4X6BB

Bk6 tcr apo structure
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
244
structure length
244
Chain Sequence
b'NAGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRYFLPTQGMGAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR alpha
molecule tags Immune system
source organism Homo sapiens
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
total genus 56
structure length 244
sequence length 244
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6bB02
3W2DH 5I16B 2WIMA 1KTKE 1Z9SA 3REVB 1FHGA 1NKOA 4Q2ZB 4XPGH 4WUUD 1CQKA 3VXNB 4C54A 3GMPA 4D0DB 1QR1B 1Q0YL 1J0YA 1S9VB 3G9AB 5HJ3A 1PLGH 4JG0L 2EYRB 2PW1B 5C2BH 2YZ1A 3GO1H 3NN8A 4PB9L 4M3KB 1DE4B 4RGNB 4UT9L 5IEKB 2Y72A 3ARWA 1HHIA 5EUKB 2DM4A 1XR9A 4Q7DA 5ALCL 1HXMB 1NLDL 2YD2A 3TPUB 1YNTA 3CLEL 2NY5C 3LEYL 4LEOB 3VFUB 5C07E 3CZFB 4KJQC 1CLZL 4X98A 2XN9B 1LK3H 3JUZA 4M93B 5J3HD 2J5LB 3O3BB 3TZVC 4OIIH 1SEQH 3TO4B 1H8SA 3NZHH 3Q3GB 5F3HA 1HHJA 1QRNB 4KRLB 3K0WA 2WW8A 1ZTXH 5HI3C 1KCUL 1EAPA 4M5ZL 5HD8C 4DZBB 1BOGB 1G7JB 2LABA 2VLRE 5FM5O 3MRJA 3O3BA 4LFHD 2XWJB 4UV7L 4OLVL 1A7OL 4HLZH 3QUMB 4R4FL 1MPAH 3WFEH 1U95B 4MD0A 1CXLA 2Q6WA 3VW3H 5FUCC 4KV5F 1G7JA 1S7WB 5DR5L 1C1EH 1PKQA 4OBSA 4JM2A 4JY4A 1TIUA 5HDQL 1KC5L 4URTB 3O2VL 5BOZG 4PJEE 4KTDL 5EZOH 2V7HB 2VDNL 4C4KT 3MA7B 4PREB 2CK0L 3RWGA 2X1WL 2FX8H 3V52H 5FUOH 3VFOA 1QACA 1S7WA 1YN7B 5AWNH 1DQQA 3ZYJA 4K94L 1FNLA 3ZKND 1MIEL 5DD5H 5MEPA 4HG4K 4OLYH 3I85A 2NW3A 1ZHLA 4ZS6D 3RZCC 4FTVD 3W9EB 3O6KL 5IFHL 4XVUD 1IAKB 4WGVB 3FO2B 1NCWH 4ZNCD 1J11A 3VJ6A 1IL1A 3VWJD 5CSZA 5T3ZL 2GIYA 4EUPG 3SDCA 5HHOB 1C08B 2QL1A 1Q0XL 3OJMB 4HC1L 4LQFL 4M00A 3K8KA 3AY4A 4N90E 3MLVH 3W0WD 1G7HB 4KI5D 4K2UL 1D5BB 2C7UA 4LASL 4TSAL 5HGGS 3GSUA 3MNZB 5FYKH 2XKNA 4BUGA 1OAKL 5IFJB 1GGIL 3T0BA 2M1KA 5J11B 5HYJB 4LPUA 3MRHB 4K7PH 4NPYA 4G8EA 3VGEA 3AU1B 2UYLA 2BNUB 5CFHA 1OTSC 3QBTB 3UYPA 1QBLH 3WXWH 4JFOA 1CFTA 5L2KD 5TPWL 5D4QA 5HI4C 4KI1A 4LSPH 3STZA 1NEZA 2X70A 4J7RA 3UAJC 4R9HA 5CEYB 4P2OB 2AJYH 5D6DA 4O2FB 1FNGB 3WJJA 4B41A 2NY0D 4OV5A 3LD8B 5C0BE 4CW1A 5EPMA 3BGAA 2ERJC 4UUJA 2BCKA 3QJHB 5ACLA 1UGNA 2D7TH 1L0YA 3ARGC 3LEVL 1T7ZA 5D2LB 2C9AA 4ZFFA 2OP4H 1HEZA 2XTJB 5EOTB 3OZ9H 3HB3D 1F11A 1QLEH 3QFDB 2J8HA 4BFIB 2R1XB 4D9LH 1OTSD 5K9OB 3BWAB 3DIFA 4W68A 5KVEH 3H2WA 3WO4C 4HQQH 3S35H 1VB9A 5LXGL 3FTGA 4YFLI 1NCUA 5ADPL 4FQQA 3GHBH 3LKNB 3MZGB 3GSRB 4U2ZA 1Y6MR 3IKCB 3PWVB 4UB0H 1U3HC 5ALBL 1F11B 4HXBH 5IMMB 3VXRB 3HNTH 4YDJA 1MIMH 4EIZC 3HKFA 1EX0A 5MP6H 1SVZA 4HG4J 1UA6H 3BKYH 2P5ED 3PGDB 3PG2A 4D9RE 1KPUB 3PV6A 3O3DA 3VXPA 5GS1B 2DKMA 4K3EL 2C4XA 1OP5K 1EO7A 3HAEG 3MBXL 2I60H 3BKCL 5C92A 1OPGH 3EFFB 4J12A 3N1MC 3SPVA 5H37G 5JW4N 4GXUN 1R5WA 2Y36L 4OCYH 1AIFA 1CIUA 3L3DB 3QEUA 4FFWC 3TV3H 5DRXA 1PDKA 3U9UA 1GGTA 2Z35B 4PRBA 1I3GL 5MENE 1QFWL 4JFFD 4R2GB 4KK8C 1MFBH 2C1OA 5D7JD 4MSWA 2FX9H 5GHWH 3C6LB 4QRTB 4HWEH 4CVWA 1CLYH 1OD9A 3V5KB 5ITBL 5T1DL 4N1CA 5E9DB 4G3YL 1VGKA 5HYEA 1XIWC 4NNYB 1T1YB 1RVFH 1LO5B 4MQ7B 2ZCHL 3O4LA 4MNQB 3KWWB 4OZ4A 1XR9B 5E2JA 1V5JA 3MJ9H 4PJFA 4Z8FH 1J1XL 4F37K 5F9OH 3VI3E 3BOVA 3QG6A 3LEXB 3RGVA 4ZYKA 2NTSP 1AE6L 1S7QA 3IDMB 2NXZD 4HH9A 5IW6B 3F58L 5A2JH 1OVZA 4WHYG 4OSUL 2WUBH 3PF2A 3MFFB 1FLRH 1I1YB 2DI9A 4PGEB 1MOEA 1OAUL 3OV6A 4NGHL 1MHCB 5M95B 1CL7I 4OF7A 3WUWB 4PLJC 3TZVA 4Y8AA 2MPAH 4MQXD 3T1WA 4R96B 5FYJH 1NGZB 3ARFB 1T66C 3RWGB 2QQNH 1P6AB 2C4FU 5ESAB 4NWUH 1K8DA 4LVOB 1DTUA 4BKLB 4QXGH 4IS6B 4XCFH 2CDFB 4APQC 4BZYA 4HJ0C 1NCCL 1YMMD 4POZD 3DETD 2BFVL 2QTEA 3O2WH 1LO4L 4YO0B 3RX7A 4UTBH 3CFBB 5I1DA 1TJHL 2A73B 1FZOB 1QBMH 3SY0B 1BEYH 1YYML 2GSIA 4OFIA 4O2CA 5D71H 1AD0B 3PWNB 1PAMA 1L0XA 4JPWH 4ZS6C 3RZCD 3HG1A 2ORBL 3O9WA 4M62H 2VL5B 4KWUA 3QCTL 2RCSH 1WSST 1LDPL 4KJWD 3MV8D 5D7LA 5C0CE 3DSFH 4Y5YA 1KN2H 3V5DB 2JCCF 5FK9A 4FQXB 4XGZA 2VH5L 4BQCA 1BBDL 3QXDA 4XVTL 1TZIB 4TN9A 1D5IL 1KBGL 2H2SC 3HB3C 3O9WB 4NZTL 3CSYB 4N9GB 5I15L 3DBXA 5E08L 2DWEB 1JYNA 1AXTL 4PBXA 1HZHL 4KDWA 4RQQA 3BYYA 4M1CD 2BSED 3MV7E 3WUWA 4YDIH 4GG8A 3T4AA 5T1MA 4XVJH 5DUBA 3T0XA 3PWUA 4OM1L 4LLDA 1QEWA 2CLRA 2W9EH 3DO7A 3CH8A 3WFHA 3CSYA 2PN5A 1YEGL 1CE6A 3TA3D 3LKOA 1MSPA 2E9BA 1UZ8B 6FABL 4U7KA 3NIFE 3KLAA 3DX8A 4JKLA 2DQCH 3VXUB 1KN4H 5FKAB 1MCHA 5D8JL 3VFVB 4KPHL 5FYKE 5GJTH 1AD0A 3VXRE 5I74C 3LH2L 1JWUA 2ESVD 3SEPA 2PYEA 1EHAA 5IJKC 5DLML 4GG6A 1M7DB 3G08A 5HHVL 3TN0D 2CQVA 3ZKMD 4PJ9C 5C0NC 3BIAX 4JFQB 1YDPB 3V6FB 1JHTB 2Z8VC 5L2KA 5ECJE 3ARQA 1Z5LA 3CFJB 4NKDB 2HMID 1A1MA 1FZMA 1I4FA 3THMH 2ZCKL 1VEOA 3GI8L 2YD3A 3E3QE 4HULB 2KQNA 1YPZB 2HFTA 5HGBB 2IH3B 3JVGC 5DRZA 1KPUA 3PV6B 4L3ED 4G9FB 2AXJA 2HJKA 1UJ3C 3MBEA 3TO2B 2ED9A 2HH0L 4G43B 1MY7A 5DHVH 5IM7B 1LEKA 1OGAB 3C2SA 5F88B 1T80A 1U8LB 4H26B 2R2HA 4JDTL 2FB4L 4B5EA 4LCIH 2NYYD 5HHNA 4LSDA 5CIPA 3VG0H 4KZEH 5KG9A 1ZANH 2VERN 1JFQL 5ID0A 4EDWL 4HDIA 4FQHA 4OM0H 4EXKA 4QEGA 2V9QA 1MHPL 4XNZC 1HKLL 1OTUD 5F9JB 3GJFK 3UDWA 1ADQH 3QG7H 1E6JL 1P84J 4EDXA 1WC7B 3MPCA 2DWDB 4NC2B 2O5XH 2QHRL 4RDQF 2JCCE 5E95B 3UMTA 4C83B 4RMQA 3EYQC 4JFYB 3UBXI 