1TWGJ 2DA5A 1VNDA 2IBDA 1GVDA 4D7MA 2R5ZA 1ETKA 3S14J 4M3BA 1ETVA 1IDYA 2K9SA 5EZHA 1RETA 1Z77A 1I6HJ 2XGDA 2CRGA 1U8BA 4UUSA 2Y9YA 1T33A 5J1YA 1HCRA 2R93J 1U78A 1MH3A 2GBYA 2NVXJ 3NAUA 1JT6A 4IHVA 3GTKJ 1CQTA 3HOYJ 1E3OC 3BG5A 1X2MA 4NDLA 3GTGJ 1MSEC 3S1NJ 4AC0A 3F0CA 2P81A 3WHBA 3JR9A 3A03A 1TWCJ 5EF6A 3JRCA 4HNVA 3VPRA 1MBKA 1XG1A 1JKPC 5FKKA 3TEDA 2Y30A 2G0EA 5IP7J 1BW6A 1APLC 2YU9J 4M6VA 3OSFA 5C4JJ 2XB0X 2EQRA 2FD5A 2TCTA 4JYKA 1ETYA 1IDZA 1QRYA 2X48A 3HOZJ 5BNGA 4I6ZA 2OPTA 1EF4A 1MBJA 3LSRA 1BL0A 4JX4A 5FKNA 3LSGA 2IAIA 2GLOA 3ZOBA 1IJWC 3B6AA 1JT0A 4QIWN 3HOXJ 3TW6A 4M3EA 1I3QJ 1P7JA 4Y52J 4B1RA 3S16J 1TWFJ 1D5YA 3BR5A 2DA4A 1S7EA 3S15J 4IEJA 4AYBN 3JRBA 1AKHA 1MBEA 5EZGA 2QCOA 2EZHA 2XRLA 1ITYA 2FJ1A 4BBSJ 2FX0A 3S1QJ 2YS9A 1GT0C 5J3LA 1WH5A 2ID6A 1ETWA 3I4MJ 2DMPA 2GM4A 4V2GA 3FISA 5E3NA 1AHDP 2L9RA 1IGNA 3K2AA 1WI3A 1JUSA 3QPLA 4BY1J 3BTCA 4XRSG 1K83J 2E2JJ 1LE8B 1ZR2A 4GFBA 2E2HJ 3IH2A 3S2DJ 2ME0A 2K9QA 4EEFG 2VI6A 2H8RA 1MH4A 1NTCA 3Q3SA 2WV1A 5JLWA 1B8IB 3S17J 4FISA 2X9DA 3G1LA 3GTMJ 5FKOA 2O9LA 2EZLA 2HXIA 1B72B 1ZTRA 1ZGWA 1ZKGA 2JA7J 3JRIA 5F27A 2HYJA 3QPSA 3ZQHA 1PUFA 3K7AJ 1JUMA 1NK2P 2K9NA 4JX6A 1R9TJ 3QQAA 5M5XJ 2HDDA 2DA7A 5F0FA 4RDUA 4A3FJ 4C2MJ 5C3EJ 1U9NA 3SJMA 4S0HB 3BR2A 1DU6A 1P7IA 2IEKA 3MKLA 3D1NI 1FTTA 1QVUA 2JN6A 2LD5A 1LFBA 5K7HA 3HOUJ 1H8AC 1QPIA 5EG0B 3BTIA 3CCYA 3G1OA 2LP0A 2ECBA 2XPUA 3BG3A 3PO2J 2NVQJ 4X6AJ 5F0HA 1A6IA 2XGCA 3GBGA 3BR3A 2VUMJ 4DYRA 4A3LJ 1W0TA 2HOSA 2ELKA 3O8GA 1IRZA 5C4XJ 3CMYA 3UKGA 1RKWA 3HGGA 4V2FA 1ZQ3P 2LR8A 3MN2A 4MFDA 4J19A 4A3MJ 2M34A 1HDPA 3JRHA 2LY9A 2VPRA 1W0UA 1IG7A 3ZQGA 3BTLA 4B3AA 1GV2A 3BQYA 5JLXA 3IH3A 2NVTJ 2M2EA 2EH3A 2L7MP 2KDZA 1ORKA 1WGXA 2AO9A 1ZK8A 4Y7NJ 1RKTA 3LSPA 1H88C 4DYQA 2COBA 5IP9J 1VFCA 2ID3A 2DMUA 2XB5A 1YRNB 2M8GX 4JX5A 3B6CA 1OJLA 4JP0A 2EZKA 5IYCJ 4IHYA 4A3DJ 3GTJJ 2HQ5A 1GDTA 3FK6A 5GPCA 4B4CA 3NARA 3OSGA 3BQZA 2AHQA 3JRGA 1Z0XA 3TP0A 1BJZA 1SANA 4CYCB 2LLKA 1FEXA 2EZIA 4FCYA 1IV6A 1U9OA 2L7FP 5C44J 2HOAA 3GTPJ 3H3VK 1F36A 4C3JJ 2XPVA 1O4XA 1X58A 3JREA 2M9HA 2VKEA 1LE8A 3GTOJ 3BT9A 2Y2ZA 4QTRA 3IH4A 2LK2A 2LKXA 1ENHA 2NVYJ 2ME6A 2RAEA 4XRSA 2DMTA 5EEAA 3SDGA 3FK7A 1WH7A 1B8IA 1FIPA 4MFEA 1IUFA 3RZOJ 3RZDJ 1JJ8C 3TW7A 4BKXA 5K7FA 4A69C 3I4NJ 1B72A 1RESA 2CQQA 4FTHA 4IHXA 3ZQIA 2ECCA 5F04A 2ZB9A 1JKQC 1T56A 2H1KA 3SFIA 5GPAA 2I10A 2E1OA 3Q0UA 1BW5A 3FIWA 5EDNA 4XRMA 2LVSA 5EGOB 4A93J 1X2NA 4AUXA 3A02A 2JWTA 4A3EJ 1HOMA 3HKZN 4M3DA 3S1MJ 5EG0A 1F43A 3OOUA 5J1UA 5FLMJ 1MBFA 3HDDA 3JRFA 2LTPA 1I50J 5E3OA 1FTZA 1IC8A 4W97A 1TC3C 4IHWA 2CQXA 3BTJA 1FJLA 2JMWA 1XS9A 2R92J 2OF7A 2XSDC 2WAQN 2MG4A 5M5WJ 2JJ7A 2JK3A 1OCPA 3PM1A 4UUTA 3ZQFA 1Y1WJ 2MW8A 3BR0A
chains in the Genus database with same CATH superfamily
1ETQA 2ACJA 2BXZA 3LSMA 1TT0A 5K7ZA 3HRMA 1JKOC 1VQMI 1BM9A 1EH6A 2BZTA 3IKVA 2CMPA 1XTAA 3RIRA 5BS6A 2DA2A 2R7DA 3TO9A 5LEKA 2M1BA 2DMNA 2X1EA 2Y31A 3OIOA 5H6QA 3K4BA 1SD5A 2DA3A 3BC8A 3I4PA 4XBFA 3PIOF 3A01B 3DXJF 1MDMA 1HBXG 1L0OC 5L3DA 2CQKA 4M3GA 5K5QA 2Y9ZA 1Y1VJ 1BI0A 2EIJH 4GCVA 2E1MC 1OCRH 1MSFC 4D5FA 2STTA 1HC8A 4ESBA 1WPKA 3H36A 2L0KA 2E19A 4ETSA 1POGA 2DN0A 2EV6A 4N4NB 3Q0VA 3L2RA 1MKMA 2LKSA 2DMQA 2CUFA 2CFOA 1Y6IA 2V1NA 3HOVJ 4XICA 4R1HA 3ZMUA 4CYCA 3S3MA 3CUQB 1ERDA 1Z67A 1VQ5I 2H6BA 3AL0B 2EWNA 1PUEE 4EJTA 4ABZA 4I2OA 4F92B 4OWRB 3WODF 3LFKA 2XROA 1L3LA 2DT7B 5GAEJ 3H5NA 4M6YA 5KNLA 1CGPA 3P7NA 2DYSH 1USSA 4LFUA 1SVMA 3ZQCA 1B4AA 3ZQQA 3W6VA 2RQQA 4MHGA 2FQ4A 2XAUA 5GP9A 4E6KG 3CTAA 2KIUA 3ABTA 2F5CA 3OYFA 2W48A 3BPXA 3FM5A 4Z6YA 1F5TA 2PN6A 3C2GA 2PQ8A 1O7LA 3M1CA 3LOCA 4LOCA 1R6RA 4L5IA 3RKQA 2XKPA 3WTSC 5FLVA 2DTZA 4IVNA 1MNDA 5L3CA 3W2WA 3L1PA 1NK3P 1QPMA 3HB9A 3DKXA 3WG7H 2ZCWA 3HOWJ 1IN5A 4M72A 1BN5A 3E6MA 1T6SA 3L9FA 1WHUA 1X3WB 2DI3A 3LNQA 3DLAA 3JRAA 1UHSA 4IRGA 3I58A 2MSYA 4XIDA 3HL2A 2K86A 3TP3A 4XSXF 5F0CA 1JTYA 3EUAA 3PO3J 4KN7X 1XB4A 1ZR4A 1JKRC 4UVCA 3DCFA 1E3HA 4D5CA 3M8EA 4ENNA 2BE5F 4XK4A 5LHHA 1Q1VA 1YJNI 3A0HC 3BJAA 2P5KA 1WZ2A 5J40A 3GEZA 3T0YA 2DOEA 2XF6A 3RSNA 5BPDA 2BXYA 3RPQA 2NOGA 5E3LA 2K9LA 3KYDB 3G1MA 4LK0F 2LOOA 5FLXK 2VODA 2QKLB 3GW2A 3QAHA 2R7OA 3HSFA 3PFIA 2R5YA 4WXHA 3H0GJ 3I5UA 3HM5A 3CDLA 2LF7A 2COMA 1WFXA 3OIQA 1OCTC 2RNGA 3HUGB 4UVAA 5IYDJ 2NXNB 3W2AA 2XSJC 5DCMB 3OYAA 1KQ9A 2GWRA 3R0JA 3K1NA 3QYBA 1JGGA 2MFZA 3BG9A 4QPQA 5DTDA 3JAMK 3SQNA 3PIPF 2DA6A 5BPIA 3CMAI 2DA5A 2QENA 3H9QA 5DV5A 1GVDA 4MEYF 2R5ZA 1YFHA 3HXLA 4BQQA 4M3BA 5GAGJ 2CV1A 2RREA 2PMZA 4HAMA 3E1SA 1EH8A 1UCRA 2VB6A 2A6TA 5CPRB 5D6EA 3WU2C 1U78A 3JSOA 2IA2A 3WTTC 4DNCA 2ISZA 1X2MA 4NDLA 1YJ9I 3AFHA 2BEOA 1F4KA 2EILH 2P81A 4YIIA 3A03A 1XSVA 1MGTA 3F8MA 4B48A 3VPRA 1P92A 2JSCA 4WCGA 1XG1A 2HS5A 4OIQF 3MKZA 5FKKA 1IRFA 2EFQA 3BZCA 3PFYA 1KU2A 2J5PA 4G6DA 5LHIA 1REPC 2E5ZA 2R7VA 2IT0A 1STZA 1XGNA 3GVAA 1O7FA 1APLC 3BG6A 4KMUX 1ZELA 3VB2A 1QZYA 2YU9J 1Y56A 4UV8A 3LA3A 3S2WA 1KU3A 2FD5A 4YFNF 3LMMA 4HF2A 1WRJA 1XMKA 1W36C 3LSTA 2IRFG 1EKEA 4I6ZA 2JVHA 3DU6A 2A5YB 2LNBA 5KCMA 3ULQB 2VLAA 5FKNA 1K6OA 1OR7A 2GLOA 3I71A 3ZOBA 4CA0A 4ESJA 2CFXA 2NNNA 3BCAA 1JT0A 4QIWN 3HOXJ 2HR3A 2E34A 3TW6A 1Z9CA 4I98B 4I09A 2X6XA 5CVVA 1ULYA 3H9JA 4BHPA 1HKQA 1TQPA 3ZR8X 2A07F 1E2XA 3OS0A 2ZNYA 4MTDA 1ZAOA 1K6YA 1AWCA 1ZLKA 5EZGA 4ZZDA 4M71A 1Z21A 2K3PA 2V6CA 2QBYB 3CJQB 2KZGA 1P4XA 3GZ6A 2Y0SA 2WY7Q 2NOJB 4C9YA 4BBSJ 3S1QJ 1FPQA 2VL8A 4WX9A 3KZZA 1YIJI 1WH5A 2ID6A 3I4MJ 3V42A 3OMYA 3C18A 1OCCH 2OCEA 5L3BA 3K2AA 3S3NA 4LLLA 1JUSA 4BJ6C 3QPLA 4BY1J 4KYWA 1ZG5A 2LYCA 4XRSG 5JR3A 3FX3A 3AG3H 2Y69H 3S2DJ 3FDYA 3DKWA 1DPRA 2QQ9A 1NTCA 5JLWA 3FXRA 3V8KA 4ENKA 2DDBA 2X9DA 3E6CC 5A2QK 1R5ID 3T5XA 5LRSA 2L54A 2OUMA 2CW7A 3QPSA 4A6DA 4XLCA 3ZN1A 2VPLA 1JGSA 3TOBA 4U0YA 2K5CA 5HS9A 5GTIC 3Q5FA 2QM3A 5C3EJ 3H9GA 2XC7A 4S0HB 3BR2A 3GZ5A 1EH7A 3R4KA 3ZCOA 1DU6A 1FTTA 1IN4A 1QVUA 1Z3XA 2LD5A 4LLGF 2M8EA 2CV2A 2YPRA 3BTIA 2VXZA 3H1CA 1LUJB 3CCYA 3SFZA 2K02A 1X1DA 3G1OA 2ECBA 3RDIA 4EV0A 1S9HA 4X6AJ 2GA2A 4XSZF 2Q2EA 4II2A 4NC7A 4DYRA 5FD6A 2YX4A 2HOSA 3LSIA 2QUFA 3PNTA 3O8GA 3OL3A 2IW5A 3F22A 2DCEA 1YHQI 5C4XJ 3A2KA 3UKGA 1ZARA 4CZZA 2LR8A 3MN2A 2DK5A 2VXDA 1T0FC 1RC9A 3QOEA 3JRHA 4E7HA 3BTLA 2XRNA 5JLXA 3FMQA 2FOWA 1ORKA 4Y7NJ 1MDMB 4PSWA 1X1CA 2WB1A 1F9NA 2L9VA 2OC6A 2MA3A 5ICCA 4BACA 2COBA 2Y0MA 2VKHA 4BU2A 5IP9J 2KP6A 3D5SC 3CC2I 2ID3A 2STWA 1WJDA 2IS6A 2D1HA 3ASOH 2HQ5A 3MFKA 1GDTA 3LQQA 5GPCA 2FNPA 1XGMA 1FOYA 4CCMA 1MW7A 4M9ZA 2QQ8A 1BJZA 4HRIA 1B6AA 1SANA 4CYCB 1U9OA 5DUKA 3WU1B 1V4RA 1TT5B 4L18B 3GTPJ 3H3VK 4E7JA 4BH9A 2BW3A 4HA8A 2E71A 3JREA 5BQTA 3ABUA 3M9AA 3C2HA 5E1WA 3K4NA 4QWQA 4QLCU 2RGVA 1NG7A 4RAGA 4BS9A 1H9TA 3R60A 3GZNB 3ABLH 2DMTA 1UB9A 2JRMA 2PI0A 3HRUA 4OMZA 1B8IA 2VE9A 4MFEA 2CSOA 4EM1A 3RZDJ 1JJ8C 3CUQC 3I4NJ 2CQQA 3AL0C 4FTHA 2FOKA 2QSFX 1FYLA 5E79C 4HZFA 4IHXA 1E0EA 5F04A 1X3UA 3OYGA 4F93B 3MKYB 3N97A 1IXCA 3DPTA 5LGTA 1XCBA 2E7WA 1VQ7I 2H1KA 1G4DA 3SZTA 3SFIA 5GPAA 2Y48A 2I10A 2R7UA 2CW0F 1YS6A 1HSTA 1YYVA 2F6CA 2E1OA 1UELB 2E36A 2VIXA 1BW5A 2RKHA 4RS8A 5LGNA 1X2NA 2KJCA 5ILUA 2HQRA 2KIMA 1WQ2A 2JWTA 3V8LA 1HW5A 2JUCA 4KIBA 3S1MJ 2VONA 2R7TA 4YIFA 3WG9A 2OAZA 1D3YA 1FTZA 1IC8A 2QSGX 5LFAA 2CQXA 4HV5A 1TZLA 1I39A 3K1MA 2JMWA 4C2TA 3W6KB 2R92J 4HX4A 2YX7A 5M5WJ 2JK3A 5FLXZ 1ON2A 2KZVA 3B02A 3VSLA 5JVGF 1YS7A 3ML6A 4GXOA 1MIJA 4XONA 1FX7A 3E7LA 4GYGA 1DQUA 4LGWA 1DP3A 4DZJA 1K79A 2ZO4A 3WHCA 1XC5A 3CP2A 3JRDA 1UG2A 3F8BA 4JQFA 1Y8RB 1T98A 5D5WB 2IS1A 1JI8A 3S1RJ 4AWXB 1N25A 3VFZA 2Q0OA 3WTYC 2R5YB 4C3IJ 2DOFA 2EBIA 1VQ9I 1A5JA 1MZBA 2FU4A 2JUGA 3FHZA 3JAMZ 4YIRX 2HXOA 2HI3A 4DJAA 4IKFA 4A3GJ 3LSJA 1JUPA 1MJBA 4ZJZA 1AOYA 3N4MA 1M1EB 2O8KA 2VT2A 4D1QA 3OYIA 1DGRM 4RAYA 1ZYRF 2MLGA 4CUGA 2XKOA 1A35A 4XLAA 1LJ9A 1VQLI 1KYZA 4CO8A 4S05A 3HOSA 2GIVA 3WGGA 2R5ZB 1U2WA 5AONA 4PJMA 3BR6A 1R00A 1TLHB 1ZGAA 2VQHA 4UV9A 3ABMH 2K9MA 1IN6A 2MC4A 3HTUA 4PUSA 1G3TA 3L2WA 4A3IJ 4X1EA 1YITI 2HFHA 1MBHA 1D1BA 2VBWA 1YW7A 1TW2A 2ZKZA 2DXIA 2ZFWA 3ZQ7A 2FBHA 4G12A 5FJ8J 2PEXA 4IZZA 2DQRA 3F6VA 4ZTFA 2BVLA 2Z9OA 3NQOA 4PGGA 2KRHA 4LMYA 3S2HJ 1E3PA 1OCOH 1R58A 2OZUA 3KCCA 1ETXA 3H3ZA 4DZPA 3J80K 4IPAA 4D9JA 2BY3A 4A3CJ 4BNCA 2CUEA 1DU0A 3LA2A 3FXLA 3K4CA 2IXSA 2HPIA 3VODA 1K61A 5DM7F 3RQ4A 1R5HA 2O7OA 3MMYB 1SFXA 1GV5A 4Y33A 1LQ1A 2IGNA 2XV4S 4BAYA 2EA4A 4CHUA 1S6LA 4HEA2 3WTZA 2IJLA 4KFCA 2QLZA 2B0LA 4WF2A 5FD5A 4B44A 3VYUB 2XIGA 1B59A 1QGPA 