4X6DE

Cd1a ternary complex with endogenous lipids and bk6 tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
200
structure length
189
Chain Sequence
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSTSLPNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1a
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 189
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dE02
4WENB 4NQVB 1WTLA 3EJZD 2ZKHH 3D85B 3RIFK 2VDKL 4PREA 3TIEA 3EUUA 2AQ1A 2BVOB 3WE6A 4TPRL 5I8KH 2XZQL 3CFDB 5SX4I 1KPRB 5IHZB 5ELIA 4Y2DA 4NZRL 3SPVA 4P3WA 3O6FD 1T7WA 3IF1A 3QZWA 1FL3A 4KQ4L 5F3HA 3BEWB 3GHEH 5I8EB 1UVQB 4O51B 4OQ1A 1Y6MR 2BNQD 4D9RD 5MP6L 2BC4B 4HUVA 1G6RL 3O2DA 5L7XH 1TVDA 4WI4A 1RURH 4Y4FB 1DQLH 4OIIL 4NQDD 5HGAB 5GGVY 4OUUB 1YEKL 4P23A 3K2UL 1GYAA 4H0IA 4DGVL 3EZJB 5T1MB 3ZKND 5INDA 4D9RE 4GG6E 2L7JA 2HKHL 4C55A 5H37H 3X14B 1K3IA 1QBLH 1MCOH 3ZHDA 4KJWD 1U8HB 4ODBD 1XEDA 4AENA 4R7NB 1Q9KA 1JNHB 1NLDL 1QSFD 2VL5A 1GOGA 4RZCA 1RZKC 3MRPB 4YPGB 4NKOB 1OTTD 2PYEB 2VKXA 2VXUL 3MRQA 1GGUA 3WFBL 3ZKMC 4YWGL 2EO9A 3A0OA 3FO0H 2FRGP 5DJZB 1FJ1B 1EHNA 3VFSB 2X89A 4YFDB 5EO0B 3RVUC 2PYFB 3HLAB 2CXGA 3MOAH 4MHHG 4JHWL 4AG4H 4PLNC 3MLRH 4TUJB 4JFQA 3X11A 3AM8C 3FQUA 1JWSA 3BAEL 1RZKH 1RMFH 1FO0H 3GIVB 5E5MB 1A9BB 1KB5A 2W0FA 1FNGA 4LSPL 3HAEB 5JORA 2D7TH 4ZPVB 4HX1B 1SMAA 4BSVA 3WS6A 4Y1AE 3H0TA 5HPMA 4M7ZC 5CBEA 4YXKL 4P5TC 3C5SB 4LVOC 4P5MA 1FFNA 4ZYKA 5JW3L 3V9FA 1NANH 1HHKA 2F9BT 1F58L 5B3NA 2QHRL 4YUEL 5DHVH 1KLUB 1JYWA 4UIMB 4NWUL 3T4YB 4RRPG 4QGTA 2FBJL 3V95A 1ADQA 2F54B 3DYOA 1ND0A 1B3JA 5FGBC 4TQEL 5J9PB 4JG0L 3RTQC 3W0WD 3KS0H 1IC5L 3SE3C 3WKMH 5KW9L 3DRTA 4LEXL 4N1HB 4Z76B 2FEEI 2NXYB 1LO5B 4G43B 1OCWH 1Z5LB 3IKCA 3BZEB 5TDPA 5ITFB 4WWID 3LRSA 2E9JA 1I8MB 2UZIH 1BLNA 2BJML 2WBJD 4MAYB 3WJLC 2Z8VC 3ARFB 1J8KA 3DXAA 4I0KA 2Z4QB 4E42A 4LSVH 4NN7B 5AWNH 4OCMC 4H1LB 3EO9L 2XN9E 3KHOA 2HJKA 1JHTB 3GUTA 5CZXD 5E5RB 4LLUA 3ELAT 1JMZA 4HJ0C 1DLFL 1KCUH 4JHAL 5CP3A 1R3JA 2JJWA 2D0FA 3DBXB 4JAMB 3RWFB 5ACZB 1KOAA 1A6UH 3BQUB 2V2XA 1UM4L 2QSQA 4PRBB 3LEYL 3OR7B 5F96H 3PHQA 3QQNA 1M7DA 1RJYB 4U7MA 1MAML 2ATKA 5I0DA 4FQPA 5EIIA 3QHZL 3P0GB 3VFTB 3T0XA 2P8LA 2QQQA 4Y2OA 4Q6IA 2FO1A 4NZJA 1EJ6A 3L7EB 4YHMH 2A6DB 4EI6A 2YPKA 4RX4A 3QG7L 1EEYB 3K46A 4LU5H 3QEQA 4NNYA 1P7QD 4MXQD 5BS0B 4G9FD 3HE6D 1LK2B 3JV0A 3UEZA 1E4XI 3WIFA 5EZJB 3AXLB 5I15L 4PLOB 5DMJB 4LLYA 3IRZA 4LSQH 5ETUB 3KPNB 1A3RH 3NA4A 3VXPA 3FMGH 2R4RL 2L7UA 1LP9A 3CSYB 5E2UH 3MODH 1EIBA 2VISB 3ZT6A 2AV7B 4G9FE 3U0TB 3QUXD 4KI5D 1TTGA 2VR5A 3OAUH 5JIKA 4OTXL 3WO3B 3P9LB 2EH8H 5EOCH 1BJMA 4AMKL 3UBXB 1JTOA 1ZHBB 3O6KL 4X6EB 2WANA 4OZHF 3FRUA 1B2WH 2VQ1A 3L1OL 2DS4A 1F3DJ 5EORL 2BHUA 1EVTC 1ZTXL 2AQ2A 5D6CB 5E8OB 3E6FA 2YD1A 5HVWA 5F7EH 4XCEB 1FFQA 1FORH 1UJTA 3EOBB 4NJ9H 2B7DT 2MSPA 4KK9D 5LJYH 1LGVA 1IM3B 1BIHA 2NNAB 3QG6B 3CDGA 2VLRA 4OUOA 3H3PL 3MLTB 5M94B 2N7BA 4D0CB 1RUMH 2FL5B 4N0CD 1JF1B 5KS9F 3HG1A 4HCRA 2GUOA 2X4TA 4F3FB 1OAZH 3WNPA 5CJ5A 1Q9LA 1MJUH 1LO3H 2A6JB 2BVQB 4JHBA 4BH7A 5HVFB 4JPKH 5J1TC 1MCPH 3ZSSA 3GSRA 4FS0A 3ULUF 4RQQB 4Q2ZB 3P4OA 2XPGB 3MACL 1WZMA 3W9DB 15C8L 1EZVX 3MNWB 1KNOA 4XB8A 2PXYC 5ICXB 3BEVA 4UT6H 1P1ZA 2VR4A 4OZGA 4NNXB 2NXZC 4MSWA 3V6OA 5EU6B 1T21B 4ZFOA 4DKEH 3QNYB 2VWEE 4XMPH 2BY1A 4QRPA 1CGSH 5IVOA 1YEIL 4MQSB 3WYRA 1WBXB 5T1LB 2F19L 3EOTH 1S7SA 3WXWL 5CZVH 3L95B 3F12A 2HRPL 1ZVSA 4MA1B 1CDJA 3QIWA 3C6LC 4JFDD 3V6BR 5B8CA 2NY4D 2IFFH 3G5ZB 1D9KD 5HD8C 1FAIL 2MPAH 4ODUB 2A6IB 1CR9H 3RKPA 4EOWH 4M02A 4LCWA 4TTGA 2F5BH 5IB5A 5BVJB 2LABA 2PYEE 3DTXB 1QLFB 4OBSA 6CGTA 1XIWA 4EI5C 3P0YH 2M2DA 5SWZA 1T1XA 2VDML 4AT6A 2HT2C 1K5NB 1R3KA 3LY6A 2EIBA 3GGWB 1R0AH 4H26A 2CJUH 4HZLB 4EDWH 5ICYB 4PJGB 1BVLA 3LN9A 3P4NB 3HKFA 5I76A 2QADC 2MHAB 4XXDB 3RWDB 4P2QB 5CSGA 4CBPA 5C0RL 3S3SA 3P4MA 5FYKL 1RUAL 4NJAL 3QEGL 2VITA 1WWCA 3HUJF 4YZFE 3UTQB 1A7OL 3LAFA 4MNGA 3STZB 2ZUXA 3SKNA 1YEFL 3U2SB 1U8OA 1GHFH 5JPNB 1FCCA 4IMKC 4D0DA 2NTFA 4JZNB 5C07B 3N1GC 2F54E 2ICWB 3MLYL 2E9WA 3BGMA 3BH9A 2ADGA 4X6FA 5MENA 3FQNA 3RWCB 1I1RA 5FYKE 2HWZL 3DECA 1S9YA 3LDBB 4U1NA 5D71L 2P7TB 3ARFD 3BUYB 3VRLE 1D6EA 1D5MA 1IMHC 5F6HJ 1RIHL 5D7JA 3ZE0F 3IETA 1YYLH 1DBAH 1BX2B 3TBWB 2V17H 1IQDA 2QQKL 1LO2H 3VD5A 3IFNH 1NMCC 5CJ8A 4GS7C 5DO2C 1DQDH 3MXWH 2DLTA 1U8JA 4WW2F 5IEKA 2VC2L 3ROOA 4KROB 1NGPL 3GJFK 5JQHC 2IADA 4ZTOH 1TZGL 3U36B 3ULVC 5B4MC 3FRPA 3FZUC 3C8KA 2JTDA 4PRHA 5IJVB 5DD1L 1OW0C 4ZNCD 2WIIB 5E1AA 4JY4B 4U2ZA 4WU7B 5J8OA 3RWEA 3EYUL 3UBXI 2DMBA 3DGGB 5CCKL 4TVPH 2CDEA 4DN3H 2R2EB 3UJTL 1GZPB 3ULVH 3NCEB 1INEL 4TSAL 2EEAA 2O5YL 4U6VL 1G0XA 1V3JA 3UTTA 2BMKB 1FC1A 5DQJA 4DAGL 1F3JA 4GKZB 5EBMA 4YK4C 4PGCA 3PP3K 3VH8A 3RL2B 