4X6BB

Bk6 tcr apo structure
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
244
structure length
244
Chain Sequence
NAGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRYFLPTQGMGAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TCR alpha
total genus 56
structure length 244
sequence length 244
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bB02
3BGFB 4ESKA 5EZOL 1FP5A 2BJML 1UKTA 2FJHB 4M61B 1TJGL 4M62L 5FB8A 5DHYA 1B4RA 3U7YH 4FQQB 4NQCB 4HKZB 5JUEL 1KLUA 4OLVL 2BSTA 1T89A 1J11A 2D9CA 3B5TA 1VHPA 4LK4A 2R8SH 3QUKA 1UWGH 2HT4C 5IFJA 3TA3A 3O9WD 1AKJA 1NC4B 1A9BA 4NIKB 2R1WA 3C09B 4JN2A 1L9NA 4J3TA 3LMJL 1CFTA 4G7VH 4QRRA 1IAKA 4MJIE 3D18B 5ETUB 3L3OB 4PGCA 2FWOB 4XNYL 4IDLA 3V4UL 5C0CA 2DL9A 4L4VD 3WN5A 4L4TB 4ACPA 4KWUA 3PV7A 3DJ9A 1M7IA 32C2A 3BZEB 3BESR 3EFFA 3MRBA 4WUUB 1JZ7A 4KK6C 4ETYA 5I2IA 4YNYA 1YEKL 1FZMB 4G8GA 3F65A 4PRHD 2X4QB 4PRBA 5LAXB 5HYIA 3SY0A 3D25B 2WP3O 3F8UB 1NCAL 3MXVH 5FF6B 4NJ9L 4Z78B 2ZJSH 1RJLB 2YPLE 1KTKE 3BIKB 4JN1L 4TTGA 1YQ2A 3OL2A 2GKIA 2P8MA 3MV8B 3QUXB 2X4PA 1ZANH 3GMOB 1CE1L 4W6WB 2EEBA 4U05A 3CMOH 5DRXA 5D7LB 2QTEA 3PNWB 2R0ZL 4KQ4L 1CDGA 3H42L 3EOBA 4UT9H 3PP3H 1JWSA 4ZUWB 5GGUA 2EYSB 1QD0A 4XP5H 2D0GA 4XVTH 5ESAB 2VO5A 1U8PA 5EO0A 2V5MA 3BX7C 2ZOLB 1MHCB 1YEIH 4JPVH 2ZUXA 3KXFA 3EOTL 4EI5D 3MV8D 3NVQA 1KCRL 4L8BB 4XCCL 2ZPKL 3ARPA 2YSSA 4YDJA 1RJZA 1MF2L 4CJ0A 3LV3B 1A21A 2C3XA 4MJIB 1XIWD 3W81A 4JFFB 1S7XA 2FR4B 5B21A 5ISZD 1GIGL 3UTTA 1EHLH 3MOBH 4OZGB 1J8HA 1DTUA 1N5AA 1NBYA 2NXYC 1ITBB 1OGTA 4BK5A 5DHVB 2H1PL 3UYPA 4DUWA 5J11C 4PIRF 3FB8A 3DMMC 4P2OB 2F8XC 4YXLH 3CFIC 4OV5A 4M5ZL 1YEJH 5E2WH 4J6RL 2DQCL 2H2PD 1C08A 3GBML 5DRZA 3TZVB 2AI0L 2VL4A 4AIZA 4C56B 3GBNL 3RI5K 4O2CB 1D5ZB 1MOEA 1MCHA 4HLZG 4OI9A 3VXRD 1MY5A 3P2TA 4OIAA 4WI8A 5FGCE 4R8WH 4WW2A 2JE8A 1A5FH 3FONA 4YHLL 4ODWB 5LCVL 1WFUA 4L8SB 3F7YA 1C5BL 3U0TA 3QXAA 3T0ED 5FYJU 4HFWA 4P2OD 5GGSB 4GRLC 1BQHG 4J3SA 3RNQB 4M7LH 5FF6A 3D18A 4QRPD 5IFAH 3HUJA 4NO3A 3OR6A 3VFUA 2ZCKH 2OQJB 1A9EB 4LSSH 1D5XA 1J10A 2XWBA 5LXGL 3FTGA 3EYVB 4OLUL 32C2B 4HS8L 2BVTA 4RFNC 1T5XB 5ILTH 3FQTB 3FO2A 4QHNB 3PWPD 3CFBB 3KVQA 3MV7B 2AJUH 1A6UL 3NIFF 1OSPH 1ROWA 4PJ9D 3GMPA 5DQ9B 3OGOE 5DHYB 1TTUA 3KYKL 1U8JB 1RPQA 2HFFA 2DWDB 4Z8FL 4NO5B 2Y1VA 4ORZC 3VA2C 1AXSA 1OWWA 2B2XH 4PJXB 3U7WL 5DFVD 2AXJA 1EA9C 1G6RB 1NKOA 4Z7QF 4ERSH 4XWOD 1UZ6E 2YA1A 2HKHH 2BNQA 3SDAD 4IOIB 2XV6B 4J3WA 5HGAA 3KLSA 4EBQL 4W4NA 1FL3B 4OCWL 2DQDL 5J1AA 5BJTA 2EDRA 5CP7B 1X6NA 5DMJB 5IK3A 2QADC 1XCQB 5ID0B 5L88L 2YK1H 1O0VA 1XF3A 1RULH 2FR4A 1A4JB 2OK0H 2ARJA 2BZDA 4KI5F 1ZOXA 2OTWB 3MROB 3QWOB 2Z91A 3J7HA 3SQOH 3CPLB 1T7ZA 2I26N 1MCOH 3S6CA 4XXCC 3L3GB 4CBPA 4HWBA 3OHXA 3WKNA 4NO0A 4HBQA 4MHHG 3QZWA 2A83A 1JGDA 4YGVB 3SOBH 3MGOA 1NC4D 4MMZC 2UWEB 3WE6B 3EZ8A 3TBWA 3EJJX 1SBSL 3X11B 4YBLB 4L3EE 5E56A 2IH3A 1BVLB 3DX7B 1KELH 1MWAB 4I48B 3V52L 1S3KL 3STZA 3CFJB 4R0LB 2KBGA 1U9KA 2KPNA 1U2HA 5D5MA 5AYUH 4HZLB 3DSNA 1J87A 5LBSL 1YPZF 3BMWA 1DLHA 1XH3A 4RDQF 4W81A 2VDLL 2HLFC 4QHLA 3JV0A 3UMTA 3CX5J 5IJKC 2QKIA 3WFEH 3U2SB 3EUUA 2IPUG 4XP1L 5JORA 4HPYL 1KIRB 2GFBB 4KRLB 5KSBF 4PUBL 4YHZL 5IMKB 1SBBA 2ZNXA 3EYOA 1B0RB 2CD0A 5DD1H 3MRJA 4L9DA 2XWBB 2CDEA 4CW1B 4OFKA 2FJFA 4LSUH 4PJ5A 4HUVB 5E8PB 3BH9A 3RTQA 1LP9E 4XNXL 5L2JA 3O3DB 3UTSD 2R2HB 4H26B 5GGSY 4IIQB 3T1FB 4K3EL 3FHQA 3PHQB 5D9SA 3GMLA 4NT6A 4PJDA 4HFUH 3TT1L 4XZUA 1DBKH 3SDCC 3GI8H 4Y88A 1KN2H 4RMWA 5FYKE 1YJDL 4WRLA 3ES6B 4Y7MA 1YN7B 3MJ6A 1NLDL 5GS2H 5IQ7L 4N0FA 4BH8A 2AK4A 2C9AA 3WSQH 2X89D 4I77L 2OBGA 2UWEE 4LQ1A 3D85A 3KWWA 4KJYB 4XB7A 1M7DA 4I0PD 4NNPH 3MJ8B 2VXSL 1T6VN 4HX1A 5IW6B 2Y07L 3N9GH 3OXRA 4AK1A 3DOSA 3K1DA 5H35B 2P5WD 4LSQL 2CRMA 1S5IL 2W0KA 5MI0B 3FONB 4HCRH 1D5MA 5L2KD 5KOVC 4OTXL 3I9GL 3MRIA 4QXUH 3DUSA 5ALBH 2IJ0C 2IAMC 4GXUM 4ZSOE 2F5AH 2Z8WC 5DMIL 1DVFC 4PJGB 3QA3B 5C8JA 1EXUA 1H8OA 4PJ8A 5HHMB 3OJDA 3S34L 4EI5B 3VA6A 2FO1A 1RSFA 5BS0A 1PG7X 4Q58C 3NCCB 1TPXB 2VAAA 4JGJA 4NQVB 4YAQB 3KJ4C 3R8BB 1CE6A 2JIXD 4JG0L 4N0YH 2BVQA 3ILQD 3MTRA 4JFFD 4KHTH 4XVJL 4XCEB 5EOCL 3FRPG 1LP9B 5BXFB 7FABL 5EZJB 2NTFA 3MRKB 4RGOL 1I3VA 3GMNA 1S7SA 2VN7A 3VXUB 4GQ9L 3WE6A 4G42B 1D5IL 2DQEL 5GHWH 1OAYH 1CTOA 5AEAA 4Z7UE 2MHAA 1N4XL 3RBGA 3GJFH 4B41A 4U1KB 2E7LC 3RJQB 1KTLB 4P57B 4TSBH 1DBMH 3DURB 1NGYA 4HC1A 1R3KA 2L7JA 1CFQA 2CDEB 3BSZL 1MRCL 4V1DA 1FFQA 1P7KA 3T77B 4ODSH 3MZTA 4JG1H 2OR8A 3EDKA 4YHPA 4Z7WB 4DOHE 5JORB 4JANA 2VDNH 4OBSA 1H9VA 1A7RL 2J5LC 4PJ7F 3VXRB 2AJ3A 2V9RA 5CKGA 5GISH 2DTMH 2BOBB 4WWKC 3T8XA 1ZWIA 4H8WC 1P5UA 4L8BA 4RSVA 4TULH 3UZVB 2J2ZA 4TVPL 1FBIL 1M05B 3HAEH 2QR0B 1JI2A 4FZEH 5HD8D 3O3AA 2CLZA 1AY1L 1EH9A 3SBWA 5EIIB 5GZOD 4ZSOB 2GTWB 1E4WH 4GW5A 1DUYB 4WU7B 4XBPA 5H37G 3RVWD 5JNYB 3V7AG 1CQYA 3P73B 1U8OB 1I1YA 5IJVB 4IRSC 2FNBA 5JLZB 5EU6A 5EBGA 4GKSA 4RWYL 1M71B 4XNMA 5E00A 3C6SA 5JO5A 4LCUB 4PJHB 3QPQD 2VQUA 2VDPL 4EOWL 4XXDB 3HRZA 4OD2B 2KUTA 2MCG1 2DJ4A 5AD0A 2YD9A 2D7NA 1UB6A 5DC0A 5C0NC 1T7WA 3FHAA 1RI8A 4Y2DD 3P0VH 3VH8G 5ADPH 1BWWA 5H2BB 