1VQNI 4FE7A 3BZKA 1J5YA 2NS0A 1B9NA 3AG4H 2K7LA 3ASNH 1V5GA 3FKJA 5EYRA 3DEWA 2JA5J 1V5EA 2DFHA 2MD5A 2FA5A 3K4JA 3WU0A 2P8TA 2WAQA 1O3TA 4BE1A 2CV0A 4L0YB 3ZP5A 3J81K 3FZVA 5E20A 2M45A 2GXAA 1MD0A 3HBLA 1JTXA 3O2PE 3CQZJ 1OFCX 5F6FA 1ZREA 1OMIA 1X4PA 1TTYA 3ROUA 3H5RA 4LD5A 4KUMA 1GXQA 1RI7A 5ILSA 2VQLA 5IYBJ 1XDUA 4BXXJ 1LFUP 4RM2A 3JSPA 3VYRB 5ICGA 5A2QZ 4RAFA 1QZEA 4KT6A 2OBPA 4EATA 2A5WA 1R23A 1VF9A 3KP3A 4L5EA 4IOCF 2JPCA 2D45A 1P6RA 2JZYA 4WXCA 3QU3A 4HBLA 3SDBA 2D5VA 2ADUA 2NS7A 1MMAA 1V5FA 1UHWA 3VSKA 1TWGJ 5GTHC 1OYIA 4DOZA 3ZN0A 2IBDA 4ANJA 1R22A 3GXOA 1ETKA 3S14J 4R79A 4ZDOA 3PSIA 2K9SA 4A2UA 1RETA 1Z77A 2CRGA 4UUSA 3LAPA 3DLLF 2HDWA 2PFBA 3OR1C 4JK1X 4M6XA 3NAUA 5J4YA 2UV1A 4KITB 1JT6A 5DDGA 3GTKJ 1CQTA 1E3OC 3S1NJ 4AC0A 3F0CA 3JR9A 3EETA 4A12A 5FROA 1TQIA 2XAFA 4HNVA 1S29A 1BOBA 2K27A 2KJBA 4FETA 1BI1A 3FXOA 2PX9A 4NC8A 5DCFA 2Y30A 5IP7J 5D8LB 1BW6A 3OL4A 4ZTJA 4BXUA 1WJFA 2WY8Q 3ERMA 1OYYA 3S3OA 3FXUA 2H8WA 2Q2EB 4M6VA 1Y39A 3OSFA 4IHTA 3U1KA 2ISYA 1A36A 5HLHA 2TCTA 4FX0A 5L3GA 4M9XA 3KYLA 3U1DA 1IDZA 1ETYA 3HOZJ 1WVRA 3M8JA 2PBIA 5GAHJ 3LSRA 4RB0A 2XDVA 4LB6B 5B5EC 1E17A 4AVPA 2F4OB 1FC3A 2ETHA 4Q5SF 2ZC2A 1ZLJA 4R8HA 2FUG2 3FF5A 2X6WA 1SD4A 2V1DA 4XMYA 3G71I 2HVQA 1I3QJ 2EIMH 4B1RA 2GXBA 2O3FA 3S16J 2DODA 3L00A 1T95A 3H35A 2DA4A 4ZYAA 1K7AA 2BBYA 3S15J 4AYBN 1D8KA 1TNSA 2GZWA 2W7NA 1AKHA 3HJEA 3RI4A 2YSRA 4H0EA 2W25A 3F23A 1D0ZA 2I5UA 1FSHA 3DKYA 3HKZA 1BI2A 1BIBA 4XLFA 3FWEA 3DBLB 1MNEA 4I99C 5J3LA 1GT0C 3IWZA 1SMTA 2J5OA 1YI2I 1AHDP 4CCJA 1U6GA 1VQ6I 2L9RA 1IGNA 3BDDA 3EUHA 2BW3B 3GO5A 1QZZA 4LIVA 4BJTA 3ZMZA 3G4SI 1ZG1A 4KJZA 3L09A 3HTSB 2LREA 1U0JA 2DFFA 2W85A 4GFBA 5IT9K 2PJPA 3FXJA 4XKBA 5HVQC 2HKXA 4EEFG 2R7SA 4Y3OA 1BR4A 1B8IB 3S17J 5ILVA 4Q47A 1Z3YA 3G1LA 3GTMJ 2F4MB 3L7WA 2O9LA 3Q9SA 2O0YA 2EZLA 2HXIA 1O3RA 1IZ1A 1ZTRA 1A6QA 1ZKGA 2X1CA 5CVUA 1ZGWA 1H0MA 2VC1A 3OY9A 5HLTA 2ZMEC 2CG4A 1DGWY 1JUMA 4IXAA 1A04A 4JX6A 1PP7U 3E5XA 2XASA 2EJRA 1FBSA 3CP8A 3BY6A 1XMAA 2HDDA 2PLYA 4BHBA 2IGOA 4U7BA 4IHSA 2FXAA 4BL0B 4C2MJ 4A0XA 2VE8A 2NNYA 2HEOA 2WC2A 1J2XA 2IEKA 1IUYA 3MWMA 2GOXB 3BWGA 1BC8C 3CD6I 1VTNC 5K7HA 2KRFA 3RKYA 2O61A 3MEXA 1XCVA 2KFDA 3OV8A 4BQNA 4G6QA 4F52A 4HX8A 2LP0A 2ZBKA 5H2FC 2V26A 4LG0A 3TQNA 1TP4A 3ZRGA 5ICFA 2BGCA 1QBJA 2LH9A 2VBZA 2XGCA 3GBGA 3BR3A 4HQMA 4O3MA 1ZH5A 1SD7A 2VUMJ 4P9UA 1W0TA 2EFPA 1ZHFA 3JW4A 3J7ZI 1IRZA 3E3VA 5CVJA 2BY1A 3E5QA 1NHAA 4EVIA 1PP8F 3CUOA 3IP4B 3HGGA 5AIQA 1ZQ3P 3KEYA 3NWSA 2MH2A 4MFDA 2Q1ZB 4J19A 1ZRDA 3CO7C 4XM3A 2HVSA 2DLLA 2M34A 4Y13A 1W0UA 1OLTA 3ZQGA 1BR1A 1Z05A 2R7FA 3BQYA 1FNNA 2H6CA 2NVTJ 4XLHA 2M2EA 2EH3A 4AU7A 2BVMA 3P9CA 1IF1A 2P7CB 2AO9A 4IL6C 1UG0A 3F8CA 1RKTA 1EJ9A 1X19A 1LNWA 2IGMA 2UUZA 3I64A 1MMGA 2DMUA 2XB5A 5LLQA 2A05A 3F6OA 4EJOA 4JX5A 2DT6A 3B6CA 3DPLC 3OYNA 4JP0A 3L2QA 1S3JA 4N9HA 5KVRA 3FK6A 2OQRA 2M0MA 4B4CA 4EM2A 3NARA 5K1YA 2MLKA 4IX7A 3L2UA 3TP0A 2NAZA 2KISA 1R1VA 2FNAA 1ZRCA 1FYKA 4UUVA 1FEXA 3K10A 3CF5F 2DO7A 2EZIA 1NH3A 5C44J 1G3SA 2EFOA 4GDFA 4NBQA 1XMXA 4BUPA 1D1CA 4UB6C 2VOPA 2K4BA 1XPXA 2V9PA 1HW1A 1FBUA 1LE8A 3J7YJ 2AQEA 2JSPA 2Y2ZA 2ZJRF 4IOAF 1S8NA 4QTRA 3J80Z 2LK2A 1ENHA 2NVYJ 3EYIA 2EPFA 4HPQA 5EEAA 3FK7A 3BCBA 4UHTA 1FIPA 3HYIA 2V1XA 4OOIA 3KLNA 2KPMA 3RZOJ 3IL2A 2HU9A 1B72A 4I01A 4PJJA 1YOVB 2ECCA 1MJAA 3CLQA 1UJ8A 3CESA 2L2OA 3CMMA 3PJRA 4BXFA 3K4MA 2IVMA 1SC7A 4HLXA 4BDYA 4E7LA 3I54A 1WWXA 3FIWA 3MZ8A 3LL7A 2FEZA 4A0ZA 4ZYHA 2K3FA 3A02A 4RM3A 2Y75A 2M30A 2DFIA 2ZXWH 3OIPA 1KQ0A 2A69F 3J81Z 3D5LA 3QWLA 3O6BB 5BMZA 5EG0A 5J1UA 1MBFA 3TDZC 3HDDA 4FX4A 2E1MB 1FWZA 4W97A 1TC3C 4IHWA 2M7AA 1BJAA 1FJLA 1XS9A 2H27A 3CC4I 2AXTC 4HLYA 2Z1DA 2A61A 3WTWC 1OR7C 1QNTA 3PM1A 1SAUA 1WKMA 3ZQFA 1EA3A 5J4VA 3ZGKA 3BR0A 3ECHA 4BE0A 3LQRA 3E5UA 4E70A 4HDVA 4U7DA 3SXYA 1BIAA 3M3YJ 2VC0A 2P7VB 4P1WA 2MABA 3RCOA 4BDZA 3HEFA 3G6EI 1Z6RA 2VASA 4YFXF 2R7RA 3RJPA 5M5YJ 4C30A 4D7NA 3GFMA 1W7PA 5HODA 3T1BA 4DYCA 3D0SA 1QVTA 1SMYF 2Z3YA 2CH0A 1HF0A 4HF0A 2Z2SB 3J7AY 3GFJA 1YRNA 1H89C 2OU2A 1AA7A 1C0WA 1FT9A 5LEJA 3CMEI 2XGEA 2L9SA 2DK8A 2LG4A 2YUSA 4G6TB 1VQOI 2QVOA 4C3HJ 5M3MJ 2L7ZA 1YG2A 1FP2A 2F4IA 1KU7A 2R7ZJ 2AS5F 4CCLA 2DA1A 3TKYA 3PUBA 4UUSB 3DU5A 3KP2A 4BGDA 2IGKA 1J75A 3VYTB 2DBBA 4MQVA 2HOTA 2W84A 2KT0A 3KEOA 2HOEA 3M1EA 1TWHJ 2LKPA 2Z5UA 2CS3A 3IAM2 4MNUA 3HHGA 3AG2H 4OIOF 1MNMC 5IOZA 3OYBA 1X1PA 2NS8A 3FKIJ 1OQYA 3ZMSA 4MQ9F 2O5RA 3OWTA 5H6RA 5F1JA 4Y17A 3ZMDA 2X4HA 2HYFA 1IW7F 3K0LA 4WK8F 2M5WA 1Z7LA 2N8GA 2L4AA 2E2IJ 1F1ZA 3GX4X 2K4JA 1WCMJ 3M8FA 1Z1DA 2DJNA 2L02A 1QA6A 1GXPA 2IS2A 1TQMA 2XGXA 3C3WA 4X0GA 1Z91A 4RGUA 4XN0A 2I8DA 3CCUI 3BG7A 5ERIA 2XF7A 2HGCA 3K2ZA 2WB1N 3K69A 2QZ8A 3Q0WA 1VI0A 4F3QA 3MZHA 4RB2C 2PG4A 3CCEI 2FMLA 1YW9A 3ECOA 5EGOA 3BJOA 4RBOA 2LC2A 3F3XA 2M87A 3PQJA 3ZMTA 5H20A 2FE3A 5KAIC 2ZFUA 5M3FJ 2HPMA 4CZCA 4P5OA 4BE2A 4DBQA 4IRIA 4QSHA 1AKHB 5FKMA 5KK1A 3OYHA 1FMVA 5B1BH 2V4JC 2KDOA 2KRCA 2RV8A 3H0DA 3SZGA 3GTQJ 3QU6A 2Z99A 1ETOA 2BHYA 3CDHA 4BQAA 4OAYA 4ENMA 4DGWB 2CU7A 3WTUC 3OYJA 1SEUA 1SFOJ 2CJJA 1TBXA 3HGYA 2P4WA 1H9GA 2XPWA 5IT9Z 3PL8A 1BR2A 2CYYA 3VOEA 2CQNA 2RNJA 4A3KJ 3H3UA 5KAFC 4HG2A 4EQQA 1MMSA 2YR2A 5CJ9A 5E3MA 2E60A 2JVGA 1R1UA 4BEHA 2VKVA 1X3ZB 2DAOA 5D5XB 3IV5A 1ON1A 1WJEA 3QP5A 3ZQLA 2ZNZA 1J09A 2VJJA 4XQFA 2FQ3A 3CF2A 5F1RA 2HDCA 1HDDC 3ELKA 4A3BJ 2MGQA 4RLQA 4PFOA 4DQ2A 3TO7A 3AAFA 2OTJI 3CCSI 1IRGA 3HG9A 4OU0A 4HX7A 2GAUA 2PJRB 3QYFA 2LRDA 4BJ5C 2W00A 2XAGA 2JT1A 2V7FA 4NQWA 1J9IA 2IA1A 1IDYA 4Q48A 3HRSA 5EZHA 1I6HJ 2O03A 5CVRA 2Y9YA 1T33A 1HCRA 1OKRA 4EJWA 1MH3A 2GBYA 2NVXJ 2JTVA 3CLOA 2P5VA 1R4MB 3MQ0A 3GTGJ 4E7KA 2G9WA 3WHBA 2LMDA 1RIOH 3HSRA 4U0WA 5EF6A 3GFLA 3TBIA 3TEDA 3E6DA 1T39A 2W1OA 2G0EA 3MCZA 4LG0B 2NVUB 1T8IA 5E18F 1MMNA 4KISA 1J7KA 1YX3A 1V54H 2O8XA 4HYEA 1B1BA 2F5VA 3QPHA 5D8KB 5C4JJ 5HNHA 5IY5H 2XB0X 1U5TA 3I56I 4CCOA 1QRYA 2A68F 3HIFA 2D1VA 4LJZF 3ERED 2OPTA 1YX5A 3DQVC 3VDXA 4H4KC 2DYRH 3NEUA 5D6FA 4JX4A 5LD2C 1XDSA 2A3SA 3CCVI 4KT5C 1HA8A 3LSGA 1IJWC 1W5TA 3L2CA 3B6AA 1G8XA 4IRHA 5CLSA 5KHDA 4U0VA 4CH7A 2KL4A 2R7QA 1P7JA 1PYVA 4Y52J 5DEQA 2XVCA 3PQKA 2AXLA 1S7EA 4GYIA 4IEJA 3LWFA 1I1GA 5E1XA 3JRBA 4E7SA 2QA4I 1SFUA 3I9V2 1KZHA 2QCOA 1GVJA 2F5FA 2XRLA 1J0RA 2GQQA 1VQ8I 1ITYA 1K4TA 4RMNA 4G7OF 5FB2A 2R7WA 2OJED 5D4RA 2VQGA 2XUBA 1FSEA 2ZJQF 4I02A 5HDNA 2YS9A 3FBIB 2MD0A 3IRQA 2CUZA 1ETWA 2E7XA 1XSXA 5DM6F 1I1SA 2DMPA 2A6HF 3HOTA 2GM4A 3FISA 3DV8A 1S7AA 4XL9A 4OIRF 2ZXJA 5JHFA 2W24A 3TDUC 2V6EA 2RDPA 2K85A 3M07A 4OIPF 1BBYA 2MBFA 2E2JJ 2CW8A 1SD6A 1LE8B 4HV6A 2FBKA 3V7RA 3A1YA 1XGSA 2E2HJ 2L5QA 4G7ZF 4L9TA 2ME0A 2K9QA 3NRVA 3D5RC 4LG3A 2H8RA 3P5JA 1T08B 3Q3SA 3I59A 2WV1A 2X6YA 3SYTA 1LVAA 1ZGJA 1LVKA 3KX2A 1I6XA 4JBAA 4ZDPA 4NHJA 3KYCB 5JHUA 3G2BA 1B72B 2X0LA 5F27A 1I27A 3GF2A 4OMYA 3OYMA 2HYJA 3K7AJ 4HSTA 1NK2P 4A5NA 4G7HF 1USTA 1Z6TA 4UB8C 5EEHA 2DA7A 4RDUA 2G7UA 4YG2F 1WSUA 4A3FJ 4G8XA 1U9NA 1R36A 1P7IA 3F21A 3MKLA 4A6EA 3RPUA 1LFBA 3HOUJ 1N75A 4A0YA 2CQ7A 4IF4A 5EG0B 1DDNA 2CUJA 4XLEA 3LSHA 2LY2A 2JPBA 3GMEA 2XPUA 3BG3A 3C7JA 1HW2A 1IN8A 1WJ5A 1XN7A 3OS2A 3A4CA 2WWYA 5F0HA 3PNVA 4HSRA 2WBMA 2ESNA 1YE9A 2MYSA 4XKWA 4L9NA 1HXDA 1KGSA 2ELKA 2ZXIA 3HZJA 2L9NA 5J47A 3FM3A 2Q8KA 4N9IA 2F2EA 3BZ6A 4G9YA 4PZJA 2QQAA 3CMYA 1VQKI 4V2FA 4RB1A 1IO2A 5FFXA 3LA7A 3NWTA 1R49A 2MH9A 4UXNA 1HDPA 4N4OB 2VPRA 1IG7A 4B3AA 1GV2A 4QPOA 2DTRA 1W7PB 1D8JA 2L7MP 1WGXA 1RUOA 1ZK8A 4AYBA 3KP5A 1Y0UA 5EEGA 1IN7A 3ZXSA 4DYQA 1V55H 3MAJA 2CO5A 1UHMA 2ESHA 4EGZA 3KP6A 5E8IA 1YRNB 2OV7A 2M8GX 3FHNA 3KEQA 1GHCA 2EZKA 4IHYA 3RYRA 4A3DJ 4AIDA 2ZMEA 4XRFA 4KICA 4M73A 3R0AA 5HDKA 3OSGA 3BQZA 4O6JA 2AHQA 3JRGA 3CCRI 4PGHA 4BHCA 2LLKA 5JVTA 5CVIA 1TNTA 3V8JA 4FCYA 1P2FA 1W4MA 2G7HA 2L7FP 4XN3A 3OYCA 4C3JJ 4YRVA 4NC6A 5L3EA 3CCLI 3UNGC 3K70D 3WGIA 2OCCH 3ONQA 4HNUA 4E7IA 3FXKA 3OOPA 3BPVA 1X1BA 4CCNA 2OD5A 4XRSA 3SDGA 2F5DA 2RC4A 4C2UA 3P9KA 1IUFA 4OINF 4KMFA 5E1ZB 3OYLA 2BOLA 2LSOA 2JRTA 3SZPA 3DTEA 4BKXA 5K7FA 1VZ0A 2UZKA 2EFWA 1RESA 5ED4A 1Y8QB 4TV7A 1RZ4A 5DUIA 3DTIA 2HKOA 1P4AA 5K5RA 3RYPA 2ZJPF 2HQAA 4OAZA 3HRTA 3N05A 1P9QC 2BY0A 4CXFA 1SVOA 3GFIA 1VQ4I 2LF8A 2UWMA 3AG1H 2A6EF 3Q0UA 5E8GA 2ZXHA 4Q4ZF 5F64A 5EGOB 2KIQA 4ITVA 1ZG3A 2EA2A 3F72A 4KIGA 4AUXA 2HTSA 2PJRA 4EJUA 4BYYA 2P5LC 1CF7A 4AIKA 4XOTA 1HOMA 2IP2A 1UAAA 1G3YA 2KKOA 1YIOA 4UVBA 1BC7C 3HKZN 4FHTA 3JRFA 1N77A 1I50J 1A31A 2QYOA 