1AD9B 1KG0A 3O9WC 1KULA 5BS0E 3OXRA 4XGZB 1NAMH 3X3FH 3PV6A 4NC2B 3ARED 4TTDD 1GC1L 1ZXQA 2E6PA 4L4TD 5EN2A 5IOPB 5C9JB 5IUSA 3HE7C 4U6HB 2XWTA 3CXHJ 4HGWA 4YGVB 2FX8H 1R24A 2IBZX 2I07B 3O8XA 3VFMA 4AEFA 1BQHA 1RUKH 2GKIA 1IAMA 1YNTA 3OGOE 4PRAB 1AGFB 5GGQL 1OGTA 3LQMA 1ERNA 4G5ZL 3GMOB 4GRLA 1A7RL 1KBGL 5HGBA 1MRFL 5KSVB 1I75A 1CVRA 1Z9SA 5FM5O 4NM8L 5BQ7B 2H2SD 5HBBA 5FHAL 1S7WB 2DQFA 3RVTC 3E3QC 4Z7VA 2EDRA 2D03L 4PRNB 3ZTJH 1KJVB 2DQJL 1QQDA 1LE5A 3GBLA 1JWMA 3MGTA 4XPFL 3GRWA 3RZWA 1BJ1H 3ZKSD 3H9HB 4JREB 1M1SA 4OZFA 3WD5L 5D7SL 4M3KB 2M1KA 2FD6H 3IDGA 1RK1B 3B5TA 3Q1SL 3HS0A 5KJRL 2MCG1 3TVMD 4YHZL 3LKQB 4Z7OE 2R1XA 1QG3A 1T5WB 1C1EH 4GUPA 3CVIL 4RGNC 5DFVD 3DURA 1ZSDA 5IMOB 5KSAC 3D39A 3WFDL 3T3ME 5DWUH 1N26A 1Q0YL 5EU6D 4NBXB 3EOAA 4QRRB 4ONHB 4FRWA 2UZYB 5GS2H 4XWGL 1ED3A 4JRYA 5BVPH 4PG2A 4WI8A 5LXGL 4OD2B 1MFBL 5T1LD 4N9GB 1NC4A 4PLKD 1OGAB 1Y18A 1NH6A 2JJVA 1OL0A 1XR8A 1MELA 5EU6E 2YEZA 5I8OH 3BHBB 3BE1H 3N06B 4ZUUA 3RZCB 4OCXL 1HSAB 3PIQB 1JYVA 2AJ3B 2VH5L 4U3CA 1WJ3A 4H88L 4MJ6B 5I66B 3H42L 3HZKB 2VDPL 5D70L 1WBYB 5D9SA 3VGHA 1DQJA 5I1KH 3G5XB 2ICWI 5BV7B 2R2HB 4APQB 3T2PA 4XNQA 2XFXA 1I1AA 1OP5K 3RUGF 3DMMB 3JV4B 3NIDE 3AB0C 4CVZA 3GEWB 3NN8A 1MVFA 4ZUTB 1MVUA 5ITBL 1ORQA 2NQCA 1SEQH 1H9VA 1VHPA 4P9HL 4P2QD 2ZUUA 3NZ8A 1INQB 4YNYA 5FA4B 5TFSH 4BKLB 5GZOD 3FFCB 4KUCF 3U46B 2WSKA 5GHWH 4JR9L 3RDTB 5EZLB 5I1AA 2G9HA 3QA3A 4PJGE 1J86A 2JB6A 4GRMB 4NFDA 2J8UF 1OARH 2AXGB 3RNKA 1FV1B 4P2QE 1NEZA 3ZDYE 5C07D 2QKIB 4WDIB 4MQTB 4Z6AT 5C0BB 2NY7L 4Y2DC 1W8NA 4XVUD 1G7IB 4J4PD 4P9MH 4DK3A 1NBVL 3SDYH 1UB6B 1VSCA 5IEHA 3NCBB 1PJ9A 4GMTH 3MJ8A 1IC4L 1MIEH 3IXTB 1MJ7L 3PGDA 4UT7H 5C07E 1RD6A 2X4OA 4ZMAT 3N0PB 3O3BB 4YE4H 5DR5H 2B4CC 2ENYA 3VGDA 2YK1L 1LEIA 2D7NA 4MX7A 4P23C 4FXKA 2CMRH 3TV3H 3DI2B 3O2DH 3DLQR 1F13A 1T22A 4X4XB 3FFDA 5KG9A 1MI5A 5C0NC 4KROD 5HHOD 4OF7A 2B4CH 4JO4L 5E94A 1W72B 3MZTA 2CLVB 4AH2B 3A6BH 5HDBF 3UYPA 3O41A 3H7BB 5GRUL 4JY5L 3V0WL 3NPSC 3FN0L 4NO5A 4R90H 2ARJA 1GZQB 3BP4B 4WUUB 3FT2B 1LO0H 4JY6A 4WFED 5SX5K 4NKMB 3OWEA 3LMJH 1HI6A 5HI4C 2QSTA 1SYVA 4ORZC 3MV11 1NPUA 5C0EB 4PG9B 1B4JH 4FP8L 3CUPB 1MJJB 2UZXB 3WS6C 1GCFA 3R8QA 1J1PL 4WFEE 3F65A 4UINL 2RFXA 3HN3A 2ARJQ 4M43H 3FAXA 3GI9L 1JGEA 1KB5H 2FB4L 4YHNB 3DX9A 4OAWA 1T7YA 3QEUB 4KPHH 4M9PA 4Y5XC 5DUML 1B9ZA 3ABZA 1HINH 5DUPL 2LVCA 4NQSA 3ZDZF 4ODWA 4WUKH 4QHNA 4J6RL 5JDJA 5HI3D 2OJEA 3KR3H 4NO3A 1BD2B 5BXFB 1F97A 5JMRA 1N59A 4E0RA 1ADQH 4HUXA 4NC0B 4I3RH 1YJDC 3MLSL 3LKRA 5DJCA 3MA9H 3RIFF 5AAMA 4PJHB 4LSRH 3BDYH 1R3LA 3HZYA 1MUJA 1FBIL 1R6VA 3KNBB 4PBWD 1FO0B 2X2YA 3O3DA 1SEBB 1JGUL 2KL6A 3QQ4B 5DC9B 5D7IF 4XVTH 4GG6F 4LKXA 3VW3L 2OJZH 3GNML 3IJYB 4XPAH 3L3GA 2XZCL 5EZIL 1A7QL 2V5RA 1S5HB 3PWPB 5M95B 3PWLB 3O6ML 5F9JA 2F53A 1A6VL 3UPAA 1HHJA 2XRAH 1KCVL 5T5FH 3BKJL 5GRVL 3T04D 5DHVB 3CXDH 1J12A 1EFXD 4QRRD 5CP3H 5C09A 2ZCHL 4Y5VA 4Q6IC 2XA8L 2NX5D 4C4KO 2NY1C 4O02H 4M7ZB 3MR9A 2CLZB 2G60H 4P5TB 5EFIB 5IBTH 4OGYH 1CDIA 2GITB 2C3WA 4L3ED 1FPTH 2V2WA 2HJFA 5KSBA 3MCLH 3RRQA 2Y5TB 4GT7A 5EC2A 5LVEA 3FOMA 4QRRE 4XP1L 3RZCD 5MEPA 3EYVB 1N64H 4W81A 5DJ2A 5A2LH 4KTDL 4CVXA 5BV7L 1AGEB 1OGAE 2FEDD 1QSZA 1IGML 1HZHH 1MY5A 3REWA 4GXVH 4PPTA 1MCFA 5C0GA 1PEZA 2CK0L 4GQ9H 4APQD 4P48A 1LK3L 1RIVH 3DMMD 2JIXB 2JKXA 1TPXC 3CDFA 1ZOXA 2CUMA 6FABL 3J8F7 2W65A 4HWNA 1ONQA 4J23A 3N85H 1GGIL 4XNUH 4R7DA 4F7EB 1P69B 2AAVA 5E9DD 4WEBH 2VOTA 2MKWA 4OLXL 1H3UA 2YD2A 3FFCD 1S7TB 4LCYB 1PAMA 2GY7B 5INCA 2AABH 1U0QA 3L3IA 4LLDA 3EYSH 3Q6GL 1C5DA 1P7KB 4PY7B 2UYLA 1NFKA 1PG7H 1OSPL 2OL3A 4X7DC 4ZAKA 3SGEI 3W11C 4U7SA 1KTLB 1RSFA 4JHZA 3FFCE 2VXVH 4JDTL 4HJJL 1CU4L 5DC4B 1QLEL 5ISZA 2XZZA 3PP4H 5I1DA 3OKKB 2BVPB 1N0XH 1I1FB 3F7YA 4JO3H 3LIZL 4RA3A 1TIUA 3EYOA 3LS4H 5CMAA 3QIBA 4RMTA 1EUTA 3S36H 1QZ1A 4LNRA 3NA9H 3QNXB 4HCRH 5L2KD 1YNLL 5C0BE 3MNVA 1IL1B 1I3RB 3RI5K 4CMHC 4KJYA 2HMIC 3GI8L 4RIRA 3TWCH 4P4RA 1RZIB 5E2TH 3GSUB 2DJ4A 3ARPA 1KTKE 5T33L 4JO1L 4L5FL 1WAAF 3P73A 1W72L 4FXLA 3V6OC 5IP4A 3T2QA 1T0MB 3EJYD 2CRZA 4HUWB 1F8TH 3NIGE 4NDMB 5AEAA 4M6OH 4PJAA 3BGFC 1OB1A 1HNGA 4HT1H 4WGWB 3QUZD 2CSPA 4X5LA 1PKQA 1N4XL 3FCTA 3GSNA 5F8RC 3QIWC 5AAWA 4BFEA 5B8CC 5K59E 4WUUD 1AR1D 1IGYA 4CL7A 5HGDA 5F7NC 2MMXA 4LL9A 1AFVH 3OAZH 3PWVA 5FKPB 3U0PA 4KHXH 5I8KL 4Z7WF 2HN7B 3MMEB 1KIRA 4J12A 3PJSB 3DO7A 4ZUSA 3T1WA 1EEUA 5I19L 3RAJH 4I8DA 5C3TA 4XVSH 1RUPH 3TBYB 3GSXB 5DT1L 1KLGB 3BDBA 4MNQD 4WUUE 5C0FA 5B39G 2V7NB 1YEHH 1YA5A 1EFQA 4EUPA 3VFGH 5E8NA 5L7XL 1OP3H 5IB4B 1RURL 4XVJH 2X4QB 1DQLL 5I2IB 1U8QA 1LD9A 3S3PA 4CRPA 1YY8A 3CFCH 3QULB 1DL7H 3MO1B 5FM4A 3CZFB 4RCAA 4MNHA 1UA6L 5C0AB 1KSRA 4P3DA 3V7AG 1QBLL 1IGCH 5L8LB 5JW4Q 