1EH9A 4YLQT 4ZOAA 3BRDA 5T3XH 3OAUL 1RZGA 1MRCH 1WBXA 1ZLVH 5F9JA 4U1JA 5BRZE 3ULUL 1G9EA 1RULL 2AXGB 3C60D 2A9NH 3H7LA 1H8OA 1GZQB 3MRDB 4M7ZB 4MJ6B 5TE6H 2BERA 2Q20A 1EDQA 1FSKB 2GFBB 1K3ZA 3V4PL 3VFSB 4P4KC 2NXZC 1WEJH 4OLZL 1UC6A 3C5JA 3SE3A 2VDQL 3TO4C 5IQ9B 4OT1L 1WITA 3EOBA 2XQYG 1NMAL 3ZKXC 5I8EA 3VFTB 1AO7D 1WAAE 3BP5A 3FQWA 1RUKL 4Z6AT 4ONFL 3RAJH 4LLVA 2HWZH 3QZWG 2HA1A 4LGPB 3ZT7A 4U1NA 4POYA 2E7BA 4GQPH 1EEZB 3VDBA 2G9HA 4PJDA 5I1EL 5JHDA 3GSVB 3PP3H 4ZMAT 4ZNEE 4X6DB 2UV3A 4CMHC 3DYMA 2DLIA 2F19L 2H32A 1TLKA 1TENA 4IMLB 5I1LB 3DURA 1OT2A 1T1YA 1HOCA 1XGUB 3DYOA 5H37H 2I26N 4ODXA 4ODBD 2KH2B 1J1PL 4LSUH 3MO1B 4HZLB 1AGFA 3D3VD 4P5TD 2QKIA 3MROA 4WCYL 3HUJF 2Y06L 3QDMB 1VERA 1AP2B 3EDFA 4HKJA 1JZ8A 4JRYB 5D1QB 5CILH 2VTFA 4F37F 1IQDB 4HIEB 3B5TA 1ONQB 4LCCC 3ZKSD 5CZVL 1FFQA 1XGTB 2ZOKB 5E94A 5E0QA 1UADC 3EYOA 3O3AA 3P0VH 5B21A 2AJ3A 3J7HA 4M5YH 1N4XH 2YPKB 4NC0B 1MCPH 1T83A 2VDKH 3OGOE 2FJFB 3WIFA 3ZE2F 2NXYC 4ELKA 3NVQA 3QXAB 5C9JA 4JO2H 2LU3A 5IF0A 3F6LA 3FO1A 3RWJB 1A4JA 3QUZC 2OSLA 5BCAA 2QQKL 3WUZA 3T1FB 2HTKD 3FMGL 3VFMB 2E3VA 2CK2A 1KJ3L 5DYOA 4EN3D 5BVPH 4Z78B 3JWOL 3QPXL 1QG3A 4PJ9B 4KKNA 3MLUL 5MEQA 3BZ4A 1BQLL 1IBGH 1ORQB 2YMXL 1VFBA 1I3UA 2GJ6D 1P4BL 5D6CA 3L5HA 1MQ8A 5H8DA 1AXIB 4JRXE 1B4RA 3GSRA 4M1CC 5K9JH 3RVVC 3GIZH 3QEQE 4DFHA 1KGCE 4X5WB 1H3GA 4HUMB 2BX5A 4JGJA 5C09B 4JFYA 3NA9H 1Q1JL 2HJFB 3CFKA 1P7KB 1CE1L 1N6UA 3P4NA 3TF7C 1JPSL 2AK4E 4FQJH 1ZLUH 4JKPH 4P3CL 2YRZA 2WBKA 1CICB 3MLYH 5E8DL 4R2GC 2FBJL 4RMTA 4PLNC 1VACB 5KG9B 1SVCP 3GMRB 3HG1E 4PRIB 1RIVL 4RRPG 3H8NA 1IGMH 4G8IB 2OJZH 3SOBL 2JB6A 1M7DA 3Q1SH 4H25B 1JF1A 1KCSL 3MNVA 5BVJB 4FQ2H 3VRLF 3LKQA 1S3KL 4UT7H 4CMHB 4WUKL 3LV3A 1EJOH 1WBYB 2VDMH 1KLGA 5C08D 3TJEL 3FO1B 4W4OA 4XPAL 4R7NA 2P42B 2IFFL 1S9KC 2YD7A 4KI5C 4UQ2B 4U6VL 1IKFL 2XZCL 5JW3L 1YMMA 1A6UL 1MJ7L 3NFNA 4ISVA 4LLWB 4NC1E 4XP4L 5E7FA 5DC4B 1H3WM 1PY4A 4WW1B 5B8CA 5DQDH 2A77L 2ZUYA 4JFEE 2AEPH 3OTTA 5KAQF 5H94B 5FDYA 4OV5B 1MCOH 3OKNB 4HV8B 3MRMA 5C7XL 3E8UL 1G6RA 1URLA 3KJ6L 5LAXA 2V2TB 1NC2A 1IM9B 1A7NL 1B2WH 4GG6F 4JPVH 1T89C 4HUWA 1E4XL 3RY4A 5JR1H 1X5HA 1PSKH 4HD9A 1RJLB 4NRXB 3GMOA 4U33A 4XX1G 5F1NB 3WFCL 4YDKH 3MZTA 4O51A 1RZJC 1C12B 1F58H 3P4LA 4DEPB 1CDCA 2NX5D 2VABB 2IPUK 32C2B 3C60B 5HGHA 3LKSB 1JVKA 3ZSSA 4JQVA 3GDBA 2D7QA 5IMLB 4JFFA 5DHVA 3JBG7 2QSCH 5C0BA 3E3QC 2X4TB 3EO9H 4QOKD 1N8ZB 5FKPA 1ROWA 2A83A 1WZ1L 2YPLA 2J12B 1FG2A 5HDOA 1A6WL 4JVWA 3VXMB 5ANMA 2DJUA 4KMTL 3IJSA 3O4OB 4XMLH 4UINL 1BVLB 5GS3A 2YUWA 1CWVA 4MX7B 1KFAH 2O26U 1FBIL 2WWMD 2X05A 4Z76B 2I27N 1YECL 2GKIA 1JTPA 2XN9E 2D9CA 4XP1H 4HWBA 2P8LB 2QSVA 4CAGA 3UBXA 4OZHB 3NH7H 4GW1A 1BREA 1MLCB 3KPOB 1SQ2N 5JOPD 5B39B 5ID1A 1CGWA 2Y7QB 1F8TL 3GSXB 4TNWK 4IJ3B 5LCVH 1EMTH 3ILPB 1RUMH 3RNQA 2WIIB 3PDOA 4XB8A 2PXYC 5CZXD 5D2NE 5C0DA 2OJEA 4X6BA 1MWAH 3MXWL 5HBBA 4D8PA 4WNQB 4AMKL 5D7IA 4G9DA 4P2QD 1M7XA 4MJ6A 3JV6A 4CMMA 2ICWA 1JE6A 5EWIL 1D5ZB 1RIHL 4X4XA 5DVMA 4P9HC 2YA1A 1R5IB 1U3JA 4FNLH 3LB6C 4XP6L 5KSBE 3L9RA 2HP4A 4ODSH 2Q6WB 3C6LC 5IMKB 4G80A 1XGYL 3H6JA 4P23A 4GKNA 2X9XA 3BKMH 2J8UB 3MFGB 4P23D 1HILB 3OJDB 2EDHA 1N5YL 3MBEC 5INCB 1RZ7H 3MRIB 4YHOL 3V5KA 2O61A 4JG1L 2PYFB 2P43B 4WI5A 8FABA 2WWMC 4P5KB 3B9KB 3P4MA 3QXWA 3WHXA 1FFNA 3ZTNL 4WW1A 5EDXA 4S1QH 4O4YL 1DCLA 5KVMC 5LGKA 5ADOH 4Y4HD 4JRYD 2DYPD 2OTWB 3O6FC 1HQRA 4KKLD 5FYLH 2NR6C 4YHZH 3QO0A 5D9SB 4AT6B 3WD5L 2DDQL 3F7VB 3FFDB 1DUYB 1GGCH 4FP8H 1T1XB 5KVDH 5IK3A 1VDGA 3VI3F 4HUVB 3TZVB 2RGSA 4M1GL 1IC4H 2KQMA 1N6VA 5FCUH 2YXMA 2VKXA 4ZFZB 5LKNA 1NCAH 4X6CB 1IARB 3MLSH 4OD3H 2DQFB 3GBNL 5DJDA 1FNSH 3G6JE 2FEEI 5C9JB 1BQUA 1SM3L 3B9KD 3FHQA 4TOYL 1AI1L 4ZUSB 4NUJB 5L2JB 3ULVC 4CGTA 1FAKT 1BM3H 3ZE1F 1ED3B 4S10A 2PUQT 3AREA 1YNLL 3DXAE 4ODVH 4Z0BL 3ESUF 3WKNA 2WUCH 5AD0A 3GO1L 2X4NB 4DGVH 3WNNA 2JIXD 1RZJH 2VDOL 1V3LA 2R23B 3Q48A 1HILA 4QHNA 2EO1A 3GSNH 5F9AC 1MFEL 4KC3B 5IHZB 2BNUA 4EI5C 4Y16D 3UTTA 5ALCH 5F6IB 4E5XB 4XRCA 3KHOA 4XZUB 1I8IA 3PIQA 2YBRA 5IBLD 2G5BB 3CLEH 1Q38A 2EE6A 2Z31A 2FDBP 1CLZH 4MHHI 3I3BA 1JMZA 3BIKA 3FRUA 4F8QA 3L3IA 3SE9H 4LLDB 4JCLA 3NZHL 3S96A 3GNML 2BSSB 4UUJB 4Y2DC 3QDHA 1KJ2A 4PTUB 4N5UA 1DUYA 5E03A 3A6CL 1UB5B 1ZHKA 4EUPA 5TH2A 3O2DA 5I66A 3ALWA 1R24B 2CRMA 2A6IA 5AYUH 5IVXE 1IEHA 4I2XB 4M6AA 2VLKA 1C5BH 4ZD3H 1CIDA 4R4FH 5B39A 5ID1B 1MPAL 3CVHH 3DHMA 3ZZ1A 4EOWL 3NMEA 3VXRD 3B5GA 3HRZA 4N9OB 3B9DA 1G7IB 4QRPA 1C1EL 2YD4A 1NAMA 2FEDC 2QKIB 4HEME 2X4SB 1T5XB 5D7IB 3EJZC 4Z7VF 2J4WL 2VDNH 4MNQD 4PV9A 3W82A 1FQ9C 2CK0H 3V52L 5FO8A 2RB8A 3KAAA 2QLVB 4XWGH 4Y5XA 3MXVL 3ZDYE 4NQED 3X14B 4PJFE 2DLEA 1YMMB 4M7ZC 4K94H 1L7TL 3VGHA 5HGDB 3MRFB 3O6KH 4KJQD 4PJDE 1S8DB 1RJYB 2XPGB 4L1HA 4EI5A 3W39B 5KS9E 1P1ZA 3QCUH 2DQHH 1U0QA 4DZBA 3GJEB 4X4ZA 3UYRL 4XNUL 1Q0XH 4LQFH 1BLNB 1DBBH 5KZCD 3CVIH 2I9TA 5FF6A 5I9QB 1MAML 4P5TC 3KYKL 4ZUSA 2NY6C 4KVNH 5J9PB 4K2UH 5JOEA 5D5MF 5EZJA 4TSAH 5DFVD 3DRTA 3O9WD 1UVQB 4Y4FA 5ITFB 4IOIA 3JWDL 1AKJA 1U92B 1I1RA 4K7PL 2AJUL 3BHBA 4MAYB 4NRZA 1YEHH 4HH8A 1QLFA 3RJQB 3D18B 1RK0B 