3KZIC 3QRFF 1FLIA 1KQ8A 3C1DA 2DU9A 2MG4A 1RR8C 2ELJA 4ZC3A 2EINH 3DBHB 1W7PD 3VYSB 4ZDLA 3FXQA 2MW8A 4BQOA 1UMQA 2VJ5A 3BR1A 2FSWA 3GCMA 2JQ7A 4MLOA 5FKLA 4AVZA 2ZSHB 1W1WE 1TWAJ 2WA0A 3EPZA 3KP4A 2FMYA 5IP6A 2QQBA 4CSWA 3O3KA 4J00A 2LFBA 3DPUA 4BEHB 4RA2A 3K6GA 3RQIA 1O3QA 1PUFB 2BHZA 3MKWB 2AQFA 4FE4A 3GUDA 3X2QH 4LITA 2B63J 5CQGA 4A3JJ 3FMSA 4PJNA 1HKTA 5J1RA 2L4MA 1JHHA 1IV8A 1UFMA 2ZJ2A 2EV0A 4XOPA 2X51A 3EUHC 2EV5A 4B43A 1QU3A 1G3WA 4CICA 3IAS2 1DUXC 2HVRA 5F08A 3QPTA 9ANTA 3TMOA 4NQWB 1AU7A 4DW6A 3T8TA 2KIFA 3L2VA 1HQCA 2KQRA 3SEZA 4S04A 4M74A 2B9SA 2DPDA 4ZZLA 2VJIA 2LBFA 2PMZN 2X6OA 3HC7A 2OZ6A 2EIKH 4EJVA 2DFEA 5HLIA 1IAWA 1TL8A 2BV6A 3KP7A 2WADA 1D0XA 3KZYA 3T8RA 4M3FA 1U3EM 3CZ6A 3S93A 5CYVA 1NG6A 3DP7A 4WXDA 3TGNA 1K78A 5FRMA 2P6TA 4MGRA 4L0ZB 2K40A 2GIZA 4KDPA 2JA2A 5IPAA 3RTRA 5TJJA 3FMRA 4BBRJ 4XORA 1U5TB 2TRTA 4LLNA 5IOYA 2RQPA 1MJ9A 1ZN2A 3HSEA 3IKTA 4FASD 4L5JA 2QKMB 2R0QC 4AIJA 3BLYA 2KMUA 2IPQX 3IHUA 4P55A 1RPWA 2QF7A 2MC3A 3ESWB 5CKTA 3WE3A 1X1AA 1G2HA 3W3CA 5BOXA 3C2BA 5DS9A 5LGUA 3F8NA 2E35A 2GXGA 1X4OA 2WAEA 4AM3A 3Q9VA 3CJNA 3KETA 3DEUA 4MO7A 1IRXA 5DD4A 4CYDA 1T0FA 2TDXA 3U9GA 1JJ6C 2Z16A 5ICEA 1FIAA 4LK1F 4U87A 4AIHA 3BP8A 2QSHX 2D2WA 3JCUC 2R7XA 1VQPI 1GUUA 4NUBA 4I76A 3CC7I 2PMUA 3GTLJ 4F55A 2E5NA 1BA5A 4MIMA 5TRDA 4XLPF 4BY7J 2WAFA 3EUKL 2M0CA 3CCQI 3M4OJ 3O8HA 2Y0SN 2IA0A 5J8CA 1HLVA 3LSKA 1ONVA 4A5MA 5IT3A 5B3SH 2V9VA 4GRIA 4E7ZA 4KA4A 1BOAA 2M4KA 1UZCA 4W1UA 1SFKA 1FP1D 3E0JB 3A01A 4PCQA 4RAZA 2VOOA 2DT5A 1V3FA 3I59B 3E97A 2O6GE 3MVPA 1MBGA 5DYMA 2JA8J 5D5VB 2M4GA 2F48A 3QODA 3BJ6A 4UNOA 2C6YA 1RR7A 4I0BA 2JA6J 2VBYA 3W2VA 1WJBA 1VNDA 3EQLF 5LRRA 1J59A 2HNHA 4U88A 2L7KA 4D7MA 4PSXA 1R4NB 4CDGA 2W57A 4AD9A 1ETVA 2KLOA 5FO5A 1LKXA 4Y15A 2XGDA 1U8BA 4YELA 2L01A 4HF1A 3CUQA 4L9VA 4M9SA 5J1YA 3I0TA 5HOOA 2R93J 3R61A 2CGPA 1O57A 3WGHA 2VQCA 1LDJA 4IHVA 3HOYJ 1KONA 3BG5A 3RKWA 3B73A 1MSEC 1TWCJ 3JRCA 3K70C 3PUFA 3FBNB 1MBKA 3K4KA 5AIPA 1WJAA 2XHKA 4II3A 1T2KA 1JKPC 4F7ZA 1I3AA 1GLNA 3HHHA 3WTVC 4UY8I 4DBRA 1SAXA 1R71A 2V1UA 2E1CA 1DPUA 1FY7A 3DF8A 3OYKA 2EQRA 5B1AH 2F5EA 4JYKA 4ZYDA 2X48A 2W4SA 5BNGA 3GLLA 5D4SA 4XKVA 3W6JB 1EF4A 3REOA 1MBJA 3TOAA 1BL0A 3K1PA 2V9KA 3ABKH 4YEJA 3KFWX 2V79A 4JOMA 5TISC 2VBXA 5FRNA 1QQIA 4E4HA 3U2RA 2IAIA 4EMSA 4IO9F 3COAC 1OISA 1QHHD 5FGMA 4NB5A 3HPGA 1LEBA 4M3EA 3DTKA 2WV0A 3QYEA 1OCZH 1LEAA 3R6SA 1K4SA 1TWFJ 1D5YA 3BR5A 3V7CA 1FZPB 2X1DA 4KNYA 4MEXF 4B3XA 1JE8A 1S7OA 3IUOA 3PSFA 1MBEA 4PJLA 4CGZA 1B9MA 1LDKB 3K9TA 2EZHA 5CQEA 2ZMEB 3KPHA 1LPQA 1S5LC 5HDGA 4RLFA 1XGOA 2FJ1A 4ON0A 4EM0B 2FX0A 2HQNA 4XKCA 2DQLA 2H94A 2VJ4A 3OR2C 2HZDA 4D0PA 3OS1A 3DFGA 2FRHA 4V2GA 5E3NA 6PAXA 2HZTA 4Y4RA 1FMWA 2YU3A 1RRJA 1RUNA 2X85A 3F8FA 1WI3A 1R7JA 5HLGA 5K5OA 1LDDA 2DW4A 4FQGA 1XSDA 2ZSIB 3BTCA 5HNFA 1XX5A 1K83J 3K4LA 3LFUA 1ZR2A 2IS4A 4HDUA 2XAHA 3IH2A 5LHGA 2CWEA 3E6BA 2VI6A 3HUGA 1MH4A 2XAQA 3CJTB 3TO6A 2VKDA 4FT8A 5DCMA 4FISA 4ZH4F 2HTJA 4NNJA 5FKOA 2PMHA 1JXSA 4LIUA 1PJRA 1WJCA 4EGYA 1OYWA 3ZPLA 1W5SA 3EYYA 2P6SA 1FBQA 2R3SA 2JA7J 2H1LA 3A0BC 3JRIA 3RPUD 3QOPA 2ICWG 3OYDA 1N78A 1D5VA 4YFKF 3ZQHA 1Y0NA 4I7HA 5J6XA 1PUFA 3CCMI 2K9NA 1W5CC 4IQ4A 3QQAA 1R9TJ 3I55I 2OTLI 3SEQA 2RVCA 5M5XJ 4LB5A 5F0FA 2DPUA 4P9FA 1R5GA 4J01A 4KIFA 1BI3A 3SJMA 1I5ZA 3LAJA 2VT3A 1CF7B 3D1NI 2QEXI 2JN6A 4N0BA 3IRRA 2Z33A 1H8AC 4ENJA 1QPIA 3BROA 4GO1A 2R4GA 2NRAC 2L3DA 4HW0A 4B09A 1SVLA 3DWLE 3PNYA 1U8RA 3PO2J 2B7EA 5TGTA 2BYVE 2NVQJ 4RGRA 1SFEA 4KN4X 1A6IA 2NYXA 2OA4A 4A3LJ 2XF5A 2DDAA 3H5AA 4V19K 5L3FA 3KIOA 1KA8A 4I0AA 5J8FA 1RKWA 2VN2A 1FOKA 3RKXA 4Z2YA 3OYEA 3CCJI 1PDNC 4A3MJ 1ACIA 1QHGA 1YQAA 3FXMA 3GLXA 1G59A 2LY9A 1O3SA 3BOQA 3IH3A 2HYGD 4O5VA 4CCKA 2OQGA 3SHFA 2KDZA 3ISPA 4XLNF 1S72I 3LSPA 2W82A 2UXXA 3GWZA 5EJCA 2E1NA 4MTEA 3VEPA 3IWFA 1H88C 1WI9A 3V4GA 1G6NA 1R1TA 4PFPA 1VFCA 2ELHA 2EB7A 2WTEA 4HNTA 2QBYA 1OJLA 5IYCJ 1ZRFA 4HQEA 1FOXA 3GTJJ 3MD2A 1T38A 3KLOA 1KYWA 3DBRB 4K2EA 4DIQA 3CDIA 1Z0XA 1QO0D 2LDUA 2QGUA 3VWBA 1HKSA 3EDPA 4XR6A 2LBFB 1IV6A 1YW8A 3WTXC 2HOAA 5HS7A 1YTYA 1F36A 1RNLA 3P9IA 3GYHX 2XPVA 1O4XA 1X58A 1FOWA 2M9HA 2VKEA 4GGGA 4PDKA 1HSJA 5JI6A 1PVEA 4ZYEA 2XAJA 1KU9A 1OPCA 3GTOJ 3BT9A 4IJAA 3IC7A 1K78B 1IXSB 3IH4A 1XD7A 1D0YA 2LKXA 3QP6A 2ME6A 2RAEA 1TW3A 5DD8A 1WH7A 5E17F 3JTGA 4HOBA 3AKZA 3I53A 2P0WA 5HS8A 2GA1A 1JHFA 3G73A 3TW7A 4A69C 3MZYA 2HWVA 2H09A 2M7BA 1W36D 5FFZA 4PJ0C 3UR3C 4WWCA 3ZQIA 2GOMA 2ZB9A 1JKQC 4F91B 4L9JA 4ZYGA 1T56A 2KHMA 1Z7UA 3JTHA 1IXRC 1EV7A 5D5UB 2FF4A 3U21A 4RB3C 4IQJA 1FYMA 2EK5A 2FBIA 3DEEA 4XNFA 3I3LA 3V7SA 1LFPA 1P4WA 4B8XA 5EDNA 1ODDA 4RGXA 2LVSA 2EFNA 3WE2A 4XRMA 4A93J 1Q1HA 3KE2A 1YLFA 4G94A 3S8PA 2DJIA 2LY1A 4A3EJ 1U5TC 4M3DA 1LB2A 1F43A 3OOUA 5FLMJ 2BY2A 1YO5C 2LTPA 5E3OA 3G3ZA 2M3AA 5LBQA 3CJRB 3BTJA 2DOAA 4B47A 1MMDA 1YJWI 3HPHA 3ZMVA 4P96A 1D1AA 2OF7A 4ASNA 5JFRA 3CO6C 3TL4X 2XSDC 2WAQN 2JJ7A 1OCPA 2QWWA 3M7GA 4UUTA 5B66C 4ESFA 3H92A 3S32A 2RN7A 1DP7P 3J7AO 1Y1WJ 5GADJ 4PK4A 2UXNA 4RGSA 3F9KA
chains in the Genus database with same CATH topology
1ETQA 3E7LA 1UMQA 3BR1A 4DZJA 3WHCA 1XC5A 5K7ZA 3JRDA 1UG2A 4MLOA 5FKLA 1JKOC 3M3YJ 3S1RJ 1TWAJ 2R5YB 2DA2A 4C3IJ 3HEFA 2EBIA 1A5JA 2DMNA 5IP6A 2Y31A 3OIOA 2LFBA 5M5YJ 2HXOA 2HI3A 4D7NA 2DA3A 3RQIA 3LSJA 1JUPA 3A01B 5HODA 4A3GJ 4DYCA 1PUFB 1QVTA 4FE4A 2O8KA 1HF0A 4M3GA 2B63J 2Y9ZA 4A3JJ 1Y1VJ 5J1RA 1MSFC 4D5FA 1YRNA 1H89C 1WPKA 2L0KA 2XGEA 2E19A 1POGA 2DN0A 2YUSA 3Q0VA 5F08A 4C3HJ 5M3MJ 2R5ZB 9ANTA 2L7ZA 1AU7A 2DMQA 4DW6A 3BR6A 2CUFA 2R7ZJ 2DA1A 4UUSB 3HOVJ 4XICA 4CYCA 2PMZN 2X6OA 4A3IJ 2HOTA 4X1EA 2KT0A 4ABZA 1MBHA 1TWHJ 4M3FA 1MNMC 5IOZA 4G12A 2NS8A 3FKIJ 5FJ8J 3ZQCA 3W6VA 5F1JA 2FQ4A 5GP9A 2K40A 3S2HJ 2N8GA 5IPAA 1ETXA 2E2IJ 2W48A 4DZPA 1WCMJ 2DJNA 4A3CJ 4BBRJ 2CUEA 2TRTA 5IOYA 1DU0A 3LOCA 4LOCA 3RKQA 1K61A 5FLVA 2DTZA 2O7OA 2R0QC 3L1PA 1GV5A 1NK3P 1RPWA 3HB9A 2QF7A 2WB1N 3Q0WA 3HOWJ 1VI0A 1G2HA 3C2BA 5DS9A 5EGOA 4RBOA 3LNQA 3JRAA 1UHSA 4FE7A 4MO7A 2MSYA 5M3FJ 4XIDA 5EYRA 3DEWA 2JA5J 3TP3A 5F0CA 1JJ6C 1JTYA 4QSHA 1AKHB 3PO3J 1FIAA 5FKMA 1ZR4A 1JKRC 1GUUA 3DCFA 4D5CA 4I76A 4XK4A 3GTLJ 1Q1VA 3HBLA 1JTXA 3GTQJ 1BA5A 4MIMA 1ETOA 4BY7J 2M0CA 3CQZJ 3O8HA 2Y0SN 1OFCX 3M4OJ 1SFOJ 2CU7A 1HLVA 2CJJA 3HGYA 2NOGA 5E3LA 2XPWA 3G1MA 5IYBJ 2R5YA 4A3KJ 4BXXJ 1LFUP 3H0GJ 5E3MA 3HM5A 4W1UA 3CDLA 2VKVA 1OCTC 3A01A 3IV5A 1VF9A 4L5EA 5IYDJ 3ZQLA 3MVPA 1MBGA 2JA8J 1HDDC 1JGGA 4A3BJ 3BG9A 2MGQA 2D5VA 5DTDA 1RR7A 2DA6A 2NS7A 2JA6J 1TWGJ 2DA5A 1VNDA 2IBDA 1GVDA 4D7MA 2R5ZA 1ETKA 3S14J 4M3BA 1ETVA 1IDYA 2K9SA 5EZHA 1RETA 1Z77A 1I6HJ 2XGDA 2CRGA 1U8BA 4UUSA 2Y9YA 1T33A 5J1YA 1HCRA 2R93J 1U78A 1MH3A 2GBYA 2NVXJ 3NAUA 1JT6A 4IHVA 3GTKJ 1CQTA 3HOYJ 1E3OC 3BG5A 1X2MA 4NDLA 3GTGJ 1MSEC 3S1NJ 4AC0A 3F0CA 2P81A 3WHBA 3JR9A 3A03A 1TWCJ 5EF6A 3JRCA 4HNVA 3VPRA 1MBKA 1XG1A 1JKPC 5FKKA 3TEDA 2Y30A 2G0EA 5IP7J 1BW6A 1APLC 2YU9J 4M6VA 3OSFA 5C4JJ 2XB0X 2EQRA 2FD5A 2TCTA 4JYKA 1ETYA 1IDZA 1QRYA 2X48A 3HOZJ 5BNGA 4I6ZA 2OPTA 1EF4A 1MBJA 3LSRA 1BL0A 4JX4A 5FKNA 3LSGA 2IAIA 2GLOA 3ZOBA 1IJWC 3B6AA 1JT0A 4QIWN 3HOXJ 3TW6A 4M3EA 1I3QJ 1P7JA 4Y52J 4B1RA 3S16J 1TWFJ 1D5YA 3BR5A 2DA4A 1S7EA 3S15J 4IEJA 4AYBN 3JRBA 1AKHA 1MBEA 5EZGA 2QCOA 2EZHA 2XRLA 1ITYA 2FJ1A 4BBSJ 2FX0A 3S1QJ 2YS9A 1GT0C 5J3LA 1WH5A 2ID6A 1ETWA 3I4MJ 2DMPA 2GM4A 4V2GA 3FISA 5E3NA 1AHDP 2L9RA 1IGNA 3K2AA 1WI3A 1JUSA 3QPLA 4BY1J 3BTCA 4XRSG 1K83J 2E2JJ 1LE8B 1ZR2A 4GFBA 2E2HJ 3IH2A 3S2DJ 2ME0A 2K9QA 4EEFG 2VI6A 2H8RA 1MH4A 1NTCA 3Q3SA 2WV1A 5JLWA 1B8IB 3S17J 4FISA 2X9DA 3G1LA 3GTMJ 5FKOA 2O9LA 2EZLA 2HXIA 1B72B 1ZTRA 1ZGWA 1ZKGA 2JA7J 3JRIA 5F27A 2HYJA 3QPSA 3ZQHA 1PUFA 3K7AJ 1JUMA 1NK2P 2K9NA 4JX6A 1R9TJ 3QQAA 5M5XJ 2HDDA 2DA7A 5F0FA 4RDUA 4A3FJ 4C2MJ 5C3EJ 1U9NA 3SJMA 4S0HB 3BR2A 1DU6A 1P7IA 2IEKA 3MKLA 3D1NI 1FTTA 1QVUA 2JN6A 2LD5A 1LFBA 5K7HA 3HOUJ 1H8AC 1QPIA 5EG0B 3BTIA 3CCYA 3G1OA 2LP0A 2ECBA 2XPUA 3BG3A 3PO2J 2NVQJ 4X6AJ 5F0HA 1A6IA 2XGCA 3GBGA 3BR3A 2VUMJ 4DYRA 4A3LJ 1W0TA 2HOSA 2ELKA 3O8GA 1IRZA 5C4XJ 3CMYA 3UKGA 1RKWA 3HGGA 4V2FA 1ZQ3P 2LR8A 3MN2A 4MFDA 4J19A 4A3MJ 2M34A 1HDPA 3JRHA 2LY9A 2VPRA 1W0UA 1IG7A 3ZQGA 3BTLA 4B3AA 1GV2A 3BQYA 5JLXA 3IH3A 2NVTJ 2M2EA 2EH3A 2L7MP 2KDZA 1ORKA 1WGXA 2AO9A 1ZK8A 4Y7NJ 1RKTA 3LSPA 1H88C 4DYQA 2COBA 5IP9J 1VFCA 2ID3A 2DMUA 2XB5A 1YRNB 2M8GX 4JX5A 3B6CA 1OJLA 4JP0A 2EZKA 5IYCJ 4IHYA 4A3DJ 3GTJJ 2HQ5A 1GDTA 3FK6A 5GPCA 