2BVYA 4RWYH 3V52H 3WO4C 1BD2D 1Q9WA 1HKLH 1H3VA 4Q9QH 4M7LT 4P57B 2PR4L 4ELKA 3T2NL 4ELMA 3SDCD 4MS8C 2D7QA 1U8MB 2A9MH 2DD8H 2PXYB 3O0RL 4EQ2A 1NANI 2AXJA 3FO0L 2Y07H 3O2VH 4D8PB 2NXZB 3BKMH 1FYTB 3LB6C 3Q2CA 3KPLB 4CN6A 1BD2E 3JV5A 3MLRL 1U91A 2X4NB 2Y6SD 4Z0BH 1RZKL 2IH1B 1FO0L 3TM6A 1AGDA 2YD7A 3B2VH 3EO1A 1I7RA 4ISVB 5D7JC 1DP0A 3QDGB 2PTUA 4HH9B 3T3PF 3C6LB 4PJHE 3M17A 1RHHA 3GMMB 4HLZH 3VG9C 3N1FC 4OGAC 4QRSA 3UTOA 1TJIL 5ECJE 5L9DH 1U36A 1IGJB 1S9WA 4EI5B 2DWEB 4M5ZH 3V5KB 3M8OH 3LEVH 1H3XA 3BW9B 2FO4B 3KG5A 3MV7D 1D5BB 5F21B 2GJ6A 3WKML 4P5TD 4R96B 3VXOA 5J6HB 3PWPE 3LKOB 3NACH 5IMMA 4U1HB 2QADB 5AYUL 5ADOH 5IM7B 4KKCC 5IHUL 2DIAA 1OCWL 1YEDB 4HH8A 4HS3A 2CIKB 4GW1A 3G5VB 4GAFB 1T7VA 2D7OA 3KPRA 2FWOB 3AS3A 4ZOCA 5EOCJ 1HEZA 1JPSL 1C08A 1VADB 3D1MC 4HAGA 1L6XA 3FQRB 3RWHB 2H3NA 2QTEA 1ZWIB 1NCAL 4P4KD 1NDGB 5D96C 4K3DH 5AWNL 2UY6A 4YDKL 3QJHA 1JZ3A 2RJMA 5HHPA 3SE9H 1EPFA 1P4IH 1OAKH 4O4YL 4QGYA 1KCUL 2H6PB 1P2CB 3LZFL 5TDNB 3WCYA 4NC1C 2I9TB 1DTUA 1PZUB 3D0LB 4YZFF 2DRUA 5F96L 3T8XB 1T4KB 4GRLC 1EEZA 4I0PA 3V8CA 1HCVA 3D2UA 5AUMB 1T1WA 4NGHL 3O3AA 1VFAA 4AM0B 1W0YT 2F58H 1NMCB 4YHML 4GS7B 4F7CA 1QUNA 4LU5L 2V5TA 2V7HB 2ORBH 3KPPB 4BFBD 4PRIB 2ATPA 4U1SB 3OJMB 1LEGB 2CRYA 4LFHD 3VRLF 3VXSB 4LSQL 3F58H 4DVBA 5I1LA 4CADB 3FMGL 1EERB 4HG4K 4H8WL 4X99B 1A2YB 5E2UL 4YX2L 5J13C 3MODL 5FUOL 2APTA 5KVGH 2HFEA 2ESVA 1QVOA 5HPOA 4ZXBD 3GRWH 2EYSA 1TETH 2W9EH 2C3XA 4OZFH 1ZT7A 2DI9A 1HK6A 3OAUL 5I74B 5HHVH 5DJYB 4GBXA 5CGMA 2JELH 3L5WB 1MCIA 1NAMB 3DETD 2BDNH 5C0DA 1IQWH 4Y4HA 2PN5A 3IU3A 4QT5A 1UB5A 4NP4H 4PG2C 1UZ6E 2LAGB 1QBBA 1ETZA 3O6LH 4XNXL 4GSDL 5F7EL 5B39B 4PJXF 2NTSP 4NZUH 35C8H 1NCTA 2GTWB 5ICZB 1FORL 1N5AA 5KBNC 3I6GB 3HE7B 2IALB 3HI1A 4HC1A 4C59B 2YPLB 2DQIH 4XT1C 4IRJA 2R4SH 4QHMA 1S78C 2YBRA 4M6NH 3CLEH 3OKDA 3FT4B 5CSZB 2Z92B 3V7MA 2GQHA 4NRXA 4JCMA 1AP2A 5ACMA 1S7QB 4OZIF 4X7SH 2X5PA 4HKZB 1OAZL 5F3BB 1MJUL 3TBTB 1LO3L 5HJ3A 3QIUC 5HI5D 1YEJH 4JPKL 1KUMA 3U7WH 1MCPL 2HFFB 4ZFGH 5F88B 3L5IA 4OM1L 3X3GH 2X09A 3QFJB 4HWEH 2CKBA 2LE9A 1IEBA 2XXCB 4YHIA 2XWBB 1AO7B 1IC7H 3PXJA 5EOQH 3TJEH 5J0BA 4PJ5D 1S9KC 1V05A 4UOW0 1DBML 1JN6A 4UT6L 3CC5B 4TNVK 3O6FA 4QXWA 2E8YA 2BK8A 3G6JA 3ULSB 3BVNA 5T3XD 3QQ3A 2BNQA 2WP3O 3IDNB 4WHTA 5CGYD 5DK0A 4XMPL 2QJDA 4OFVA 1CGSL 2BNRB 3WUWA 4ZFFA 1G6RA 4NQDA 5FO8A 3EOTL 4QHKJ 3S34L 2KBGA 3VFOB 5DJAB 5E7FA 1QO3B 4RGNB 2PXYD 5J12C 5C0AE 2OXGA 5C70A 5KSAB 2D0HA 4KV5E 5L8KB 4N0FA 1ZS8A 2D31A 3GZKA 2B2XH 3T0EB 4Z78B 4JM2D 3IDXL 3TT3H 2K1MA 4OGZA 2IFGA 2F5BL 5H2BA 3VXQA 1NLBH 5FIEA 1QSFA 2P8PB 3C5ZC 4YBQD 4Z7OF 4QHUA 2OK0L 1KN2H 3QWRD 3QDGD 3P0YL 4JPIA 5MHSD 1FYTE 2BSED 4HUUB 3W9EA 5HHNA 3T3MF 1T1ZA 5IJKA 4EDWL 1CQKA 2UUDH 3M07A 2GEEA 1K6QL 1T0NB 1JWUB 1OY3B 3QDGE 1NGYB 3IJSB 3K4ZA 4NQXA 1NBYB 4HXAH 1Y0LA 4KVNH 3BP7A 2IQAA 3GSOA 4U1IB 4YXLH 4P3CH 4AIZB 3LQZB 3NAAH 3C60D 3VDCA 4TYUA 2DB8A 1GHFL 2QL1A 1WGOA 1YPZF 2C1OA 5I73B 3HC3H 2VZ3A 2YXMA 5IW6B 2W9LA 4H5SB 1CFVH 1ZT4A 1AXSA 2W59A 4WFHD 5ERWB 2ICEA 4MXVE 3W0WA 3WLWC 5MEQB 3NCCB 4PREB 3D3VD 1X7QA 3WE6B 5GXBB 1E0OB 3A6OA 2HP4A 3VFNB 3IT8D 2XTJB 4OFYD 4S11A 1YYLL 1DBAL 2V17L 4JJ5B 1LO2L 4KHTH 4FQXA 4XPHH 4Y2DB 3FO9B 2YD8A 4QTIH 1DQDL 3MXWL 3IF1B 5F3HB 1LVEA 1DUYA 1OSZA 3GJEA 2AVGA 2WBJA 2HT4C 4LVEA 3HZMA 1YC7A 4ZTOL 3WN5A 3DX6A 5CKAA 1N3NA 1UM6H 2EDQA 3LSOA 1BZ7A 1BQSA 2VB5A 4MJ5A 4FFYH 3BPNC 5ADPH 4DZBB 2FH6A 4TVPL 1OWWA 3LV3A 1BJ1J 1T03H 4HPOL 4JE4B 4S10A 3RVWC 3OHXB 5DJXA 3VRJB 5DQDL 4AQOA 1CFQA 4K7FA 3RBSA 4PRID 5LCVL 3HRPA 1E6OL 3I6LD 1Q9KB 2OP4H 2RB8A 4ALAL 3WFZA 2C3VB 2VL5B 1HH6B 5DZLA 3E6HA 3NPSB 2EZ0D 2B1HH 2J3SA 4KMLB 3MRQB 4WHCA 2FJGA 3P30H 1IE5A 4I77H 2QSVA 1P7QA 2WUBH 4TVPE 3ULVE 1NAML 4G9FA 3SOBH 1EO8L 3HE6A 1RVFH 3RBGA 1L7TH 3VXSE 1WCQA 2JK5A 1V7ML 3VGGA 4JFYB 1KB5B 2W0FB 3KJ6H 1FNGB 5JORB 4IRSD 2PNDA 4NPYA 1QBML 5CJXA 4FTVD 5EU4A 1R5VA 4Y5VC 1MAKA 1RUKL 4OCRH 3RWGB 3H0TB 5HPMB 5IW1A 4PIRF 3QUXA 1CF8H 4JKKA 4X83A 1FFNB 4ZYKB 4LAJH 5GS0L 4LVHC 3BD3A 2KH2B 1HHKB 1WZ1H 2Q8AL 3SDXF 1MHCB 5DSCA 2FATL 3OTTA 4CW1A 5FHBH 3L6FA 2DMCA 1ES0B 5TQ2L 4M7LH 3HE7D 5GS0D 4Y5XB 4PFEA 1N2RA 2YPLD 5F8QC 4HK3J 5D2LF 2IWGA 2ADIB 2HVKA 4G9DB 1ND0B 5GGTL 2DKMA 2EDKA 5EBGA 5KTEH 4UNUA 1S5IL 2H41A 2YHGA 3S37H 4QOKB 3CX5J 3DRTB 1BREA 2YPLE 3PL6D 1A0QL 3DV6B 4JQVA 2ICES 3IKCB 4LLAA 5IMLA 1LDPH 5TDPB 4N90E 1NBZB 3LRSB 3IDUA 1KPRA 5EOTA 3IDJA 1FCGA 3NZHL 3BSZH 1BLNB 4M93B 3V7AE 3B8YA 5FOBA 3DXAB 3MGOB 3L5HA 5EWIL 2PF6A 3QFJE 4FN0A 2HJKB 1H8NA 3GUTB 1AO7E 2BNRD 5KSUA 2A0LC 1R3JB 4ZAKC 1EEQA 2EDBA 3KYNA 2R56H 2V2XB 2BVEA 5T1MA 5I8OL 1M7DB 2ATKB 1JHKH 3X14A 1N6QL 5EIIB 2VAJA 3QXAB 3S3JA 4EZMA 1FDLL 3MLPA 3T0ED 