3QNXB 2R0ZH 4MCZB 3SJVD 1FG2B 1KENH 1BGXL 5KVFH 4LEXL 3WCYA 5I1CH 4YE4H 2ADFL 4WW2F 5CILH 3MNZB 1S3KH 2ICES 3U30C 3RTQD 3IFLH 1VFOA 3NGBB 3FQWB 4XAKD 3QUYB 3W2DL 2IAND 3IDYC 2E7LA 1MJJA 3VMNA 3FQTA 4EVNB 5IIEB 1BOGB 4R6UA 4LARH 1CGVA 3QXWA 1QSEE 1K2DA 5BXFA 1RK1A 1CCZA 1RZIB 1SY6L 3WDHA 4MS8C 3MLWH 4KPHH 4Q6IB 5DD1L 2D03H 1GIGH 1A6VL 1F2QA 3REWB 3DRTA 4JQXA 4K9EH 4DGYH 3QI9B 3MOQA 3OV6A 1ZHBB 1NCWH 1L0XA 1D5MB 1MCPL 3HB3C 1ZWIB 3OKEA 4FFYH 4G9DB 4P57A 2BVOA 2K1MA 1ZLSL 4NQEE 3K4ZA 5F6IB 4H20L 1HQ4A 1QQDB 3U6RB 1R3IH 4JQIH 4F7EA 1GRWA 3O9WB 5D7JA 3EJZD 4NHCL 3ROOB 3UO1H 4QHUA 4XB8A 1AHWB 1CL7L 2Z0BA 3CH1A 3Q5TA 3V0VB 1RUML 1MCSA 4LVHC 3RWDA 4LRNH 3OZ9L 2PR4L 3FO1B 4OV6F 3ROLB 5T3XE 4LLDB 1NJ9A 1FNLA 5F9WC 3IVKB 4JY4A 2KDGA 2NY4B 5GGRY 5FUCE 5IVZB 3STLA 5KVDH 3VRLE 5LCVH 3OKLB 1A1OB 4UQ2A 4KJQD 1X5FA 1DBBH 2UWEA 3OMZA 4JFXA 4NUGH 1MCRA 4FTVA 3THML 5JZ7D 3IJYA 2AEIT 1NC2B 1YEGH 3QG6B 4KV5E 1WCBA 4LSSL 4NHUA 3BKCH 1K4CA 3CMGA 3HCVB 4P9HH 2H32H 2HRPH 3NACH 5I8KH 3NPSB 2XN9E 4JHBA 2F5AL 3HKFA 1A3RH 4F7CA 4AG4L 4DK3A 1QSVA 4U6YA 4OT1L 3RU8L 4O4YL 1O7SA 2QQLH 4KDTA 3WIFA 3SJVE 4PJ9A 3NZ8A 5TJWK 3QWRA 3PWPA 4PGCB 2B0SH 4KVNH 2Z93B 4BSWB 3NCFB 5CSZA 5D70L 4FQCL 4XAKE 1KG0A 3RKDC 5TF0A 2OMNA 1ZTXH 4W4OA 3KHQA 5FCUL 7FABH 3GIZL 1MJJB 4QOKD 3MJ7B 1P2CA 1SJEB 3PV6B 4MD4B 4O58H 2CKNA 1EIBA 5DJCB 4AT6A 2P7TB 3IETB 3IFOA 2XPGB 2R69L 4OCWH 2R2HA 5HYJA 4M61A 2AERT 3GKWL 2LU4A 1MCDA 2K7QA 4AENB 3EYFB 5GSVB 4LDLB 5T1MA 1GSMA 4YQXL 3OX8A 1EMTL 1FO0A 4MNQE 4QGYA 4X7CC 4D9QD 4GRLD 3VXOA 4NQED 3QEQB 2AKRB 1I8MB 3OB0H 3RVTC 3UCRA 1NCTA 3ZE1F 2X4RB 3L3OA 3TWCL 2DMBA 1WBZA 1HCVA 3VG0H 4NKDB 4XHJC 5GRVL 2AV1A 2CRZA 1BHGA 1IGTA 2F5BH 4I2XA 4CMMA 5GJTH 1W0VA 4JGUA 2QV2A 1AE6H 4HH9B 1F3DH 3MJ9L 4KRPC 2GCYB 4JO3L 2V2WB 3IDNA 5CGYD 4M7LL 4PJBA 1BZ9A 1MFBL 4GAYA 5GZND 4JZJB 4CVUA 3HNVL 1NGWB 3FOLA 1KYOJ 3G5YA 5KSBA 3IFPA 4HIEA 4PLJC 1FYTA 4QRPB 3QNZA 3RA7H 1WT5A 1ORQB 4WDIB 1QNZH 5BS0B 1IGYB 3ME0A 1I7TA 2EE2A 3CZJA 4YDKH 4Z7UF 4PG9B 3NIDE 3O6ML 4G43A 2R56L 5KSAB 3T2OA 2Z8VC 2NW2A 2ZUSA 3N1MC 4PJ9B 2P4AB 1A1NB 5DD5H 5IVXA 3W0WD 3ZHDA 1NCBL 1YQVL 3RZWA 3OGCB 1AKJB 3O0RL 4NHUB 5K9KB 5T3ZD 1JYXA 4PJ7E 3MRFA 4HGMA 1P1ZA 5C0IB 1G0XA 5D6DC 4ENEC 1R5VB 4XVJH 3IFLL 5CD3A 4OF0A 3JV4B 3QZWG 3WSQL 3PGFH 2GI7A 2ITCA 1CD1A 2FATL 4ZFZB 1NAMH 2DQJH 1MCQA 3PWLA 4FQIL 1DN0B 4F8QA 3BJLA 4O5LH 3R4DA 2X09A 5IR1B 2OCFD 4J3VA 4N8CL 4ORGB 3BGFC 4JDZA 4U1IA 3G5ZB 1VGKB 4X9FA 1SBSH 4LHUB 3QEQE 4S2SA 1NUGA 3HC0A 3OAUL 1KNOA 1JGUH 2PO6D 1NGZA 4G6AC 4R90H 2FX7H 1DSFL 4K8RH 2IQAB 4I4WA 4NFCA 3HCVA 5KG9A 1NEZG 4K9EC 3OX8B 4C58B 3U46A 1VB9A 2XZAL 2HRLA 2V7HA 5DO2D 3DGGA 2VLRE 5ESAA 3QEQA 1U58A 4PRID 4XXDA 2XKNA 2WQRA 4K7PY 1HIML 2C3GA 2DQHL 4QO1A 4DEPB 4NM4L 2XY2A 3BH8B 1KCVL 2JJWA 5IB3A 2ZKHL 3U36B 3W39B 2Q87A 3GNML 1ZVHA 4NNXB 4OQTA 1FFNA 1YY8A 3FFCB 4B50A 1X7QB 5I1LA 5F1IA 4F7PB 3GJFB 2X70B 3QIBD 4OQTH 3HPLA 3EJYC 3L9RA 4IMKA 4ZO7A 1S7VA 3O2VL 4HUNB 5HYJB 1T66D 4RBPH 2HFFB 2VB5A 2G75A 1HXYA 2AJYH 4G9FE 3QDGD 1LDSA 3CFCL 4Y5XB 4E5XB 3SQBA 3G04A 1B4JH 1T5XA 1IKFH 1A4KB 3VRIB 4DCQB 5AUMB 4JFDA 4ISVA 1PVHA 4WWKA 5DJAA 5C0DA 5T3ZE 5L6YL 1QSFA 4JY6B 5ENWA 2HT2D 1GXEA 4D0BB 1CF8H 1FNHA 5CCKL 5I1CL 2IAMD 4ONOA 1PKOA 2X4RA 5CP7A 3WFDL 4QF1B 1DANU 1A7QL 3B9KB 2CK0L 5J6HA 3LPGA 2OM5A 4EZMA 1HYSC 3DHJA 4N90D 1AD9B 4U1GC 2V2XB 4QWWD 2DICA 3E6FB 3GSVB 3IDJA 2CLVA 3I3BA 1WZ1L 3G5XA 5ALBL 4QGTA 4MJID 4R96A 3B9AA 1H3UA 3W9DA 4OLYH 4QHUB 3CK0H 1YEHL 2ADJA 2O5ZL 2VIRB 4L8DA 2PW1B 1QBLH 2X4UB 3LOWA 4KJWD 5JHDD 2AABL 1N64L 4HZAA 3DMMB 3ZYZA 4KDWA 2Y4SA 3DWTA 2BVEA 4XVUD 1UQSB 3OPZL 3W82A 1YJDC 1MCNA 1II4E 4RIRA 3VFTA 5GJSL 3S36H 3S88H 4HIJB 4PRPB 3DROA 5E1AB 3Q6FA 1F97A 5IBLC 1BVZA 3V95A 2DLHA 3QIBA 1VPOL 3HC0B 2NR6C 4UT7H 5FA4B 1DE4B 5ETUA 4BK4A 3C08H 4U1SB 3MACH 3BHBA 3OGCA 3DO7A 2BNQB 4I4WB 5ECJE 4HPOL 3L5XH 4BFEA 3BP6A 1ZT7B 4QHMA 5DD0H 1K8IB 4Z95H 3GMRA 1XCQA 1BIHA 3N1PC 5T5NG 1OAQL 2I5YL 4HK0B 3QHFL 3BXNA 4J4PA 4FQ1H 4UNVA 5FO7A 1CD1B 5ACMA 1RUPL 3CX5K 1YEGL 1EERB 4JM2B 1XGYH 1WISA 3GK8L 3MV8E 1LE9B 1YPZE 1DN0A 3IDIB 1IMHC 3BKCL 1FFNB 1YY8B 3FFCA 4YHNA 7CGTA 1FAIH 4OF6A 1V7ML 4ZXBC 4JPWH 2QQKL 4RMQA 3GMOA 1LO3H 1JN6B 3DVGA 1B6UA 3AVEA 3U0PB 3E2HB 1I3RA 5F96H 2H3NA 2GJ6D 4EQ2A 3O3BB 5I16B 5I15L 4HDIA 5LBSH 2AVGA 3BN3B 3WJJA 1KIQA 3MLTA 2VDLH 1OGAD 4KVNL 3U83A 3DSFL 1UM4H 3R06B 1CDJA 5I1EH 1RUMH 2X10A 1GGIH 1EAPB 2H32A 2NTSP 4LAJH 3N1QC 5KG9B 4ZOAA 3X17A 4I9WE 4O58L 4CDHA 1LEGA 3C9NB 4WFEE 4WGVB 3M8OH 2QADB 1CFBA 1DUZA 1GC1H 2GFBA 4L5FH 4D0BA 4JR9L 2Y7QA 4Q2ZB 3HMXA 3P0YH 1P4LA 4TSAL 2C5DC 4V1DD 3LS5H 4ZD3L 3MR9B 1HHJB 4KTYA 2W0LA 4XNXH 5FUCC 4L3CA 3HZYA 3ZTJH 5KJRL 1MAML 5H8DA 3GDBA 3O2DL 2APWA 1YMHB 4Z77B 4IHOA 5D1QD 1TZGH 3FQNA 1H8SA 3TVMA 5EN2A 4Y5VC 5HTSA 2ADFH 1MVUA 4DAGH 3WNLA 4H26A 1F6LL 4UT6L 4Z5RA 3QIUA 3BT2H 4HD9A 4LRIA 3K2MC 3CU7A 4P9MH 4C56E 1WFNA 1F45A 2JCCF 2BY3A 4I77H 4JQVA 2RFXA 4HMCA 5D2NA 5DGQA 1YPZB 1A8JH 3BWUC 3RWFA 4XPBL 4F7MB 3A67L 3F7VA 4OKVA 3HB3D 1W72B 