4B4CA 3NARA 3OSGA 3BQZA 2AHQA 3JRGA 1Z0XA 3TP0A 1BJZA 1SANA 4CYCB 2LLKA 1FEXA 2EZIA 4FCYA 1IV6A 1U9OA 2L7FP 5C44J 2HOAA 3GTPJ 3H3VK 1F36A 4C3JJ 2XPVA 1O4XA 1X58A 3JREA 2M9HA 2VKEA 1LE8A 3GTOJ 3BT9A 2Y2ZA 4QTRA 3IH4A 2LK2A 2LKXA 1ENHA 2NVYJ 2ME6A 2RAEA 4XRSA 2DMTA 5EEAA 3SDGA 3FK7A 1WH7A 1B8IA 1FIPA 4MFEA 1IUFA 3RZOJ 3RZDJ 1JJ8C 3TW7A 4BKXA 5K7FA 4A69C 3I4NJ 1B72A 1RESA 2CQQA 4FTHA 4IHXA 3ZQIA 2ECCA 5F04A 2ZB9A 1JKQC 1T56A 2H1KA 3SFIA 5GPAA 2I10A 2E1OA 3Q0UA 1BW5A 3FIWA 5EDNA 4XRMA 2LVSA 5EGOB 4A93J 1X2NA 4AUXA 3A02A 2JWTA 4A3EJ 1HOMA 3HKZN 4M3DA 3S1MJ 5EG0A 1F43A 3OOUA 5J1UA 5FLMJ 1MBFA 3HDDA 3JRFA 2LTPA 1I50J 5E3OA 1FTZA 1IC8A 4W97A 1TC3C 4IHWA 2CQXA 3BTJA 1FJLA 2JMWA 1XS9A 2R92J 2OF7A 2XSDC 2WAQN 2MG4A 5M5WJ 2JJ7A 2JK3A 1OCPA 3PM1A 4UUTA 3ZQFA 1Y1WJ 2MW8A 3BR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETQ A;  3E7L A;  1UMQ A;  3BR1 A;  4DZJ A;  3WHC A;  1XC5 A;  5K7Z A;  3JRD A;  1UG2 A;  4MLO A;  5FKL A;  1JKO C;  3M3Y J;  3S1R J;  1TWA J;  2R5Y B;  2DA2 A;  4C3I J;  3HEF A;  2EBI A;  1A5J A;  2DMN A;  5IP6 A;  2Y31 A;  3OIO A;  2LFB A;  5M5Y J;  2HXO A;  2HI3 A;  4D7N A;  2DA3 A;  3RQI A;  3LSJ A;  1JUP A;  3A01 B;  5HOD A;  4A3G J;  4DYC A;  1PUF B;  1QVT A;  4FE4 A;  2O8K A;  1HF0 A;  4M3G A;  2B63 J;  2Y9Z A;  4A3J J;  1Y1V J;  5J1R A;  1MSF C;  4D5F A;  1YRN A;  1H89 C;  1WPK A;  2L0K A;  2XGE A;  2E19 A;  1POG A;  2DN0 A;  2YUS A;  3Q0V A;  5F08 A;  4C3H J;  5M3M J;  2R5Z B;  9ANT A;  2L7Z A;  1AU7 A;  2DMQ A;  4DW6 A;  3BR6 A;  2CUF A;  2R7Z J;  2DA1 A;  4UUS B;  3HOV J;  4XIC A;  4CYC A;  2PMZ N;  2X6O A;  4A3I J;  2HOT A;  4X1E A;  2KT0 A;  4ABZ A;  1MBH A;  1TWH J;  4M3F A;  1MNM C;  5IOZ A;  4G12 A;  2NS8 A;  3FKI J;  5FJ8 J;  3ZQC A;  3W6V A;  5F1J A;  2FQ4 A;  5GP9 A;  2K40 A;  3S2H J;  2N8G A;  5IPA A;  1ETX A;  2E2I J;  2W48 A;  4DZP A;  1WCM J;  2DJN A;  4A3C J;  4BBR J;  2CUE A;  2TRT A;  5IOY A;  1DU0 A;  3LOC A;  4LOC A;  3RKQ A;  1K61 A;  5FLV A;  2DTZ A;  2O7O A;  2R0Q C;  3L1P A;  1GV5 A;  1NK3 P;  1RPW A;  3HB9 A;  2QF7 A;  2WB1 N;  3Q0W A;  3HOW J;  1VI0 A;  1G2H A;  3C2B A;  5DS9 A;  5EGO A;  4RBO A;  3LNQ A;  3JRA A;  1UHS A;  4FE7 A;  4MO7 A;  2MSY A;  5M3F J;  4XID A;  5EYR A;  3DEW A;  2JA5 J;  3TP3 A;  5F0C A;  1JJ6 C;  1JTY A;  4QSH A;  1AKH B;  3PO3 J;  1FIA A;  5FKM A;  1ZR4 A;  1JKR C;  1GUU A;  3DCF A;  4D5C A;  4I76 A;  4XK4 A;  3GTL J;  1Q1V A;  3HBL A;  1JTX A;  3GTQ J;  1BA5 A;  4MIM A;  1ETO A;  4BY7 J;  2M0C A;  3CQZ J;  3O8H A;  2Y0S N;  1OFC X;  3M4O J;  1SFO J;  2CU7 A;  1HLV A;  2CJJ A;  3HGY A;  2NOG A;  5E3L A;  2XPW A;  3G1M A;  5IYB J;  2R5Y A;  4A3K J;  4BXX J;  1LFU P;  3H0G J;  5E3M A;  3HM5 A;  4W1U A;  3CDL A;  2VKV A;  1OCT C;  3A01 A;  3IV5 A;  1VF9 A;  4L5E A;  5IYD J;  3ZQL A;  3MVP A;  1MBG A;  2JA8 J;  1HDD C;  1JGG A;  4A3B J;  3BG9 A;  2MGQ A;  2D5V A;  5DTD A;  1RR7 A;  2DA6 A;  2NS7 A;  2JA6 J;  1TWG J;  2DA5 A;  1VND A;  2IBD A;  1GVD A;  4D7M A;  2R5Z A;  1ETK A;  3S14 J;  4M3B A;  1ETV A;  1IDY A;  2K9S A;  5EZH A;  1RET A;  1Z77 A;  1I6H J;  2XGD A;  2CRG A;  1U8B A;  4UUS A;  2Y9Y A;  1T33 A;  5J1Y A;  1HCR A;  2R93 J;  1U78 A;  1MH3 A;  2GBY A;  2NVX J;  3NAU A;  1JT6 A;  4IHV A;  3GTK J;  1CQT A;  3HOY J;  1E3O C;  3BG5 A;  1X2M A;  4NDL A;  3GTG J;  1MSE C;  3S1N J;  4AC0 A;  3F0C A;  2P81 A;  3WHB A;  3JR9 A;  3A03 A;  1TWC J;  5EF6 A;  3JRC A;  4HNV A;  3VPR A;  1MBK A;  1XG1 A;  1JKP C;  5FKK A;  3TED A;  2Y30 A;  2G0E A;  5IP7 J;  1BW6 A;  1APL C;  2YU9 J;  4M6V A;  3OSF A;  5C4J J;  2XB0 X;  2EQR A;  2FD5 A;  2TCT A;  4JYK A;  1ETY A;  1IDZ A;  1QRY A;  2X48 A;  3HOZ J;  5BNG A;  4I6Z A;  2OPT A;  1EF4 A;  1MBJ A;  3LSR A;  1BL0 A;  4JX4 A;  5FKN A;  3LSG A;  2IAI A;  2GLO A;  3ZOB A;  1IJW C;  3B6A A;  1JT0 A;  4QIW N;  3HOX J;  3TW6 A;  4M3E A;  1I3Q J;  1P7J A;  4Y52 J;  4B1R A;  3S16 J;  1TWF J;  1D5Y A;  3BR5 A;  2DA4 A;  1S7E A;  3S15 J;  4IEJ A;  4AYB N;  3JRB A;  1AKH A;  1MBE A;  5EZG A;  2QCO A;  2EZH A;  2XRL A;  1ITY A;  2FJ1 A;  4BBS J;  2FX0 A;  3S1Q J;  2YS9 A;  1GT0 C;  5J3L A;  1WH5 A;  2ID6 A;  1ETW A;  3I4M J;  2DMP A;  2GM4 A;  4V2G A;  3FIS A;  5E3N A;  1AHD P;  2L9R A;  1IGN A;  3K2A A;  1WI3 A;  1JUS A;  3QPL A;  4BY1 J;  3BTC A;  4XRS G;  1K83 J;  2E2J J;  1LE8 B;  1ZR2 A;  4GFB A;  2E2H J;  3IH2 A;  3S2D J;  2ME0 A;  2K9Q A;  4EEF G;  2VI6 A;  2H8R A;  1MH4 A;  1NTC A;  3Q3S A;  2WV1 A;  5JLW A;  1B8I B;  3S17 J;  4FIS A;  2X9D A;  3G1L A;  3GTM J;  5FKO A;  2O9L A;  2EZL A;  2HXI A;  1B72 B;  1ZTR A;  1ZGW A;  1ZKG A;  2JA7 J;  3JRI A;  5F27 A;  2HYJ A;  3QPS A;  3ZQH A;  1PUF A;  3K7A J;  1JUM A;  1NK2 P;  2K9N A;  4JX6 A;  1R9T J;  3QQA A;  5M5X J;  2HDD A;  2DA7 A;  5F0F A;  4RDU A;  4A3F J;  4C2M J;  5C3E J;  1U9N A;  3SJM A;  4S0H B;  3BR2 A;  1DU6 A;  1P7I A;  2IEK A;  3MKL A;  3D1N I;  1FTT A;  1QVU A;  2JN6 A;  2LD5 A;  1LFB A;  5K7H A;  3HOU J;  1H8A C;  1QPI A;  5EG0 B;  3BTI A;  3CCY A;  3G1O A;  2LP0 A;  2ECB A;  2XPU A;  3BG3 A;  3PO2 J;  2NVQ J;  4X6A J;  5F0H A;  1A6I A;  2XGC A;  3GBG A;  3BR3 A;  2VUM J;  4DYR A;  4A3L J;  1W0T A;  2HOS A;  2ELK A;  3O8G A;  1IRZ A;  5C4X J;  3CMY A;  3UKG A;  1RKW A;  3HGG A;  4V2F A;  1ZQ3 P;  2LR8 A;  3MN2 A;  4MFD A;  4J19 A;  4A3M J;  2M34 A;  1HDP A;  3JRH A;  2LY9 A;  2VPR A;  1W0U A;  1IG7 A;  3ZQG A;  3BTL A;  4B3A A;  1GV2 A;  3BQY A;  5JLX A;  3IH3 A;  2NVT J;  2M2E A;  2EH3 A;  2L7M P;  2KDZ A;  1ORK A;  1WGX A;  2AO9 A;  1ZK8 A;  4Y7N J;  1RKT A;  3LSP A;  1H88 C;  4DYQ A;  2COB A;  5IP9 J;  1VFC A;  2ID3 A;  2DMU A;  2XB5 A;  1YRN B;  2M8G X;  4JX5 A;  3B6C A;  1OJL A;  4JP0 A;  2EZK A;  5IYC J;  4IHY A;  4A3D J;  3GTJ J;  2HQ5 A;  1GDT A;  3FK6 A;  5GPC A;  4B4C A;  3NAR A;  3OSG A;  3BQZ A;  2AHQ A;  3JRG A;  1Z0X A;  3TP0 A;  1BJZ A;  1SAN A;  4CYC B;  2LLK A;  1FEX A;  2EZI A;  4FCY A;  1IV6 A;  1U9O A;  2L7F P;  5C44 J;  2HOA A;  3GTP J;  3H3V K;  1F36 A;  4C3J J;  2XPV A;  1O4X A;  1X58 A;  3JRE A;  2M9H A;  2VKE A;  1LE8 A;  3GTO J;  3BT9 A;  2Y2Z A;  4QTR A;  3IH4 A;  2LK2 A;  2LKX A;  1ENH A;  2NVY J;  2ME6 A;  2RAE A;  4XRS A;  2DMT A;  5EEA A;  3SDG A;  3FK7 A;  1WH7 A;  1B8I A;  1FIP A;  4MFE A;  1IUF A;  3RZO J;  3RZD J;  1JJ8 C;  3TW7 A;  4BKX A;  5K7F A;  4A69 C;  3I4N J;  1B72 A;  1RES A;  2CQQ A;  4FTH A;  4IHX A;  3ZQI A;  2ECC A;  5F04 A;  2ZB9 A;  1JKQ C;  1T56 A;  2H1K A;  3SFI A;  5GPA A;  2I10 A;  2E1O A;  3Q0U A;  1BW5 A;  3FIW A;  5EDN A;  4XRM A;  2LVS A;  5EGO B;  4A93 J;  1X2N A;  4AUX A;  3A02 A;  2JWT A;  4A3E J;  1HOM A;  3HKZ N;  4M3D A;  3S1M J;  5EG0 A;  1F43 A;  3OOU A;  5J1U A;  5FLM J;  1MBF A;  3HDD A;  3JRF A;  2LTP A;  1I50 J;  5E3O A;  1FTZ A;  1IC8 A;  4W97 A;  1TC3 C;  4IHW A;  2CQX A;  3BTJ A;  1FJL A;  2JMW A;  1XS9 A;  2R92 J;  2OF7 A;  2XSD C;  2WAQ N;  2MG4 A;  5M5W J;  2JJ7 A;  2JK3 A;  1OCP A;  3PM1 A;  4UUT A;  3ZQF A;  1Y1W J;  2MW8 A;  3BR0 A; 
#chains in the Genus database with same CATH topology
 1ETQ A;  2ACJ A;  2BXZ A;  3LSM A;  1TT0 A;  5K7Z A;  3HRM A;  1JKO C;  1VQM I;  1BM9 A;  1EH6 A;  2BZT A;  3IKV A;  2CMP A;  1XTA A;  3RIR A;  5BS6 A;  2DA2 A;  2R7D A;  3TO9 A;  5LEK A;  2M1B A;  2DMN A;  2X1E A;  2Y31 A;  3OIO A;  5H6Q A;  3K4B A;  1SD5 A;  2DA3 A;  3BC8 A;  3I4P A;  4XBF A;  3PIO F;  3A01 B;  3DXJ F;  1MDM A;  1HBX G;  1L0O C;  5L3D A;  2CQK A;  4M3G A;  5K5Q A;  2Y9Z A;  1Y1V J;  1BI0 A;  2EIJ H;  4GCV A;  2E1M C;  1OCR H;  1MSF C;  4D5F A;  2STT A;  1HC8 A;  4ESB A;  1WPK A;  3H36 A;  2L0K A;  2E19 A;  4ETS A;  1POG A;  2DN0 A;  2EV6 A;  4N4N B;  3Q0V A;  3L2R A;  1MKM A;  2LKS A;  2DMQ A;  2CUF A;  2CFO A;  1Y6I A;  2V1N A;  3HOV J;  4XIC A;  4R1H A;  3ZMU A;  4CYC A;  3S3M A;  3CUQ B;  1ERD A;  1Z67 A;  1VQ5 I;  2H6B A;  3AL0 B;  2EWN A;  1PUE E;  4EJT A;  4ABZ A;  4I2O A;  4F92 B;  4OWR B;  3WOD F;  3LFK A;  2XRO A;  1L3L A;  2DT7 B;  5GAE J;  3H5N A;  4M6Y A;  5KNL A;  1CGP A;  3P7N A;  2DYS H;  1USS A;  4LFU A;  1SVM A;  3ZQC A;  1B4A A;  3ZQQ A;  3W6V A;  2RQQ A;  4MHG A;  2FQ4 A;  2XAU A;  5GP9 A;  4E6K G;  3CTA A;  2KIU A;  3ABT A;  2F5C A;  3OYF A;  2W48 A;  3BPX A;  3FM5 A;  4Z6Y A;  1F5T A;  2PN6 A;  3C2G A;  2PQ8 A;  1O7L A;  3M1C A;  3LOC A;  4LOC A;  