4S1DD 2P8LB 2BNRE 2OL3H 3QIBC 4LGSB 4Q6IB 1JZ6A 2X40A 4R7NA 2NY1B 4AK1A 1F4WH 3OG4B 2RCSH 3TJHD 4RGNE 1KFAH 2JJTA 4IBLT 3ZE2E 1O7SA 1VPOL 4JFDA 4NIKB 2ZJSL 4ZD3H 3SO3B 3V2AR 4PY8I 3VFSA 1FJ1A 3T0EE 3FRPG 1D9KA 2PYFA 3BO8A 3VXPB 5IWLA 1AQKH 1HQRA 1LP9B 5DJDA 1CS6A 4HIHA 2KKQA 3MLXH 5KN5A 3HAEA 5TFSL 5HYEA 4ZPVA 3WS3A 2HAZA 2VLKD 4WI3A 4HX1A 1LILA 2ED7A 3QDHA 1I1YA 5GHWL 2AJYH 3GK8H 2Z0BA 3C5SA 1AY1L 1SJXA 1DSFL 1OARL 4KDVA 2JB5H 3VH8G 1PLGL 3T4YA 2BRQA 3GSNH 4LAQH 4WI6A 5I8CA 2A1WH 3L3JB 3F7QA 2DL9A 1TJGH 3E6FB 5J9PA 2LV4A 2XQYK 4P9ML 1FG2B 1ZEAH 3SDYL 2ZZUT 2LU7A 5D93C 4GMTL 4XMKH 1MIEL 1A6PA 3QPQC 3CDGB 2VLRB 4YE4L 2FHFA 5IKCA 1LO5A 2XTJD 2R0WL 2VLMD 4DFHA 3QUYD 1QKZL 3HG1B 4QHLB 2GUOB 1CGVA 2F8VA 4EUPH 1A02N 2GCYA 3MFFA 3TV3L 2AEPL 3NIFF 1I8MA 3O2DL 4EIZC 1QACA 2LU4A 2CR3A 3MBXH 4BH7B 5F9AC 1DVFD 1P4BL 1HSBA 3VWKD 1NFIB 3H3BC 3GSRB 2XTJE 4HEME 1L0QA 2VLME 3P4OB 1G9EA 3F6LA 3MOBH 4HHAA 3PHOB 4MA8L 1PGRB 4CMHB 5HYQB 1FLRH 1KNOB 2E6QA 3BEVB 1J0ZA 4GAJL 2EDWA 3TBSA 5BO1H 1ZGLP 4PGDB 4OZGB 1JI2A 2ZG2A 2FLBT 1LO0L 1ZV5A 3PWNA 4JAMA 4OZFG 4ZFOB 5C0ND 4PRBA 3EAKA 3OR7A 4QRPB 3LMJL 2MJWA 1RJYA 1WFTA 1F6LL 3BGFB 2ZUSA 1F4XH 3MXVH 5A43C 3S9DB 1OHQA 1S7SB 3F12B 1B4JL 1ZVSB 2BY0A 5BZWA 3QIWB 5F6IB 2A6DA 2VXSH 1AGBA 1QRND 3GBMH 1MCKA 2X89D 5IK3A 3NFNB 2C1PB 4OLWH 3GMRA 1BQLH 1KB5L 5EZJA 3AXLA 4XH2B 2NR6C 5CUSL 3RI5F 4HQQL 3OMZA 4KPHL 4MD0A 4KMQA 5ETUA 3KPNA 1MLCA 1HINL 2HJLB 3LH2H 3X13B 1J5OH 4WUKL 2XKUA 3CSYA 5SWZB 2EE3A 4AT6B 3LS5H 2VISA 3KR3L 4UBDC 1OD9A 4H26B 4IRZH 4QNPE 3AREA 4LASH 3BP6A 1WUNT 1BVLB 4L4TA 2AKRB 1YEGH 4PLJD 5I76B 1ADQL 3CJJA 3P9LA 4MA7H 5I18H 1ZT1A 1DBKH 4X6EA 4I3RL 1MY7A 3CVHA 3SE4A 3MA9L 3V4UH 5F9WB 3A67H 2YD9A 2VITB 3NCMA 4S0TD 4MNGB 2XZAH 1A47A 5E0QA 5D6CA 3BDYL 4OD1H 3WO4B 1U8OB 2VJXA 4LVNC 4QOKD 4XCEA 5C3LD 1K8IA 1WEJH 1YJDL 4FNLL 4ONGH 3EOBA 2APBA 3IB4A 4NQCB 1A9EB 3S35H 4X5XB 1IM3A 3BH9B 3OF6D 4PJ8D 4X6FB 5MENB 3QG6A 4XVTL 1CWVA 1B0WA 3MRFB 4ZODA 3BH8A 3L3KA 3PDOB 1S9YB 4QOKE 1XF2A 4Q58C 4G42B 4LOUC 2FYYA 4KK6D 3V4VH 5GS3A 1D6EB 1D5MB 4I0PC 3U4BL 5T5FL 2A6JA 3VFUB 2GK0B 3OBAA 2BVQA 5D7JB 3CXDL 1NEZG 4M00A 1INDH 3IETB 4WV1A 5KVEL 4LDLB 4ZOEA 3TVMA 1IQDB 3T4AA 4MCZA 3VG9B 2G60L 1U8JB 3QPXH 5E4EC 1RULH 3T2OA 5IBTL 5IEKB 4EIGB 3DHMA 4TRPH 4OGYL 5DF0A 3MNWA 5ICXA 3DXAE 2IADB 3MGAA 3EYQC 3QXDA 3C8KB 3MCLL 3H8NA 5EU6A 5E1AB 1UCBH 1KCKA 4TUOB 3QNYA 3RWEB 2ZCKH 1ZLUK 5TDOA 3IFLH 3VFWA 2E7HA 4GMSH 5I6XC 5T1LA 2CDEB 5H35A 2W92A 4JVUA 1IGTA 3L95A 3HC4H 4PJBF 2VQUA 4N8PA 1XCTA 4GBXC 1RIVL 3UTTB 5DQJB 1F3JB 3IDIA 3T0BA 4O5LH 5EBMB 4Y4HC 1BWWA 3S98A 3VH8B 2A6IA 2QSCL 4RRPA 3SKOA 3ARYA 3N85L 3N1PC 4HKBA 3K81A 5BVJA 1ZHKA 1FN4A 4K2UH 3DTXA 4GRWF 3IYLW 4RMSA 3MRHA 3OXRB 4BYHA 2Z9TA 4BM7A 1KV3A 4TOYL 5D96B 2AABL 4HULB 1OWRM 4HGWB 4HZLA 1IAKA 3QXTA 1LP9E 4PJGA 3P4NA 2DDQH 4KK5D 5KS9A 1PG7L 1CVSC 3VFMB 4XAWH 3LN5B 4XXDA 3RWDA 4P2QA 1BFOA 2X42A 2MWCA 2YSSA 4U1JB 3I3DA 5F97E 3IU4H 4L4VB 4D0BB 1I3GH 4GRLB 3MYZA 5HGBB 4HC1H 1N0XL 3EJZC 4JO3L 1IAIH 5CEZL 2IGFL 3Q0HA 4QO1A 2DQFB 5CEZD 3QWOB 4HPYL 3NA9L 5C07A 4HCRL 3V4PL 1HCFX 4RNRA 2X05A 1MRCH 3MGTB 3HI5H 3KPMB 4J4PA 1NUGA 1FNAA 2X4PB 3O6FC 4R0LA 2MKLC 4XPBL 1CG9A 4OZFB 4X6DF 3X17A 3ZL4H 1GOHA 1F8TL 2CKBH 5CEZE 4DGIH 4IMLA 3HS0B 2VLRE 5J13B 1ZGLB 4M6OL 1F4HA 4XP9H 3PGCA 3GB7A 4XAKD 1VEPA 2R1XB 3HG1E 4UTBH 3H9ZA 4GUPB 1UACL 3DURB 3MJGX 4NZRH 4C83A 4ZFOL 3ZKNC 3D39B 2E9BA 2H2PD 2MFNA 1IC1A 4P2CG 5HHOA 4UQ3A 1G6RH 3U36A 4KHXL 4XAKE 3HPLB 2Q7YA 5IJVA 3INUH 2GSGB 4OIIH 4OBRA 3RAJL 4JY4A 1RUPL 3CLFH 3OAZK 4XVSL 3STBA 4PGEA 1OTTC 4WU7A 4ORGA 5C0IA 1Y18B 1YEKH 2VN4A 4OZGE 3K2UH 2L4OA 1TTFA 1YEHL 3B6SA 3V6OE 2R2EA 2YEZB 3GM0A 3KDMA 1BFTA 3BISA 3GHBH 4ZUUB 3QFDB 2APFA 3JWOC 5IJKC 4QRPE 4XVJL 5FECA 3GIZL 4YHLH 2BMKA 5C0JB 2VLJD 1DL7L 2ZOKA 4NKDB 1V5JA 1DQJB 5DC0A 4JFOB 1AD9A 4NZTH 2VXUH 2DIBA 1PZ5B 4LP4A 4MCYA 3S8WA 4YWGH 1OQXA 3QIUB 1A6ZA 3BP5A 2DKUA 2CO6B 1D7FA 4M4PA 1IGCL 1JUFA 2X1OA 4CVZB 3V52L 1HKLL 1IM9D 4DQOH 4Q9QL 5AG8A 1A5FH 2HH0H 4W70A 1MVUB 5IOPA 1AKJD 5C9JA 5DXWA 3ZT5A 4U6HA 4MLSA 4HKJA 5GS1A 2DD8L 3SKJL 5EUOF 1QFWL 2B5IC 4YNYB 4U05A 3O2VL 5SWZE 4HWBL 2JJSC 1OTUD 4LLVA 1AGFA 2BXZA 2WK2A 2G9HB 3QA3B 5J6GA 4Z0BL 5JW3H 4UV4H 2JB6B 4K9EL 3P2TA 1F58H 1QPPA 3RNKB 5MERA 5EC1B 5KSVA 1NEZB 4ETQA 4UNVA 3KHQA 5AD0A 3CH8A 4WW2A 4Z95L 3ROLA 5J12B 4NQCD 4FQXC 3GMNA 1WIOA 4MNGE 4PRNA 2A74B 2WBJC 5CJBA 5IEHB 1MRDH 3WN5C 3MJ8B 3PGDB 5L9DL 2EXYC 4LEXH 2X4OB 1WZKA 3C5ZB 2P5ED 1BJ8A 1LEIB 4NQCE 4TNVF 1RFDL 3HFML 5MENE 2DM7A 3V5HB 4MX7B 1J10A 4FXKB 5CZXC 2WUCL 3LEVL 3M8OL 5JOPE 3S88H 4NOBA 1A7NH 4QEGA 1T22B 1CDCA 1P5UA 3FFDB 3G6DH 4L3AA 3S7GA 1MI5B 