4DCQA 1YUHA 2D31A 5T1LB 2O61A 3E6HB 5C08E 3C6LA 1KGCD 1FL6B 1I9IH 5D7IA 1U95B 3RWGB 4JREC 1N2RA 3OB8A 3QDHA 1EZVX 2EE3A 5DK0B 2NX5A 4GRWH 2DBJA 4NCDA 5F9JA 3LQZB 1HI6B 5DVMA 4OIIH 1ADQA 2XQBH 3CFDB 1HN1A 3QIWC 3PF2A 4YEEA 4M00A 3MO1A 3G9VA 5A2IH 3ARBA 3Q3GB 1LWRA 1IC7H 3HI6H 1R3IL 4JQIL 4LCCB 3CCHA 5CSBA 3CXDH 2A9MH 3UTSB 1EXUB 3LRHA 3QYCA 5EOCJ 1CLZH 1FIGL 2E8YA 3IDXH 2BVPA 5FKPB 3QHZH 2VLLA 4Q9CA 4NO2B 3PWVB 1OB1B 3M45A 1UEYA 3N06B 2GK0A 3LKSB 1TJIL 1IM3B 2LTQB 3WHXA 1YQVH 4NQVA 2EDOA 1MCBA 4KK8D 2XQYK 4YDVB 1M05A 3I50H 3HZKB 2G5BA 5CCKH 5K9JL 1EAPA 2H32B 1RZKC 1EAJA 4LPYA 2E6PA 1A6PA 2DN7A 3C60A 1LILA 4QRPE 2Y72A 3NFNA 1EEZA 4Y4KD 1Q9OA 2VLJB 2I24N 3DX8A 3RZCD 5FYKH 1U92B 3ZYOA 3P9MA 4PJBF 5D7KE 2EKSB 4J4PD 4P46C 4Q7DA 4I5BB 3N85H 5E94A 4XI5C 1CIDA 3PDOB 4HXBH 3GKZA 3TVMC 1RZKH 3SDCD 3UBXG 5EU6B 2VZUA 4YWGH 3QI9A 3DARA 4KY1H 5DMKB 1GHFH 4X7TA 2IAMB 4PJGF 3O6KH 1JI1A 2YA2A 1NSNL 5ALCH 4QHKJ 5LGHL 4S1RH 1JRHI 3BH8A 4I0PC 4PTUB 2Q8BH 1OHQA 2FEDC 3NTCL 4Y19D 3WKMH 5GJSH 2YWZA 5FCUH 3QDJD 4K8RL 1T1ZB 3BD4A 5B38A 4H88H 3VXMD 2VKXA 4LLDA 4P48A 3MBEA 6FABL 2HAZA 4OCXL 4QTHB 2VXQL 1T21B 3BISA 5BZWB 4Y0GA 3OKDA 5C08D 3VFRA 4ZS7L 3C08L 1U8NB 3WLWC 1N2RB 5B8CB 2DQGH 3WL9A 5F3HB 5LG1A 1IAMA 3B2UD 5CWSA 3DV4A 2PW2A 1A2YB 4PJFE 2EDHA 3RAJH 3RL2B 5IMLA 4GKSB 4OJFL 3TGXA 5TGBB 3MCLL 4YFDB 4JM2D 2Q1EA 2YOCA 3EYOB 4XX1E 4U7SA 2HT3C 4X5WA 3EHBC 4OM0L 1MJ7L 4X6FA 2O93L 1XGUB 1RHHA 5DWUL 4U33A 3RUGF 4HWUA 4YHMH 5B38G 3OAUH 4U1HB 3ZLQC 3AB0C 2BNQD 4XNUL 2FGWH 2WBWB 1IT9H 3ARBC 1NMAH 3LRGA 1IL1A 5JOPE 4X7EC 4D9LH 1TJHH 2V2XA 4JFDD 4JY4B 4M02A 4W4OC 4RGMB 4LHQB 4PGDB 4YR6A 5D7JB 2E27L 2F9BT 4PLKC 2AXFA 1WBXB 4RDQG 1I85C 4LARL 4QYOA 1HIMH 2DQHH 3V79C 3NZHH 2R15A 3AU1B 2FCBA 2J8UB 3M8OL 2JELL 4NNYA 4G7YH 3RVVC 2X4TB 3V7MA 1A6VH 3UYRL 3FN3A 3O6MH 1E4KC 1TTGA 2FBJH 2M26A 2DBLH 3VWJC 2YD3A 3CDGA 1JF5A 4ZD3H 4UTBH 3Q5OA 5DHXB 3GRWA 1NMCC 3K8MA 1ZANL 3AY4C 3RJDA 2I25N 5BQ7A 4GLRH 3T0EA 9CGTA 4L8CA 1BBDH 5C07E 3BYTA 2VDOL 1QRNE 5I1GH 1RZGB 1FORH 2YWYA 4JPIA 5C7XL 3CIQA 5KAQG 3HG1E 3NA9L 1HINL 3SDCA 4PV8A 3S36L 3JUZA 1UADC 4OSUL 3TBSB 4H8WL 5I71B 3ROOA 3U30B 5GS1B 3RHWF 1AHWA 1CF8L 4XMLL 3SDAA 1BZ9B 4GAYB 1OP5H 4XCEA 2NY3C 5DVKA 5JW3L 3QUZA 3QNYB 3TO4C 4LSRL 4X4XA 2CKBH 3HMWL 3MACL 5E5MB 4N9GA 3ARUA 1HNGA 1X3DA 3L3HB 2YSSB 3K1KC 1HSAB 1MRFL 3OAYK 4P4KD 3UX9B 1FO0B 4LCYB 4PJDE 1WEJL 4Y4FA 5DO2C 4KH2A 3QDMD 4NN6C 1YC8A 2RIKA 4Z9KB 3NACL 2F15A 1Q9LB 5L0QC 5DK3A 1CLOL 1K4DA 3GSNL 4L4VB 3KPSE 5DSCA 4FQXD 1DSFH 1NANH 3PWNB 4IS6B 2DQFB 3SO5A 3BP4A 4CMHC 5BZDA 4DKEH 5IW1A 3VD9A 4OGYH 3KPRA 2VZTA 4UU9A 4OZFH 1G9NL 3QPXH 4ZUTA 2QQKH 3GRWL 2MOVA 1XGQB 5J6GB 1A3QA 4E0RB 5F7FA 4FFVD 1C08B 5DRWA 1XFPA 4TUJA 1AHWC 4LVHB 3V4PL 5EIIA 5HGHA 3CSBA 1T04B 5E6ID 5TQ0H 5JDSA 5CEYB 5B3JE 1CDUA 3ARGB 3RNKB 1JNHA 2FH8A 1M6OB 1W0VB 3PV6A 4IOFD 4KMQA 2DL2A 4WO4B 1KPRB 1KB5L 4WI5A 4GXVH 5DVLA 1BQHB 3F12A 3G6DH 1CYGA 2F54B 3O2VH 2PN5A 3DHMA 4XGZB 5I1KH 2VDQL 4Z95L 1YEFH 1BLNB 3TBYB 2L0DA 1Q94B 4KTEL 3P0YL 3ZE0F 2NW2B 3VXUD 2AXFB 3QIUD 4U6TA 4S2SB 2IANE 4ZS6C 2IMMA 3MRNB 4YDLC 3RL2A 5IMLB 1CXLA 5E4EC 4NYLB 4QKXB 4UBDC 2D31B 3NPSC 2IQAA 1X4XA 3ZMRA 2H2PC 2NY2B 4HUWA 1KJ3H 3BFOA 4M5YL 5D2LA 3H9HB 4JDVB 5MEOA 4UT6H 2YPVL 1N6QH 3BKYL 1MHHA 1T1YA 1IGFH 4KJWC 2P43B 3BMVA 4HBCL 4Y8DC 5MEPA 4GW4A 4EBQH 4JPIB 4F7TB 5JTWA 3TBVB 2WBJC 1N3NA 5LVEA 2AP2A 3I85A 2VZOA 2XNAB 3ZYIA 2DM3A 3QUXA 1G9EA 2XWTA 4PFEA 4HIXL 4HWZA 3ZT6A 4AM0B 5IBLD 4NZJA 5ID1A 1XF3B 3IDGA 5IHZA 1W2KT 3LSOB 2Q7YB 3IXAA 5AG9A 3DIFB 4ODVL 3HRPA 3T0WA 1WZLA 1G7IB 4JFEB 2ICEA 3KPSB 2OTUA 3BQUA 1FC2D 4XXCA 5DVOA 4KZEH 4E41A 2J6EL 1UZ8B 5IEKB 2Q3AA 4JQXC 1PKQE 5EO0B 1OWRM 3VFPA 3RWCB 1A7BA 2NLJB 2HJLB 2PTTB 1OM3L 1MCWW 4EDXA 1KTDB 2A9NL 3D85B 4KJYA 3DLQR 1JGLH 5F70A 1JWSB 3GSOA 3GBNH 5JIPA 4PJGE 4PJ5D 2E9IA 1UM6L 2DJUA 4JRXE 4TPRH 4XCYB 4DZ8B 3PGFL 5E8DL 3T0BA 5FAAA 4X9IA 4ZDHA 1F3DJ 3CD4A 2FX8H 4OGXL 3ZKXB 3L3DA 1WIOA 2I5YH 4GRMA 3TO2A 1IZJA 4Q9RH 3VXNB 5A2KH 3NZHL 2QSCL 2I60L 4ZFFB 4MJIA 4KKCC 2QSVA 4PV9A 4ODTL 1U91B 1TVHB 3JBG7 1A64A 4Y2OA 5DFWH 4HXBL 1A1MA 1HSAA 4JZOB 2XZCL 2HWZL 3VRIA 2KKQA 4K94C 4R4FH 1RVFL 3NABL 5D72H 2KZWA 1CDCA 3Q48A 3ZO0A 2E3VA 3AS1A 5FA3A 3PGDA 3TBYA 4Z8FH 3Q6FB 2Z9TA 1YY9C 5HYQB 3MV11 1FORL 3QBTB 4ZUWA 5C7XH 4UZGA 2APVA 3VD3A 4RMRA 2Q8BL 3EDJA 2R0LH 2Z35A 1MHHB 2B2XL 4XPHH 3U7WH 2GITB 4PLJD 4NDMA 4WW2C 4ETQB 3KPNA 3TP4A 5DR5H 2WBJA 4PREA 4NM4H 4HUKB 3RGVB 2EDDA 3TJHC 3GNMH 1WIUA 3W9EA 3P11H 4G6KL 2YC1B 1PGRB 1WAAF 3E1F1 2YK1L 1S78D 3FMGH 1CDIA 1S9VA 1AO7D 2A6IA 2LQRA 4OQTL 3UAJD 4K2UH 2WLZA 1AH1A 4CVZA 5ICYA 2XN9D 1IEAB 1WLHA 2EYTB 5FECA 1CGTA 3SQOL 1WEJH 2AJYL 5E1HB 1SEQL 3TN0A 5AZ2L 3KNBB 2BC4A 1RIUL 4X6CE 2VLKB 4WFGD 1HKLH 1EK3A 1NBQA 4KKNA 3QCUL 3O6KL 5AAMA 2WANA 3ULUE 4N8PA 1WBXA 1J0JA 4OGYL 5HHOE 5L6YH 1ULVA 1D6EA 3VGFA 4FMKA 1CG9B 4MDIB 3TJEH 1E4XI 4XVSL 4PBWD 4EJ1C 3QIWD 1CFVH 3IKCB 4NNYB 4JKMA 5AUMA 3JV5A 4WY7H 4HIIA 4ODUA 5C0AA 5K9OB 1U42A 1KT2A 4KZDL 3TNMB 4XC1H 2FHCA 