1R6R A;  4L5I A;  3RKQ A;  2XKP A;  3WTS C;  5FLV A;  2DTZ A;  4IVN A;  1MND A;  5L3C A;  3W2W A;  3L1P A;  1NK3 P;  1QPM A;  3HB9 A;  3DKX A;  3WG7 H;  2ZCW A;  3HOW J;  1IN5 A;  4M72 A;  1BN5 A;  3E6M A;  1T6S A;  3L9F A;  1WHU A;  1X3W B;  2DI3 A;  3LNQ A;  3DLA A;  3JRA A;  1UHS A;  4IRG A;  3I58 A;  2MSY A;  4XID A;  3HL2 A;  2K86 A;  3TP3 A;  4XSX F;  5F0C A;  1JTY A;  3EUA A;  3PO3 J;  4KN7 X;  1XB4 A;  1ZR4 A;  1JKR C;  4UVC A;  3DCF A;  1E3H A;  4D5C A;  3M8E A;  4ENN A;  2BE5 F;  4XK4 A;  5LHH A;  1Q1V A;  1YJN I;  3A0H C;  3BJA A;  2P5K A;  1WZ2 A;  5J40 A;  3GEZ A;  3T0Y A;  2DOE A;  2XF6 A;  3RSN A;  5BPD A;  2BXY A;  3RPQ A;  2NOG A;  5E3L A;  2K9L A;  3KYD B;  3G1M A;  4LK0 F;  2LOO A;  5FLX K;  2VOD A;  2QKL B;  3GW2 A;  3QAH A;  2R7O A;  3HSF A;  3PFI A;  2R5Y A;  4WXH A;  3H0G J;  3I5U A;  3HM5 A;  3CDL A;  2LF7 A;  2COM A;  1WFX A;  3OIQ A;  1OCT C;  2RNG A;  3HUG B;  4UVA A;  5IYD J;  2NXN B;  3W2A A;  2XSJ C;  5DCM B;  3OYA A;  1KQ9 A;  2GWR A;  3R0J A;  3K1N A;  3QYB A;  1JGG A;  2MFZ A;  3BG9 A;  4QPQ A;  5DTD A;  3JAM K;  3SQN A;  3PIP F;  2DA6 A;  5BPI A;  3CMA I;  2DA5 A;  2QEN A;  3H9Q A;  5DV5 A;  1GVD A;  4MEY F;  2R5Z A;  1YFH A;  3HXL A;  4BQQ A;  4M3B A;  5GAG J;  2CV1 A;  2RRE A;  2PMZ A;  4HAM A;  3E1S A;  1EH8 A;  1UCR A;  2VB6 A;  2A6T A;  5CPR B;  5D6E A;  3WU2 C;  1U78 A;  3JSO A;  2IA2 A;  3WTT C;  4DNC A;  2ISZ A;  1X2M A;  4NDL A;  1YJ9 I;  3AFH A;  2BEO A;  1F4K A;  2EIL H;  2P81 A;  4YII A;  3A03 A;  1XSV A;  1MGT A;  3F8M A;  4B48 A;  3VPR A;  1P92 A;  2JSC A;  4WCG A;  1XG1 A;  2HS5 A;  4OIQ F;  3MKZ A;  5FKK A;  1IRF A;  2EFQ A;  3BZC A;  3PFY A;  1KU2 A;  2J5P A;  4G6D A;  5LHI A;  1REP C;  2E5Z A;  2R7V A;  2IT0 A;  1STZ A;  1XGN A;  3GVA A;  1O7F A;  1APL C;  3BG6 A;  4KMU X;  1ZEL A;  3VB2 A;  1QZY A;  2YU9 J;  1Y56 A;  4UV8 A;  3LA3 A;  3S2W A;  1KU3 A;  2FD5 A;  4YFN F;  3LMM A;  4HF2 A;  1WRJ A;  1XMK A;  1W36 C;  3LST A;  2IRF G;  1EKE A;  4I6Z A;  2JVH A;  3DU6 A;  2A5Y B;  2LNB A;  5KCM A;  3ULQ B;  2VLA A;  5FKN A;  1K6O A;  1OR7 A;  2GLO A;  3I71 A;  3ZOB A;  4CA0 A;  4ESJ A;  2CFX A;  2NNN A;  3BCA A;  1JT0 A;  4QIW N;  3HOX J;  2HR3 A;  2E34 A;  3TW6 A;  1Z9C A;  4I98 B;  4I09 A;  2X6X A;  5CVV A;  1ULY A;  3H9J A;  4BHP A;  1HKQ A;  1TQP A;  3ZR8 X;  2A07 F;  1E2X A;  3OS0 A;  2ZNY A;  4MTD A;  1ZAO A;  1K6Y A;  1AWC A;  1ZLK A;  5EZG A;  4ZZD A;  4M71 A;  1Z21 A;  2K3P A;  2V6C A;  2QBY B;  3CJQ B;  2KZG A;  1P4X A;  3GZ6 A;  2Y0S A;  2WY7 Q;  2NOJ B;  4C9Y A;  4BBS J;  3S1Q J;  1FPQ A;  2VL8 A;  4WX9 A;  3KZZ A;  1YIJ I;  1WH5 A;  2ID6 A;  3I4M J;  3V42 A;  3OMY A;  3C18 A;  1OCC H;  2OCE A;  5L3B A;  3K2A A;  3S3N A;  4LLL A;  1JUS A;  4BJ6 C;  3QPL A;  4BY1 J;  4KYW A;  1ZG5 A;  2LYC A;  4XRS G;  5JR3 A;  3FX3 A;  3AG3 H;  2Y69 H;  3S2D J;  3FDY A;  3DKW A;  1DPR A;  2QQ9 A;  1NTC A;  5JLW A;  3FXR A;  3V8K A;  4ENK A;  2DDB A;  2X9D A;  3E6C C;  5A2Q K;  1R5I D;  3T5X A;  5LRS A;  2L54 A;  2OUM A;  2CW7 A;  3QPS A;  4A6D A;  4XLC A;  3ZN1 A;  2VPL A;  1JGS A;  3TOB A;  4U0Y A;  2K5C A;  5HS9 A;  5GTI C;  3Q5F A;  2QM3 A;  5C3E J;  3H9G A;  2XC7 A;  4S0H B;  3BR2 A;  3GZ5 A;  1EH7 A;  3R4K A;  3ZCO A;  1DU6 A;  1FTT A;  1IN4 A;  1QVU A;  1Z3X A;  2LD5 A;  4LLG F;  2M8E A;  2CV2 A;  2YPR A;  3BTI A;  2VXZ A;  3H1C A;  1LUJ B;  3CCY A;  3SFZ A;  2K02 A;  1X1D A;  3G1O A;  2ECB A;  3RDI A;  4EV0 A;  1S9H A;  4X6A J;  2GA2 A;  4XSZ F;  2Q2E A;  4II2 A;  4NC7 A;  4DYR A;  5FD6 A;  2YX4 A;  2HOS A;  3LSI A;  2QUF A;  3PNT A;  3O8G A;  3OL3 A;  2IW5 A;  3F22 A;  2DCE A;  1YHQ I;  5C4X J;  3A2K A;  3UKG A;  1ZAR A;  4CZZ A;  2LR8 A;  3MN2 A;  2DK5 A;  2VXD A;  1T0F C;  1RC9 A;  3QOE A;  3JRH A;  4E7H A;  3BTL A;  2XRN A;  5JLX A;  3FMQ A;  2FOW A;  1ORK A;  4Y7N J;  1MDM B;  4PSW A;  1X1C A;  2WB1 A;  1F9N A;  2L9V A;  2OC6 A;  2MA3 A;  5ICC A;  4BAC A;  2COB A;  2Y0M A;  2VKH A;  4BU2 A;  5IP9 J;  2KP6 A;  3D5S C;  3CC2 I;  2ID3 A;  2STW A;  1WJD A;  2IS6 A;  2D1H A;  3ASO H;  2HQ5 A;  3MFK A;  1GDT A;  3LQQ A;  5GPC A;  2FNP A;  1XGM A;  1FOY A;  4CCM A;  1MW7 A;  4M9Z A;  2QQ8 A;  1BJZ A;  4HRI A;  1B6A A;  1SAN A;  4CYC B;  1U9O A;  5DUK A;  3WU1 B;  1V4R A;  1TT5 B;  4L18 B;  3GTP J;  3H3V K;  4E7J A;  4BH9 A;  2BW3 A;  4HA8 A;  2E71 A;  3JRE A;  5BQT A;  3ABU A;  3M9A A;  3C2H A;  5E1W A;  3K4N A;  4QWQ A;  4QLC U;  2RGV A;  1NG7 A;  4RAG A;  4BS9 A;  1H9T A;  3R60 A;  3GZN B;  3ABL H;  2DMT A;  1UB9 A;  2JRM A;  2PI0 A;  3HRU A;  4OMZ A;  1B8I A;  2VE9 A;  4MFE A;  2CSO A;  4EM1 A;  3RZD J;  1JJ8 C;  3CUQ C;  3I4N J;  2CQQ A;  3AL0 C;  4FTH A;  2FOK A;  2QSF X;  1FYL A;  5E79 C;  4HZF A;  4IHX A;  1E0E A;  5F04 A;  1X3U A;  3OYG A;  4F93 B;  3MKY B;  3N97 A;  1IXC A;  3DPT A;  5LGT A;  1XCB A;  2E7W A;  1VQ7 I;  2H1K A;  1G4D A;  3SZT A;  3SFI A;  5GPA A;  2Y48 A;  2I10 A;  2R7U A;  2CW0 F;  1YS6 A;  1HST A;  1YYV A;  2F6C A;  2E1O A;  1UEL B;  2E36 A;  2VIX A;  1BW5 A;  2RKH A;  4RS8 A;  5LGN A;  1X2N A;  2KJC A;  5ILU A;  2HQR A;  2KIM A;  1WQ2 A;  2JWT A;  3V8L A;  1HW5 A;  2JUC A;  4KIB A;  3S1M J;  2VON A;  2R7T A;  4YIF A;  3WG9 A;  2OAZ A;  1D3Y A;  1FTZ A;  1IC8 A;  2QSG X;  5LFA A;  2CQX A;  4HV5 A;  1TZL A;  1I39 A;  3K1M A;  2JMW A;  4C2T A;  3W6K B;  2R92 J;  4HX4 A;  2YX7 A;  5M5W J;  2JK3 A;  5FLX Z;  1ON2 A;  2KZV A;  3B02 A;  3VSL A;  5JVG F;  1YS7 A;  3ML6 A;  4GXO A;  1MIJ A;  4XON A;  1FX7 A;  3E7L A;  4GYG A;  1DQU A;  4LGW A;  1DP3 A;  4DZJ A;  1K79 A;  2ZO4 A;  3WHC A;  1XC5 A;  3CP2 A;  3JRD A;  1UG2 A;  3F8B A;  4JQF A;  1Y8R B;  1T98 A;  5D5W B;  2IS1 A;  1JI8 A;  3S1R J;  4AWX B;  1N25 A;  3VFZ A;  2Q0O A;  3WTY C;  2R5Y B;  4C3I J;  2DOF A;  2EBI A;  1VQ9 I;  1A5J A;  1MZB A;  2FU4 A;  2JUG A;  3FHZ A;  3JAM Z;  4YIR X;  2HXO A;  2HI3 A;  4DJA A;  4IKF A;  4A3G J;  3LSJ A;  1JUP A;  1MJB A;  4ZJZ A;  1AOY A;  3N4M A;  1M1E B;  2O8K A;  2VT2 A;  4D1Q A;  3OYI A;  1DGR M;  4RAY A;  1ZYR F;  2MLG A;  4CUG A;  2XKO A;  1A35 A;  4XLA A;  1LJ9 A;  1VQL I;  1KYZ A;  4CO8 A;  4S05 A;  3HOS A;  2GIV A;  3WGG A;  2R5Z B;  1U2W A;  5AON A;  4PJM A;  3BR6 A;  1R00 A;  1TLH B;  1ZGA A;  2VQH A;  4UV9 A;  3ABM H;  2K9M A;  1IN6 A;  2MC4 A;  3HTU A;  4PUS A;  1G3T A;  3L2W A;  4A3I J;  4X1E A;  1YIT I;  2HFH A;  1MBH A;  1D1B A;  2VBW A;  1YW7 A;  1TW2 A;  2ZKZ A;  2DXI A;  2ZFW A;  3ZQ7 A;  2FBH A;  4G12 A;  5FJ8 J;  2PEX A;  4IZZ A;  2DQR A;  3F6V A;  4ZTF A;  2BVL A;  2Z9O A;  3NQO A;  4PGG A;  2KRH A;  4LMY A;  3S2H J;  1E3P A;  1OCO H;  1R58 A;  2OZU A;  3KCC A;  1ETX A;  3H3Z A;  4DZP A;  3J80 K;  4IPA A;  4D9J A;  2BY3 A;  4A3C J;  4BNC A;  2CUE A;  1DU0 A;  3LA2 A;  3FXL A;  3K4C A;  2IXS A;  2HPI A;  3VOD A;  1K61 A;  5DM7 F;  3RQ4 A;  1R5H A;  2O7O A;  3MMY B;  1SFX A;  1GV5 A;  4Y33 A;  1LQ1 A;  2IGN A;  2XV4 S;  4BAY A;  2EA4 A;  4CHU A;  1S6L A;  4HEA 2;  3WTZ A;  2IJL A;  4KFC A;  2QLZ A;  2B0L A;  4WF2 A;  5FD5 A;  4B44 A;  3VYU B;  2XIG A;  1B59 A;  1QGP A;  1VQN I;  4FE7 A;  3BZK A;  1J5Y A;  2NS0 A;  1B9N A;  3AG4 H;  2K7L A;  3ASN H;  1V5G A;  3FKJ A;  5EYR A;  3DEW A;  2JA5 J;  1V5E A;  2DFH A;  2MD5 A;  2FA5 A;  3K4J A;  3WU0 A;  2P8T A;  2WAQ A;  1O3T A;  4BE1 A;  2CV0 A;  4L0Y B;  3ZP5 A;  3J81 K;  3FZV A;  5E20 A;  2M45 A;  2GXA A;  1MD0 A;  3HBL A;  1JTX A;  3O2P E;  3CQZ J;  1OFC X;  5F6F A;  1ZRE A;  1OMI A;  1X4P A;  1TTY A;  3ROU A;  3H5R A;  4LD5 A;  4KUM A;  1GXQ A;  1RI7 A;  5ILS A;  2VQL A;  5IYB J;  1XDU A;  4BXX J;  1LFU P;  4RM2 A;  3JSP A;  3VYR B;  5ICG A;  5A2Q Z;  4RAF A;  1QZE A;  4KT6 A;  2OBP A;  4EAT A;  2A5W A;  1R23 A;  1VF9 A;  3KP3 A;  4L5E A;  4IOC F;  2JPC A;  2D45 A;  1P6R A;  2JZY A;  4WXC A;  3QU3 A;  4HBL A;  3SDB A;  2D5V A;  2ADU A;  2NS7 A;  1MMA A;  1V5F A;  1UHW A;  3VSK A;  1TWG J;  5GTH C;  1OYI A;  4DOZ A;  3ZN0 A;  2IBD A;  4ANJ A;  1R22 A;  3GXO A;  1ETK A;  3S14 J;  4R79 A;  4ZDO A;  3PSI A;  2K9S A;  4A2U A;  1RET A;  1Z77 A;  2CRG A;  4UUS A;  3LAP A;  3DLL F;  2HDW A;  2PFB A;  3OR1 C;  4JK1 X;  4M6X A;  3NAU A;  5J4Y A;  2UV1 A;  4KIT B;  1JT6 A;  5DDG A;  3GTK J;  1CQT A;  1E3O C;  3S1N J;  4AC0 A;  3F0C A;  3JR9 A;  3EET A;  4A12 A;  5FRO A;  1TQI A;  2XAF A;  4HNV A;  