5KG9B 4LGRB 3QO0B 5IMOA 1ZLSL 4BELD 5E94B 5ADOL 1PSKL 2APVA 4JZOA 3D87B 3KLHD 1TCMA 3L5JA 4Y19B 3EO9H 1EFXA 3O41B 1NGQH 4X6CF 1CLYL 4QRRA 1UXWA 2NX5A 5IR1A 3QP3A 2E5EA 1I8KA 4OD2A 2FBOJ 5DD5L 2GIYA 2W1NA 4L3EA 3TYGH 1TNNA 3HE6C 2MTPA 1AE6H 1UM4H 4K3DL 1YY9D 4F7MB 4NRZA 3BHBA 1HI6B 1MAMH 1GGTA 3RZCA 1VESA 3SE9L 1P4IL 1OAKL 1CDYA 2BY3A 4M7JH 5CJXC 4MJ6A 2XNAA 4PJEA 5IW3A 2XICA 4XCNB 4XNMB 5I66A 2APXA 2RFXB 3QUXC 1IARB 1RZ7L 4KI5C 2YRPA 2FDBP 4HS6B 3UTTE 4APQA 1KCRL 1NGWB 4V1DB 3DMMA 3DX9B 2OXHA 2XQBL 4X9IA 3UC0L 3PWUB 3MRIB 3C2SA 3OZ9H 3SKUD 3VI3F 2R4RH 4ZUTA 4JFXA 4NQSB 4ODWB 2R9HD 4QHNB 5E9DA 1PD6A 1IFHH 1FG9C 1FNSH 1INQA 4NO3B 4EUPG 3FFCA 4L4VD 5BW7C 3U46A 4NZDA 4R26L 4E0RB 1CDUA 1N59B 1L7IH 4HUXB 3F58L 3AMLA 4AMKH 4JQVC 3BPNB 4L8DA 2GHWB 4KK9C 1DCLA 4FG6D 4NC1E 3LKRB 1FV1A 5DJCB 3MRRA 4OGXL 1FP5A 3ZE1E 2YUZA 2D3VA 5EH1A 4N0CC 1A7PH 2AJVL 2W9EL 3L1OH 4Z9KB 3I6KA 5EORH 5JDSB 2OR8A 5DHXB 4LCCB 1G7IA 2JELL 3HZYB 2ED8A 1MUJB 5E95B 1I9RH 1UH3A 4J7RA 4N0UA 2VDNL 3IXTA 4NP4L 5J1AA 4YDLC 5L2KA 2EC8A 4PJDB 2H26B 4LKXB 3L3GB 3ET9F 3FB8B 1HWHB 2AJSL 3L5XH 1UFUA 4NZUL 5F9JB 1K8DB 2F53B 1YUHB 4ZOAA 2FSEB 1QRKA 2YZ8A 1X44A 2YA0A 4J3WA 4DKAA 3NVQA 2X9XA 2R4SL 4JQIH 5C09B 1EDQA 1W72A 3TPKA 1G84A 3BXNA 4AH2A 3MR9B 3QUZA 3BZ4B 2KZWA 2JJTC 4X7SL 2NW2B 2W38A 3ULVF 1JNNH 3D39E 2V2WB 2NY4C 1GZQA 5KSBB 4LBEA 4WUUA 1YEJL 1D9KC 2X10A 3FOMB 3VMNA 3U7WL 5IF0A 4ZFGL 5IWLC 1T3FA 4GAYB 5CEYB 4NN5C 1VGEH 1UGNA 5DA0B 5DMKA 1IC7L 2K3TA 5EOQL 1YEIH 5DJ2B 2F19H 1ZANL 4PG9A 5C0GB 2IPKA 4MNQA 5CSBA 4I9WE 3CUPA 3FT3B 4K3JH 1MJJA 4G8FA 5F1OB 3QIUD 2J8UA 1PY9A 5E56A 2YD5A 3TO4B 3C09C 2OR9L 1ONQB 1UQSA 5HHXL 3HAEH 5JA9A 4R7DB 2CPCA 4IOIB 1IRAY 1QA9B 3QEUA 1I9JH 3ILPB 4P2RB 5K33A 1AJ7H 3EDEA 3UTPE 4HV8B 1ZVYA 3SKMA 5DJ8A 4Z7QE 4LDEB 1G7HA 2B2XL 5C1MB 1O0VA 3L3IB 4LLDB 3EBAA 3M1BB 1BD2A 2DKSA 4JM4H 1C5DB 4UB0H 2UYLB 3SDCA 3PDGA 1F90H 2UY7A 3DROA 4ZAKB 2EKSA 4XWOC 1EO7A 4Y5YB 4KKNA 5C0RH 4CJ1A 1EAPB 4FMKA 4O2CB 3L7FA 4PJFB 3SCMC 4IDJH 2DWDB 2X1XR 4PJHA 5EPMA 1V3MA 1JF6A 5GGRA 3F7YB 4UDTA 1T6VN 1OPGH 3EYOB 5CMAB 3P4LA 1YEFH 4S1RL 1DDHA 1YYMH 1PBYA 4NNPH 4LNRB 5I16B 1LMKA 1Y6KR 2C5DC 3C5ZD 3WNKA 4NN7C 3KNBA 4CAGA 1S9VA 2BSTA 4KJYB 2PW2B 2UUDK 3ALXA 4RIRB 4HXAL 3LCYA 5HVGB 2Z91B 1CI5A 4KVNL 3QQ4A 3WL9B 3SE8L 4YXLL 4P3CL 1C5BH 4AZ8A 3HCVA 1W0WA 3P73B 3MUJA 3EYFB 3IJYA 5FUCC 5DJ0A 1ZMYA 2GJJA 5TE7H 3JV6A 5D71H 3HC3L 3STLA 4PJAB 1A6WL 2BERA 1OB1B 2ZUTA 1CFVL 5KOVC 1N7ML 4Y19D 3BIBX 3FCTB 3GSNB 2ZG1A 1MJ8L 1QTYT 1BZ9A 3UXFA 3MV7A 3LVEA 1MI5E 4P5TA 5EFIA 2EDTA 5HGDB 4OZ4A 1NGPH 1EMTH 3PWVB 5FO9B 1XGTB 2XG4A 3B9KD 1T5XB 4FQIH 5C2BH 1NCDL 4Y19E 4ZUSB 1DBBL 3CCHA 4XPHL 4HF5H 4QTIL 5D7LD 4Q0XH 4H0GA 1AGEA 4EUPB 4OLEA 5I30H 1XF5A 4TSAH 4KGJA 3CPLA 3AREC 1UM5H 4P4KA 4TTDC 3UYRH 4KZEL 2O5YH 1UM6L 3CFIC 3HMWH 4V1DD 4M4RA 5GSRA 1QR1A 4FFYL 4LF3B 3AGVA 4LEOA 3SE4C 4MNHB 3T08A 1T03L 4QWWD 3QCVH 4P3DB 2EIZA 3B5HA 4PS4L 1FVCA 4V1DE 1Q9WB 3H9SD 4K3GA 1XGQB 3ARUA 2OP4L 4UI2A 5DRXA 4ELKB 3OX8A 3CVHH 2H2SC 3V79C 3DUHA 1QFHA 2B1HL 4PD4J 2J88H 5D7IA 1YN6A 1P7KA 5DRNA 3P30L 3B4NA 4I77L 3NFPB 2WUBL 1KTLA 5D1QC 2RQ8A 1OLZA 4RBPH 1RVFL 1U91B 4ZG1A 1L7TL 1EVUA 1KN4L 3P11H 4G5ZH 4YBLC 1HYRC 1KBGH 2J2ZA 1RY7B 3EO1B 1I7RB 2QBWA 3GBNH 4JB9L 2YWZA 4WV1C 3L3OB 3TVMC 3M17B 4E41D 5JTWA 5TQ0L 4ZXBA 2D03H 1IL1A 1CF8L 1U58A 5LGJB 3BRDA 5ID0A 5E2WH 2D9CA 4QRSB 1RZIA 5DFVC 4IOSD 4XPFH 4RGMC 1JFQL 4NHUA 4HFUL 2R0ZH 4M7LL 3WD5H 5D7SH 32C2A 1UCTA 1T0MA 3CD4A 4Z7UB 5C09D 4NDMA 1S9WB 2XIDA 5KJRH 3QEHA 2YZ1A 4PJDE 2Z8SA 4XP4L 1K4CA 1JNLL 3T77B 2GJ6B 4KFZC 3VXOB 3PXHA 3CVIH 3QJFA 2F53E 1KTRL 5IMMB 5HYJB 2X7LA 2MCPH 3BN9D 3WFDH 1A3QA 2IPTH 3PHSA 1Y6NR 5C09E 1LDPL 3HNSL 1F2QA 4GW1B 3PJSA 5LXGH 4JGJA 3BSZL 2JE8A 1HEZB 4JKPH 3OKEB 4LVNB 5KSBE 1MFAH 3EO0A 4PD4K 3TH3T 4X8XA 5E6YA 4U31A 1RZFH 1L4IA 1CXEA 1UENA 1CD1A 1J88A 2X4QA 5I2IA 3TO4D 4OCLC 3TCXA 1WISA 4W6WB 4PJ5A 3QULA 4LRNH 2VDPH 3VXMB 1I7TA 2R56L 3ETBF 4YIQA 1LEKA 3CZFA 4P2RD 5GZOC 4P9HC 1EEZB 4I0PB 1ACZA 2AERT 3HNTH 4ZPTA 4AYFA 4A6YB 3Q48A 2YRLA 3O3AB 1BECA 2XTLA 2HFGH 5JOFA 2PW1A 1PQZA 3K7UA 5JXED 4P2RE 4P9HH 5KVMC 2PXYA 1U2CA 2I9LB 4Z7NF 3H7LA 2ATPB 4HW6A 4J4PC 4R0LC 4D8PA 4DVBB 2R2BB 4JM2A 1ORSA 3MNZA 3S96A 1J1XL 2IH1A 2RR3A 3DVFA 4CUCA 4Z77A 2SEBA 2HFEB 1FFOA 3MLXL 2EYSB 3QWRA 3QDGA 3WBDA 1XH3B 4PJFE 5ISZE 2NY7H 3EHBD 2AJYL 1NBVH 3MJ9A 5C0DB 4Z7WA 4Y4HB 3SJVB 1TDQA 3MCKA 4XC1L 4KROC 3IU3B 1JVKA 4QT5B 2JB5L 1FGVH 3WMSA 4OI7A 1X5AA 4JN2A 3GSNL 3VFRB 4LRIC 4JCLA 1IGJA 4LAQL 4MJIB 1TJGL 4HLJA 1JPFA 4WJ5B 1KEGH 4WTZA 2DWEA 1ZEAL 3DSNA 1N5AB 1DJSA 3BW9A 2FO4A 3C60A 4JO2L 3HI1B 5J6HA 4R96A 1UKSA 3KGRA 3VA6A 4PJAE 