2YSSB 3C9NB 4GOSA 5ABDE 1A6ZA 2XWTA 3OXSA 4Y19E 2BVYA 4L9LB 4FFYL 1JGUL 4TUKL 4AM0B 5EBGA 4S1DD 3I6GA 1NAMH 5HHPB 3BUTA 4ZOBA 1FO0A 1QFHA 4ZXBA 1EEZA 5JOFA 4NO5A 1JN6A 5TE7H 2OP4L 1BF8A 4YFDB 4D2NA 2OI9B 4GKSA 3BP5B 4DCQA 4LARL 2SEBA 1K2DB 5DMJB 3GKWH 5DMIH 2E7LA 1WC7A 5TDOB 4HQQL 5IMKA 1LEGB 4JQXC 3S35L 1W0YT 5ADPH 3GHBL 3EHBD 4QXTA 3FT4B 1BAFL 1BFSA 3L3DA 1KT2B 2GCYB 4RSVA 1Y6NR 4J3WA 4P46A 1BFTA 3MV8B 2IMNA 3HNTL 2VLMD 4PG9B 4XBPB 3UROR 3MMEB 5DD6B 4LCUB 5DTFB 4H5SB 1MCCA 3REVA 3MBEB 3SDYH 4XP9H 1UA6L 5E8EA 4XH2A 1MUJB 2P1YA 4M4RA 1JUFA 2GY7B 4Q58C 5BS0B 5D1QC 5DD0L 4K3EH 3L1OL 5FUCE 5CCKL 3MMEA 3BD4A 3K74B 1XIWA 5MI0B 5JXAL 3QI9B 4E9LA 4E0RA 5FYLE 1CDUA 1U8QB 5FAAA 2CGRL 3CMGA 4L4TE 3Q6GH 5GIRA 1RMFH 3UPAA 1ZWIB 1S78D 4OCYL 4KH2A 4RGND 5GGQL 1QTYT 4JB9H 3KPRE 4G8GA 3TV3L 1ODAA 4EI5B 5CBAA 3GMMB 1NGQL 3BD3A 5CGYD 3BPOC 1QFWH 3T65A 5LGHH 1HSBA 1W0VA 5E8NA 5IMOB 1EBAA 3OKLB 2Z4QA 5GGTH 4OAWA 3Q6FB 3TGXA 4PJXB 2J5LC 3B9EA 1FFOA 1KTLB 1S78C 2J6EH 3KLAB 1GXEA 2BNQB 2AJSL 4KAQH 4MD5B 2XWBB 5T1DH 4EN3C 3GKZA 5A2KH 5ISZD 1U91A 3CFDA 5GGUA 4J3XA 1RVFL 3D0LB 1TJGH 4U1IA 1CVSC 1XF4B 4PJGE 4U6YB 1SYVA 2O93L 4Z8FL 5F9OL 2G5BA 4PGDA 5LGJA 3ARBC 5KOVC 1FIGL 1F4AA 4NN5C 5DTFA 3QQ3B 1U8HA 1AGCB 4OGAC 5T1MB 3UZEA 1KPRA 1D5XA 2WUBL 4L4TA 1R5VA 2XG5A 4J1UA 5ESVA 3VMNA 2QQLH 5TF0A 2X4OB 4YX2H 5HHME 3DURB 5EZJB 3O2DH 3PQYB 3T2QA 1F4YL 3BZEA 2XKUA 3QCVL 3ULVF 1TQCC 3O11B 5F3BA 2BOCB 1CN4A 2F54E 4NQCA 3CFCL 2GUOA 4YZFE 1UH3A 5CJQH 1CD1B 3RGVC 3QEUB 4LLVB 1OQXA 5KSAC 1W0WA 1NCCH 1F3JB 5FXCH 1N7MH 3O2WL 1IGYA 5ENWB 4H1LG 4OD1L 2NNAA 3HE7C 4DKAA 5KSVA 5C0EB 1FE8L 5GS2H 3HNVL 1QBML 5MEOA 4Q0XH 5HVGB 1BEYL 3QUKA 1YYMH 5IT2L 4XI5D 3FQUA 3TVMC 4F58L 2R2BB 5IQ7H 3L7FB 4ELMA 1F5WA 3OXRA 5JZ7D 4YWGH 4JDZA 5C0AE 3H7BA 3BW9B 2AKRA 3SGJC 1N59B 4RZCB 3FFCA 5T33H 2OYPA 2B1HL 3AMLA 3K2UL 4QOKB 2K9UA 1MI5E 3VFPA 2VH5H 3VFNA 2OR9H 3MYZA 4XVTH 4Z7QE 5I73C 1TITA 35C8H 3DRTB 4BK5A 5GGTA 3ULVL 3DVFA 5DQ9B 2XQBL 2C1OB 4JREB 5I15H 5E08H 3V0WL 4PR5A 3BZFB 3LIZH 1MCQA 1AXTH 5IR1A 1CK0H 2MCPL 3RDTC 4U6XA 1F45A 4YDIL 3OAYH 5JW5A 4GBXB 4KHTH 5BZWB 1JI2A 4WO4D 5B38B 4ZSOB 4JR9H 1FG9C 2PKDA 2ZCLL 4JFED 3EOAB 4Y4KB 2DB8A 1JNNL 1E4KC 4M02A 4MMXC 3U7AA 3QNZA 2YA0A 4G42B 5EU3A 4BFEA 1JGVL 1I3VA 1LEIA 2W0KA 5EPMB 1FGVL 4HSQA 5IESL 1U8KB 1JWMA 6FABH 4LAJH 1B3JA 3MRJB 5I6XC 1IGYB 1SMOA 2DQTL 2HT4D 1MRFL 1Z9LA 1UVQA 1KN4L 3ARZA 3QI9C 1YNKH 3MLWH 1DZBA 2VDRH 3L3IB 1KJVA 4JCMA 5GJTL 3E2HC 5F88A 3G9VA 4QHMA 5F6HJ 2EDXA 3T8XB 5CLTA 1DBJH 3MBED 4GUPB 1XH3B 3C9NA 2VMFA 3GEWB 3GHEL 4JM4H 3QUZB 3DXAD 2F8XC 5IMOA 4YNYA 2CSPA 4NQDA 4EI6B 3LVEA 4FXKB 1VGKB 5ISZE 3ZKNC 2A6JA 3BEVA 1JZ5A 4GRLB 3DNKA 3L5WA 1OP9A 4IM8A 4TPRL 2JKXA 3P73B 5IVXB 4AL8H 4UV4H 4W4OC 1D6VL 3IDJA 3OKNA 4WWKC 3MYJA 1NMBL 25C8L 4WI7A 5IB1A 1CZ8H 5EA0H 5GRVL 4KDVA 1J5OL 4F7MB 1ZGLP 4U2YA 4WW2B 1MNUL 4N0FA 3G6DH 1A1OA 2CKBB 4K3DH 5C08B 4O5LH 3WLBA 4HJ0D 3BQUC 5JDSA 4PV9B 2FB4H 3JTSB 5DDHB 4MZ2A 2BNRA 2NY0C 3RX5A 1OAZH 3OJDA 2J2ZA 1JFQH 3ARPA 1KULA 3LQMA 3WLWC 1K6QL 1HKLH 4JRXB 3IDGA 4OLWH 5J6GA 1B0WA 1QFWM 2GTZA 4XBEH 4D9QE 3DBXB 3GMMA 2P48B 1T0MA 2V7NB 3GUTA 2NZ9C 5D7SL 4L8DB 3G6AA 1YEEL 3DX7A 1ZT7B 5L88H 1SBSH 2MCG1 1GZPA 5C6WH 1JGLH 4PJAE 4QT5A 3HZVA 1EGJL 3NCFB 4X9GA 1RJLA 4PD4J 4PYGA 5DJ6A 3HPLA 1RULH 5SWZA 4X9BA 2PTVA 1KYOK 5KSUA 3G5ZA 1SYVB 4JVUA 4XC1L 2EDFA 2XTJE 4HWBL 4JFPA 1T2JA 3ILQC 5IJVB 4I0KA 1EEYB 2AI0L 1GPOL 5ETUB 2XT1B 2X4QA 3W11C 1NMAH 3HE6D 2Y7QA 3NIDF 3H7BB 5B38A 1T21A 1V8HA 4OCSH 5E99H 2E27L 4LCCB 1JHKL 3O45A 1XGQA 2P5EA 5D93C 2Q7NA 3Q5YA 2BNQE 4KV5E 4XRCB 5CP7A 1EJ6A 1IAIH 4Q9QH 1BZ7B 2BY1A 2GK0B 2CRYA 3GSNB 5EU3B 3FFCD 2AV7A 1J05A 5DQ9A 3GBLA 4XCEB 5J6HA 4ZPTB 3O6LH 2COQA 2BVPA 4CL7A 1J1PH 2LAAA 4LSUL 4WI6A 2V7HA 4GBXA 4Y16C 5I1LA 3N06B 3QEQB 2HJLA 3EDKA 4WRLA 4PRPB 4NOFA 4C4KO 3P0YL 4OTXL 1BFOA 1S7UA 3OPZL 5CP3A 4ONHB 5IMMA 1JPST 3L5JA 4RFOH 2ICEA 5MEQB 5CILL 4LDLB 1KB9J 5I1IL 2AK1L 3UPRB 3QUMA 1CL7L 2Z8SA 1MAKA 3FN3A 5DUML 1ORSA 1UM5H 2ID5A 2Z9TA 3TVMD 4NRYA 3RBSA 2F54B 4S2SB 3D85A 1NCTA 1RZ8B 2YPLB 3LRHA 1UWGL 2GTWB 4DN3L 2R56H 1CT8A 5HHOA 1IKNC 4A6YH 2OCFD 3UTSE 3ARED 3U0PA 4R0LB 3ARYA 4R90H 4YHNA 1TTUA 4H0HB 3PQYA 2NNAB 1LO5A 4ZS7L 4Z7WE 2QR0A 5DK2A 3RU8H 4LVHC 1AKJD 3JWOH 4XNQB 3MCKA 1JRHH 1FNAA 3O41A 1BQLH 1IBGL 3MUJA 5KSBF 1OCWL 3SE8H 4NO3A 1TNMA 5EU4A 1HHGA 5IW1B 4GS7C 3ARXA 4I0PD 3OJVC 2P5WB 4ZFGL 4PJGF 3KHQA 1ORQA 1KT2A 2GCYA 4RGMB 4LCYA 3MJ7B 3WFDH 3UO1H 2R2HB 4BZ1H 3NA9L 5I9QC 4ZFOA 5CMAB 1CYGA 1D9KB 1WQVT 2GAZA 5KZCB 1CE1H 2YN3A 1NDMB 3MCLH 2B2XL 1DANU 3QQ9C 2PTUA 3EYSL 2ATPA 2FLRT 3MLYL 1PGRB 1BD2B 1R3JB 2FBJH 1CLCA 1Q72L 5IW3A 4MXQC 1OARH 3C5ZA 4I5BB 2G5RA 4HKZA 1ZT4A 2V2WA 4QNPF 2OJZL 3SOBH 1U58B 1XGUA 5D5MA 4ZSOE 4C59B 4I0PC 3OAZH 5M94B 3MV11 1S3KH 2F53D 3EOAA 1Y0LB 4UT7L 2VUYA 5EIQA 5IB5B 2VDML 3HCVA 3TJEH 2J3SA 1XT5A 2IFFH 3JV5A 3VA6A 3WE6A 3EYUL 2BJML 1T1WB 1FC2D 2D9QB 4JEGB 1IKFH 4DAGL 4RAVA 5JW3H 5IP4A 3VWKC 1NKRA 3RUGE 3KNBB 3QAZC 1A4KA 3TBTB 1U8HB 4XP4H 4FQXD 3NCJL 