4O02L 3LDBB 3VGGA 1RFDH 2ARJQ 3GMNB 5F7UA 4ONHA 1AC6A 4EEEA 3ARTA 3OBAA 1X5XA 3QO1A 1KTDA 2KL6A 3CSGA 1ADQL 4YFLF 1UM5L 3EO9L 1DANT 5D2LE 4DW2L 1RZ7L 5IW3A 1P84J 3R8QA 3U7YL 1ONQB 2CJUL 2VDQH 2CPCA 4L4TE 4MZ3A 3DBXB 3GIVB 3IRZA 4XWGH 3WUZA 1U3HB 3G5VB 4KTEH 1QLFB 3S4SG 4PJXE 2R8SL 4NP4H 4X7DC 3LN5A 4FTVE 2Q20A 4P23C 1XGTB 4H0HB 3IDXL 3KXFE 2XY1A 3D48R 1IARB 2R0WH 3U48A 1LO0H 3HLAA 1QO3B 2P5WB 2R2BB 4Z7WE 4E41D 1TCRA 3HFML 5IVXB 5ADOL 5E70A 3KPQA 1I9JL 1ZLWH 3AAZB 1NLDH 3H3PL 4NQSB 4HXAH 5BVJA 1IGFL 1FNGA 1QFWL 4S1DC 3QEQD 4PRIA 1BQUA 5JMRA 1F11B 3EJYD 3O6FB 4HDIB 4GW5B 4XMLH 5C0RL 5JW4Q 3VI4E 1ORSB 5IVOA 3B9KD 5I0DA 4M7ZB 5KS9B 2EIBA 1YNLL 3UJJL 2NW3A 2AK1H 4D9RD 2ILLA 1LK3L 2GIYA 1CTNA 3TM6A 4NQDD 2O5XL 3QUZC 3OJMB 3PL6B 4R7NB 5B3JF 1T5WB 4CN4A 2BHUA 3HE6A 3HG1B 4U6XB 4XBEH 5ESVA 1G9NC 4XPAH 3HA0A 4LPUA 3SO3B 4XH2A 1OPGH 3VFMA 4G7VL 4OGAC 4PS4L 5HHOD 1ZEAH 2UY6A 4PJCB 3ULSB 4DVBB 2Q76A 3DMMD 4JZOA 3DUUB 1IM3A 1A7OL 4FQJH 1MPAH 2B7DT 2C1PB 2J88H 1IQDB 3O11B 4X6EB 1GGIL 4TQEH 2DQDH 5FGSA 3DVNA 3IU3B 3QO0B 1T2JA 1NCDL 1WUNT 1J0YA 2DQIL 1F4WL 3U9PH 1FO0H 1CXKA 1E4XL 4FQXA 3T04D 5CZXC 4AJ0A 2VJXA 4OZ4B 4ONHB 5D71L 3HTLX 2SEBB 1CFTB 1OTUC 1X5HA 2N4IA 1RIVH 3WIIL 2AV7A 1CT8B 3OKKB 3BDBA 4P4RA 1DLFL 2Z31C 3R1GH 3SE8L 3WDJA 4L4VE 5F7LB 4NWTH 2IMNA 2ZCHL 1MRFH 1S9YA 2D03L 2DLIA 5IV2B 3DVIA 4YDIL 5I30L 2VUOA 3KR3H 5FUZL 3SGJA 4Z0BH 1FYTE 5FHBL 1N6VA 3GBMH 4NQDA 1Q72L 2NZ9D 2AK4D 4N90E 5I18L 1DCLA 4ZXBB 4X5XB 3DRQA 2BVOB 1FBIH 3KPRD 3UPRB 3HZKA 1M1SA 2V5TA 1JZ5A 1FZKB 4M5YH 3MRGA 3RWJA 3SPVA 1UXWB 3WD5L 2C3VA 4FQ2H 3IDGB 1HHGA 3FT3A 5IHZB 43C9B 1XGTA 4PUBH 4U3CA 3VFRB 4QCIA 4JY6A 4RGND 1CDYA 5ENWB 1KTRL 3HI1B 5I73B 3EGSA 5JHDE 1GGCL 2HJKB 1KCSL 5HYSA 1HOCB 4OKVB 5E8OB 1AGEB 1PX3A 3STLB 4LSUL 5MENA 3NAAL 1MIEH 2OJZH 4ZXBD 1NAMB 3BD3A 2ZOKB 3X3GH 5IB2B 1J0KA 2YEZB 4K8RD 4HH8A 4Y4HD 4MHHI 2WUBH 5EOTA 3MOAL 1G1CA 4UIMA 2EH8H 2BNRB 4U3HA 1KOAA 3MO1B 1RIUH 1Y18A 5SX4I 1YECL 4CMMB 2OI9C 2VDKL 3OKMB 1P7QA 3FQXA 5BW7A 3HMXL 1DL7H 2ESVB 1LK2B 1Y0LA 5GIRA 5ICXB 3RP1A 1KENL 1E0OB 1N0LA 3CDFA 3VJ6B 1PEWA 3EYUH 5ESVB 4J8RB 3FCTB 4Y16A 3WUWG 3QJFB 2W92A 1WC7B 5L88H 3WFHB 1P4BL 4TPRL 4RAUA 5TDOB 1A22B 1N59B 1N6UA 2GJJA 3RX5A 1D3CA 4S1SL 2HLFD 1IJ9A 5EUKA 3ARDD 1QFHA 2QSCH 2ESVD 1HHHB 4LCWA 3LQAL 2YD2A 3MLWL 1E6OH 4KPHL 3WUWB 1KJ2B 2MQ3A 5FDWA 3FT4B 1QR1B 5ANME 4ELMA 5IROA 1EMTH 1TQBC 4LQFL 1KJMA 4MA8L 1U3JA 3F62A 4PREB 4FRWA 4S1RL 1JHKH 1T3FA 1Z9OA 1RZGA 2CRYA 3NTCH 4LPVA 4WFED 1BX2B 4FQPA 1ZLSH 1D5XB 1MCJA 1ZKAA 3NFPA 2JJTC 4H88L 3O2DA 1Y6NR 3W11C 3GB7B 4RNRB 4X80L 3BI9X 4GQ9H 4QLRA 1OM3H 4HLJA 1ZHLA 3SJVA 1LD9B 3DXAA 3CLFL 3H9YA 3BGMB 1JWUB 4LLVB 4MJ6A 1MVFA 1NL0H 1BBJB 5IB1A 3MBEB 3QQ9C 5GPRA 1ZMYA 3E3QE 1U3HD 3BSZH 3H6JA 1OT2A 2DIAA 1ZT1A 5LJYH 1NMBL 3KPPA 1KLGA 2AJZB 3T3ME 4F57H 1INEH 4IRJA 2CKBA 2Q6WA 3T0EC 5JW5B 4QTIL 4DUVA 1Z0MA 4XAWL 1YNTA 4PY8J 4OD1H 4YX2H 1PZ5A 4K3EH 1JE6A 2VH5H 1UA6H 5HHVL 5C0AB 2BY1A 4UU9B 43CAB 1KN2L 1NMAL 1HWHB 2FBOJ 4OT1H 4U4BA 3RU8H 5SWZD 1XEDA 2I07A 4MD5A 3AY4A 3TZVC 2XKNB 5AYQA 1AFVL 2ADIA 3VJ6A 5IMOB 2ITDB 2A83B 3K80A 3HZMB 5TDNA 2EICA 1S8DA 3K4DA 3CXHK 3VXMA 5CGYC 3EFFB 2F53E 3ECBB 1IC1A 3MRBB 1UXSA 1FDLL 1YPZA 5FYLD 4L8SC 4PP1D 2I9LA 2Z4QB 4D8PA 5C08B 3C5JB 4IDJL 2R4SH 4EOWH 3KLAB 2R23A 4Z7WF 2WBKA 3I9GH 3SDAC 4BFBD 5T33H 5I6XB 4S10A 2DBLL 1HQRB 1MLCA 2IH1A 4M8QB 1XIWA 3R0MA 4HHAB 4K2UL 5JIIA 1X6LA 5MENB 1UFUA 4MQTB 3P4OB 3TIEA 3VE0A 2F74B 3OKOA 1SEQH 3MODL 1EGJL 1DR9A 3PE9A 4PJFF 4ZNEE 4LHUG 3MREB 4YBQD 5J3HD 4PJCF 3NA9H 4R90L 5JXAL 4M9PA 1IC4L 1MQKL 5CJOL 3TWCH 3AB0B 4RZCB 2AXGA 4JFFA 1G0DA 4RMUA 2D2OA 3GSXA 1L4IA 5DXWA 5HHPA 4RGMC 5BS0D 5F7WC 4ODHL 1IAOA 4YK4B 5JW3H 1YYLH 1NBYB 5IB1B 4TYUA 4X9BA 5I2IB 4WO4A 5K33A 2CKBL 3HMWH 5TDPA 1SQ2N 2QEJA 3S37L 1FFPA 2OXGA 2JLLA 5F89B 2W9LA 3CFKA 5GSVA 2VLJE 5CHNA 1RFDL 1SM3L 1QZ1A 2VDRL 5TE4L 3GO1L 4V2CB 5FYJH 5J0BA 3VXOB 1N0XH 5SX5H 4FXKA 4Y4HB 4ZFOB 4P59H 1I1FB 1MWAH 3SKOB 2O5YH 3V4VL 2DQTL 1B0GB 4J2XA 1F6FB 1WCBB 4MVBC 4AENA 4HX1B 2CJUH 4UILH 2CDGA 1FVCA 1CBVL 4LDEB 4FZEL 3VG9C 4ZMAT 1HE7A 3ARRA 5I8OL 4WFHE 2YUXA 4L4VA 2HJLA 2PTTA 3EKCA 4IJ3B 1IKFL 1OTTD 3IF1B 5F93C 5HI3C 2W9EH 1JPGB 4WVRA 4ZUTB 3S4SB 1OAYL 4MQ7B 2IADB 4KQ3L 3QWOA 4GBXC 3IB4A 1MFDL 4HAGA 4I8DA 2P5EE 4XMKH 3FMGL 4MNHA 4WENB 1S7XB 2GEEA 5CZKA 5F7YC 1JPSH 3EBAA 4WEBH 3G6AB 4UUJB 4HUXA 3JV6B 4X8JB 3VXQA 3QUXC 4U6HA 2F19L 1BFOB 1BZ7B 5I17B 5C0CE 4F7TA 3STBA 3MV9A 4K23H 4BYHA 3F6LA 3QNZB 1OD9A 3BPCB 3WLBA 1VENA 4WDIA 3NCEB 1MLBA 3CFJA 4KROB 5E0QA 5L0QB 3LRSB 2AJVH 2NX5E 1WTLA 2VIRA 1F3RB 4BELD 1INQB 5FUZH 1YNTB 1TNNA 5D1ZD 1XH3B 4X6FB 3MCKB 3FQUA 3SKMA 2XWJB 5EUOE 4JO4L 2NY7H 3RDTD 4KKLD 4RMSA 3SDXA 5JPMB 1RJCA 3FFCD 4PBVC 1DFBH 3RX7A 4N0UA 3OJVC 4WNQA 4X80H 5INDA 1N5YH 4ZPVA 5DEFB 1RU9L 1IEBA 5DURD 2P8PB 3WDIA 1F58L 2VMFA 3U1SL 2W1NA 3CDYA 4Q2ZA 4LU5L 4IRJD 5F88B 3QZWB 3KS0H 4X98A 5ID0A 2GJ6A 1VADB 3T09A 1MEXH 5E2VH 4NGHL 4U7MA 1SEBB 1AGCB 1RIVL 3P4MB 4Z7QE 3VXMB 3ALWA 4I3GA 5J89A 