4QHMB 3VWJD 4JO4H 3IS1X 2MNUA 1F4YH 3BMWA 2FIKA 3QR2A 4NRXB 4JFPB 1AP2B 4JY5H 3V0WH 2CDFA 5IB1A 1PFCA 4YDJA 5HJ3B 2ZUWA 2Z8WC 3D3VA 4GLRH 2P8MB 2XKNA 3FJTA 3RWHA 2X1QA 1J1OH 3THMH 1LP9F 3DOSA 4IMKA 4P46D 2CKBB 4YHIB 1G7JA 4OFYA 2OTPA 5GS1C 1FLRL 1U8PA 2J12B 3FQTA 4G8GD 1P5VA 2ZUYA 3O6FB 2H6PA 4FP8H 1P2CA 3G6JB 5ALCH 5TDNA 2DLFH 1UWGL 3QQ3B 2BNQB 3D0LA 4WHTB 3DX8A 3LN4A 3T8XA 3GI9H 1QFUL 1XGPB 2CUIA 4RFEB 2FB4H 5FO8B 4XCYB 5GGSA 4WW2C 3IFOA 5DUPH 3GBML 3SGJA 2EH7H 4N0FB 2Y7QB 1UYWL 1UWXH 2D31B 4OLWL 4PRIA 1BQLL 1WWWX 5KOMC 2FX9L 1QSFB 3OAYK 1JRHH 2FJFA 4QHUB 3LH2L 1J5OL 4X99A 1A2YA 2OQJA 1DANU 4YFEA 2VUOA 5DHYB 2D4FA 2XYCA 3SY0A 2ZUQB 1I3VA 3W9EB 5HHNB 1T1ZB 2WIMA 4LASL 2E27H 4MA7L 5I18L 4N0YL 1FBIH 1DBKL 3DJ9A 4IRSA 5EU7C 5T5NF 4NO0D 4FTVA 3WIHL 4NQXB 4FQCL 5D1XD 3V4UL 1UT9A 1PW3A 1Y0LB 2EEBA 3A67L 3BP7B 2IQAB 4O2EB 3GSOB 3I3EA 4K71B 4KKAD 4LMQI 3GSVB 3VW3H 4OD1L 3GNMH 2XZCH 3EJJX 4JFHD 4WFGD 5EZIH 1RJLB 3X12A 4GJTB 1GGYA 2C1OB 5HYJD 1WEJL 2JCCF 3P77A 4ONGL 2IALA 4GG8B 2EC9U 1IAIM 4WHDA 1KCVH 2YPLA 2C7UA 4XX1G 2B5IB 4DKFH 3CMOH 2ADJB 1DANT 2DQTH 2ICEB 2ZCHH 4LPUA 3QRGL 3W0WB 2GJ6E 4F9LC 5GGTA 4WFGE 3FT4A 5L8JB 2Z92A 1YMHB 1S7QA 3V4VL 5HYJE 1X7QB 4HS8L 3HR6A 5F3BA 4APQC 4YDVB 3TBTA 3E1F1 3PL6A 1J9CT 3DMMC 2ZOLA 2XOTA 2VXQH 1INDL 1X4ZA 3DVNA 4FQXB 5F88A 4JANA 2HT3D 2WLZA 3NTCH 1RULL 1DUYB 1OSZB 1RIUH 3GJEB 4KTDH 2OBGA 1IGMH 3VXMD 3UJIH 3WN5B 1CTOA 1XCQA 2N1KA 4A6YL 1YZZA 3P3YA 1MCNA 2H45A 5HYFA 1N3NB 2EC9T 3E0GA 3ULSA 5HXMA 1HYSD 1UCBL 3LSOB 4HUNB 2OMNA 4MJ5B 1JJUA 1KCSH 1DR9A 3AS0A 3ARDA 4LMQE 3ARBC 3IFLL 4GMSL 3RGHA 3LV3B 2X1PA 1GGIH 3VXME 4NT6B 3QO1B 2G5RA 4QXGL 1G9NL 5DJAA 5DJXB 4DN4L 3T1FA 1VFUA 3LKNA 4BFIA 3PUCA 4O5LL 4RGOL 4GOSA 3T0EA 4EXKA 1F11A 3E6HB 1A1NA 3GJFA 4DUVA 2FJGB 3OL2A 3W82A 3CFJB 1IAII 2P8PA 1HE7A 1MFDH 3WLBB 1P7QB 3VCLA 5DS8A 4WW1B 2VSDA 4NN6B 3TNMA 1SVZA 4PJ7A 5DYOA 4N8VG 1CU4H 4L29A 1F42A 3I85A 2JK5B 2EDOA 4OT1H 5E08H 3SJVD 3EJYC 4CVUA 2DDQL 5I1EH 1RAMA 1U8IB 4WEUD 3TN0B 1BM3H 1R5VB 4DTGH 4OZIA 1T04A 3SO5A 3QUZC 5C0CD 4MJID 2VNCA 3QUXB 5GRYA 3IJSA 3KYAA 2VLKA 3GI8H 1I3GL 1NBYA 1ZKAA 1SYSA 4HC1L 4WHYG 1S3KL 2YUVA 5KANI 4CW1B 5DSCB 3L6FB 4XC3L 2RGSA 4U1IA 3SJVE 1AR1C 3MLWH 4L5FH 8CGTA 4RAUA 4UILH 1W72H 1G1YA 4DVRH 5CZKA 3D25B 5FV2A 3UROR 3EOYG 2V5YA 4H5SA 3VGFA 1N4XH 4DUXA 3MRMA 1CLOL 4PJIB 5MEQA 1FAKT 4IOFD 1MCRA 3ZL4L 2CKBL 4I18B 4DGIL 2PCPB 4HBCH 5IMLB 4XP9L 3EFDH 3VFNA 5EOTB 1WTGT 3IDJB 4UTBL 1N8ZA 5E2VH 3IAQA 5I19H 3WDJA 5CHNA 3QUYA 3KPOB 2H9GA 1NDMA 4JJ5A 3FO9A 5DT1H 4U0RC 3TZVD 5FOBB 3LD8B 3RX8A 4JFFD 1Q0XH 4XBPB 1DVFA 4X6BB 3VWKA 3A6CH 2AEIT 3INUL 4FHBD 5KSUB 4YDLB 3SDCC 5BJTA 4CN4A 3CLFL 4HFWA 5AZEH 3KYNB 1TITA 4DZBA 4RMRA 3G6JE 5F1IB 3ISWA 2YWYA 1SBSH 1UA6H 2BNQE 3NBNA 3GHBL 1KJ3L 2JJUA 3EDFA 3VRJA 3OHXA 2Y6SC 4NQDE 4YHLL 1F3RB 3VXUB 3VI4F 4Z7VF 1AHWA 1DLHA 2PR4H 1K3ZA 1FYHB 3T2NH 3ZDXE 1J7VR 2C3VA 4PP1D 1HH6A 1HILA 3O0RH 4NZTL 1CBVH 4JFDB 5FAAA 1OAYL 2Q6WB 1X9QA 3JWOL 2NY4B 1H8SA 1QRNA 2Q3AA 3OPZL 1D9KB 1YPZA 1WCBB 3FAWA 3BO8B 3CIQA 4DQOL 5E5UB 1I8IB 1A5FL 2HH0L 1JI1A 4NN5B 3TT1L 4XCFL 3WEXB 1HQRB 1QSFE 1JV5A 5DJDB 1T20A 5IBLD 3CH1B 4HIHB 1G6VK 4JFYA 3SDDD 5KN5B 1U93A 4X4YB 3WS3B 3G5YA 1JK8B 5FYLL 1I1YB 5CS7A 3BPCB 3RWGA 3GMQB 4C57C 2FZ3A 3WHXB 1TQCC 5FYLD 4UV4L 1VA9A 1J0YA 3I75B 1AD0B 1MHCA 3LKPB 3C09B 1TJIH 1ES0A 2DTMH 1AC0A 4OM0H 4Y5XA 5I8CB 3RHWK 2BVTA 2ADIA 3U79A 4G9DA 5L88H 4WCYL 1P84J 4BQ6A 4CKVX 4CMMB 4X8JA 5FYLE 1WSST 2P44B 2YRZA 1MRDL 5LGKA 1QR4A 5GIRB 1HN1A 2H32B 1A6TA 4QOKA 3FO2B 2A9NH 4P4KC 1HIML 1Z3GL 4GXUN 5AYUH 5T3ZL 1ZLWK 3DV6A 1J05B 5IKCB 5IHUH 4R3SB 3QXWA 4PJ8A 3OF6A 1FVDA 2DTSA 3W0WE 4FQXD 1NBZA 3SCMB 5T3ZD 2DLGA 3C5JB 2GCYB 3MFFB 3S88L 4ZO9A 1VERA 4YDIH 4K3EL 1A7NL 3ARXA 2FHBA 3G6DL 4KVCH 1MAJA 3B3IA 1JPSH 1HSBB 3ARSA 1B88A 3NMEA 3QUKB 2EXYD 1NCAH 1FIGH 4YHKH 3MGOA 3LPFA 5L6YH 2YPVH 4HHAB 1OAXH 4YDKH 1NGQL 5T3ZE 4G6FB 3K1KC 3TBSB 4O4YH 3PWNB 3LZFH 3U1SL 1X4XA 5GJSH 5C92A 3TYGL 4N8VB 1AE6L 3WHE1 3TPUB 3RWJA 2WM0A 2EDFA 4MDJA 3QXAA 3PGFL 4KY1L 4NGHH 3R0NA 4M7JL 5BZWB 5EU5B 4FOMA 4Y89A 1AGBB 4ZXBC 2IQ9H 4H8WC 4Y8AA 4I4WB 3MOQA 5IK3B 1NKOA 3GMRB 3MCG1 2OS7A 5F71A 3DETC 1G1CA 1P84K 4QRUA 4MD0B 3BWAA 3OZ9L 1KF9B 1MLCB 4B7IA 4H8WH 4WO4D 4PJ9A 1QSVA 3G08A 2GAZA 4OLYH 3TN0D 4YX2H 5FUOH 4P59L 5FDWA 1IFHL 1FNSL 2J8OA 3BT2L 4HDIB 5DJ6A 3AREB 3LPGA 4TSBL 2B0SL 2EXWD 3BP6B 4XHJD 4L4TB 1L7IL 2NY6D 2BY2A 1P4LA 1ZT1B 1LDSA 3CVHB 4ERSH 1A7PL 1MCWM 4KI5E 4U6YB 3Q3GA 3L3JA 1AGCA 4XZUB 7CGTA 4XNXH 2ZWLT 1DQML 4GSDH 5ILTL 4FQHB 1FG2A 4F2MA 1I9RL 5HI5C 1K8IB 3LKSB 2IANB 2HVJA 3D9AH 1WC7B 4DFIA 5MEOB 2HA1A 3I2CH 1S7VA 1K2DA 3BH8B 3L3KB 5D1QB 