4H8WL 3RIAK 5JIKA 1I8MB 5DQDL 4JRXD 3LN5B 4ETQB 5ICXB 1U92A 5L7XL 2VLJD 1UWXK 4JFZL 4LDEB 3QZWB 2VLJA 4OBRA 3E8UH 4X8JB 3QUXC 3GMNB 1XF2A 1UJ3B 1L9MA 5CINH 1E4XH 2GY5A 3QULB 3C08H 3S4SA 4MB5A 4FQHB 2WBWB 3C6SA 1S7VB 2GJZA 1QSEB 1F58L 1UXSB 3BUYB 3DUHA 3LQZB 4NHCL 3TNMA 1QEWB 3QZWA 2IPKB 3NIGE 3H9SE 2VDLH 4KK5D 1YYLL 5GSRA 4PRAA 4O51B 1BZ9A 3GMPB 1F4HA 4R7DA 5IQ9A 5EORH 4HFWB 2N7AA 1WCBA 2ZUSA 4YNYB 3RA7L 4EI6A 5CJXA 1HH6A 4Q9RL 4JQVC 4YBLB 3PNWB 3IAPA 1XCTA 1A6WH 5EC2B 4HMCA 3HI1A 1T5WA 4XMLL 5BZDB 4UINH 4DKDC 4PP2A 4QRUA 4X4MA 4P23C 5J56B 5HI5D 5EZIL 4HXAL 1FBIH 5FGCB 1F2XK 5GRXG 1BJMA 1NAKL 4PJ8D 2XA8L 3NH7L 4MB4A 2GYSA 3B83A 4GO6B 2M8XA 2Z8WC 5HHPA 3WYRA 1M1SA 2FGWL 4EI5D 2BXZA 4WV1B 3L7FA 1RHFA 5I17B 1GAFL 1EK3A 1L7IH 2J8OA 2QV2A 4S1RL 1MWAL 2RFXB 2VZTA 1C5DB 3LDBC 3MXWH 4X6FA 5FUZL 2OS7A 1ZLWK 1T0MB 2V7NA 4YHKH 4L5FH 1SY6A 4OZGB 3UTPD 4UNVA 1ACYH 5EWIH 1A02N 1HSAA 1RIHH 4NRZB 3U79A 1CXKA 4JJ5A 3TIEB 3VMPA 4U1SA 4KZDH 3JWOC 5DI8A 1EPFA 5EZLA 1G9NL 2DQUH 5I19H 1XCQB 4FNLL 4JM2D 3L95A 5TQ0H 4NCC1 4F33B 3FO9B 1YY9D 4HIJB 4E42B 4HKXB 4P0DA 1QSFE 1XGYH 4PGBA 4QRRE 3FB6B 5F70A 2F74B 5CMAA 1BZ7A 2GK0A 3D9AL 3VXSD 2OK0L 1KLFA 2VQUA 5EC2A 5D7IE 1TQBC 3HRPA 1S9YA 1FO0L 2CLZA 5HJ3B 5JTWA 2F53A 1U8LA 1KUMA 2NLJB 4LSQH 4TYUA 4J3OC 4JQIL 4FXKA 4IRZL 5D7JC 2VWEC 5HXMA 5EOQL 1U58A 2IALB 1LGVA 3GK8L 5GZND 2EDKA 4TULH 3TPUA 4YHZL 3WNLA 2DDQH 3X12A 4FP8L 1LP9E 4X99B 1PBYA 4CJ0A 4M1GH 2JJTA 5EH1A 1BF2A 3HLAB 5J89A 5T3XD 3Q3GA 4XXCA 4OD3L 4LHJB 1ZSDB 3IDXH 2KZWA 3RIAF 3P9MA 1FNSL 2X10A 5F8RC 3ULSA 2OLDA 4JREC 2V9TA 1D5BA 1SM3H 2LV4A 4O2CB 1PZ5A 2VLLA 1NEZG 1Q9WB 3REWA 1A2YA 4TVPL 4EN3A 1SBBA 4K3JH 1S5HA 3E6HA 2GJ6A 5C3TA 5I8CA 4KQ3L 4E0RB 2NX5E 3ES6A 3S4SB 1VFAA 4Z0BH 3SKOB 4Z0XA 5DFWH 2VDOH 2JF1A 3D0VB 4UTAL 4OCRL 2ZWLT 3GSNL 4LLWA 4H1LH 4S1SH 2BY3A 3JV6B 4M7JL 2H2PD 3FRPG 3OKMA 4L29A 3SDXF 3V6ZA 2CDGA 3LS4H 2VLRB 4JHAL 4ZUTA 3VFGH 4M48L 1RFDH 5CZKA 4ZTPH 3VFPB 1I1AB 2AXFB 4HK0A 1J0KA 1KTRL 4LNVA 4WHDA 3FQTA 1I7ZB 1IC7L 3RIFK 2AV1B 2WMPA 4FZEH 4QTIH 2UWEA 1A9EA 5HPOA 2NY3D 2I24N 2VE6B 2J7LA 4E41B 4XNYH 4X80L 3G5XB 3A6CH 1EO8H 3BP7B 4QY8A 3QUKB 3SGKA 1WJ3A 1M71A 3TJHC 4KUZH 5AYUL 5HGBA 5D7LB 2PW2B 2IANB 4MJ5B 2X9WA 2DQIL 1I1FA 4ZD3L 4NHUA 1MJUL 3WN5B 1U2HA 4YDLB 3L95B 4F33A 3CVHL 4QRTA 2BVOB 3QIUC 4EOWH 3RVUD 4CVXB 1P53A 4FQCH 1NSNH 5DZOA 4HMEA 1FZJB 2MMXA 4IIQB 4G6AC 4M6OH 1IGIL 1A7PL 5TGBB 3L7EA 4PJFB 3ETBF 3D0VA 4CVZB 4NZUH 1KEML 3MRRA 1WFNA 2Q3ZA 2YWZA 4YZFF 2Q7YA 4IRJC 4N8PA 5HYQB 5DHYA 1KPRB 2YUVA 4L4TB 4MAYC 5DK0A 1UKQA 3B9AA 3WHE0 5I8KL 1P4LB 1IFHL 2D31B 4W6XB 4ZPTA 2IH3A 1EHXA 4Y4FB 1FL5B 4X0KB 3SO3C 3ZHLA 3WBDA 3RWHA 2IGFL 5T1KB 1NFDB 5IVZB 5E6ID 1E28A 2HT3C 2X70B 5E24E 4HIXH 4LAQL 4LSSH 4ODHL 3OHXB 2ITDA 5EOCJ 2F5AH 2FRGP 2DS4A 3FOLB 5GJSL 4OQTL 3GGWB 4N8VA 1R5IA 3KS0J 3UYRH 1TJIL 4P59H 3RVWD 3AXLB 4XZUA 3CVIL 1IC1A 4FN0A 4MQ7A 3KYKH 4HUVA 3NIDE 4MA1B 2EEDA 5JMRA 3K7UA 4XVSL 4U4BA 3GRWH 2VAAA 2YEZB 4M1DL 4LVNB 5TQ2H 5KBNC 3JVGA 3IFLH 4Z5RB 2FH6A 3DMMD 1CD0A 4ZTOH 5IB2B 2JB5H 3PDGA 1BHGA 3QJFB 1NCDL 1I1YA 3V6OE 4C56A 4PGEA 1FYTE 4XWOC 1NBZA 3E1F1 4P46D 3WHXB 4PRIE 5EUOE 4LBEB 2HN7B 4Y19B 4LKCB 5DRNA 1MCJA 3W81A 4DGIH 5GZOD 3QIBD 5INCA 3SBWA 4PJFF 5A1AA 3ZE0F 3RX8A 4OKVB 4FFYH 3O0RH 4TUKH 3LQAL 4L3EA 4N0CC 1D6EA 3CX5J 2N7BA 5GRUH 2NLJA 1OW0A 5E4EC 3ZDZF 4KU1A 4ZPVA 2VSDA 2BHYA 1P7QA 3K4DA 5F9WB 1S9XA 2EDDA 2WK2A 4PRHD 5HSFA 4G7YL 1D5MA 1LD9B 2FX7L 1J8HA 1X44A 4Z7OF 4LARH 2R8SL 5IUSA 3GKWL 5DMIL 1KIRB 5E6ZA 1MCWM 3RVXC 1A6VL 4C55A 3T09A 4OUOA 2YD9A 4NM8L 5CUSL 4UBDD 4FQ1L 1A0QL 4XP5H 3BEVB 3STZB 1DJSA 4X5WA 4LGSB 1J05B 1MY5A 2A38A 4JQXA 4JFDE 3LKNA 3GSXA 3BW9A 3STBA 5EBLB 2CLZB 4U1MA 4PJ8A 2JK5A 4YQXH 4H8WC 4M4PA 1AQDB 3O9WC 4XP9L 1V3JA 3BH9B 3EW3B 3HR6A 4K8RL 3WS3A 2FEDD 4JO4L 3FOMB 1KLUB 2HMIC 3FO0L 3IDIA 5DJCA 5CCKH 2B7DT 3BZFA 1EUUA 3GSWB 2ZOLB 3HG1B 3BISA 4GQ9H 2CGRH 5F7KC 3BP4A 1KLGB 1NFDF 3R1GL 4JB9L 3TA3A 1IE5A 1F6AB 5K93A 4MDIB 3MJ8B 3I6KB 4JFOB 4CN4A 4XNZB 3EGSB 5GS2D 4CRPA 1QSEA 4F7PA 3MSPA 5LGHL 5JO5A 1QSED 1PG7W 3IYLW 1G7LB 1RUPL 2DQJL 1EXUA 4FFWD 2DYPA 5HHNB 3C09C 1OW0C 4TTDD 2J6EL 4NQDE 1HSBB 1W0VB 5E8NB 1WCBB 2AJSH 3MJ8A 3I6LD 3HC0A 3ZL4H 5T1LB 3T2PA 1TJGL 2OTWA 4WEBL 1NUGA 4KRMB 4NHUB 3QUZD 3OKKA 3S35X 2VR5A 1LILA 5D6DC 1VACA 1HHKA 5F7DB 2EXWD 4YEFA 5MERB 4JFXB 4UZGA 5AUMA 2C4FT 1IMHC 4AEHL 1G6RH 4X6EA 4PRHE 1E4XI 2PXYD 4WJ5B 1V3MA 2PNDA 5HHXH 3I50H 2VXVH 1T2QH 4HBCL 1WV7T 1MCDA 5SWSD 2DWEA 3RDTB 4F9LC 2XXCB 3QHFH 4MXQD 1PX4A 3RZWA 5DMGC 5F21B 1DBAH 3PGDA 5IGXL 3QEQD 3AY4C 1CG9A 3VDCA 1HIML 1FAIL 2B1AH 3IXAA 3NAAL 4Z7VE 5D96B 3VXOB 5BV7L 4PR5B 5HVHC 4F7PB 2APVA 4WHTB 2EH7L 1CFVH 4CVXA 2IH1B 1CFSA 3MJ7A 1VADB 2ESVB 5IVOA 2JTDA 5DVNA 4PLOB 1FFOB 1KTLA 1U8NA 2APBA 4LU5L 4RISH 1UQSB 2IANA 3DTXB 2YUXA 4L1DA 3H9HB 1CFNB 4EEEA 4P2QE 2B1HH 1CU4H 4G8GB 4QF1A 5GSRB 2VZUA 1TXKA 1HYSC 4BZ2H 2W65A 4RNRB 3SDXB 1SJXA 2OR9L 2Y07L 3NZ8A 4LNRA 1I7RB 3L5XH 3QIWC 1IRAY 4PJ8C 3S6CA 2D7MA 1AY1L 4Z7UE 3RVWC 2XQBH 2PYEB 2IBZY 