3VFSB 2OX5A 3P73A 1ZLUK 4OUUB 5DT1L 2IBZY 3NCYP 1T0PB 2EE6A 4FA8A 3QIUB 1U8JA 2D7QA 1JZ3A 5JOPD 1MI5B 2ZUVA 4YDLB 4QNPE 5BW7C 4LEXH 4Z7VF 4WV1C 4K7PH 4YHNB 4EQ3A 2VC2L 5C07B 3LN4A 3S8WA 3LMJH 3C2AL 4WWKD 3PP4H 2LABA 4MDJA 4BQ8A 1U8QA 5IHUH 4LF3B 3S9DB 2YD8A 1RUAL 4ZAKD 3FQRA 5DJ8A 1F4YH 5DC4B 3QG7H 1Q1JL 3OXSA 2HJFB 1E28A 3V6OC 5C6WH 1HZHH 4KHXL 1FLRL 1FG2A 4Y4FC 1INDL 1JF1B 3THMH 3KPOB 5E7FA 1CXFA 5TQ2H 5E5MA 5MEND 4Y5XA 4UNTA 4F9PC 3TIDB 4L9LB 4LSVH 4OCYH 3L7EA 2PXYC 2YN3A 5C9JA 3GB7A 3TPUB 5I1JL 1KXVC 3MLRL 3VXSD 4DUXA 5E08H 4H20H 2AK4B 1AP2B 1S7VB 3IT8D 1D6VL 3LCYA 1H0DA 4WI4A 5EUOB 3V6ZA 2H9GA 3UO1L 5E24E 1MPAL 2J88L 1F3JB 1YECH 2E7HA 4OLEA 3BKJL 3NMEA 3RVTD 3T2NH 3GIZH 5GGTL 4Y2DC 4LMQI 5HYQA 3LRSA 3O6LL 4MNQB 3SGDI 1F11A 3DGGB 4LFHD 3C87A 2X5PA 4UT7L 3WS6A 1KCKA 3LV3A 4FQIH 5SV3A 5BMFH 2W07A 1T22A 1KSRA 2ATPB 5C1MB 1NEZB 3QDJA 3B2VL 5IB4A 3VFVB 5AZEH 1M7IB 1OSZB 4I2XE 4RQQB 4G9FB 1MHCA 1U41A 3VGAB 1B0WA 3K2UH 4OFPA 5D93B 5EA0H 1NFIB 5CEXA 4MNHB 4WU5B 2UWEF 1S9VB 2A6IB 4HQQH 1YYMH 1JGUL 5F9DC 3DROB 4Q74A 3ZDZF 2DLTA 1MQ8A 4JO2L 1RK0A 2FO4B 5C3TA 4ZYKA 5B38B 4J6RH 1IC5L 5E8EB 1UWGL 4XTRD 2V5RA 1EO8L 2J7LA 1D5ZA 4FQ2L 3U4BH 4HGWB 2D4DA 2UZXB 4MCYB 4LF3A 3JVGA 4A6YB 1BMGA 5EZJA 1CDHA 2RJMA 2OR9H 3I50L 3QUYC 1ED3B 2C1OA 3MFGB 2MPAL 4EDWL 5K9OA 1FN4A 3PXHA 2W65B 4OAWA 4PR5A 4R26L 3PJSB 4HT1H 2AV7B 2DYPD 4NKMA 3S37X 1YEEL 2MTPA 3ALPA 2R4SL 1J05B 4YQXH 1SMOA 4LVOB 4JR9H 3N85L 3NH7H 5F88A 4TSAH 2NMSA 3E3QC 3QXAB 1IVLA 4JRXD 4X83A 3D0VA 3O41A 3C5SA 4Q0XL 5IT2L 5C0EA 2GUOB 5D1ZB 5KSUB 1JFQH 3BPLC 3V0AC 4ZUUA 1VEPA 2GT9A 4JFEA 4PJ8C 1C7SA 3BRDA 4X5XA 3DMMA 5L9DL 4PPTA 1TZGL 4WHTB 5JIKA 5LGHH 3UTTD 4EKXA 3ARDC 3VI4F 2DM7A 4RAHA 5I1AA 5AWNL 3SE3A 5ADOH 3IAQA 2NTFB 5C92A 1MI5A 2XOTA 1I3RB 3NCJH 5IIEA 4KK8C 1R5WA 2RQ8A 3DYOA 1MFBH 2YXMA 1ZLVK 3TA3D 1NLBH 4NQEA 3QXVA 4CNIB 1DP0A 5JNYA 2C1PA 4NM8L 3H9ZA 2P48B 5GSRB 1JRHL 4I2XB 3VXTA 5HDOA 2FD6H 2RB8A 1ZT4B 5GGQL 1OD7A 4MB4A 3GUTA 4QNPF 1W72H 2ZUQB 5B8CA 1YDPA 3QNXA 3TVMD 4Z7WA 1WF5A 4LQFH 2DLFH 1A6AA 1JTPA 4OZGF 4TOYH 1IAKB 2ZUYA 2CLRA 4B0MM 1FNEA 4GKNA 4PYHA 5I75C 5E95B 5AD0B 3SGEH 3HN3A 1GL4B 2OL3H 4LOUC 1PY4A 1ZEAL 2BDNL 1JHLL 3KJ4B 1YMMD 5DWUH 5DUBB 2RFXB 1T66C 5GGVY 2YUWA 4PJ5E 2JK5B 4PRHE 5ICXA 4LLQB 4K7FB 4P2RB 3V52H 5L7XH 3L1OL 2GTWA 4H5SA 3RWEB 4B7LA 5DQ9A 1J9CT 1DLHB 1S7UA 3QDMA 1ETZA 5KVEH 2HTKC 1I1YB 2A1WL 4UOW0 4HJJH 4ZYKB 5CBAB 1HHKA 5TDOA 1A0QL 1MWAA 2UZYB 2X4PB 1YYLL 2EZ0C 2GW5A 1AGBB 5SWQA 3UTQA 3R1GL 1W0YT 3WIHA 1KEGL 4IMKC 4PJIA 2HKFL 2M8XA 1GOGA 5EO1A 2FJHA 3MMEB 2JELH 4LAQH 5D7IB 2ZCKL 4M93C 4F7EB 1IRAY 5IFHL 5IK3B 2DM2A 4OZHA 5HHNB 1FCCA 1QVOB 5C0EB 2RAMA 2GAZA 2Z93A 3OKMA 1ACYL 2Z91B 3NOIA 1H3VA 4JDTL 1MH5B 3UTTE 4PJIE 3FZUD 3I3EA 3MV01 1MVUB 3NPZB 4MLSA 4NC1C 1EEZB 3ULVE 5BO1L 5JHLL 5ESQA 5EU5B 1MSPA 2X9YA 2HN7B 2C4FT 2BOCB 1KCVH 3BPOB 4YC2C 4M03A 1NC2A 2AJSL 1I9EA 3B3IB 5FFLA 3S3SA 4R0LA 5DHVH 3QIWA 1JZ2A 2QBWA 1B88A 5DJ0A 4AIXA 2ADGA 3SE9H 3GSQB 1G7LB 2RR3A 3GJFK 5FYJD 2R29H 4UQ2B 5IEHB 2Q6WB 2IAMA 1UVQA 3WNPA 1T1WB 5E6YA 5JW4R 2KQNA 4MA1B 2W0FA 3BVNB 4R2GC 5IOPB 1VEOA 1FV1B 1U6AH 4F37K 3UPCA 4XP6H 1WIPA 1UACH 1T4KB 1BWMA 1TITA 1Q9LA 1WBYA 4UINL 1KN4H 3RTQB 3W5MA 4X9HA 5FYKU 3A6OA 4G6JL 5F9AC 4NCC1 3KPLB 5CIPB 5EFIA 1TZHA 5TE6L 4OCRH 5BRZA 4XRCA 4N8VG 2OJEA 3KS0J 4G9FD 1L9MA 5IVXE 4MJ5B 4NRYA 5E99H 3L5IA 3X3FH 4S0SD 4PJAA 5DD0L 4XP1H 5K9QG 2FLBT 2CKBB 2LVEA 4K7FA 4P2RA 1WZ1H 3HC4H 2AQ3A 4R3SB 4LU5H 1JPFA 4YIQA 5T5NF 5SV4A 1TTFA 1NAKH 4W6YB 4G7YL 2LU7A 1QFPA 1IGTB 3O3EA 4M7KL 2FSEA 2HMIC 1KF9B 3A6CL 5A43C 1K85A 1IBGH 2BSRB 4X5LA 1I7ZB 3BP5A 3ARXA 2YRLA 1PQZB 3QIBC 2H2SC 4UIKL 3S88L 3K7UA 1IAIL 1PW3A 3JTSB 4NC0B 4QXTA 4Y2DA 1ZLVH 1GGUA 2X4SA 4O9HL 5F9WB 1BX2A 3WNOA 3LY6A 2OL3B 4P9HC 4PGJA 4LCWE 2VC2H 3GSXB 1I3GL 2NY4C 3AU1A 2IANA 1EFXA 1NPUA 3T0EE 3D2UB 1GYAA 5IHUL 1WFTA 5E6IC 5GGVH 5MERA 3LB6C 3GSQA 3MGTB 4L5FL 1LP9A 2W60B 3MRLA 4JDZB 4F80A 3G5ZA 4FQXB 3VGDA 4CGTA 1HZHL 4MB5A 5IWLC 3TBVA 3U4EA 4JRYD 1JRHH 4XHQA 2FD6L 5CBAA 1I1FA 1GHFL 4KXZH 4OTXH 2YD5A 2VDMH 3D6GA 3JTTA 3ILPB 4GAGH 5JA9A 4F15C 3PWPE 3CXHJ 1X5YA 4AQ1B 5CD5C 2EDJA 4OCYL 5I76A 4HKJB 1QPXA 4NN5C 1LO3L 1XGUA 2FHBA 1CLOH 1FGNH 4NZRL 5FM5O 4KROD 4UBDD 3HE6D 5F96L 5H2BA 1E4KA 3S34H 2OP4H 2ZUTA 5IEKA 5DD6B 5HHPB 2AGJL 1IAOB 2NY1B 5D96B 3PL6D 4PJAF 5F9OL 5HGBB 3RWHB 2VLME 1F58H 3IDIA 1S7QA 1C12A 4U0RB 1OAKL 3F6IA 1CD9B 1EZVY 5SX4H 3L6FA 4QT5A 4FFWC 2B5IC 3T0XA 1BF2A 2VR4A 4MXWH 4OQ1A 2ATKB 2A0LD 1X5AA 1JNLH 4R26H 4ZODA 4BZ1L 4CRPA 1XF2A 5EC2B 4Y4KC 2OJEB 4UV7H 1HXYB 3ZT7A 3QUYA 1U8OA 2I60H 4OM0H 5AZEL 1PBYA 2XFXB 3IXTA 1G7PA 5TF1H 1NCUA 2MKWA 4F9LC 3IDMB 3K74B 5GRWA 1EGJH 3CXDL 4HF5H 3FJTA 2QQNL 1GPOH 4ZO9A 3HI5H 3SGJC 3VFOA 1PX4A 2K7PA 1UWEL 3D39B 3VCLB 4HW6A 3TN0C 2K3TA 4NKIH 2C26A 4N5UA 3OXRB 4OZGE 1HYRC 2EXWC 1AY1H 3O45A 1JNHB 4LKXA 5E6IA 4DVRH 1Q1JH 5M94B 1OLLA 5AWNH 5EO9B 5BO1H 5HYSG 2Q86A 5D1XA 5JHLH 1EGJA 4JZJC 1HCFX 2IF7A 2BFVL 5E2TH 3V6FA 2J1KA 3U9UB 4UV4H 4M43H 5JR1H 