1S29 A;  1BOB A;  2K27 A;  2KJB A;  4FET A;  1BI1 A;  3FXO A;  2PX9 A;  4NC8 A;  5DCF A;  2Y30 A;  5IP7 J;  5D8L B;  1BW6 A;  3OL4 A;  4ZTJ A;  4BXU A;  1WJF A;  2WY8 Q;  3ERM A;  1OYY A;  3S3O A;  3FXU A;  2H8W A;  2Q2E B;  4M6V A;  1Y39 A;  3OSF A;  4IHT A;  3U1K A;  2ISY A;  1A36 A;  5HLH A;  2TCT A;  4FX0 A;  5L3G A;  4M9X A;  3KYL A;  3U1D A;  1IDZ A;  1ETY A;  3HOZ J;  1WVR A;  3M8J A;  2PBI A;  5GAH J;  3LSR A;  4RB0 A;  2XDV A;  4LB6 B;  5B5E C;  1E17 A;  4AVP A;  2F4O B;  1FC3 A;  2ETH A;  4Q5S F;  2ZC2 A;  1ZLJ A;  4R8H A;  2FUG 2;  3FF5 A;  2X6W A;  1SD4 A;  2V1D A;  4XMY A;  3G71 I;  2HVQ A;  1I3Q J;  2EIM H;  4B1R A;  2GXB A;  2O3F A;  3S16 J;  2DOD A;  3L00 A;  1T95 A;  3H35 A;  2DA4 A;  4ZYA A;  1K7A A;  2BBY A;  3S15 J;  4AYB N;  1D8K A;  1TNS A;  2GZW A;  2W7N A;  1AKH A;  3HJE A;  3RI4 A;  2YSR A;  4H0E A;  2W25 A;  3F23 A;  1D0Z A;  2I5U A;  1FSH A;  3DKY A;  3HKZ A;  1BI2 A;  1BIB A;  4XLF A;  3FWE A;  3DBL B;  1MNE A;  4I99 C;  5J3L A;  1GT0 C;  3IWZ A;  1SMT A;  2J5O A;  1YI2 I;  1AHD P;  4CCJ A;  1U6G A;  1VQ6 I;  2L9R A;  1IGN A;  3BDD A;  3EUH A;  2BW3 B;  3GO5 A;  1QZZ A;  4LIV A;  4BJT A;  3ZMZ A;  3G4S I;  1ZG1 A;  4KJZ A;  3L09 A;  3HTS B;  2LRE A;  1U0J A;  2DFF A;  2W85 A;  4GFB A;  5IT9 K;  2PJP A;  3FXJ A;  4XKB A;  5HVQ C;  2HKX A;  4EEF G;  2R7S A;  4Y3O A;  1BR4 A;  1B8I B;  3S17 J;  5ILV A;  4Q47 A;  1Z3Y A;  3G1L A;  3GTM J;  2F4M B;  3L7W A;  2O9L A;  3Q9S A;  2O0Y A;  2EZL A;  2HXI A;  1O3R A;  1IZ1 A;  1ZTR A;  1A6Q A;  1ZKG A;  2X1C A;  5CVU A;  1ZGW A;  1H0M A;  2VC1 A;  3OY9 A;  5HLT A;  2ZME C;  2CG4 A;  1DGW Y;  1JUM A;  4IXA A;  1A04 A;  4JX6 A;  1PP7 U;  3E5X A;  2XAS A;  2EJR A;  1FBS A;  3CP8 A;  3BY6 A;  1XMA A;  2HDD A;  2PLY A;  4BHB A;  2IGO A;  4U7B A;  4IHS A;  2FXA A;  4BL0 B;  4C2M J;  4A0X A;  2VE8 A;  2NNY A;  2HEO A;  2WC2 A;  1J2X A;  2IEK A;  1IUY A;  3MWM A;  2GOX B;  3BWG A;  1BC8 C;  3CD6 I;  1VTN C;  5K7H A;  2KRF A;  3RKY A;  2O61 A;  3MEX A;  1XCV A;  2KFD A;  3OV8 A;  4BQN A;  4G6Q A;  4F52 A;  4HX8 A;  2LP0 A;  2ZBK A;  5H2F C;  2V26 A;  4LG0 A;  3TQN A;  1TP4 A;  3ZRG A;  5ICF A;  2BGC A;  1QBJ A;  2LH9 A;  2VBZ A;  2XGC A;  3GBG A;  3BR3 A;  4HQM A;  4O3M A;  1ZH5 A;  1SD7 A;  2VUM J;  4P9U A;  1W0T A;  2EFP A;  1ZHF A;  3JW4 A;  3J7Z I;  1IRZ A;  3E3V A;  5CVJ A;  2BY1 A;  3E5Q A;  1NHA A;  4EVI A;  1PP8 F;  3CUO A;  3IP4 B;  3HGG A;  5AIQ A;  1ZQ3 P;  3KEY A;  3NWS A;  2MH2 A;  4MFD A;  2Q1Z B;  4J19 A;  1ZRD A;  3CO7 C;  4XM3 A;  2HVS A;  2DLL A;  2M34 A;  4Y13 A;  1W0U A;  1OLT A;  3ZQG A;  1BR1 A;  1Z05 A;  2R7F A;  3BQY A;  1FNN A;  2H6C A;  2NVT J;  4XLH A;  2M2E A;  2EH3 A;  4AU7 A;  2BVM A;  3P9C A;  1IF1 A;  2P7C B;  2AO9 A;  4IL6 C;  1UG0 A;  3F8C A;  1RKT A;  1EJ9 A;  1X19 A;  1LNW A;  2IGM A;  2UUZ A;  3I64 A;  1MMG A;  2DMU A;  2XB5 A;  5LLQ A;  2A05 A;  3F6O A;  4EJO A;  4JX5 A;  2DT6 A;  3B6C A;  3DPL C;  3OYN A;  4JP0 A;  3L2Q A;  1S3J A;  4N9H A;  5KVR A;  3FK6 A;  2OQR A;  2M0M A;  4B4C A;  4EM2 A;  3NAR A;  5K1Y A;  2MLK A;  4IX7 A;  3L2U A;  3TP0 A;  2NAZ A;  2KIS A;  1R1V A;  2FNA A;  1ZRC A;  1FYK A;  4UUV A;  1FEX A;  3K10 A;  3CF5 F;  2DO7 A;  2EZI A;  1NH3 A;  5C44 J;  1G3S A;  2EFO A;  4GDF A;  4NBQ A;  1XMX A;  4BUP A;  1D1C A;  4UB6 C;  2VOP A;  2K4B A;  1XPX A;  2V9P A;  1HW1 A;  1FBU A;  1LE8 A;  3J7Y J;  2AQE A;  2JSP A;  2Y2Z A;  2ZJR F;  4IOA F;  1S8N A;  4QTR A;  3J80 Z;  2LK2 A;  1ENH A;  2NVY J;  3EYI A;  2EPF A;  4HPQ A;  5EEA A;  3FK7 A;  3BCB A;  4UHT A;  1FIP A;  3HYI A;  2V1X A;  4OOI A;  3KLN A;  2KPM A;  3RZO J;  3IL2 A;  2HU9 A;  1B72 A;  4I01 A;  4PJJ A;  1YOV B;  2ECC A;  1MJA A;  3CLQ A;  1UJ8 A;  3CES A;  2L2O A;  3CMM A;  3PJR A;  4BXF A;  3K4M A;  2IVM A;  1SC7 A;  4HLX A;  4BDY A;  4E7L A;  3I54 A;  1WWX A;  3FIW A;  3MZ8 A;  3LL7 A;  2FEZ A;  4A0Z A;  4ZYH A;  2K3F A;  3A02 A;  4RM3 A;  2Y75 A;  2M30 A;  2DFI A;  2ZXW H;  3OIP A;  1KQ0 A;  2A69 F;  3J81 Z;  3D5L A;  3QWL A;  3O6B B;  5BMZ A;  5EG0 A;  5J1U A;  1MBF A;  3TDZ C;  3HDD A;  4FX4 A;  2E1M B;  1FWZ A;  4W97 A;  1TC3 C;  4IHW A;  2M7A A;  1BJA A;  1FJL A;  1XS9 A;  2H27 A;  3CC4 I;  2AXT C;  4HLY A;  2Z1D A;  2A61 A;  3WTW C;  1OR7 C;  1QNT A;  3PM1 A;  1SAU A;  1WKM A;  3ZQF A;  1EA3 A;  5J4V A;  3ZGK A;  3BR0 A;  3ECH A;  4BE0 A;  3LQR A;  3E5U A;  4E70 A;  4HDV A;  4U7D A;  3SXY A;  1BIA A;  3M3Y J;  2VC0 A;  2P7V B;  4P1W A;  2MAB A;  3RCO A;  4BDZ A;  3HEF A;  3G6E I;  1Z6R A;  2VAS A;  4YFX F;  2R7R A;  3RJP A;  5M5Y J;  4C30 A;  4D7N A;  3GFM A;  1W7P A;  5HOD A;  3T1B A;  4DYC A;  3D0S A;  1QVT A;  1SMY F;  2Z3Y A;  2CH0 A;  1HF0 A;  4HF0 A;  2Z2S B;  3J7A Y;  3GFJ A;  1YRN A;  1H89 C;  2OU2 A;  1AA7 A;  1C0W A;  1FT9 A;  5LEJ A;  3CME I;  2XGE A;  2L9S A;  2DK8 A;  2LG4 A;  2YUS A;  4G6T B;  1VQO I;  2QVO A;  4C3H J;  5M3M J;  2L7Z A;  1YG2 A;  1FP2 A;  2F4I A;  1KU7 A;  2R7Z J;  2AS5 F;  4CCL A;  2DA1 A;  3TKY A;  3PUB A;  4UUS B;  3DU5 A;  3KP2 A;  4BGD A;  2IGK A;  1J75 A;  3VYT B;  2DBB A;  4MQV A;  2HOT A;  2W84 A;  2KT0 A;  3KEO A;  2HOE A;  3M1E A;  1TWH J;  2LKP A;  2Z5U A;  2CS3 A;  3IAM 2;  4MNU A;  3HHG A;  3AG2 H;  4OIO F;  1MNM C;  5IOZ A;  3OYB A;  1X1P A;  2NS8 A;  3FKI J;  1OQY A;  3ZMS A;  4MQ9 F;  2O5R A;  3OWT A;  5H6R A;  5F1J A;  4Y17 A;  3ZMD A;  2X4H A;  2HYF A;  1IW7 F;  3K0L A;  4WK8 F;  2M5W A;  1Z7L A;  2N8G A;  2L4A A;  2E2I J;  1F1Z A;  3GX4 X;  2K4J A;  1WCM J;  3M8F A;  1Z1D A;  2DJN A;  2L02 A;  1QA6 A;  1GXP A;  2IS2 A;  1TQM A;  2XGX A;  3C3W A;  4X0G A;  1Z91 A;  4RGU A;  4XN0 A;  2I8D A;  3CCU I;  3BG7 A;  5ERI A;  2XF7 A;  2HGC A;  3K2Z A;  2WB1 N;  3K69 A;  2QZ8 A;  3Q0W A;  1VI0 A;  4F3Q A;  3MZH A;  4RB2 C;  2PG4 A;  3CCE I;  2FML A;  1YW9 A;  3ECO A;  5EGO A;  3BJO A;  4RBO A;  2LC2 A;  3F3X A;  2M87 A;  3PQJ A;  3ZMT A;  5H20 A;  2FE3 A;  5KAI C;  2ZFU A;  5M3F J;  2HPM A;  4CZC A;  4P5O A;  4BE2 A;  4DBQ A;  4IRI A;  4QSH A;  1AKH B;  5FKM A;  5KK1 A;  3OYH A;  1FMV A;  5B1B H;  2V4J C;  2KDO A;  2KRC A;  2RV8 A;  3H0D A;  3SZG A;  3GTQ J;  3QU6 A;  2Z99 A;  1ETO A;  2BHY A;  3CDH A;  4BQA A;  4OAY A;  4ENM A;  4DGW B;  2CU7 A;  3WTU C;  3OYJ A;  1SEU A;  1SFO J;  2CJJ A;  1TBX A;  3HGY A;  2P4W A;  1H9G A;  2XPW A;  5IT9 Z;  3PL8 A;  1BR2 A;  2CYY A;  3VOE A;  2CQN A;  2RNJ A;  4A3K J;  3H3U A;  5KAF C;  4HG2 A;  4EQQ A;  1MMS A;  2YR2 A;  5CJ9 A;  5E3M A;  2E60 A;  2JVG A;  1R1U A;  4BEH A;  2VKV A;  1X3Z B;  2DAO A;  5D5X B;  3IV5 A;  1ON1 A;  1WJE A;  3QP5 A;  3ZQL A;  2ZNZ A;  1J09 A;  2VJJ A;  4XQF A;  2FQ3 A;  3CF2 A;  5F1R A;  2HDC A;  1HDD C;  3ELK A;  4A3B J;  2MGQ A;  4RLQ A;  4PFO A;  4DQ2 A;  3TO7 A;  3AAF A;  2OTJ I;  3CCS I;  1IRG A;  3HG9 A;  4OU0 A;  4HX7 A;  2GAU A;  2PJR B;  3QYF A;  2LRD A;  4BJ5 C;  2W00 A;  2XAG A;  2JT1 A;  2V7F A;  4NQW A;  1J9I A;  2IA1 A;  1IDY A;  4Q48 A;  3HRS A;  5EZH A;  1I6H J;  2O03 A;  5CVR A;  2Y9Y A;  1T33 A;  1HCR A;  1OKR A;  4EJW A;  1MH3 A;  2GBY A;  2NVX J;  2JTV A;  3CLO A;  2P5V A;  1R4M B;  3MQ0 A;  3GTG J;  4E7K A;  2G9W A;  3WHB A;  2LMD A;  1RIO H;  3HSR A;  4U0W A;  5EF6 A;  3GFL A;  3TBI A;  3TED A;  3E6D A;  1T39 A;  2W1O A;  2G0E A;  3MCZ A;  4LG0 B;  2NVU B;  1T8I A;  5E18 F;  1MMN A;  4KIS A;  1J7K A;  1YX3 A;  1V54 H;  2O8X A;  4HYE A;  1B1B A;  2F5V A;  3QPH A;  5D8K B;  5C4J J;  5HNH A;  5IY5 H;  2XB0 X;  1U5T A;  3I56 I;  4CCO A;  1QRY A;  2A68 F;  3HIF A;  2D1V A;  4LJZ F;  3ERE D;  2OPT A;  1YX5 A;  3DQV C;  3VDX A;  4H4K C;  2DYR H;  3NEU A;  5D6F A;  4JX4 A;  5LD2 C;  1XDS A;  2A3S A;  3CCV I;  4KT5 C;  1HA8 A;  3LSG A;  1IJW C;  1W5T A;  3L2C A;  3B6A A;  1G8X A;  4IRH A;  5CLS A;  5KHD A;  4U0V A;  4CH7 A;  2KL4 A;  2R7Q A;  1P7J A;  1PYV A;  4Y52 J;  5DEQ A;  2XVC A;  3PQK A;  2AXL A;  1S7E A;  4GYI A;  4IEJ A;  3LWF A;  1I1G A;  5E1X A;  3JRB A;  4E7S A;  2QA4 I;  1SFU A;  3I9V 2;  1KZH A;  2QCO A;  1GVJ A;  2F5F A;  2XRL A;  1J0R A;  2GQQ A;  1VQ8 I;  1ITY A;  1K4T A;  4RMN A;  4G7O F;  5FB2 A;  2R7W A;  2OJE D;  5D4R A;  2VQG A;  2XUB A;  1FSE A;  2ZJQ F;  4I02 A;  5HDN A;  2YS9 A;  3FBI B;  2MD0 A;  3IRQ A;  2CUZ A;  1ETW A;  2E7X A;  1XSX A;  5DM6 F;  1I1S A;  2DMP A;  2A6H F;  3HOT A;  2GM4 A;  