3P9LA 1FYTA 1MF2L 3LIZL 1I9IL 2R0KH 4PJ5D 1GGBL 3TM6A 4LKXB 4JM2F 3VFRA 3MLRL 1OWRM 4Y4FC 1K5NB 1R3HB 3QXAA 3GM0A 3UC0H 1ZVHA 1JPFB 1U3HA 2W0FB 2CPCA 4JR9L 4WW2C 3O11A 4M93C 1UM6L 4WWKB 2XRAH 3G6JF 5BMFL 4OGYL 3QIUA 4GLRH 1FGVH 1FYHB 1P6FA 5IESH 4DZ8B 3AC0A 5TFSL 4OF6A 5L9DH 4YE4L 2FJGA 1TZHA 1MRFH 3QWOA 4JO3L 2IQAB 1NDGB 4OZIA 5MEOB 5CD5C 3CDCA 1SY6H 4WI3A 2VDRL 3ZHDA 2K1MA 1QUNA 3OWEA 4R3SB 3KYOA 5HVWA 4HV8A 4L4JA 4UT6H 4P2OA 2VB5A 2LVCA 5ACMA 5BV7B 3LKRA 2W38A 2Q86A 4PUBH 5IHUL 2HRLA 2DRUA 4YC2B 3QRGH 1UCTA 4B0MM 4X6DA 2E8ZA 1YEIL 4L4VB 4WFFD 3G5YB 4MNGB 2PR4H 5T5NF 4HPOH 4DN4H 4LIQL 2B5IC 4R4BA 3B2UC 5LBSL 6CGTA 5GGVH 4C56B 3EOYG 3GIVA 2VZVA 1F4XL 5DEZA 2ZG3A 1ZS8B 4UBDC 1F13A 3TBVB 4TPRH 3ZKMC 4RFNB 4U3HA 4AL8L 4NO0A 5SWZE 3TBWB 3T1FA 1I1AD 2YWYA 2AV7B 1NMBH 25C8H 2DLHA 3UTPE 4NUGL 4NWTL 2DI8A 4K7FA 1J5OH 4KVCH 3VGAC 3PGFL 1MNUH 4YBLC 1UB6B 1OSZA 3MGTB 2CR3A 3EO1A 2NCMA 2G60L 3QDJB 3WIIL 5I75B 4P3WA 4HHAA 1M71B 1NFKA 3S3PA 3CK0L 1OAZL 3BT2H 4MD5A 3I6KA 3WFBH 1J86A 4JFQA 1K8DB 4XCCH 4OLWL 3PV7A 1IQWH 5C0FB 1FL3A 1QQDB 1IZJA 2I9TB 2A0LC 2JK5B 4PJHF 2VITA 3GSOB 5JXEA 1IAMA 1JF6A 5DS8A 3HE6A 2AS5M 1SBSL 1F4WL 5J57B 3GSNA 4IJ3C 4MLSA 3VXUE 1GGYA 3RNQB 4Y16B 3CFBA 1E6OL 4HZLA 2ZSWA 4L8BA 1MHHA 4G8IA 1TZGL 3NZ8B 1CDBA 3LQZA 3C5SB 5DEFB 1V3KA 3LKPA 3L3JA 1JCKA 4YXKL 4NT6B 3QAZB 4HWBH 3UZVB 3EO0A 3BXNA 2AI0H 4HGKC 3HZKB 1KJMB 4UQ3B 3ES6B 4BQ8A 2NX5A 1MCWW 5JNYB 5JORB 2X4NA 4UOW1 5FV1L 4EVNB 2X1XR 3MOBL 4PB0H 4UDTB 4L8SB 3VD3A 4JN2B 2Q8BL 1IAIL 4XX1E 3O81A 4Y5VC 5DF0A 3AVEA 3AU1A 2K7PA 3R4DA 4JFHD 3QIWA 1CLOH 1QOKA 1UJTA 4S2SA 3K2MC 4NBXB 1LK2B 4IRSA 5JO5B 3WEXA 5D5ME 1WIUA 4JZNB 5I2IB 4G43A 4NN7C 3QNXB 3WIHL 1AHWA 2R1YB 3P0YH 5ICYB 3U4AA 3VXMD 5L0QB 2XN9A 4MLIA 4X7DC 3LHPH 3KPMB 3IJYA 4U6TA 4NKMB 5JLZA 2AQ3A 4KJWC 4NNXA 5I1IH 4JHWL 2AK1H 3IDNA 1P4IH 4JZNA 3HPLB 4IOSD 1CL7H 2F53E 5DUMH 1TZHB 4FMKA 5KW9H 3ARGB 3U1SH 5D72H 1IQDA 3DSNA 3IS1X 5JW5B 2BSTA 3FQNA 4M61A 4ZDHB 4HWNA 4HWZA 3UCRA 1CD8A 1ZLUK 3PWVA 3C8DA 2XYCA 1T5XA 3MV8E 4NNXB 4WU5B 1XF3B 2AK4A 4A6YL 4Y2DA 1UKSA 1J1OL 4X6DE 1MFNA 3QNZB 1XZ0A 3SN6N 2DMKA 3BVNA 2Z92A 4ZS7H 1JF1B 1QNZH 2HKHH 3ZDZE 4JHZA 1J18A 4JFDB 4AZ8A 3N1GC 1DP0A 4ZDHA 5GGSB 4AH2A 2VL4A 4TSCH 3BH8A 1BGXH 1R3KA 4RMWA 4PLJD 1CFBA 5JXED 1N8ZA 1MQKL 2JELH 2NZ9D 5I66B 1B90A 1E28B 5T3ZD 2ADJB 4ODTL 4WNQA 2LVEA 3CSPA 2ATKB 1GHFL 3HC3H 1MEXL 5TDPB 2FLBT 2B4CL 1JIBA 5ID0B 2XI9A 1V05A 2B2XH 1A5FH 1X5ZA 1GH7A 3DUSA 4P46C 2AJVL 2DLGA 4NKIL 4JHBA 4ELMF 1RUAL 2EC8A 4PJHB 4LSTH 4JZJC 3RHWK 4PJBB 2XQYK 2GK2A 5AEAA 1A3LH 4NT6A 2W9DH 3UDWC 1DQDL 1MCSA 1NFIA 1OAQL 2WLYA 3QA3A 3HPJB 3IRZA 4OLXL 4LHUG 3AREB 3UJJL 2ZUVA 3QIBB 2B20A 1MFCH 2P5EE 1PEZA 2VKWA 2VIRB 1LDSA 2OX5A 3MYJB 4BFGA 4DW2L 3G5XA 4L9LC 5FGBC 5C6TH 2GQHA 3L3JB 3LSOA 5HYSB 2AAVA 4PJ9D 2YBRB 4JFZH 3AB0B 1D7FA 3S97C 5L8LB 4OI9A 2OTUB 1B0GB 4XC3L 4HK0B 1ITCA 1DQQB 4OB5L 5A16B 1CBVH 2FEEL 4K71C 3C08L 4WI4A 5EU7C 5SV4A 4G5ZL 4U1LB 3U46A 3MLTA 2PYEE 4D0BA 4MA8H 1FH5H 3QWRA 4NHCH 4Z7VA 3DARA 1XR8B 5ITFA 2VDLL 3H42H 2BDNL 3K46A 2LAGB 3DGGA 4JDVA 4V2BA 5FYKD 1UYWL 4HKBB 3KR3H 5E5MA 5EORL 3RA7H 1U42A 2OZ4H 4JZJA 2XTJD 3QFDA 2FSEA 2W59A 1E0OB 4PJXE 5B4MC 4PJIE 2ICCA 2CRZA 4I77H 3LAFA 1NC4B 1D9KD 5DD1L 2OXGA 2R4RH 4PJIA 4YPGB 4IRJA 2C7UB 2F15A 1MUJA 2BVEA 5EZIH 2WQRA 1NBVL 5JIIA 4GRWF 4NCDA 2YC1A 4WFEE 2AEIT 4XGZB 4GSDH 1WWAX 3GSWA 2XA8H 1EVTC 3HC4L 4I48A 3V7AE 4JJHA 2FGWH 4YBQD 4WI2A 4CNIB 3HA0A 2EYSA 5E56A 4GW1B 4XNXH 4BH8B 3U6RA 1JGDA 5EIIA 1L7IL 1LO3L 3P0GB 1A21A 1JTOA 3EIFA 1H3PL 3ROLB 4OFKA 2P24B 4JE4B 5FUZH 3RL1B 4OLUL 4U1GC 5ESVB 4YHKL 5D7LE 1K4CA 5CEZE 3E0GA 1NGXB 5FDWB 1YN6A 1KIUA 3PP4H 1NGYA 4OF5A 1YPZF 3HZKA 3T3MF 5MENA 2FIKA 1JNJA 1DQMH 3X13B 4XMPH 2OXHA 5ICZB 5I19L 5I1JL 3A6BH 3EFDL 2GAZB 3X12B 1N5AB 3PE9A 1A1NA 3SKMB 1AQDA 1BQHG 1T0NA 1W2KT 4BSVB 3BI9X 5I6XB 5DJ2B 3SO3B 3VRLE 4PJBF 5SX5K 5K59E 4V2CB 2BZDA 2Z93A 2OJEB 3MV7B 3DUSB 2IPTH 4F7MA 1FO0H 4LCUA 2O5ZH 4O58L 3RWCA 4LSQL 3D87B 5C0CD 3LMJL 4NJAH 4JQIH 1ZEAL 4Y4FD 1JHLH 3V95A 3I2CL 4P99A 2XOTA 4GRMB 4U3XA 3MRNB 1AGBA 3HPJA 1G9ML 4LCYB 5I74B 5GS0D 4TULL 3U7YH 1I8IB 4HLJA 2CMRL 5DURB 1WWWX 1XCTB 2R69H 5DZNA 3VXQB 4MXWL 5I16A 4RX4A 4J3TA 1X4XA 2IEPA 3GJEA 3O6ML 1R3IL 4NBYB 2ZUTA 5KVGH 5DSCB 4K7FB 2FBOJ 5AZEL 1AFVH 4FQLH 3MR9B 3SKJH 4NO5B 1J8HE 3TN0C 2FR4B 4JN1H 5D1ZB 1EHNA 4DFIA 3HC0B 1CQYA 1PG7H 3D3VE 2ATKA 4NNPH 3BH9A 3ZE0E 1B4JL 5DVKA 5J1TC 3HMWH 4HIEA 4NQEA 1H15B 4K3JL 4K9EC 1Y18B 4BSWA 5DMGD 2ZSVA 4J1UB 1I9JL 4GRWE 5F7DA 1JWUB 1YC7A 2WSKA 2IAMB 4DTGL 3FJTA 3CUPB 4GLRI 4N0CD 4EBQL 4AG4H 3PHOB 3JV4B 4KQ4H 4P3DA 2B0SH 1WAAF 1FNHA 5I30H 4S1SL 4X6EB 3ARFC 3MREB 1DBML 1OD7A 1H8NA 3CDFA 2Z91B 4ZFOL 2H6PA 2ADGB 4Q9CA 2X44D 3T2NL 2JCCB 1A1MB 1FZMB 1I4FB 5F89A 5J9PA 1KLUA 3C2AL 4QXUL 1K9TA 3V5DA 2BSRA 3M1BB 3HI5H 4ZG1A 1A9BB 1HI6A 3FN0L 3MRHA 5D70H 1IEBA 4YHMH 2ED7A 1KCVL 3X11A 3X3GL 3GGWA 3EAKA 1UACH 4FABH 1QP1A 2IBBA 4KJPC 2EIBA 3LSOB 5FO7A 4YH6A 1U95A 3TFKD 4PJHE 4ZXBD 1ZOXA 1LO2L 4XNYL 1F6AA 4X80H 