5MHSE 1I9IL 5EN2B 3AREC 4TUJB 4FXLA 2VQTA 4X4YA 3BUYA 1A14L 2R2CA 4RAVB 2MFNA 3ARVA 3KYMA 3WIHH 4N9GB 4O00A 3K3QA 2A6JA 1J5OL 1CFNB 5D7IF 5I9QC 3WLWD 3DO3A 3FKUS 1LO4H 1YEEH 2VDPH 5KSAC 4Y89A 1ACZA 2LU3A 3QHTC 4UILL 3UP1A 5L2JB 3ZL4H 3QFJA 3O3DA 1H8NA 1B0GA 3PG2A 1V05A 3CVHA 3UPAA 3PWJB 1QO3A 4RX4D 3BP4B 5BZDB 3H8NA 2P8MB 4KKBC 3WEXB 4F58L 3BKJH 1HI6A 3NN8B 5DD6A 3PIQB 3JSSA 4PJDF 2B1AL 5DDHA 4U1SA 3E2HC 2HKHL 4M1DL 5T1KD 5T3XL 4OCXH 4KKAC 2WWMD 4PP2B 5D1QC 1PQZA 5HDBE 3SCMB 5TE6H 3MMEA 4K07A 4LNRB 3FQRB 3OXSB 1A6WH 1Q9KB 4U1MA 3SE3C 4QOKA 4JO1H 5DUPH 1IAII 3RY4A 3CNKA 4PJIF 1S5HA 4LBEB 1H3GA 3QISA 1J18A 3QSKB 4O2FB 2GSIB 5BOPA 1JF1A 2LV4A 3ARGA 4MXVE 3RNKA 4NQTA 5F1KC 5GXBB 4JM2A 3TYGH 3OKYA 4F33B 4APQB 1UB5B 4RFEB 5K9QI 3VD7A 1RZ7H 2B20A 1JGVH 5A16A 4ENED 3MGTA 1CDBA 15C8L 4Q9BA 4OCMC 5EU4A 3IETA 2NLJA 3IFOB 2APBA 1GGYA 2MJWA 3MYJA 1MCPH 3C5ZA 3G9AB 4XNZC 5A1AA 2HT4D 4OF5A 5DJXB 4WTXA 5INCA 3RGHA 4GS7C 2E7BA 5DD3L 4KRNA 2BMKB 4I3RH 1KC5H 1MCIA 4ONGH 4NPYB 6FABH 1D5IH 2DQEH 5GHWL 3WBDA 4O9HH 3OAZK 4LCUA 4PJHA 3WIFB 4HFWB 4TSCL 4MD5B 3MJ9H 1UG9A 4KK6D 4ZPVB 2C3HA 1FV1A 4MAUH 3KXFB 4MDJB 3P30L 2ATPA 5T5FL 5KANG 1S8DB 3GHEH 2VLKD 4HC1H 1T1ZA 4X0KA 2WWKT 1X4YA 3LKPA 2X4NA 5DK2B 3EYSH 3KPMB 5DLMH 4LPXA 3RZCC 2J8HA 1EJ6A 4XNQB 5I8CB 1BD2D 5EBLA 4NO0D 3SKJL 3MBED 1MCWM 4OZHF 2H9GB 4WUUD 8FABA 2R56H 3KYMB 3PGCB 1XIWB 2FO4A 3FTGB 4XBEL 4HIEB 3ILQC 2FLRT 5IBUG 4YH6A 4BZ2H 3HE7A 5IGXL 4JKPL 4JDTH 3MRQB 2WSKA 4H8WH 2A77H 1I85A 1VFUA 2WINA 3CC5A 5JW4M 3UTPD 4NSKB 5HYFA 4LLYB 1K8DA 2LTQC 3QUXD 1U8KB 3MRPB 4MA7H 2VR5A 3CVHB 3MLYL 2M1KA 2A6DB 5EBMA 3VFVA 3REWA 4OAWB 4OFYD 4KK9C 1T2QL 1QBAA 2FJGA 3LD8B 1PKQA 1AXIB 3D87B 4JFDE 1T89C 1BOYA 3I75A 1DBJH 5GGSA 5JIHA 2HFGL 1ZA6B 2PNDA 3GGWB 4OKDA 2BC4B 3RZCA 1UM5H 3EO9H 5BJTB 4FZ8L 5A16B 3UZEA 2UUDK 4LSTL 1LEIB 2J6EA 1V3MA 2ZSVB 4KZEL 1T22B 3QXDB 3V2AR 2HTKD 1B9ZA 1NFDB 5F7DB 3FB7B 4EXKA 1U36A 4XC3L 5I30H 3JZ7A 5FGRA 5TFSL 4DGIL 2BSTB 3FRPA 4YE4L 4NZUH 3VRJA 2AEPL 4HWBH 1SJHB 1YMMB 2FX7L 3PGDB 5EOCH 4YFEA 4PGZA 1RMFL 4YGVA 3RWGA 5KVMC 1SYVA 3LPWA 2FH6A 1QP1A 1RUQL 1MFEL 5F3BA 1FE8H 1EHXA 5E8DH 4MA3A 3FT2B 3KDMA 4Y1AA 1G1YA 5EU7E 3WD5H 4UB0L 3NN8A 2YZ1A 2FX8L 1I1AC 1A47A 4R4NC 1N4XH 1AJ7H 4ZFGH 5CZXD 3H3PH 1KJVB 2XTJB 3KYNB 5IW6A 1VEMA 4TSBL 3QDAA 3VFGH 3LKOB 1FAKT 5I66B 3PABB 3X3FL 4RWHA 3K4AA 1XF1A 5FV2A 1RK1B 1FL3A 5J1AB 3O4OB 4TNVK 4H0GA 2Y36H 3TEUA 3X14A 4X6CB 4K9EL 4DGYL 2A38A 2JCCE 3UJJH 1TLKA 3RPIB 4LKCA 3HC3L 2XZCH 4LIQL 2NR6D 3L7FA 3PWVA 1ONQA 3EYQC 2GK0B 1A7PH 3QUML 2PXYB 3B6SB 4ODXB 5FIEA 4WI2A 3QEHA 5ACZA 4XZUB 1Z5LB 1GGTA 3MLXL 1R5IA 5J1SC 4IMLB 3H3KA 5HY9A 2IBZX 3I6LD 5I1AB 1JWMB 3IU4L 4U1IB 2JJSC 1I8LA 4OGZA 3MGOB 5C86A 3OZ9H 4C59B 3SEPA 4Y4FD 5DR5L 2MMXA 1AGDA 1QLRB 4K94L 5T3XD 4R2GD 2AJSH 5E8EA 5HBBA 4U1NB 1G7JA 1A7OH 4FQJL 5KVDL 2Y6SD 2DQFA 3BKML 3EYUL 4MJ2A 2PETA 3UEZA 3AMKA 1MAJA 1NCDH 2W0PA 4QRUB 4UI2A 1OW0C 1WSST 1ZVSB 4J8RA 4MS8D 1UCBH 1PKQB 4I0KA 1NBVH 1Z9SA 3GMMA 1YDPB 1IEBB 2HFTA 4NJAH 5I1KL 4YDJB 4HEPG 3GEWB 3L95B 4TN9A 4CVWA 2R0KL 4Z7NE 1U8KA 2WK2A 1TETL 1VADA 5FO8A 4DZBB 4AG4H 4LEOA 5JDSB 5H35A 3O4LE 2XKUA 3DTXB 4WV1A 5EZLA 5L8KB 2B39A 2Y5TA 4GO6B 5FDWB 2YRZA 2I07B 2X1QA 1T21A 4MSWA 3UTSA 5D5ME 5IF0A 3CLEL 5DJ6A 1UT9A 3S7GA 4PG2C 4J3UA 5D1XC 1I4FB 5DS8A 4NZRH 4GRLA 1ZTXL 2E8ZA 4M6AA 3QUMB 5HGGS 4LLMA 2UZIL 1VKXB 3MV7E 4MQXD 1A2YA 3IYLW 3FRUA 5DYOB 5ANMA 1DE4A 1VPOH 4PLOB 3ZDZE 2HMID 3U0WH 2OR7A 1FVDB 1OGAA 2FRGP 2RCSH 2X89A 2VL5B 3T4AB 4JREB 2R23B 1FNGB 1LD9A 3DXAB 3P9MB 3VXPB 4KGLA 5JDJA 2P49B 1BM3H 4Q6YA 5KSAA 4FN0A 1KCSH 1P7KB 4FG6D 2BNRD 3GSUB 3T77A 1A14H 5L8JB 1JL8A 1WV7T 1Z3GH 3F7YB 3L5XL 5EZIL 4H25B 3PDOA 3I2CH 4MA3B 1QVOA 5T1MB 3DV4B 1OAQH 3P77A 2OJZL 2AQ2A 1F6AB 2NY4D 3BVNA 3KPOA 2MHAB 5DURB 1A7NH 3GBLA 3IDUA 4PP2A 4OLVH 4C55A 1CGSH 2RGSA 3BWAA 4NN6B 1IM9B 2YPLA 3BIBX 4RA0C 1R5IB 3HE6B 4YR6B 3WJLA 4YXHL 4AEFA 1RHHB 2CO7B 3W9DB 1VFBB 1DQTA 1V7MH 2CGRH 1P9MA 4JFOA 1DZBA 1G7HA 2BVUA 1UENA 3QAZB 5GJTL 3L1OH 2R0LL 3FB7A 4XPHL 3HFMH 4PB9L 1TZIA 2IPKA 1T7VA 1HOCA 5C09E 3T65A 4EUPG 5I1EL 3RRQA 5CHNB 1CU4H 3MYZA 4G6KH 4JZJA 5CGTA 3WFDH 2C3VB 1FLTX 4POUB 1JGEA 5EPMA 4UOW1 1WCQA 4NUGL 1NDMB 1G6VK 1QNZL 2CIIA 4IOIA 5HGAB 3KDMB 1HH6B 2O5XH 2NXYB 4JKWA 1H15A 2YMXL 1EVUA 3LEYH 2C7UA 5FDYA 2J8UA 1S9XA 4GAGL 5CZVH 2Z31A 3ELAT 3V5KB 3VXSE 2WBJD 5AZ2H 4FXGB 1A4JA 5DJYB 2DJSA 4N5ED 3U4AA 2D0FA 3J8F7 1S7WB 5KJRH 2ESVA 3V8CA 4MSWB 4I0PB 1ZHKA 2OP4L 2A6KB 1FC1A 4JCLA 4KQ4H 5E4EB 3P4OA 3TIEB 3VE0B 1IL1B 4AH2B 4NKQB 5D70H 4XI5D 4DZBA 1LE9A 3PHOA 1RK0B 2P44B 5DD3H 3X11A 1REIA 3FO1A 4PY8I 1BVLA 4IMLA 1T1XB 1H3PH 1FSKC 5KW9H 4O02H 3LS4H 1WWWX 4I18A 2G60H 4HGWA 3A67H 3AROA 43C9A 5IBTH 1JPST 1OP3K 2BOCA 1BLNA 1EX0A 5DZOA 5E03A 1ZA3A 2D7TH 1JF6A 4KFZC 3FN0L 4H25A 3WXVL 3WFHA 3PDDA 1OCWH 2EDNA 3LQZA 3CVIH 3I6GB 3EZJB 4XX1G 4F7MA 1DQJA 3P4NB 3ZKMC 2A73B 3UDWA 4P23A 5BV7C 3LPFA 4BZYA 2DI9A 1QSFB 2NQCA 3ARED 4NRXB 3BZ4A 3EOBB 2YC1A 1WQVT 2DRUA 5IOPA 4LCCA 2YA0A 1IC7L 