3FIS A;  3DV8 A;  1S7A A;  4XL9 A;  4OIR F;  2ZXJ A;  5JHF A;  2W24 A;  3TDU C;  2V6E A;  2RDP A;  2K85 A;  3M07 A;  4OIP F;  1BBY A;  2MBF A;  2E2J J;  2CW8 A;  1SD6 A;  1LE8 B;  4HV6 A;  2FBK A;  3V7R A;  3A1Y A;  1XGS A;  2E2H J;  2L5Q A;  4G7Z F;  4L9T A;  2ME0 A;  2K9Q A;  3NRV A;  3D5R C;  4LG3 A;  2H8R A;  3P5J A;  1T08 B;  3Q3S A;  3I59 A;  2WV1 A;  2X6Y A;  3SYT A;  1LVA A;  1ZGJ A;  1LVK A;  3KX2 A;  1I6X A;  4JBA A;  4ZDP A;  4NHJ A;  3KYC B;  5JHU A;  3G2B A;  1B72 B;  2X0L A;  5F27 A;  1I27 A;  3GF2 A;  4OMY A;  3OYM A;  2HYJ A;  3K7A J;  4HST A;  1NK2 P;  4A5N A;  4G7H F;  1UST A;  1Z6T A;  4UB8 C;  5EEH A;  2DA7 A;  4RDU A;  2G7U A;  4YG2 F;  1WSU A;  4A3F J;  4G8X A;  1U9N A;  1R36 A;  1P7I A;  3F21 A;  3MKL A;  4A6E A;  3RPU A;  1LFB A;  3HOU J;  1N75 A;  4A0Y A;  2CQ7 A;  4IF4 A;  5EG0 B;  1DDN A;  2CUJ A;  4XLE A;  3LSH A;  2LY2 A;  2JPB A;  3GME A;  2XPU A;  3BG3 A;  3C7J A;  1HW2 A;  1IN8 A;  1WJ5 A;  1XN7 A;  3OS2 A;  3A4C A;  2WWY A;  5F0H A;  3PNV A;  4HSR A;  2WBM A;  2ESN A;  1YE9 A;  2MYS A;  4XKW A;  4L9N A;  1HXD A;  1KGS A;  2ELK A;  2ZXI A;  3HZJ A;  2L9N A;  5J47 A;  3FM3 A;  2Q8K A;  4N9I A;  2F2E A;  3BZ6 A;  4G9Y A;  4PZJ A;  2QQA A;  3CMY A;  1VQK I;  4V2F A;  4RB1 A;  1IO2 A;  5FFX A;  3LA7 A;  3NWT A;  1R49 A;  2MH9 A;  4UXN A;  1HDP A;  4N4O B;  2VPR A;  1IG7 A;  4B3A A;  1GV2 A;  4QPO A;  2DTR A;  1W7P B;  1D8J A;  2L7M P;  1WGX A;  1RUO A;  1ZK8 A;  4AYB A;  3KP5 A;  1Y0U A;  5EEG A;  1IN7 A;  3ZXS A;  4DYQ A;  1V55 H;  3MAJ A;  2CO5 A;  1UHM A;  2ESH A;  4EGZ A;  3KP6 A;  5E8I A;  1YRN B;  2OV7 A;  2M8G X;  3FHN A;  3KEQ A;  1GHC A;  2EZK A;  4IHY A;  3RYR A;  4A3D J;  4AID A;  2ZME A;  4XRF A;  4KIC A;  4M73 A;  3R0A A;  5HDK A;  3OSG A;  3BQZ A;  4O6J A;  2AHQ A;  3JRG A;  3CCR I;  4PGH A;  4BHC A;  2LLK A;  5JVT A;  5CVI A;  1TNT A;  3V8J A;  4FCY A;  1P2F A;  1W4M A;  2G7H A;  2L7F P;  4XN3 A;  3OYC A;  4C3J J;  4YRV A;  4NC6 A;  5L3E A;  3CCL I;  3UNG C;  3K70 D;  3WGI A;  2OCC H;  3ONQ A;  4HNU A;  4E7I A;  3FXK A;  3OOP A;  3BPV A;  1X1B A;  4CCN A;  2OD5 A;  4XRS A;  3SDG A;  2F5D A;  2RC4 A;  4C2U A;  3P9K A;  1IUF A;  4OIN F;  4KMF A;  5E1Z B;  3OYL A;  2BOL A;  2LSO A;  2JRT A;  3SZP A;  3DTE A;  4BKX A;  5K7F A;  1VZ0 A;  2UZK A;  2EFW A;  1RES A;  5ED4 A;  1Y8Q B;  4TV7 A;  1RZ4 A;  5DUI A;  3DTI A;  2HKO A;  1P4A A;  5K5R A;  3RYP A;  2ZJP F;  2HQA A;  4OAZ A;  3HRT A;  3N05 A;  1P9Q C;  2BY0 A;  4CXF A;  1SVO A;  3GFI A;  1VQ4 I;  2LF8 A;  2UWM A;  3AG1 H;  2A6E F;  3Q0U A;  5E8G A;  2ZXH A;  4Q4Z F;  5F64 A;  5EGO B;  2KIQ A;  4ITV A;  1ZG3 A;  2EA2 A;  3F72 A;  4KIG A;  4AUX A;  2HTS A;  2PJR A;  4EJU A;  4BYY A;  2P5L C;  1CF7 A;  4AIK A;  4XOT A;  1HOM A;  2IP2 A;  1UAA A;  1G3Y A;  2KKO A;  1YIO A;  4UVB A;  1BC7 C;  3HKZ N;  4FHT A;  3JRF A;  1N77 A;  1I50 J;  1A31 A;  2QYO A;  3KZI C;  3QRF F;  1FLI A;  1KQ8 A;  3C1D A;  2DU9 A;  2MG4 A;  1RR8 C;  2ELJ A;  4ZC3 A;  2EIN H;  3DBH B;  1W7P D;  3VYS B;  4ZDL A;  3FXQ A;  2MW8 A;  4BQO A;  1UMQ A;  2VJ5 A;  3BR1 A;  2FSW A;  3GCM A;  2JQ7 A;  4MLO A;  5FKL A;  4AVZ A;  2ZSH B;  1W1W E;  1TWA J;  2WA0 A;  3EPZ A;  3KP4 A;  2FMY A;  5IP6 A;  2QQB A;  4CSW A;  3O3K A;  4J00 A;  2LFB A;  3DPU A;  4BEH B;  4RA2 A;  3K6G A;  3RQI A;  1O3Q A;  1PUF B;  2BHZ A;  3MKW B;  2AQF A;  4FE4 A;  3GUD A;  3X2Q H;  4LIT A;  2B63 J;  5CQG A;  4A3J J;  3FMS A;  4PJN A;  1HKT A;  5J1R A;  2L4M A;  1JHH A;  1IV8 A;  1UFM A;  2ZJ2 A;  2EV0 A;  4XOP A;  2X51 A;  3EUH C;  2EV5 A;  4B43 A;  1QU3 A;  1G3W A;  4CIC A;  3IAS 2;  1DUX C;  2HVR A;  5F08 A;  3QPT A;  9ANT A;  3TMO A;  4NQW B;  1AU7 A;  4DW6 A;  3T8T A;  2KIF A;  3L2V A;  1HQC A;  2KQR A;  3SEZ A;  4S04 A;  4M74 A;  2B9S A;  2DPD A;  4ZZL A;  2VJI A;  2LBF A;  2PMZ N;  2X6O A;  3HC7 A;  2OZ6 A;  2EIK H;  4EJV A;  2DFE A;  5HLI A;  1IAW A;  1TL8 A;  2BV6 A;  3KP7 A;  2WAD A;  1D0X A;  3KZY A;  3T8R A;  4M3F A;  1U3E M;  3CZ6 A;  3S93 A;  5CYV A;  1NG6 A;  3DP7 A;  4WXD A;  3TGN A;  1K78 A;  5FRM A;  2P6T A;  4MGR A;  4L0Z B;  2K40 A;  2GIZ A;  4KDP A;  2JA2 A;  5IPA A;  3RTR A;  5TJJ A;  3FMR A;  4BBR J;  4XOR A;  1U5T B;  2TRT A;  4LLN A;  5IOY A;  2RQP A;  1MJ9 A;  1ZN2 A;  3HSE A;  3IKT A;  4FAS D;  4L5J A;  2QKM B;  2R0Q C;  4AIJ A;  3BLY A;  2KMU A;  2IPQ X;  3IHU A;  4P55 A;  1RPW A;  2QF7 A;  2MC3 A;  3ESW B;  5CKT A;  3WE3 A;  1X1A A;  1G2H A;  3W3C A;  5BOX A;  3C2B A;  5DS9 A;  5LGU A;  3F8N A;  2E35 A;  2GXG A;  1X4O A;  2WAE A;  4AM3 A;  3Q9V A;  3CJN A;  3KET A;  3DEU A;  4MO7 A;  1IRX A;  5DD4 A;  4CYD A;  1T0F A;  2TDX A;  3U9G A;  1JJ6 C;  2Z16 A;  5ICE A;  1FIA A;  4LK1 F;  4U87 A;  4AIH A;  3BP8 A;  2QSH X;  2D2W A;  3JCU C;  2R7X A;  1VQP I;  1GUU A;  4NUB A;  4I76 A;  3CC7 I;  2PMU A;  3GTL J;  4F55 A;  2E5N A;  1BA5 A;  4MIM A;  5TRD A;  4XLP F;  4BY7 J;  2WAF A;  3EUK L;  2M0C A;  3CCQ I;  3M4O J;  3O8H A;  2Y0S N;  2IA0 A;  5J8C A;  1HLV A;  3LSK A;  1ONV A;  4A5M A;  5IT3 A;  5B3S H;  2V9V A;  4GRI A;  4E7Z A;  4KA4 A;  1BOA A;  2M4K A;  1UZC A;  4W1U A;  1SFK A;  1FP1 D;  3E0J B;  3A01 A;  4PCQ A;  4RAZ A;  2VOO A;  2DT5 A;  1V3F A;  3I59 B;  3E97 A;  2O6G E;  3MVP A;  1MBG A;  5DYM A;  2JA8 J;  5D5V B;  2M4G A;  2F48 A;  3QOD A;  3BJ6 A;  4UNO A;  2C6Y A;  1RR7 A;  4I0B A;  2JA6 J;  2VBY A;  3W2V A;  1WJB A;  1VND A;  3EQL F;  5LRR A;  1J59 A;  2HNH A;  4U88 A;  2L7K A;  4D7M A;  4PSX A;  1R4N B;  4CDG A;  2W57 A;  4AD9 A;  1ETV A;  2KLO A;  5FO5 A;  1LKX A;  4Y15 A;  2XGD A;  1U8B A;  4YEL A;  2L01 A;  4HF1 A;  3CUQ A;  4L9V A;  4M9S A;  5J1Y A;  3I0T A;  5HOO A;  2R93 J;  3R61 A;  2CGP A;  1O57 A;  3WGH A;  2VQC A;  1LDJ A;  4IHV A;  3HOY J;  1KON A;  3BG5 A;  3RKW A;  3B73 A;  1MSE C;  1TWC J;  3JRC A;  3K70 C;  3PUF A;  3FBN B;  1MBK A;  3K4K A;  5AIP A;  1WJA A;  2XHK A;  4II3 A;  1T2K A;  1JKP C;  4F7Z A;  1I3A A;  1GLN A;  3HHH A;  3WTV C;  4UY8 I;  4DBR A;  1SAX A;  1R71 A;  2V1U A;  2E1C A;  1DPU A;  1FY7 A;  3DF8 A;  3OYK A;  2EQR A;  5B1A H;  2F5E A;  4JYK A;  4ZYD A;  2X48 A;  2W4S A;  5BNG A;  3GLL A;  5D4S A;  4XKV A;  3W6J B;  1EF4 A;  3REO A;  1MBJ A;  3TOA A;  1BL0 A;  3K1P A;  2V9K A;  3ABK H;  4YEJ A;  3KFW X;  2V79 A;  4JOM A;  5TIS C;  2VBX A;  5FRN A;  1QQI A;  4E4H A;  3U2R A;  2IAI A;  4EMS A;  4IO9 F;  3COA C;  1OIS A;  1QHH D;  5FGM A;  4NB5 A;  3HPG A;  1LEB A;  4M3E A;  3DTK A;  2WV0 A;  3QYE A;  1OCZ H;  1LEA A;  3R6S A;  1K4S A;  1TWF J;  1D5Y A;  3BR5 A;  3V7C A;  1FZP B;  2X1D A;  4KNY A;  4MEX F;  4B3X A;  1JE8 A;  1S7O A;  3IUO A;  3PSF A;  1MBE A;  4PJL A;  4CGZ A;  1B9M A;  1LDK B;  3K9T A;  2EZH A;  5CQE A;  2ZME B;  3KPH A;  1LPQ A;  1S5L C;  5HDG A;  4RLF A;  1XGO A;  2FJ1 A;  4ON0 A;  4EM0 B;  2FX0 A;  2HQN A;  4XKC A;  2DQL A;  2H94 A;  2VJ4 A;  3OR2 C;  2HZD A;  4D0P A;  3OS1 A;  3DFG A;  2FRH A;  4V2G A;  5E3N A;  6PAX A;  2HZT A;  4Y4R A;  1FMW A;  2YU3 A;  1RRJ A;  1RUN A;  2X85 A;  3F8F A;  1WI3 A;  1R7J A;  5HLG A;  5K5O A;  1LDD A;  2DW4 A;  4FQG A;  1XSD A;  2ZSI B;  3BTC A;  5HNF A;  1XX5 A;  1K83 J;  3K4L A;  3LFU A;  1ZR2 A;  2IS4 A;  4HDU A;  2XAH A;  3IH2 A;  5LHG A;  2CWE A;  3E6B A;  2VI6 A;  3HUG A;  1MH4 A;  2XAQ A;  3CJT B;  3TO6 A;  2VKD A;  4FT8 A;  5DCM A;  4FIS A;  4ZH4 F;  2HTJ A;  4NNJ A;  5FKO A;  2PMH A;  1JXS A;  4LIU A;  1PJR A;  1WJC A;  4EGY A;  1OYW A;  3ZPL A;  1W5S A;  3EYY A;  2P6S A;  1FBQ A;  2R3S A;  2JA7 J;  2H1L A;  3A0B C;  3JRI A;  3RPU D;  3QOP A;  2ICW G;  3OYD A;  1N78 A;  1D5V A;  4YFK F;  3ZQH A;  1Y0N A;  4I7H A;  5J6X A;  1PUF A;  3CCM I;  2K9N A;  1W5C C;  4IQ4 A;  3QQA A;  1R9T J;  3I55 I;  2OTL I;  3SEQ A;  2RVC A;  5M5X J;  4LB5 A;  5F0F A;  2DPU A;  4P9F A;  1R5G A;  4J01 A;  4KIF A;  1BI3 A;  3SJM A;  1I5Z A;  3LAJ A;  2VT3 A;  1CF7 B;  3D1N I;  2QEX I;  2JN6 A;  4N0B A;  3IRR A;  2Z33 A;  1H8A C;  4ENJ A;  1QPI A;  3BRO A;  4GO1 A;  2R4G A;  2NRA C;  2L3D A;  4HW0 A;  4B09 A;  1SVL A;  3DWL E;  3PNY A;  1U8R A;  3PO2 J;  2B7E A;  5TGT A;  2BYV E;  2NVQ J;  4RGR A;  1SFE A;  4KN4 X;  1A6I A;  2NYX A;  2OA4 A;  4A3L J;  2XF5 A;  2DDA A;  3H5A A;  4V19 K;  5L3F A;  3KIO A;  1KA8 A;  4I0A A;  5J8F A;  1RKW A;  2VN2 A;  1FOK A;  3RKX A;  4Z2Y A;  3OYE A;  