1YEKH 2DBLL 3VD9A 5IG7B 4WTXA 2W07A 3PHQB 2E9IA 4I3SL 4IDJL 1B0RA 3UP1A 4CDGC 3L3GA 1INDH 1KJ2B 5C0RH 3QWOB 1RHHB 5F1IB 2EIZA 3DVGA 4H0IA 4XXCC 2DQIH 1PY9A 1G7LA 1MJUH 3C8HA 3L9RB 3ZYOA 3DI3B 2FHCA 1CICC 3LPGA 4OCXL 3MNWA 4PJDB 1ZHBA 3GSQA 1ACZA 1AH1A 2DQDH 4XTRD 3SQBA 5C0ND 5SWQA 4JRXA 1BVZA 4GXVH 1AHWC 1DEDA 1PX3A 2EICA 3EDEA 5ISZA 2VWEE 3RNKA 5I1GH 2R0LL 3TYFA 3FB7B 1IC5H 1SJHA 3Q5TA 2VQ1A 3KPPB 5I8KH 1IFHH 1HQ4A 1C7TA 4P9ML 3IS0X 2EXYD 3UTQA 2QADC 1D5MB 3VFWB 2YSSA 1XF1A 2BP3A 2P5WA 2WBJD 2QSQA 3C60C 1A7RH 1JPTH 2ADIA 1U41A 2OTPA 5CSGA 3U2SB 1V7MH 1TMCB 4R4NC 2W91A 2ZUQC 2P46B 1LP9A 1VFAB 3SKOA 3QDJA 1I9RH 1EV2E 5I73B 3S88L 4OQTH 4U0RC 3LB6D 5ANMB 5CWSB 1IGCL 3WIFB 2HRPH 1ZGLB 3EZJB 1TJIH 4HK3N 5CHNA 3ROLA 2HKFH 4PBWD 3WKML 2C3WA 3TBTA 4PGJA 5I76B 5D6CB 4N0UE 1N0LA 4POZC 3A67H 3NCYS 1BLNA 3GRWL 3IF1B 4FMFA 1H3UA 2DTSA 4M1DH 4Y4HA 5TQ2L 1T3FB 4OF3A 1BFOB 3PHSA 3LS5L 5J7CC 3S36L 5IOPB 5CD3A 4O2EB 1MWAB 2DQFA 3QDMA 5DYOB 5EN2A 5BS0E 4GMSH 4JY5H 4TQEH 3WDHA 1KJ2L 5GS0C 4LFHG 1NCDH 3D69B 5J6HB 2H2PC 1S7XA 1YMHA 3P30L 4KFZC 3UPRA 3TN0B 3RUGB 1WFTA 3DROA 3MA7A 3VFNB 3VGGA 2DD8L 1XGRA 4DGIL 3ALPA 2F58H 2CIIB 1CFQA 3IFOB 1JGEA 4PG2C 3O0RL 4U1JB 3QHZH 4ALAH 1K4DA 2G9HB 5JHDB 4DK6A 1YDPA 1ZVSB 4OJFH 4Z77A 4NO0D 2EH8H 2VZ3A 2RQ8A 3TT3L 2AQ2A 3TT1H 1FZJA 5E1AB 5I71B 5IB3B 3PHQA 2HLFC 2PCPB 3B4NA 2XZAL 3KJ4C 1VSCA 2EDOA 4RMRA 2Q86B 2R8SH 5GGRB 1CGSH 1AO7B 5DD3L 5FYJD 4LLQB 2PO6A 1B6UA 3UTZB 4HEPG 3I3DA 1A6VH 3OBAA 2X1OA 4V1DB 3M17B 4RGNC 3T0EA 1IAII 1HI6B 2DMCA 1N59A 4RZCA 4KDTC 2VXTH 2X2YA 5D96C 2G2RA 4LF3B 1M6OA 1T3FA 4AEEA 5E8PB 5DJ8B 5F7YC 4P9HL 4O9HH 4OZHF 4YQXL 2BMKB 3SGEI 3U4BH 4OKDA 2UVEA 5KVFH 1HWGB 5D7JA 1R3JA 5T3ZE 4LSRH 3W2DL 1PKOA 1JWSA 4K8RH 4LRNL 4MAYD 4PJGB 2XNAB 1QSFA 3FTGB 5BXFB 5JW4M 4QRPB 4Y1AA 1KNOA 4QTHB 5SWSE 4EVNA 1H3TA 3ECBA 1MVUB 5DJZB 1S7QB 1JV5A 2JJSA 1L0QA 5C2BL 3KPRD 2CLVB 3U82B 1TVBA 5F7WC 1BFVL 3S34L 3QXDB 3DUUB 3KPLB 2DLFH 5ETUA 4XHJC 4CU8A 2H6PB 5K9QI 1MFDH 4RRPA 3LKSA 1J87A 1NLDH 5GGSA 3BE1H 3S37X 3QEQA 3U7WH 2RFXA 1LE9A 3NIGF 2VOTA 1F3RB 1NGZA 5C0GA 1MVUA 1H3VA 3LEYH 4PTTB 4QRRB 2Q8AH 2RR3A 3VXTA 3RWJA 5CEYA 1RUPH 1M05B 1TPXC 1SEQL 1H5BA 4QXWA 4FZ8L 3ZL4L 4PY8I 2XA3A 4RIRA 1FNFA 2PF6A 4R26H 1NL0H 3QUXB 1KB5A 4ONOA 1RJZA 4WEBH 1N6QL 5C2UB 1NUNB 3HTLX 4MNQE 2FL5A 3VXOA 4OLVH 4QYOB 2I5YL 2ADGA 5ESAA 3D39A 4LRIC 3OKKB 3CFEA 3WFEL 1EVUA 4HT1L 3RWDB 1T1ZB 1JYVA 3C6LA 4PGDB 1U2CA 1FGNH 4PY7A 1DEEB 3VW3L 4P3DB 3PXHA 4Y2DB 2UUDK 3SCMC 2J88H 5FK9B 5F97E 4XBPA 2I9LA 4YC2C 5HHXL 3I50L 3O2VH 1T2QL 3RBGA 2A74B 4KTDH 1DLHB 2R0ZH 3FRUB 3MA9L 3CH1A 1SJHB 3RKDD 1MJJA 3ZE1E 3LEXA 1A9BA 3RGVB 4NQSB 2FX8L 1O7SA 1DBAL 3KDMB 3U83A 4ZAKA 2R9HD 5BV7H 5E6YA 4F9PC 2F5BL 4Z95H 3DXAA 4K71B 3V0VB 2EH7H 1CFVL 3VXTB 3KPNA 4A2LA 1FSKC 2NYYC 4KJYB 5A3ID 1U8JA 2OTUA 4L4VE 5JOFB 4LU5H 2XICA 3TBYA 1G1YA 2OM5A 3QHTC 3AS3A 3DLQR 4MD4A 5CZXC 3VXUD 5C09D 5DT1H 4Y7MA 5BO1H 1CU4L 3G5ZB 3O6FB 3KPMA 4BZ2L 3BQUA 4HC1H 5E2VL 4L9DA 4XH2B 3E6FB 3VWKD 2ZG2A 3L5XL 3MLVL 3BEWB 5EO0A 1PYWA 1AY1H 5IVNA 2AK4D 3ZLQC 1P2CA 1F3JA 4MXVF 4MCZB 5DD6A 3MUGA 4LCWA 1QD0A 5CBEA 3OKYA 1Z3GH 2EDNA 3DX7B 4TSBH 3KYMA 1YEDB 4LF3A 2MHAB 3IDYB 3DUUA 4I0CC 1I1AC 4HKBA 4ZO9A 3UC0L 3SDAB 3K8MA 4X8JA 1QBLL 3GI9H 3QR2A 1JBJA 1ZA6A 5TPWH 4P5KA 1YQVL 3JV0A 5BMFH 3SKNA 3CJJA 3EHBC 4R8WL 1VGEH 5EUOF 2VDPH 4GKZB 1YNTB 1WVZA 1EFXB 3BHBB 4JO3H 2PXYB 3D25A 4MAYA 4LLYB 2W0LA 3PGCB 3SY0A 4WFFE 3MUY1 4JPIA 3TVMB 1U8OB 1SY6L 3LEVH 3INUL 3OX8A 3UBXB 3FFCE 5IBUG 4FQIH 4Q9BA 1P7QD 3RTQD 3DGGB 3A6OA 4NP4H 4S1DC 4D9LL 5SV3A 3DOSA 4JLRA 1FRGL 3RVVD 2QBWA 3QRGL 4MNGE 1OP3K 2EDQA 4Q6IC 2CUIA 1AGCA 2PR4L 1QLRB 1YN7A 4LIQH 5CAYB 4FTVE 5GGVL 2Q1EA 4XCEA 2ZOLA 4D8PB 4UB0L 1FVCA 4UU9A 3EDDA 1A1NB 5CJBA 1QVOB 2GJJA 4IRJB 1AR1D 4W6WB 5F96H 4HWZB 3V6OA 1MIML 1S9WB 2NMSA 1PG7X 3OB8A 1NJ9B 4WU5A 2VQTA 1HHIB 3MRDA 3X13A 4C56D 3TCXA 1A47A 5I1AB 4NUGH 4JM2B 4NWTH 5HDBE 4KVCL 1MJJB 3PGFH 3WJJC 1YA5A 1DDHB 3K4ZA 4HJJL 1KCRH 5IFJA 3WDJA 4XHJD 5DJYB 1QR1A 3CK0H 3MQIA 3PABA 3BKCH 1OY3B 4L8SC 1XR8A 2ARJQ 1I3RB 3OB0H 3HE6C 3RVTD 5LAXB 4D9QD 4XCCL 1ZLWH 1OF2B 1WICA 1PQZB 2RHEA 2WAHA 1DBKH 3IU4H 3GMLA 3OSKA 4F7CB 2X4SA 1Z6JT 5F7MC 1MCFA 4DVRL 4OZIB 5FHBL 4IMLA 2E6QA 3UXFA 1RZKL 1B88A 4IRJD 4JANA 3A0OA 5I1CL 2UZXB 4IHOB 3GBML 2YN5A 4NPYB 4CW1B 4GRMA 5DJAA 2V17L 1ZT7A 1ITBB 1YJDC 5HHQB 5AZ2H 3ARBD 1TZGH 4HJGA 1NEZB 3RNKB 5JUEH 2HVKB 5ITBH 4YXKH 5GS0H 3M8OH 1C16A 3DIFB 2H8PB 1E4KA 2AKRB 3MR9A 2BNRB 1CR9H 5CEZD 3QT2A 1YPZE 1IGTB 2P7TA 3IU3B 1OAXH 1NC2B 4K3HA 4M7LH 4NYLA 3MACH 5D2LA 3OR7A 5FA4B 2KUTA 4PB0L 2WWKT 2UZIL 5F1KC 1U91B 2DAVA 3SKUD 1FLTX 2Q8BH 1FLRL 3LN4B 4YDJB 4YIQB 4PP1C 1OAUH 4H88H 4MDJB 1ZT4B 3ARVA 2MPAL 1K5NA 1MFAH 5FYJL 5KJRL 5IV2A 2PXYA 3D25B 4HIHA 2X5PA 4KKBD 2N4IA 2QQNL 4NWUL 1KXQE 1EIBA 4PJCB 2IG2H 4XCFL 2FZ3B 3V4VH 1AGEA 1Q9LB 1I7UA 4RAUA 4ORGA 2DQGH 1RI8A 1FPTH 3BKJL 2BSRB 4UIKH 3OKDB 4TTDC 5C3LD 5B3JF 4LSVH 2XY1A 5EBWB 1WBXB 2NY2B 3UJTL 3BPLB 3N1PC 5D93B 1NGYB 3PXJA 2JJVA 4P2QA 4X6CA 