3L5JA 2APTA 2FZ3A 1WWCA 5C0BD 1MIMH 3HZYB 1OL0A 4P3WA 2MKLC 4P2QA 4GKZA 2F58H 4IEFB 4MJ4A 4OCRL 3CFEA 5MEPB 3AS2A 2H45A 5DUMH 3ARFD 4BH7A 5IGXH 1AQKH 2HT3D 1T7XA 5E8NB 2VERN 3T65B 5CAYB 5GS1A 2W9EL 5IF0B 1ZA6A 3GGWA 4BQBA 1R3HB 1LNUB 5ISZA 5KAQF 3LEVL 4E41E 4WFFE 1FCGA 2CR6A 3EO1B 2G5RA 5IESL 2YBRB 3HZVA 2J8UF 3ZKQD 3MFFB 3ESVF 4LP4A 5T1DH 1BJ1J 1J5OH 3P4MA 2YHGA 1CGWA 1EBAA 3OQ3B 2JF1A 3RA7L 3MV8A 4LLVA 4JVPA 3ROLA 1HH6A 1BBJA 5C0JA 1K3IA 3KJ6H 5E94B 1JP5A 3MUGA 3L3IA 4Z7OF 4HC1L 3L3KA 4LSDA 4JLRA 2YD6A 4HKJA 4PJBE 2ZJSL 4RRPA 3TNNA 1URLA 2VXVH 1Q94A 1DBAH 4MA1C 3QDGE 2P5EB 3IGAB 4PY7B 5HDQL 2ICWJ 4WW1B 3FT2A 3G04B 3OG4B 5DVNA 2L7UA 3O2DH 1L0YA 4ZOCA 4K3JH 4O2CA 3KYKH 4FNLL 1DVFA 4TTDC 1J8HD 4UDTA 2Y23A 1NDGB 1R6VA 2X9WA 5GS1C 2NZ9C 3BT2L 4DKFH 3MV9E 2XWTB 1V8HA 3BOVA 2NY3B 5DUPL 2G2RB 2OZ4L 2V2WA 4MAYD 1YEIL 3LQMA 4HUUB 4JPVL 1FL5B 3KXFD 1HDMB 4GBXD 5EIQA 2DQJL 3RGVC 1AD9A 1XF2B 3K81A 5J1TC 5B39G 2B4CH 5HVHB 1A9EA 4ZFGL 2JB6A 2AK1L 4HK3J 4PJ7A 5HHOA 5CJQH 4FP8L 1KUMA 5C71A 1K6QL 3TPUA 2GK2A 5LGKA 3FO2B 4QHNA 1GVIA 3DX8B 1HK6A 2W38A 1QSFE 1U92A 5EC1A 1PSKH 4X5WB 3OKDB 4FZ8H 1CFQB 1Q0XL 4LPWA 4XPAL 4C83B 4C57C 3V4VH 1VACA 1KB9K 1OGAE 3BQUB 3U82B 1CGSL 1MJ7H 1TDQA 2VZ1A 4NCC2 3SGKC 5ITBH 5C0BE 4K8RC 3OKNB 1FYTD 1UKSA 4I3RL 1FZOA 2DWEA 2XZAH 2BY2A 1ZK9A 2DQCH 4JFPB 1RZJC 4R7DA 2A9ML 3AREA 3U0TB 12E8L 3RDTC 3H2WA 3TO2B 4OLXH 3KPRE 5FOJA 4HMDA 4P23D 2EO9A 2VE6A 3PP4L 1FPTL 1RUKH 4NQXB 3M17B 3SBWC 4X99B 4Q97A 1FE8L 1G9MC 2CUMA 3ZKSD 1JZ4A 4PRNA 5I74C 4DZ8A 1A5FL 3G5YB 5KSBB 4U1HA 4UB0H 3EYVA 1JNLL 3D3VD 1J1XL 4E9LA 1RZFH 1FLRH 2GYSA 4MD0A 2XN9A 1EPFA 5A2JH 1XR9A 2LAGB 3KLAA 4FFVC 2CDGB 3RNQA 4PJBB 1C8PA 4M6MH 3K46A 2J3SA 2FHFA 5JQ6L 4BKLB 1NUFA 1XZ0B 2EH8L 3P9WB 4LSVL 4XVUC 2P5EA 3IGAA 4POZC 5CWSB 5D2NB 3FAWA 1A1NA 5DTFA 1VDGA 2W0FB 4IOFC 5J12B 5KZCB 1C16B 2NY0C 4ZUSA 4WI7A 1DL7L 1Y6MR 1ZHNB 4NFBA 2AKRA 1KGCE 4MXQC 3BN9C 5IFJB 1MCCA 1DQML 1FNAA 1A9BB 3LKQA 1X5ZA 2NY1C 4NRZA 3PWJA 2MSPA 3NCBB 4TUOB 3T4YB 1G6RA 4QRTA 2NCMA 2WBJB 1CLYL 5E2JA 4L8CB 1I9RL 2G60L 3L3JB 5L8LB 1Z2KA 4MNQA 1AXTL 1YEDA 1Z6JT 5EDXA 4UQ3B 4HWEH 2HFGH 5KZCD 1NDGA 3S3JA 4G5ZL 3QT2A 1UCBL 4RISL 3TC9A 1CQKA 3FB6B 3LQAH 3QQ9D 4M4RA 2GJZA 2YUZA 1QSFD 2O5ZH 3D25A 2A6JB 3B4NA 3BZFB 3G6JB 5KSUA 3SGEI 1OSZA 1P9MC 4ZUUB 1PEZA 4DGIH 3CPLA 3PL6C 1RZJL 4OZIF 1SHMA 4YDVA 2RBLA 4I3SL 4JZNA 1MUJA 1S7RA 2J8UE 4DKEL 4P9ML 1PG7H 3MRQA 4YFLI 3GZKA 4U49A 5T3XH 2YPLD 1EV2E 1NC4A 3U2SA 2VWEC 4BH8B 4C56D 5KBNC 3WEXA 2PTUA 3V5DA 3ZKND 1XF4A 3DVFA 4ZO8A 1AQDA 4LVEA 1DQLL 4RGOH 3SDXB 5JPMA 5KSBE 2EIEA 1I8IB 2JCCA 1N7MH 4QXWA 4A6YA 3D3VE 4HPOH 3MRCA 2EC9U 2ZP0T 3GSWB 3HR6A 2HVJA 4QHLB 1JIBA 3AREB 3TBSA 1ZE3C 4LP5A 2CLVB 3BEWB 1U58B 3M1BA 1JCKA 2R1YB 5JXED 1INDH 1FL5A 1XGPA 2V7NB 1X5JA 3FB8B 3C6LC 5HHXL 1RUPH 2VZ3A 1BFOA 1BZ7A 3WV0A 5I17A 2PUQT 1YEJL 3MRJB 1AGCA 5D2NE 2Q76B 5EIVA 2C3WA 3IJSB 3ZDXE 2YD4A 3VXME 5I8OH 2IGFH 1QA9B 5GISL 2MCPH 5DQJA 5EU6E 1V3JA 1IFHL 1CI5A 5GS3A 4JJHA 4TULL 5D7IE 2P5WE 4XNYH 1DEDA 4WW2B 3NGBC 1VACB 1WWBX 4UOJA 5DJXA 3FO9B 1HHKB 2XIDA 3UJIH 1NCCH 5C07A 1U8PB 1HSBA 5D1QB 1E4WL 2V17H 4NPYA 5IQ7H 1UJ3A 1T0MB 3P40A 1NCAH 3MXVL 2X05A 4UQ3A 4PJIB 4M1CD 1T5WA 4WEUD 5IBTL 1Q0YH 2GTZA 4F57L 2FX9H 2NXZC 3H7BA 2ICCA 2GQHA 3VD5A 2FZ3B 4AZ8A 3G6JE 2H8PB 1A02N 4APQC 1FNFA 4MNGB 5CMAA 1UC6A 3BQUD 2DWDA 3T8XB 3KPMA 4RFOL 2WWMC 4NKOA 3S35X 1CVRA 4MXVF 5SWSA 4JCMA 3G5XB 4JZNB 5F21B 4JVUA 4DGVL 3GSNH 1QSZA 4FG6C 5ID1B 1D9KD 3KLHD 2VAJA 3G6JA 4NC2B 4UTAL 2DOCA 4P5TB 3IAGC 1ZVYA 3DUUA 2A9NH 3VCLA 5L7XL 2Q3ZA 1Z9MA 2RCSL 4D2NA 5IJVA 4ZS7H 5TH2A 3D9AL 3WS6C 3D3VB 1TVDA 4QRUA 5I1IH 4X4ZA 1I75A 4J4PC 1ORSA 4ODWA 4WHYH 5AG8A 4QRQA 4AEHH 2BXYA 2EDWA 3N1GC 1I1AA 1R3LA 2ZG3A 3BEVA 4MX7B 5F8QC 4L1DA 4KDVA 4XCNA 5T33L 2R1YA 4QRTB 1D9KB 2VITA 4OIBA 2W9DH 3CVHL 1SY6H 4XMPL 4U1JB 1U3HC 1MRCH 2FIKA 5BVPL 2BRRH 1OP5K 1T20A 3EDFA 4XCFL 1KIPB 5DI8B 4M6ML 1CICB 2X41A 3RZCB 3GSWA 2EC8A 4YXLL 4Z76A 4JFHE 3UDWC 1CFNA 4FQLL 3VH8A 1UXWA 4WU5A 2C4XA 3VI3E 4LOUD 4YJZL 3DI3B 4YO0A 5JXEA 5D7LD 4XRCB 2HJKA 4DN3H 1G7JB 4U0QB 5GQBA 1RUQH 4FNLH 2IPUK 2NNAB 3NFSH 2AJXL 3RIAF 1J88A 4NOBA 1SJVA 1P6FA 2UYLA 1MUJB 5IMKA 3RWJB 3SPVB 5HYJD 3WHE0 2VL5A 3T4AA 4XMKL 3D69A 4GRWF 3QRGL 3O3BA 5I16A 4G8IA 3MREA 1U8HB 3JWNC 4KMTH 5KN5B 4Y1AB 3UTZB 1I9RH 3O3UN 1NGQL 5CEZH 2VXTL 3ZZ1A 2Y06H 1DEEA 4NBYB 2ARWA 4ALAL 3Q6GL 4B7IA 1HXMB 5I8EB 2R29L 1HNFA 5FO9A 3KPNB 5KSVB 5DJDB 3PHSA 2DQTH 4X4MA 1FHGA 2E7CA 4JFQB 3PHQA 5D9SB 1DDHB 3QUMH 5C0CD 4HK0A 1Q9WB 1F13A 1CBVH 3BXNB 5DRWB 3MLVL 3WNKA 5E8PA 1JGDB 5C0GB 1QTYT 4X99A 4YHOH 5HHMD 4Z0XA 4NUJA 1HINH 4O4YH 5HXMA 1MELA 2C4FU 1UH2A 1OVZA 1UB6B 2NY2D 3QFJD 4Y4HA 1JWUA 3ZTNL 4WUUA 4MDIA 4IIQA 3T1FA 1PG7L 2P8LA 1O5DT 1H3PL 2R9HC 1U8MB 3QUZD 2B0SL 4MB3A 3FB5A 1GOHA 1P5VA 3PP3K 1T80A 1HHGB 4L29B 5ABDE 5J4MA 2F54A 4XGZA 3E6HA 1K2DB 1NEUA 1RZIA 3W2DH 5D6CB 1JK8B 4WFHD 4U1NA 4WUUE 2XT1B 5GRUH 1NBVL 3V5HB 3O2WH 4HCRL 5K59E 1TFHA 4HJJL 1VKXA 4G6FD 3ZDXF 1P4IL 4YXKL 1A0QH 