1XF2B 3L5XL 4QHLA 3IDMA 3RPIA 1NFDF 2FYYB 3MJ7A 1PX4A 4YBLB 4PJIE 4QXTA 3IFPB 2XG5A 1C7TA 2IPUK 1CZ8L 5CGYC 4JQIL 4WV1B 3DGCR 1NFIA 3TVMB 1CDHA 3T4AB 2HTKC 4MCZB 4OM1H 1JZ4A 2D0GA 5HHMD 5F1KC 3PHOA 1E4WH 5HYQA 4XMLH 4NOFA 1DBMH 1JNNL 5T3XH 3QXDB 4RGMB 4P0DA 4NCC1 4PGDA 2WWMD 4J3UA 4WEMB 4OQTA 4YC2B 3UZEA 1J0KA 4X80H 4JM2C 1VGEL 5TDOB 1WF5A 3VFWB 1F6AA 3VXUD 4XP6H 4YBQC 5H35B 3S34H 2GFBA 1IGTB 4F80A 3QXUA 4K3JL 1RJCA 4JVWA 1XCTB 5D5MF 4WU5B 4MGXA 2R0KL 1OAQH 3QCUL 3EW3B 3IDIB 5IQ7H 4OZHB 3NFNA 2C1PA 5EZOH 3IDXH 3VXUE 4XH2A 3HMXA 3SKOB 2KPNA 4HKBB 2VLJA 4PB9H 2M26A 1ZHKB 4WNQA 5MI0C 1FH5L 1FN4B 1I9JL 2OK0H 3ARTA 4JFDE 2HJLA 3MV9D 3MRHB 1AJ7L 3X13A 3MJ9H 4O58L 2B1AL 4JLRA 3BOVA 1UXSA 1FSKC 4M6AA 5IVZB 1N6UA 3ME0A 3C60C 1B90A 3BD5A 4JM4L 4UB0L 1IM9A 3R06B 1IAKB 5EO9A 1FFPA 1MH5B 2AKRA 1AKJA 3HNVH 1F90L 5KS9B 1WITA 1K6QH 2NY2B 5HY9A 5B21A 4DEPC 1CDGA 1BFOB 4Q9BA 2YSSB 3HPJA 4IDJL 1NAKL 5KSBF 3TCLA 5IB2A 1TLKA 4HWBA 3MRBB 4XPGH 5DK2A 1OPGL 2VAAB 5DD0L 1YYML 4NNPL 4I5BB 2Z31C 1CYGA 4RNRB 1NCCH 3U82B 4XWOD 1EGJL 5FO7B 2ZNWA 1A9EA 1M05A 2K7QA 4NQCA 4X5XA 5GRJH 4B53A 4R0LB 4YGAB 4R2GD 3SCMD 1CG9B 1C5BL 4F58H 3RY4A 4HKXB 3MRFA 1R5IA 3PDOA 4PB0H 5TE7L 1BP3B 4G42A 3RGVD 4IMLB 4N68A 1DEEB 3PGCB 2VDLH 2P5EA 3GB7B 3VFUA 5IFAH 2GK0A 3TYFB 5TF0A 4BUHA 4PGBA 4G6FD 4HBQA 4XB7A 4C83B 2NW3B 3VGBA 3SGJC 5DRWA 5E4IA 5HHOB 1EMTL 4UQ3B 1JL8A 4EQ3A 4FQIL 3H2WA 4HUMB 2JF1A 2Q7YB 5C2BL 3HR5A 3O4LD 3L3DB 2KQNA 4NUGH 1AR2A 1M7IB 1B4RA 4TUOA 4PGEB 4HF5L 2EZ0C 4ORGB 5C0IB 1A1MA 4Q0XL 3HC0A 3B6SB 1V7NL 5FUCE 3KDMB 1G7MA 1FC2D 4HPOH 2UVEA 4CU7A 5I30L 3OR6A 1TTUA 5DQDH 1UM5L 3UYRL 2JLLA 2WAHA 5I74C 5FECB 3HMWL 1FZKA 4QRTA 5LCVH 1E6OH 1KENL 1I85A 1ZAGA 4C4KT 1DBJH 4ALAH 2ZOKB 4BQ8A 5C8JB 2R23B 3K8MA 4IRSC 2CKNA 5C7XL 4OF3A 4S2SB 2BNUA 4A2LA 3QCVL 4MCYB 4QKXB 3F7VA 1A6ZB 3BP5B 2BVUA 1JUFB 2BOBA 3DUSA 4YHOH 1J0IA 4BSWA 1EO8H 4XBGB 3R1GH 4U1LA 3CVHL 5E00B 5GS0C 4HKJB 5GS1B 1V7MH 2DQDH 1F3DH 1KELH 2J88L 5HGGS 1QBMH 1NL0L 3LN5A 4LLVB 2Q8BH 4MQ7B 4U1JA 4GH7B 5J6GB 4L4TE 4L4VA 2NLJB 4D0BA 3P11L 5GS0H 3D18B 4LSSH 2Q8AH 4MYWB 2FATH 5MERB 3PL6C 4J1UA 5TQ2H 1XGYL 4HIXH 2IAND 4ETQB 5AD0B 3GBNL 4MHHI 1JGVH 4WW2B 4I13B 5C6TH 3ROLB 4FFVD 3JTSB 5GGTH 3GMNB 3OJDA 3QWOA 5J11B 3UP1A 4M1CC 4PJCF 4FABL 1S5IH 5C6PB 3DIFB 5D1QD 5E2WL 2V9TA 3KPMA 2X4PA 5BZDB 2R0ZL 2Q86A 2IANE 1A0QH 1BBDL 3UPRA 4LPTA 3UDWA 1NC2D 3ARDC 1ZGLA 3QH3A 1B6DA 4PJBA 4KQ3L 3NZHH 2YUXA 4YLQT 2ITCB 2MCPL 4ELMF 5FB8A 2PO6A 4JZOB 2ICWJ 2IPTL 5GGRY 4S1DC 2H1PH 1EFXB 3T0EC 5EWIH 3FOLA 1UXWB 1XGRA 2W07A 3VXNB 5IT2H 2NX5B 3HPLA 5IR1B 4YXHH 2FNBA 2GSGA 1I8KB 1KT2A 2I26N 3TJHC 3N9GH 4Q9CA 4W6XB 4C56B 4JKPL 4RMWA 4L3EB 1MFAL 1JHLH 1HHGB 4NRZB 1RZFL 4KU1A 5BOZG 1GXEA 3GJFH 1N6QH 3SDAC 2AP2A 3QFDA 1FDLH 4P2OD 4PRPD 2R1WA 4L3CA 1MNUL 1A6AA 1TXKA 2XNAB 2VE6A 4PJEB 2EE6A 5C0JA 4NKDA 4LRNL 1MLBA 1W0VA 4JFOA 1VPOH 1RJZA 1PZ5A 2ZJSH 3QIUA 3HNTL 4YH6A 4OZHE 3B83A 2YXFA 1GGBH 2ZPKH 1E28A 4HIJB 1K4DA 4JG1L 4JFXB 2HFGL 4ONOA 5B38G 5I73C 5JHDD 2NY2D 2FR4A 5DTFA 5E9DB 5LKNA 2BOCB 5IIEA 4X6DA 3RU8L 3K1DA 3ULUL 3RQ3A 2AI0L 5KAQF 1AY1H 3ULUD 4L8DB 1DSFH 3ARBB 2YKLL 5KS9E 5E70A 4Y8DC 2P4AB 5EC1A 3MRRB 1PLGH 2XTJC 3I6KB 3QUYC 3BIKB 5JA8B 4LARL 1KXQE 5D6DA 2EYRA 1CFSB 2X4RB 5JPMA 3ULUE 2A74A 1Q8MA 4N0UB 5JIHA 4KRPD 4CU6A 1DVFC 3VWKC 5IVXF 4R6UA 3JVGA 1FGVL 1CE1H 5J1AB 2YA1A 4M1DH 3C5ZA 3C87A 5L2KB 1KTDA 4POYA 4GLRI 1QP1A 2R0WH 4MMXC 3CK0H 3V5HA 1KEGL 2CXKA 1QKZH 2NCMA 1BWMA 3ZHLA 1HOCB 2AEPH 4LFHG 1HQ4A 1A4KB 3QO0A 4K7PH 2XY1A 2R1YA 1P4BH 2J6EA 3BXNB 1AHWC 1UEYA 3QUZB 1F4YL 5JZ7D 2GY5A 2R2CA 4Y19A 2V9QA 4MA8H 5T1KD 3RUGB 4KI1A 4GAJH 4OCSH 4GO6B 1M71A 4LBEB 4YR6B 2EDYA 5HHOE 5TE4H 5IF0B 1CGXA 1NMBH 1J1OL 1JZ8A 3THML 1T3FB 3B9KA 2X4SB 3RX7A 4F7MA 3QI9B 2CK2A 5EUOA 5DMKB 3FKUS 3LEXA 2HTLD 2BHZA 2EDLA 4BZ1H 5IGXL 4XRCA 3MLVH 5D7LA 2IPKB 4MNQB 4MXWH 5ALCL 2DLFL 3ARRA 4G8FB 4NHCH 4XCNA 3QUMA 4XNMA 1JRHI 4K8RC 2J8UB 4NQEB 3KXFD 4ZNEE 4HS6A 4R8WL 4PLJC 2Y06H 1NGWA 4V1DA 1UQSB 4KJQD 1JGLL 3WFCL 3ESVF 5CUSH 4MA3B 4EN3B 4HQQH 3PWUA 3MRIA 3NOIA 4XHQA 1TJHH 4PTTA 4U0RB 4TSCH 1IKFH 4MB3A 2EH7L 5DJ8B 3SKMB 3QXVA 1G7HB 4OI9A 2LTQB 3S5LG 3H9SA 5FA3A 3SDCB 1G7QA 3DROB 1JRHL 3VXRD 2EKSB 5D2NA 3CFKB 2DQUH 2W0PA 4R97C 3S97C 1DFBH 4HXBL 4CDHA 4PJ8C 1P6AB 4M8VA 3ILQD 3L7FB 5DMYA 3B2UC 2NY3B 1YN7B 5EPMB 3MRLA 5GGRB 4UDTB 4D9QD 5JDSA 4M93C 2NPLX 2YN3A 4LCCA 4KXZH 4KK6C 2E27L 2R0LH 1PG7X 3HZVA 1DDHB 4UTAH 4X6CA 4PGZA 3QDJD 1YJDH 4FNLH 1S9VB 2BSTB 2EYTA 4WTWA 1M6OA 3ES6A 4DJMA 4ZFZA 1XGUA 4E41A 4NRYA 4Q6YA 3G6JF 1YQVL 4NO2A 3CGTA 3HCVB 4PJDA 1W0WB 1NSNH 2H26A 2AQ3A 1H3TA 3FB8A 5DJ0B 3S36X 3JV6B 1K8DA 3STLB 1YUHA 4D94A 