3WUWG 4JPWL 3UTZA 2AJXH 3OKOA 3PJSB 4D3CH 3SDCD 1FCCA 2RCSL 4G8GD 4ZUTB 1Z9OA 2BRRL 1J1OH 1MI5D 5TGBA 1KN2L 4YK4C 3K8LA 3MV8A 1S7VA 3OR6A 4ZO7A 5IBUB 5D1QA 3FT2A 1QNZL 3QO1B 5JOPE 4NZTH 4TUOB 4OCMC 3B3IB 3LZFH 1BGXL 1LO0L 2OR7A 4PFEA 5LQBH 2R15A 2VXSL 4U0QB 2JELL 3B43A 3PWPA 1G0YR 3OKMB 4PREA 2YPVH 1WT5C 4RGMC 3V0VA 1KEGL 1U8QA 4P2RB 1UZ8A 5KTEL 1BVKB 1FO0B 1YEGH 1GHFH 4G6FD 3HC3L 3HZVB 1MEXH 5A40E 3TBYB 4PRNB 4OQ1A 1XGPB 5DO2C 4YFEA 1VKXB 1DSFL 2YK1H 8FABB 1RUAH 5I71C 1UEYA 4L3EB 2DQCL 3RJDA 5I76A 4G8FA 1W72H 4KPHH 1A3LL 1VFUA 2E7HA 3HI6H 2W9DL 5BOPA 4KROD 1DQDH 5EU6E 2VUOA 3LH2H 5CWSA 4X7CC 3JXAA 4NFBA 3CPLA 1K85A 3S7GA 1TVHB 4ZAKD 4IMKC 5HHVH 1QO3B 4B7IA 1UH4A 1Y0LA 1HKFA 3O4LE 5F1SA 4Z0XB 3AROA 5IB5A 1KV3A 2MHAA 4ZYKB 2CIKA 1EEYA 3P40A 1IT9H 4IOFC 1S7TB 3V7MA 1VFMA 4FXLA 4MJ2A 3BPCB 2ZCKH 3CFEB 3O4LD 4P2OC 2W65B 4RNRA 1LP9F 3KPQB 4HFUL 3WSQL 1J0HA 1K4CB 5FOBB 4L8SA 2HH0H 3S5LA 43C9A 1NCNA 4M6ML 3NPZB 3U30B 3DPBA 2A74A 1FDLH 3ESVF 1XFPA 4N0RA 2GUOB 1T7YA 4LCIL 1J8HB 1K4DB 3VG0L 3MLZL 4MA1C 4RGNE 4EDWH 4OM0L 3UTTB 2DL9A 1VPOL 4NO3B 4BFBD 2BDNH 4EQ2A 3SHSA 1XMWA 1ADQL 4I3GA 1E6JH 1T0PB 4PJHA 3TO4A 4OCWH 2GJ6B 3KR3L 2QHRH 2VRAA 2VLRD 3EYFB 1GYAA 2DF3A 2OZ4L 4Z7NE 1KSRA 2AERT 4I77L 3T0WA 5BRZD 4AEIH 4R0LA 3KXFB 4XPTL 3ULUH 1RIUH 4U7MA 2GW5A 1CTOA 1NBYA 5ELIA 3BWUC 4Y5XC 2Y1VA 1C5CL 4ZUUA 4NJ9L 3O8XC 2RBLA 5TE6L 4M6NH 5JA8B 2Q76A 3V4PH 2IF7A 3BYTA 5IEHA 2R4SH 1A7BA 1KG0B 3HC4H 1HN1A 1P69B 1QSEE 4M43L 1N64H 1UM4H 2PTTA 5F7EH 3WNOA 5GZOC 4YK4B 2X6MA 5EC1B 5I75C 5DJ2A 2D31A 3MLXH 4OIAA 5GGSY 2CKBH 5C70A 3NACL 5F3BB 3HFML 4KHXL 2DL2A 4WUUA 1LO3H 4JFEB 4Y4KD 1H3PH 4WU7B 1UFUA 2DKUA 1A4KB 4GW4B 5HHOD 3WEXB 4YXHH 5DGQA 4YHPB 1CG9B 1TCMA 3ELAT 4Y1AE 4K23H 4YHLL 4BSWB 3CD4A 4FFZL 1DQML 1H5BB 1PYWB 3FB8A 2CUMA 4TNVF 1H0DB 2R2EA 1RD6A 3U48A 5LGJB 4JO1L 2YR3A 3RTQA 2BMKA 2FNBA 4XXDB 3B2UD 4P5TA 3VFVA 4X6BB 1XCQA 1MI5B 1ND0A 4K07A 4YIQA 1TZIA 5H35A 4QYOA 12E8L 1N5AA 1JNLH 4QY8B 2IPTL 3IETB 3OR7B 3P0VL 1MCRA 2VC2H 4IRSD 4EQ3A 1OSZB 3MGTA 3TEUA 2V5TA 4Y88A 2X4RB 3EYQD 3LMJH 1QSZA 4NJAL 2YC1B 3BP6B 1NUFA 1MHHB 3I2CH 5H2BB 4JO2L 5IKCB 5A43C 3WO4B 1ZLVK 1T20A 1SYSA 4UAOB 3W11D 1G9MH 2WANA 2WBJB 1SJEA 3QI9D 3QQNA 1OB1A 3U7YL 2CMRH 1I75A 4A6YB 2R39A 4OZFB 4PTTA 3V6ZB 3OKEB 4RA3A 3L3HA 3GSOA 5EIIB 5C1MB 3O6MH 2IADA 1U9KA 5AZEH 3BRFA 5SWZD 4LHUA 4WU7A 1LQSR 1YY9C 1B9ZA 3NABL 1T66D 3TO4D 5B22A 3CFIC 2YMXH 4RWHA 1U6AH 3QP3A 4I0PA 4JPKL 2ICWB 4R4ND 2JE8A 3S98A 2UWEB 2NTFB 1T22A 5K9JL 3UJIL 1B4JH 1A6ZB 2XWTB 4UU9B 3RWEA 5I17A 3QISA 3HMWL 4GAJL 3VH8B 2Z4QB 1HH6B 4U1LA 1FORL 3BN9C 3G6JA 5ISZB 4HCRA 4ODUB 1MWAA 4I3RH 2R1WA 1JPSH 4FQJL 4KI5E 4K9EL 4PRAB 5D2LF 4WJ5A 2ZG1A 1CXHA 4X9IA 5DJ8A 4AG4L 1HQ4B 2B0SL 4MNHA 5DJDB 2ICWI 3RIFF 4R4BB 3BPOB 1K2DA 3GSUB 5HYIA 4MWFB 1KCSH 1WFOA 1RZFL 4P2RA 4MQXC 4G6KL 4QRRD 2VAAB 4QHUA 4MD0B 3WFZA 5D70L 1TTFA 4YHML 3QPQC 4F9PA 2ITCB 3X3GH 3B9VA 4KRPD 3AREC 4ZAKC 1SJEB 2QADD 2V5MA 2XZCH 2BC4A 1J8HD 1YEJH 1G0XA 5E1AA 4JZOA 4MA7H 1MRDH 2H9GB 1YEKL 4S0SD 3RZCB 2H41A 1F90L 4I3SH 4IDJH 2FHBA 2XG4A 3C6LD 1INDL 2VXUL 3HNSH 4KTEL 4LMQI 1CFNA 1MCOL 1UXWA 1S5IH 3KJ6H 5E4IA 3O8XD 1Z0NA 3N1FC 3D2UD 4JPVL 2HT3D 4P49A 4XAKE 5CGYC 5JR1L 1MHEB 4HIJA 1CI5A 2APWA 5FO8B 1PSKL 3WFCH 4Z7QF 3HS0B 5E9DE 3BQUB 3G04A 3PQYE 5K9OA 2E9WA 2CIKB 1W8OA 4PTUA 4KK8D 4KRPB 4ONGH 4G6MH 3T3ME 4BJLA 1A64A 1GZQA 2DQDL 4XCYA 1LD9A 4GXVL 1S9YB 1MLBA 3QFJA 4M8QB 4XPHH 4BH7B 4NM4L 5K9QG 5E2UH 1I85A 5HI4D 3CCHB 3VDAA 1IC5L 2C3GA 4GG6B 3I84A 5HYJD 1ORSB 1UWEL 3EKCA 4X4YA 4XXDA 4XPBH 4PBVC 1T83C 2R23A 4LPCA 4PJXF 2GSGA 1YECH 1BIIB 3VFRB 4OGXL 3BQUD 4XPGL 3OR6B 4C58B 2EYSB 5HTSA 2ADIB 3WNPA 3S88H 1PLGL 4YFLF 3IFOA 3RZCA 3LKOB 2NY4B 1T03H 1WTLA 3IXAB 3HUJE 5LCVL 3VH8G 1EMTL 3GMLB 1OGAA 3K3QA 4J8RA 4PB9H 3K81A 2V2XA 4PRPE 3C8KB 2NY1D 2GTWA 4P4KB 3RUGF 5D7LD 3VCLB 1GCFA 1NPUA 2L0DA 3RHWF 5DJYA 3MUGB 4LCWB 1P4LA 1MHEA 3LS5H 4R7DB 4QWWC 1G7IA 3WV0A 3MV7A 1HDMA 4H1LA 4R97B 3VA2C 3IF1A 4OIIL 4EZMA 4GS7B 4QKXB 4TUJA 1LK2A 4IRSB 3ZHKA 1VENA 4HAFA 3DRQA 5CD3B 5FO9A 3P30H 3G6AB 2FO4A 2VLKB 3MOAL 4J2XA 3QIBC 3TYGL 2ITDB 2X9YA 4QRUB 4TNVK 1C12A 2VLJE 2WP3O 1CE6B 1KCUH 2VISB 4M5ZH 3RWFA 2F58L 4FOMA 3EO1B 1BBJB 2E8YA 4Y5VB 3VMOA 4ALAL 2APFA 2VL5A 4UV7H 4KXZH 1G7MB 4ZOEA 4JGMA 4OJFL 4X9FA 3L3KB 2HG5B 4YHOH 1HINL 1KCKA 2BY2A 3TBWA 2VISA 5SX4H 3U2SA 3ZTNH 1AGBB 1NC4A 4YHIB 4HAGA 2P8MB 4MA3A 5DR5H 1EHLH 1P7QB 1V7NL 5DD3H 2JJWA 2Q3AA 4NQEB 4LBEA 5EZOL 3FQTB 2EXYC 2PYED 2NXYB 4JANB 2EYTA 5H35B 4MCYB 3CIQA 2VXTL 5KVDL 5FA3A 2G75A 1EFXD 1G0DA 4MDJA 1RJYA 3H0TB 5EU7E 5HHQA 3MRBA 1X5FA 1XH3A 5AWNL 3SE4C 3MLSL 3UPCA 4ODXB 4P9HH 5FOJA 1MIEH 4CU7A 4KK9C 2AXHA 1II4E 1MLBB 3QFJB 4M8QA 2ZJSH 4LSRL 4PGCA 1DDHA 1S9XB 1AI1H 1X6NA 4HS3A 1REIA 1BM3L 3GMNA 4QXTB 1XF2B 2ZUUA 3BX7C 4MCZA 5T3ZH 1YNLH 2CUHA 3DGCR 4WTZA 4M7LT 1F00I 4YGVB 1BFVH 4PLKD 4YAQA 4NNYA 2RAMA 1PZ5B 2VLLB 4D0CB 4QRQB 2D03H 2DLFL 1MFEH 1JGDB 4LKCA 1U8MA 3MUHL 5EO9A 3KLSA 2D3VA 3D48R 4KK6D 1JYXA 5FYKL 2Q8AL 3V5HA 4HIIB 4J23A 1OAKH 