4YZFF 5FYKD 3QG6A 4PD4K 1OGAB 2YKLL 3O4OC 3WJLC 3REVB 1YC7A 2YPLB 4A6YL 3LKPB 2AEWA 1S7TA 2R39A 5E9DA 5I1LB 3KPSD 5FO8B 4OZIB 3MLPA 3CLEH 4YHIA 3KPRB 4D3CH 3P77B 1CGUA 2YD7A 4PGBB 5T3ZL 5D7LE 2V6HA 2DKUA 3CFDA 3FO0H 1NJ9B 1RVFH 3NABH 1IFHH 1TMCB 2X1PA 4PJXF 3S97C 4O51A 5JHDA 2PYFA 1CK0H 3Q1SL 3B9VA 4PJFB 4H1LA 3LEVH 3U6RA 1CXHA 1I3UA 2WQ8A 2VLJA 3CX2A 4N0CD 4LRNL 2H26A 3RY6A 5SWSE 1NBZB 1NFKA 4D0CA 1M6OA 1T2XA 3RWFB 2EEDA 5GGVL 5J57B 1I1RA 4LLYA 3LKSA 1NCNA 3SE9L 4JFFE 1KPVA 4OI8A 3MRLB 1RZFL 2XI9A 4LCWB 2IC2A 5IG7A 4EIGB 1CD0A 4JFQA 3WUWA 4XP4L 3PL6A 5TPWL 3C8HA 4R7NA 4EDXB 5HDQH 2V5YA 5FKAA 5MEQA 2DM4A 2VDML 4PRHB 4Y4KA 1D9KA 2VITB 1AQDB 4AH2A 5L9DH 2HRPL 2LFGA 1EEUA 4NBZB 2PYEB 1KG0B 4K7PL 4H1LG 1SEBA 3S36X 3ABZA 3G08A 4M3KB 1WTGT 4UINH 1BFVL 1S7WA 5D1XB 2Q86B 4R0LC 1MH5A 2EH7H 3CFKB 1RUAH 1MCFA 4XVSH 1C5CH 3TFKC 4MWFA 5C0BA 2HG5B 5IB5A 4HJGA 5CSZB 5CEZD 4RA3A 1RURL 1A1MB 3UJTL 3ZSSA 3UBXB 1S5IH 5CJQL 1WT5C 1JUFB 4LVNC 3HRZB 2E6QA 3LKNB 4Y19A 1K6QH 1QA9A 2OSLA 4MXWL 4BJLA 1AXTH 4I18B 4RBPK 1HH9A 1NKRA 1BAFL 4CL7A 5FGBA 4ZS6D 5D1XD 4IRJC 3P0GB 1H5BA 3WFZA 1ZA3B 3M07A 4HEME 4DKAA 2BRRL 2BSSB 2JTDA 2OTPA 1JBJA 2AXGB 3ARZA 4GAJL 4Y5XC 2BDNH 3P0VL 1HXMA 3QI9D 2R4RH 4JO2H 4ETQA 3IAPA 5F7NC 5DRNB 4PG2A 5T1LD 1IC5H 5GRVK 2EXYC 3BO8A 2BOBA 3HE6C 1T0MA 5CILL 2ICWA 3AM8A 5E8NA 2PO6A 3T2NL 3IDNB 3PUCA 3SDCB 1IAIH 5CD3B 1WBYB 2OR9L 1LO0L 1KB9J 2X4QA 5LAXA 1FJ1B 5CJ8A 1LE5A 4KVCH 5TQ0L 4HG4J 3AXLB 1FVEB 3CUPB 1JPTH 1ND0A 2XYCA 2NY0D 2FL5B 1QKZL 3PQYA 3VXSA 5LKNA 4YHKH 4ZAKC 5IFHH 2HA1A 3K8LA 3W11D 4LCYA 4N8VA 2ED8A 4GXUN 4ODBD 2R1WB 4M1GH 4ZTPL 1ORQA 4G8GD 4PRHA 2XWJA 1QG3A 3STZB 1DQQA 1U8IB 4ZPTA 5IW1B 1HHJA 4PRPD 3QFJB 1XAUA 3UXFA 1UWXK 1NGPH 4DGVH 5IV2A 2DWEB 2Y5TB 1FGNL 3TN0D 1N6QL 2VDKH 3JV4A 3NIGE 4YUEH 5IM7B 1GAFL 4KAQH 2JIXB 2WIIB 4HBCH 5BRZB 4HJGB 3U36A 3W39A 3I84A 3QJFA 1U93A 4LL9A 4G6FB 5FGBC 3MLZH 1C5DB 3AGVA 1MREL 3D9AH 3L3HA 4GRWB 4L1HA 4CN1A 1OAKH 5DQDL 1J1PH 1V7NL 4MNGE 3VH8B 3VFSA 3D85D 1LK2A 1Y0LB 1W72L 4F2MB 4N1EA 4Y4FB 5ICZA 5CIPH 4ODVH 5E2UH 4OB5L 2DLFL 4TOYL 1A1OA 4JM2C 3GSUA 2YD1A 8FABB 1KCUH 4XMPH 1JGVL 2C1OB 2WUCL 5KSAD 4KUZH 15C8H 1AR1D 4L9LC 3HNTL 1JFQL 4GOSA 4WGWB 5TF1L 4AL8H 4CADA 1NGXB 5IG7B 3T0AA 4LMQE 4D3CL 3PNWA 3O6FA 5T3ZH 1CGXA 4FQCH 1AKJD 4S11A 2EIDA 1WFOA 2QHRL 3N0PB 1IKNC 8CGTA 4NKIL 4HIIB 1DQLH 1VFBA 4ODUB 4WTZA 4X6DB 5J13C 1QR1A 2DD8L 2X4SB 4YK4C 4NNXA 5DFTA 2OL3A 1L7IL 4EI6A 3RWDB 5D1ZA 3BZEA 1JMZA 2XACC 1I7UA 2XA8H 4S0TD 3TV3H 3DNKA 1LO5B 3UAJC 4YBQC 5J3HC 1ZT1B 4U6XA 2B8OT 5CINL 1NGQH 3GMQB 5D8JH 4ODTH 3MLSL 3SDDC 1WC7A 5D7SL 1OP3H 1FVEA 4DVBA 1PSKL 1FIEA 1Q0XH 1QBBA 1TJGH 1YZZA 1JHTB 2LVCA 2IGFL 5CBEA 3VWJD 1T03L 3B43A 1XR9B 2PYED 3VG9B 3ARFC 4ONFH 5DMYA 3VRJB 4G80A 4LLAA 1SJHA 1INQA 1YMMA 3GK8H 3IXTB 5GSRA 3VG0L 5CUSH 2VQ1B 4IJ3C 1HHHA 5MEOB 2NPLX 3ZE1E 3MRHB 3PGCA 5C09D 5F1NB 1XR8B 1KJMB 1NCCL 2J4WH 5EB9A 1TCRB 1CT8A 3HMXH 3V6OA 4BSWA 4GG6F 4UDUA 3BPNC 1EUUA 3BHBB 4M1DH 2OMBA 4JPKH 4HGKC 3DETD 1KV3A 4N1HB 3FN9A 1ZS8A 2EKJA 2NY3D 5DUBA 5C9JB 5HVFB 3GMRB 3TO4D 4RNRA 2Z4QA 4D8PB 3QCTH 3T3MF 3KLHC 3L3GA 2B4CC 1WICA 3BRGC 3RPIA 5HVHC 3CJJA 4DQOH 4NJ9H 3SN6N 5HI3D 2ICEB 4TTDD 1TVHA 5FOBA 3RUGA 5C70A 1CGYA 4WFFD 2EDQA 4YHYC 2A74A 3RHWK 5B22A 4PRPA 3IDMA 4EIZC 4DTGH 4LHJB 3DVGB 1MAMH 5DDHB 5EBWB 4WO4D 4P99A 1XZ0A 3H9SD 4HZLA 1BIIA 1AGDB 1QLRA 5F6IC 3RVXC 3RIFK 1TCMA 3LN4B 4EN3D 1JHKL 4EXPX 5ITFA 1A6TB 5JXAH 4XCYA 3HPJB 1NFDE 4CADB 2ZSWA 4WEMB 1F4AA 5D71H 4KVCL 4NOFA 5EO9A 2N1KA 3ULVC 2R69H 3FAXA 4B5EA 5F89A 5KTEL 3GKWH 2HLAA 4TUOA 2FJFB 3MJ9A 4NO0B 3T4YA 5I74B 3W0WE 5HYEA 1F4XH 1XF4B 2COQA 3P30H 3DO7B 1QLEL 1YNKH 1NEZA 4KKLC 4LBEA 5HI4D 3C5SB 5A2FA 3DX9A 2R1XB 4XWGL 2X40A 1U6AL 5DQJB 3QIUC 4I0CC 3MUGB 2O5YL 2VWEE 3MRDB 2H6PA 4OD1L 4PG9A 5A40E 1G7LA 4CU8A 5IB5B 1ES0B 4M5ZH 4R97C 3WFBL 5I75B 2WP3T 2R2EA 4ZXBA 4GG6A 3QUMA 4M7LT 5J12C 2J12B 1B2WL 4LLMB 1T1WA 1ZGLA 3WMSA 3S35L 4OF7A 3A6BL 1NGPL 5HGDA 1HHIA 4BSVB 3CZFB 5L2KB 3T0DA 1HH9B 1KJ2L 1ODAA 2GSGA 3W9EB 1DUZB 1N7ML 4P5MA 4CVXA 4X0KB 1C5CL 2ESVE 3HNSH 5CEZL 1E4JA 2VISA 3BH9B 2BSSA 4OD3H 4MA7L 1Q8MA 4G8GB 2G2RA 3FO9A 4NQCE 3MLYH 1S5HB 3BIAX 2GSIA 1FDLH 5CIPA 5EFIB 5GS0L 1XMWA 5HHXH 3VXQB 1P84K 3LZFL 4GUPB 3GMMB 4FFWD 4ELMF 3QQ4A 5CEXB 1LO5A 2WUBL 4OB5H 4PRIE 1ZS8B 2VLKA 1QQDA 3QFDB 1ZLUH 4DFIA 4TVPE 4Z5RB 1B4JL 1QUNA 1VGKA 1LE5B 5DJAB 3HNTH 1OOAA 3AXLA 2AJUL 4CAGA 4CVZB 1NQBA 5HD8C 4YIQB 1IEAA 2EYTA 4NQEB 4CNIA 3FQUB 2AGJH 2UV3A 1MAKA 3AUVA 4NBXB 3MJ8A 4E42A 1QHPA 4HS6B 4X4ME 1IC4H 2NY7L 3SKUD 2FEEL 3HPJA 1AGBA 2V17L 1FO0L 4J7RA 5D7JC 1KEMH 4ZNEA 2DD8H 3R0NA 4HV8B 3QQ3B 5F1NA 3E6FA 3GSVA 4M7JH 1JTTA 4RMTA 1NAML 1RU9H 4RAUB 4YXKH 3W0WB 1YN6B 1JPTL 4NQXA 3U1SH 1DLFH 3IKCA 4PYGA 3S37H 3ULVH 4LDOB 4WTZG 4JFYA 1VGEH 4UV7L 3MA7A 5C8JB 2ID5A 5ISZE 4LCWD 1IEHA 1Z3GL 5EZIH 3TT3L 3VWJB 2ZCLL 2IANB 5GS2D 1MCOL 1N64H 4Z7UB 2QQNH 4UAOC 5D2LF 1MWAL 2JIXA 2WIIA 3O8XB 4GKNB 1RQ5A 4MNGA 4HUXB 5CMAB 5I18H 4GAJH 3JWOL 5F3BB 3WHXB 4GW1A 4LLWB