3CCJ I;  1PDN C;  4A3M J;  1ACI A;  1QHG A;  1YQA A;  3FXM A;  3GLX A;  1G59 A;  2LY9 A;  1O3S A;  3BOQ A;  3IH3 A;  2HYG D;  4O5V A;  4CCK A;  2OQG A;  3SHF A;  2KDZ A;  3ISP A;  4XLN F;  1S72 I;  3LSP A;  2W82 A;  2UXX A;  3GWZ A;  5EJC A;  2E1N A;  4MTE A;  3VEP A;  3IWF A;  1H88 C;  1WI9 A;  3V4G A;  1G6N A;  1R1T A;  4PFP A;  1VFC A;  2ELH A;  2EB7 A;  2WTE A;  4HNT A;  2QBY A;  1OJL A;  5IYC J;  1ZRF A;  4HQE A;  1FOX A;  3GTJ J;  3MD2 A;  1T38 A;  3KLO A;  1KYW A;  3DBR B;  4K2E A;  4DIQ A;  3CDI A;  1Z0X A;  1QO0 D;  2LDU A;  2QGU A;  3VWB A;  1HKS A;  3EDP A;  4XR6 A;  2LBF B;  1IV6 A;  1YW8 A;  3WTX C;  2HOA A;  5HS7 A;  1YTY A;  1F36 A;  1RNL A;  3P9I A;  3GYH X;  2XPV A;  1O4X A;  1X58 A;  1FOW A;  2M9H A;  2VKE A;  4GGG A;  4PDK A;  1HSJ A;  5JI6 A;  1PVE A;  4ZYE A;  2XAJ A;  1KU9 A;  1OPC A;  3GTO J;  3BT9 A;  4IJA A;  3IC7 A;  1K78 B;  1IXS B;  3IH4 A;  1XD7 A;  1D0Y A;  2LKX A;  3QP6 A;  2ME6 A;  2RAE A;  1TW3 A;  5DD8 A;  1WH7 A;  5E17 F;  3JTG A;  4HOB A;  3AKZ A;  3I53 A;  2P0W A;  5HS8 A;  2GA1 A;  1JHF A;  3G73 A;  3TW7 A;  4A69 C;  3MZY A;  2HWV A;  2H09 A;  2M7B A;  1W36 D;  5FFZ A;  4PJ0 C;  3UR3 C;  4WWC A;  3ZQI A;  2GOM A;  2ZB9 A;  1JKQ C;  4F91 B;  4L9J A;  4ZYG A;  1T56 A;  2KHM A;  1Z7U A;  3JTH A;  1IXR C;  1EV7 A;  5D5U B;  2FF4 A;  3U21 A;  4RB3 C;  4IQJ A;  1FYM A;  2EK5 A;  2FBI A;  3DEE A;  4XNF A;  3I3L A;  3V7S A;  1LFP A;  1P4W A;  4B8X A;  5EDN A;  1ODD A;  4RGX A;  2LVS A;  2EFN A;  3WE2 A;  4XRM A;  4A93 J;  1Q1H A;  3KE2 A;  1YLF A;  4G94 A;  3S8P A;  2DJI A;  2LY1 A;  4A3E J;  1U5T C;  4M3D A;  1LB2 A;  1F43 A;  3OOU A;  5FLM J;  2BY2 A;  1YO5 C;  2LTP A;  5E3O A;  3G3Z A;  2M3A A;  5LBQ A;  3CJR B;  3BTJ A;  2DOA A;  4B47 A;  1MMD A;  1YJW I;  3HPH A;  3ZMV A;  4P96 A;  1D1A A;  2OF7 A;  4ASN A;  5JFR A;  3CO6 C;  3TL4 X;  2XSD C;  2WAQ N;  2JJ7 A;  1OCP A;  2QWW A;  3M7G A;  4UUT A;  5B66 C;  4ESF A;  3H92 A;  3S32 A;  2RN7 A;  1DP7 P;  3J7A O;  1Y1W J;  5GAD J;  4PK4 A;  2UXN A;  4RGS A;  3F9K A; 
#chains in the Genus database with same CATH homology
 1ETQ A;  3E7L A;  1UMQ A;  3BR1 A;  4DZJ A;  3WHC A;  1XC5 A;  5K7Z A;  3JRD A;  1UG2 A;  4MLO A;  5FKL A;  1JKO C;  3M3Y J;  3S1R J;  1TWA J;  2R5Y B;  2DA2 A;  4C3I J;  3HEF A;  2EBI A;  1A5J A;  2DMN A;  5IP6 A;  2Y31 A;  3OIO A;  2LFB A;  5M5Y J;  2HXO A;  2HI3 A;  4D7N A;  2DA3 A;  3RQI A;  3LSJ A;  1JUP A;  3A01 B;  5HOD A;  4A3G J;  4DYC A;  1PUF B;  1QVT A;  4FE4 A;  2O8K A;  1HF0 A;  4M3G A;  2B63 J;  2Y9Z A;  4A3J J;  1Y1V J;  5J1R A;  1MSF C;  4D5F A;  1YRN A;  1H89 C;  1WPK A;  2L0K A;  2XGE A;  2E19 A;  1POG A;  2DN0 A;  2YUS A;  3Q0V A;  5F08 A;  4C3H J;  5M3M J;  2R5Z B;  9ANT A;  2L7Z A;  1AU7 A;  2DMQ A;  4DW6 A;  3BR6 A;  2CUF A;  2R7Z J;  2DA1 A;  4UUS B;  3HOV J;  4XIC A;  4CYC A;  2PMZ N;  2X6O A;  4A3I J;  2HOT A;  4X1E A;  2KT0 A;  4ABZ A;  1MBH A;  1TWH J;  4M3F A;  1MNM C;  5IOZ A;  4G12 A;  2NS8 A;  3FKI J;  5FJ8 J;  3ZQC A;  3W6V A;  5F1J A;  2FQ4 A;  5GP9 A;  2K40 A;  3S2H J;  2N8G A;  5IPA A;  1ETX A;  2E2I J;  2W48 A;  4DZP A;  1WCM J;  2DJN A;  4A3C J;  4BBR J;  2CUE A;  2TRT A;  5IOY A;  1DU0 A;  3LOC A;  4LOC A;  3RKQ A;  1K61 A;  5FLV A;  2DTZ A;  2O7O A;  2R0Q C;  3L1P A;  1GV5 A;  1NK3 P;  1RPW A;  3HB9 A;  2QF7 A;  2WB1 N;  3Q0W A;  3HOW J;  1VI0 A;  1G2H A;  3C2B A;  5DS9 A;  5EGO A;  4RBO A;  3LNQ A;  3JRA A;  1UHS A;  4FE7 A;  4MO7 A;  2MSY A;  5M3F J;  4XID A;  5EYR A;  3DEW A;  2JA5 J;  3TP3 A;  5F0C A;  1JJ6 C;  1JTY A;  4QSH A;  1AKH B;  3PO3 J;  1FIA A;  5FKM A;  1ZR4 A;  1JKR C;  1GUU A;  3DCF A;  4D5C A;  4I76 A;  4XK4 A;  3GTL J;  1Q1V A;  3HBL A;  1JTX A;  3GTQ J;  1BA5 A;  4MIM A;  1ETO A;  4BY7 J;  2M0C A;  3CQZ J;  3O8H A;  2Y0S N;  1OFC X;  3M4O J;  1SFO J;  2CU7 A;  1HLV A;  2CJJ A;  3HGY A;  2NOG A;  5E3L A;  2XPW A;  3G1M A;  5IYB J;  2R5Y A;  4A3K J;  4BXX J;  1LFU P;  3H0G J;  5E3M A;  3HM5 A;  4W1U A;  3CDL A;  2VKV A;  1OCT C;  3A01 A;  3IV5 A;  1VF9 A;  4L5E A;  5IYD J;  3ZQL A;  3MVP A;  1MBG A;  2JA8 J;  1HDD C;  1JGG A;  4A3B J;  3BG9 A;  2MGQ A;  2D5V A;  5DTD A;  1RR7 A;  2DA6 A;  2NS7 A;  2JA6 J;  1TWG J;  2DA5 A;  1VND A;  2IBD A;  1GVD A;  4D7M A;  2R5Z A;  1ETK A;  3S14 J;  4M3B A;  1ETV A;  1IDY A;  2K9S A;  5EZH A;  1RET A;  1Z77 A;  1I6H J;  2XGD A;  2CRG A;  1U8B A;  4UUS A;  2Y9Y A;  1T33 A;  5J1Y A;  1HCR A;  2R93 J;  1U78 A;  1MH3 A;  2GBY A;  2NVX J;  3NAU A;  1JT6 A;  4IHV A;  3GTK J;  1CQT A;  3HOY J;  1E3O C;  3BG5 A;  1X2M A;  4NDL A;  3GTG J;  1MSE C;  3S1N J;  4AC0 A;  3F0C A;  2P81 A;  3WHB A;  3JR9 A;  3A03 A;  1TWC J;  5EF6 A;  3JRC A;  4HNV A;  3VPR A;  1MBK A;  1XG1 A;  1JKP C;  5FKK A;  3TED A;  2Y30 A;  2G0E A;  5IP7 J;  1BW6 A;  1APL C;  2YU9 J;  4M6V A;  3OSF A;  5C4J J;  2XB0 X;  2EQR A;  2FD5 A;  2TCT A;  4JYK A;  1ETY A;  1IDZ A;  1QRY A;  2X48 A;  3HOZ J;  5BNG A;  4I6Z A;  2OPT A;  1EF4 A;  1MBJ A;  3LSR A;  1BL0 A;  4JX4 A;  5FKN A;  3LSG A;  2IAI A;  2GLO A;  3ZOB A;  1IJW C;  3B6A A;  1JT0 A;  4QIW N;  3HOX J;  3TW6 A;  4M3E A;  1I3Q J;  1P7J A;  4Y52 J;  4B1R A;  3S16 J;  1TWF J;  1D5Y A;  3BR5 A;  2DA4 A;  1S7E A;  3S15 J;  4IEJ A;  4AYB N;  3JRB A;  1AKH A;  1MBE A;  5EZG A;  2QCO A;  2EZH A;  2XRL A;  1ITY A;  2FJ1 A;  4BBS J;  2FX0 A;  3S1Q J;  2YS9 A;  1GT0 C;  5J3L A;  1WH5 A;  2ID6 A;  1ETW A;  3I4M J;  2DMP A;  2GM4 A;  4V2G A;  3FIS A;  5E3N A;  1AHD P;  2L9R A;  1IGN A;  3K2A A;  1WI3 A;  1JUS A;  3QPL A;  4BY1 J;  3BTC A;  4XRS G;  1K83 J;  2E2J J;  1LE8 B;  1ZR2 A;  4GFB A;  2E2H J;  3IH2 A;  3S2D J;  2ME0 A;  2K9Q A;  4EEF G;  2VI6 A;  2H8R A;  1MH4 A;  1NTC A;  3Q3S A;  2WV1 A;  5JLW A;  1B8I B;  3S17 J;  4FIS A;  2X9D A;  3G1L A;  3GTM J;  5FKO A;  2O9L A;  2EZL A;  2HXI A;  1B72 B;  1ZTR A;  1ZGW A;  1ZKG A;  2JA7 J;  3JRI A;  5F27 A;  2HYJ A;  3QPS A;  3ZQH A;  1PUF A;  3K7A J;  1JUM A;  1NK2 P;  2K9N A;  4JX6 A;  1R9T J;  3QQA A;  5M5X J;  2HDD A;  2DA7 A;  5F0F A;  4RDU A;  4A3F J;  4C2M J;  5C3E J;  1U9N A;  3SJM A;  4S0H B;  3BR2 A;  1DU6 A;  1P7I A;  2IEK A;  3MKL A;  3D1N I;  1FTT A;  1QVU A;  2JN6 A;  2LD5 A;  1LFB A;  5K7H A;  3HOU J;  1H8A C;  1QPI A;  5EG0 B;  3BTI A;  3CCY A;  3G1O A;  2LP0 A;  2ECB A;  2XPU A;  3BG3 A;  3PO2 J;  2NVQ J;  4X6A J;  5F0H A;  1A6I A;  2XGC A;  3GBG A;  3BR3 A;  2VUM J;  4DYR A;  4A3L J;  1W0T A;  2HOS A;  2ELK A;  3O8G A;  1IRZ A;  5C4X J;  3CMY A;  3UKG A;  1RKW A;  3HGG A;  4V2F A;  1ZQ3 P;  2LR8 A;  3MN2 A;  4MFD A;  4J19 A;  4A3M J;  2M34 A;  1HDP A;  3JRH A;  2LY9 A;  2VPR A;  1W0U A;  1IG7 A;  3ZQG A;  3BTL A;  4B3A A;  1GV2 A;  3BQY A;  5JLX A;  3IH3 A;  2NVT J;  2M2E A;  2EH3 A;  2L7M P;  2KDZ A;  1ORK A;  1WGX A;  2AO9 A;  1ZK8 A;  4Y7N J;  1RKT A;  3LSP A;  1H88 C;  4DYQ A;  2COB A;  5IP9 J;  1VFC A;  2ID3 A;  2DMU A;  2XB5 A;  1YRN B;  2M8G X;  4JX5 A;  3B6C A;  1OJL A;  4JP0 A;  2EZK A;  5IYC J;  4IHY A;  4A3D J;  3GTJ J;  2HQ5 A;  1GDT A;  3FK6 A;  5GPC A;  4B4C A;  3NAR A;  3OSG A;  3BQZ A;  2AHQ A;  3JRG A;  1Z0X A;  3TP0 A;  1BJZ A;  1SAN A;  4CYC B;  2LLK A;  1FEX A;  2EZI A;  4FCY A;  1IV6 A;  1U9O A;  2L7F P;  5C44 J;  2HOA A;  3GTP J;  3H3V K;  1F36 A;  4C3J J;  2XPV A;  1O4X A;  1X58 A;  3JRE A;  2M9H A;  2VKE A;  1LE8 A;  3GTO J;  3BT9 A;  2Y2Z A;  4QTR A;  3IH4 A;  2LK2 A;  2LKX A;  1ENH A;  2NVY J;  2ME6 A;  2RAE A;  4XRS A;  2DMT A;  5EEA A;  3SDG A;  3FK7 A;  1WH7 A;  1B8I A;  1FIP A;  4MFE A;  1IUF A;  3RZO J;  3RZD J;  1JJ8 C;  3TW7 A;  4BKX A;  5K7F A;  4A69 C;  3I4N J;  1B72 A;  1RES A;  2CQQ A;  4FTH A;  4IHX A;  3ZQI A;  2ECC A;  5F04 A;  2ZB9 A;  1JKQ C;  1T56 A;  2H1K A;  3SFI A;  5GPA A;  2I10 A;  2E1O A;  3Q0U A;  1BW5 A;  3FIW A;  5EDN A;  4XRM A;  2LVS A;  5EGO B;  4A93 J;  1X2N A;  4AUX A;  3A02 A;  2JWT A;  4A3E J;  1HOM A;  3HKZ N;  4M3D A;  3S1M J;  5EG0 A;  1F43 A;  3OOU A;  5J1U A;  5FLM J;  1MBF A;  3HDD A;  3JRF A;  2LTP A;  1I50 J;  5E3O A;  1FTZ A;  1IC8 A;  4W97 A;  1TC3 C;  4IHW A;  2CQX A;  3BTJ A;  1FJL A;  2JMW A;  1XS9 A;  2R92 J;  2OF7 A;  2XSD C;  2WAQ N;  2MG4 A;  5M5W J;  2JJ7 A;  2JK3 A;  1OCP A;  3PM1 A;  4UUT A;  3ZQF A;  1Y1W J;  2MW8 A;  3BR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...