2APTA 4NQCB 1GGIH 1AC6A 4HK3J 1FN4B 4ZFOB 1ETZA 4HHAB 2Z35A 4UI2A 4AYFA 5L0QC 4L8DA 4XTRC 1A22B 1QFOA 1ZHKB 3WXWL 1U36A 3T0VA 1D9KC 4P57A 4X7TA 3ARFA 5HYJE 5A16A 4K55A 4LSPL 1CDYA 1NL0L 4WV1A 1OT1A 3NCYP 3P77B 2AJYL 2R2CA 4F3FB 2H45A 3QQ9D 3F7VA 3FFDA 5HI5C 3DX8B 2IAMC 2I5YH 1JK8B 1QRKA 3X17A 2Y6SD 3RPIA 3VRJB 3F7QA 5T5NG 1C5BL 1G6RB 2D7TL 2A83B 4LHQB 1JP5A 1D5ZA 1KPVA 2P5WE 5INDA 1EAPB 3S4SG 2ZP0T 4QHMB 4Z7OE 2EC9U 5CJ8A 3CX5K 4ERSL 1I8LA 3OZ9L 1FIEA 1W72B 2W60B 3BP7A 1QLEL 4NQCD 3VE0A 3WFHB 2J88L 3HE7A 1EA9C 3RI5F 1WUNT 4Q6YA 5KVEL 4N0YL 2VABA 3OF6A 2XY2A 3TYFB 3TN0A 1I1FB 2R0ZL 5CIPH 3MA9H 5E2WH 1OTTD 2EE2A 4H1LB 4JKWA 5JNYA 5JORA 1MAJA 1HSAB 3ILQD 5L2KB 4XWGL 3BO8A 1S7SA 5ALBH 4G6AD 1OSPL 3VFWA 4JY4B 4F2MA 4NQSA 4Z95L 4Z18A 4FA8A 2OZ4A 5MP6L 3QB7C 5K9KB 1HNFA 1ZS8A 2X4OA 2OQJB 4IDLA 3RVUC 2VLME 4PGBB 4B50A 4P2YA 4QTHA 4HX1A 4JFHE 2IAND 2P44B 4PJ7A 3MBXH 2YRLA 5D1QD 2HJFA 5DK3A 2EDWA 5DT1L 4NCC2 4NQUA 3DYPA 2VLJB 3LY6A 1CVRA 5BO1L 4HUXA 4UIMB 2H1PL 5D1XA 4XNUH 2Y36H 1DBBL 3W0WE 1M7IA 4MQSB 1MAMH 3PL6B 4NQVB 4JY6A 3WS3B 1WK0A 3W0WA 1IGJA 5EFIB 3P9MB 1T5WB 5BZDA 5EN2B 5LWYH 1JZ3A 5FGCE 2HYMA 2A6KB 4KK5C 2WZPD 3SDXA 4RFEA 1I3GH 1WBZA 4Z9KB 1MFBL 2BNRE 3D1MC 1CXIA 4RX4D 3IAQA 1EGJA 3JWDH 3QDJD 5F44A 4CDHA 3FB6A 4N8CL 4ZO6A 5DJ0A 2AJUH 1YEHL 4DKFL 3D85D 3GI9L 5EU5B 3CVHB 1F2QA 1FG2B 1YQVH 1CD1A 3HE7D 2IQ9H 4R8WH 3V7AG 1VGEL 4ETYA 3MJ9L 4WENB 3FAXA 4PP2B 4F8TA 3IRPX 3KPLA 2OMBA 4C57C 3L3OA 3DI2B 1AE6H 4I1NB 4KJYA 3F58H 5IVXF 4ZNEA 4DKEH 3CVHA 4OSUH 3CSGA 3FQUB 3INUH 2NZIA 4Z7UB 2X4PB 5TE7L 3VFMA 3RI5K 1LEGA 3NTCH 3LKQB 5JZ7C 3GMOB 3AS1A 4R6UA 1TNNA 1R6VA 1M05A 2D4DA 1CICD 1JF5A 4O02L 1F6LL 1FRGH 2WINA 5LJYH 2ARJB 3IT8D 3SGEH 4WTZG 5EBWA 1GZPB 1ZK9A 4QXGL 5DHXB 4WFED 1PKQE 3D5OF 5KSAB 1F97A 1NBZB 3SCMD 2NQCA 4DVBA 4PJAA 3V4UL 3EJZD 3F12A 2BFVH 2UY6A 3ALXA 4F9LA 4RCAA 4UTBL 3TFKC 3T0EE 4NSKA 5AG8A 3SDYL 1WTGT 1LE9B 3KXFE 2QADB 1G7MA 5IV2B 5IEHB 2H3NB 4HJJH 1X4ZA 3MRGA 4J4PC 5C0IB 4LLMA 5DD0H 4YHYC 4M62L 3L1OH 3LCYA 1G1CA 2ZSVB 3NPSC 5JXAH 3KG5A 1LDPH 3DSFL 3CCHA 2D7OA 3NBNA 1RY7B 3VRIA 3Q6GL 5HYSA 1CXFA 1BBDH 1X6LA 5FA4A 5GGQH 1A3RL 3CDGB 5E8OB 4DVRH 2F9BT 2IANE 43CAB 3Q6FA 1NGQH 3HZMB 5K33A 3GBMH 1HZHH 2VN7A 4H20L 1QSFD 1BECA 4X98B 5D7KD 3VFOB 4C83A 5GGTL 3U36B 4XVJL 4MVBC 5DK0B 5AZ2L 3T08A 1P1ZB 1DN2A 1ZA6B 7CGTA 4PJ5B 3BIBX 4KAQL 4BFIA 5GS0L 1PD6A 2AABH 3HAEB 5CP7B 1JJUA 1AGEB 4ODWB 3RWIA 1JK8A 1WAAA 3FQXB 5MENB 4PS4L 2KBGA 1F42A 1HCFX 2H8PA 3QUYC 2OR8A 3TNNA 1FIGH 4WWKD 4AJ0A 1VFOA 3ULUE 4HKXA 2N56A 1I7TA 3ARDB 5D8JH 2A6DA 4MB3A 4RBPH 2EDTA 4GRWH 3DXAB 2ZNWA 3FRPA 1TCRB 2QQLL 3I02A 2W92A 5CGTA 4LKXA 4YR6B 1HXMA 2BOCA 1MFAL 4M7KH 2VN4A 5KJRH 2YKLH 4LP5A 1HHKB 1F4YH 4JFDA 3WE6B 2A1WL 4L9LA 5FGBA 3B5HA 4OZHE 2GEEA 4MS8D 3BGMB 5CJQL 3KYOB 4Z76A 3THML 1I8MA 2DQGL 1N7ML 1NEUA 3B3IA 4CBPA 4F7TA 5F72S 3IB4A 2IQAA 2DKSA 1FE8H 4L3AA 4LSVL 1CD9B 5J3HC 3VH8A 4Q0XL 3MRFA 3UJTH 4P4RB 1LE5B 5IT2H 3IETA 4F58H 1S7RB 2MQ3A 4GJTB 4WWID 5D1ZC 2AJXL 4PJAB 3K1DA 4JDTH 4Z7WA 4WFHD 4D3CL 4KZEL 3MJGX 4X5XB 1HE7A 5IJVA 3LQAC 4F7CA 1ZANL 3BDBA 5EG6C 4RWYL 4HKZB 4HC1A 2E5EA 4WFGD 3MLTB 3QG7L 5I2IA 35C8L 2F53B 3MRGB 5C0IA 4BM7A 3ULVH 4M8VA 4IMKA 2CDEA 3V0WH 3QWRD 3ZO0A 4Y4HB 1D9KA 1CK0L 2MCPH 3M07A 3LZFL 4TVSa 5T3XL 4M9PA 1CGVA 2FATH 5LQBL 3VGDA 1BWMA 1TETH 3I6LE 3U9PL 1X5IA 3L7EB 1GSMA 3F12B 3OX8B 4XWOD 3QI9A 4RA0C 4PJAF 4NUJA 2ZCLH 4G6JL 5L2JA 4HUXB 5KTEH 3IJHB 2XTLA 4GT7A 5I18L 4GKZA 2PO6C 3B9KA 3P4MB 3OKEA 3VGBA 4OT1H 3MRKA 3SGDH 1JYWA 4HCRL 1DN0B 3ZDXE 2YK1L 2DM2A 4MMZC 2DQTH 1KIRA 4K8RC 1NC4D 1S8DA 2DN7A 4BUHA 5C0CB 5IB1B 2DMBA 5B8CB 1W72L 3V8CA 3MLWL 4N9GA 4OZFH 4RAVB 5JPMB 4U49A 5I1EH 3HI6L 5C71A 4ODWA 3RWIB 2PO6D 2BNQA 1NUDA 3UTSB 4LOUD 5C9KA 4NRYB 2F19H 4XCYB 2AGJH 3QXVA 3S36X 3EGSA 4PJIF 1QRND 3GHEH 5CJ5A 4OF0A 3JZ7A 1BJ8A 5J13C 5M7QA 3U36A 1L4IA 3IVKB 4Y2OA 3WJLA 5D7JB 5DZLA 3PDDA 4R3SA 3C5JB 1IT9L 1N26A 3JV4A 4PGZA 3C5ZB 4WCYH 2Y06H 4LOUC 4MYWB 4PRIA 5T1LA 4JFXA 2XIDA 1T2XA 2M26A 4HUKB 5INDB 1D6VH 2DOCA 3TH3T 4HFUH 3WSQH 4U1KB 3AM8C 3SDCB 2YOCA 3KS0H 3FQXA 3QDME 5JIHA 1CZ8L 4JDZB 4GAYA 1NBYB 3HCVB 4M6MH 4M5YL 1MCPL 2VDKL 5FOBA 5IBTH 4KDTA 3F5WB 4F3FA 1BVKA 2NXZB 2DM7A 1ZLSL 4G7VL 4DUXA 5GGRA 1FFPA 3PWLB 1Y6KR 1NANI 1LHZA 1K6QH 1VPOH 4Y4KA 3O3EB 1E4JA 1EXUB 4AIZA 3SJVE 3QNXA 2QQKH 1BD2A 5HYJA 2ICES 2OI9C 4OCWL 3FMGH 2NY3C 5FA3B 1CFSB 5IHLB 1YEEH 1BMGA 5BVPL 5L88L 1R3LB 4XBGB 1JGLL 5B38G 3QFJD 5DQJA 1JGEB 2IBGA 2AQ1A 2FJHA 4PY8J 4AEIL 4XPTH 1RIUL 5B4MD 3DMMB 3BVNB 4NN6C 3GIZL 3BO8B 4NJ9H 1FZOA 4M6NL 4FQXC 4ELKB 4O00A 3PJSA 5HYQA 4TVPD 1JZ4A 4UMGA 5E9DA 3VG9C 1Q1JH 4WTWA 3SO5A 2R4SL 4PJEB 3SDDB 4HZAA 5F6IC 3WXVL 4U1IB 1NC2D 1RJZB 1OGTA 4GMTH 4UILL 4P3CH 5F7EL 4PGCB 2E27H 4U1KA 2P47B 3MLXL 1BJ1H 4U6XB 3RWCB 3KJ4B 3NACH 2Y25A 3EYVB 5EU6A 5DGRA 1CS6A 4MX7A 5FYLD 4FQ2L 2X42A 5D2NA 3MV9E 4WUKH 1EJOL 1FYTB 5GRWA 4YHLH 3VD7A 1A1OB 4MCYA 5C0BD 4QRQA 5FEBA 1SYSB 3O6LL 4FFZH 1LEIB 1VHPA 2MNUA 3MRRB 2CR6A 3EYVA 4RMUA 5HD8D 5F7HA 3GB7A 1WBZB