4DW2L 2FSEA 5FF6A 4DCQA 3U4BH 3AS1A 2WLYA 4BQBA 3RA7L 3ZDXF 4Y4KD 4DKFL 3CMOL 2DQTL 5KVEH 1MHHB 1BZ9B 5GRVK 3MV7B 3BZ4A 5CJOH 1FZOA 1NMAH 1TQCB 5GGUA 4OZ4B 2NW2A 4C56D 1BOGB 3MPCA 5KZCB 2IC2A 3QAZC 1VENA 4ACPA 4MD4B 4PP2A 3SO3C 2VXQL 5FXCH 5EU7E 1F4AA 2NZIA 3MV01 2AJUH 3MRKA 3CCHB 5B38B 2NX5E 4MD5B 4GAYA 5CEYA 1ZA3A 3NTCL 4PJ9C 3DHJA 1CD8A 2A83A 1RIUL 1FNEA 4GAGL 4WTZG 4C56E 4EEEA 4L3EE 1QHPA 7FABL 3UJIL 2DBLH 2WWKO 2WMPA 3VGAC 1XF5B 3CPLB 4P4KB 4JRWA 3FT3A 1QLRB 3MLZL 3IXAB 5GSRB 1QR1B 4P5KA 1KCSL 1RUQH 5SX5H 4EVNA 3TO4A 4HWZA 4LEOB 4PJEE 3UO1H 4KK5C 2QSCH 3F5WB 3FQWB 1MCCA 3D5OF 2FX7L 3FQXA 4IOIA 1QA9A 2K9UA 3ILPA 2EIZB 3NPZB 1S8DA 4P2RA 1FVCB 3OKYA 4HV8A 2LFGA 1KCLA 4L9DA 5DRXB 4TOYH 3DUUB 3RHWF 3OX8B 3MJ6A 3M1BA 4G6KH 5D7IB 1YN6B 5DRNB 3UTSB 3ARBD 1JZ2A 4HAFA 5JXEA 1MFDL 5E9DE 3TA3B 2WP3T 4POZD 3ORJA 4Y5YA 1OOAA 1EAPA 1NQBA 2ZSWB 4O2CA 4PJFA 2DWDA 1E6JH 4U1GC 2ILLA 1OQOA 4OT1L 5E08L 5CEZH 3EGSB 4OF6A 1NUNB 5I1EL 2IGFH 1BM3L 2P42B 3PNWA 4DTGL 4X9GA 4J3XA 5I16A 4HPYH 4ZQKB 5ESQB 4ZXBB 1FLTX 3V4PH 1B0RB 1H15A 4OB5H 1U58B 4OLVL 2LU3A 5ID0B 2PW2A 1I4FA 4POUB 2WQ8A 4RAVA 5JO5B 4KMTL 4DZ8B 4KAQH 2Z91A 1MWAA 1SJEB 4XPBH 4NHUB 3WL9A 3QQ9D 4JPWH 2H2PC 3MLWL 4N0UE 2N56A 4UILL 4LPYA 32C2B 3EYFA 4DVRL 2DBJA 2B39A 5L0QC 3B43A 3QEHB 5L2KE 3F7RA 5DQ9A 1K4CB 2OZ4A 1QSED 1C12A 1R5WA 5F89A 3Q5YA 4U1KA 3QJFB 3GDBA 4OQTH 1UACH 1EO5A 1UZ8A 2X7LB 2FGWH 5F6IC 1GGCL 4GKSB 4XXCA 2P24B 4YHYC 5C08A 1U8LB 1DE4B 4HBCL 2NYYC 5FO9A 1CD0A 2E7LC 3VWJA 1XGTA 3EFDL 1T5XA 2QV2A 3QI9D 2W60A 4TN9A 5E2VL 4KUCD 3RUGE 4OD3H 2OTUB 4JPVH 3EO0B 4FQQA 1Q0XL 3S5LB 3OKOB 2BSSB 1IBGL 3HMXH 4NQED 4FFWC 2C26A 1CD1B 3A6CL 1LNUA 4P46A 3GIZH 3TGXA 4Y16C 3OKMA 5ESAB 1CXIA 2W9DH 4PJ5B 2OTWA 2CLRA 4EN3D 4JKLA 5AZEL 2I27N 4G8GA 1I7TB 4MNQE 1CLZH 4YIQB 4LF3A 1LEKB 1YMMD 3KS0J 4UQ2A 1PG7W 1SBSL 3JTTA 3C2AL 5F9WC 1OTUC 5D1ZB 2J8UE 1IEAA 5DGQA 2XXMB 4NQEE 1IVLA 4ZPTB 4HGMA 2VIRA 5FYJD 3TNNB 3SGKA 1XGQA 1BVZA 4U7KA 4XNZC 4S1QH 2PW1B 5JOFB 4F33A 1PQZB 2DQCH 4Z5RB 1NUFA 4K9EC 1AI1L 3E8UH 1EX0A 2I60H 3SKJH 1CBVL 1QFWH 1FRGH 1Z9OA 4HWBH 3NFPA 2NY3D 4L9LA 4D3CH 4RDQF 4M48L 4JM2B 1EHLH 1D6VH 1ORSB 4MQXD 3MNZB 3S96B 2VZSA 4K9EH 1I1CA 4X5WA 2C4XA 4Z77B 4J8RB 2SEBB 4L8BB 4MJ2A 1FFOB 3WFHB 1HDMB 2GSIB 5DA4A 3L3OA 4RAHA 4Z95H 5IG7B 3GSWB 4H1LG 2VTFA 5ENWA 1RZ8B 5LGJA 4Z7WB 3D6GA 3MCKB 1GAFH 5EO1A 5JW5B 2I5YH 5HDBE 4OFPA 1VGKB 1AXTL 2ARWA 2DTML 4JN2B 5MI0B 1T0PB 4OM0L 3KLHC 2AK1H 2R69H 3KPSB 2WQRA 5JNYA 5L88L 4NO0A 1RFDH 3HFMH 1JPFB 4Z7UA 5D1XA 2WUCH 1FSKB 4LIQH 5I9QC 1SMOA 4HG4J 3C60B 3WIHA 3T77A 2C4FU 2A9NL 2VUYA 1R3IH 5KZCD 1ZLSH 5HYJA 1YY9C 5BRZB 1PSKH 1I85C 2ID5A 4DEPB 4UZGA 1T2QH 4BH8A 3IKKA 2FIKB 2PTVA 2VDOH 5IFJB 4I2XA 2R15A 1CLYH 2BCKB 2CDFB 5IB1B 1IT9L 4YDJB 3MV7E 2ENSA 5GRZA 2NY5C 4YDIL 4XCCL 4XP5H 4KVCL 5DD5H 3D3VB 1AC6A 2OLDA 2XKNB 3OKEA 3QBTB 2V5SA 1FIGL 3IJHA 4YHKL 4F7PA 1JNJA 4B5EA 5F7UA 5FM8A 2Z31B 3ZDZE 5L6YL 2A73B 3U0WL 2YPVL 1G7JB 4LKCB 1OAXL 2VKWA 1FE8H 1U8PB 3FQTB 2NY5H 4LK4A 3JWNC 2GTZA 5A1AA 2R9HC 4LNVA 5GZND 2OSLA 5GJSL 3UBXG 3VXMA 2C4FT 3K8LA 1WIPA 1X5ZA 3DX8B 1RZ7H 3LN4B 1KCRH 3ZYZA 4KK8D 1GH7A 3WNOA 3MRCB 2LQRA 4A6YA 2XQBH 1U8NB 5HYSA 1PY4A 5TH2A 3UC0H 4TUKH 1WFOA 4U3XA 5GGSB 1ZHNB 4FG6C 1S9XA 4G6AD 1UEMA 3IFOB 3UTSD 2IQ9L 4GW5A 4DGYL 1WK0A 5HVHB 3TA3D 2I9LA 1C16A 1XFPA 3RVVC 3IVKB 5I1GH 2X4UB 5SV4A 4N5ED 4NFCA 4U4BA 1NCWH 3U6RA 2CIIA 4R26H 3U9PH 4LQFH 3JWDL 2R2BA 2FJFB 5D7IE 3UDWC 3UTSE 5CD3A 4K55A 3CSGA 1BBJB 3Q5TA 4OLYL 2OQJB 3ARGC 4OGXH 2YA2A 3SY0B 4K7PY 2AJVH 4ONFH 1XH3A 4G6JL 1T6WA 3BPLC 5DEGB 3JUZA 4NQTA 4NM4L 5ESVB 1OTSD 2GW5A 2PO6C 5EUKB 2ZSVB 1G0YR 1HH9B 3SJVA 4IRSB 3HRZB 5TE6H 3VJ6A 2PTTB 4FTVB 2VDNH 4Y1AD 4ERSL 4NCDA 5C0CA 3VFRA 2Q87A 4MJIA 4I48B 3DYPA 2NZ9D 1MREL 2UWEA 2RAMA 4WJ5A 2AJSH 4OIAA 3X12B 4MZ2A 3P77B 3D9AL 3N1MC 3HB3D 4LHJB 3ZKXC 5IB3B 4GRWH 2C7UB 3K80A 3I2CL 2AEWA 1JTTA 5A16A 1QNZL 5ID1B 3C6SA 3CU7A 4JFPA 1I8LA 4I0CC 5KVDH 3PL6B 5I1IH 5ANMA 2ZOLB 3NCYS 3O45A 2P8MA 4GKOA 2AW2A 5DRZA 3DVNB 4U2YA 1JGDA 3IAPA 4JANB 4MDIA 4OFIA 3FHAA 1U95A 3UJJH 3AAZB 3FB6A 1E4WL 4XMLL 2QLVB 5D7KD 4F15C 2HG5B 5T3XL 1ZANH 3V8OA 1U3HD 5JXAL 4BZ2H 3TZVA 3VDBA 1XCQB 3OKLA 3MUHL 4JFFA 2C3GA 5D1ZD 4R4BA 2XN9D 4X80L 1CE6A 1A21A 3ARDB 4X98A 1KIQA 3T09A 1KIUA 1XGPA 2HTKD 4PJ5E 3OXSA 4RFEA 2OR9H 4XP6L 5D7KE 5I17A 5HHXH 4XCYA 3QCTH 4U6XA 1IGFH 4G8EB 3I3BA 1SBBA 3T1FB 5EBLB 4F7TB 5T3XE 3LKNB 4BFIB 1IKNA 1OAQL 5D6DC 3IDYC 4R9HA 3OGCA 3MRDA 5IQ7L 2Y7QA 4JQXA 1FL6A 3MV8B 1HXYB 2ZG3A 5EZOL 1F11B 5T1DH 1MSPA 2FEEL 1A1NB 3GJFB 4Z0XB 4AL8L 3JVGC 3VXTA 1UH4A 4PB9L 5B22A 5TJWK 1PYWA 1UWEL 1YNKH 4PJXB 2HLFC 3VFPA 1X5FA 3O3EB 1WAAE 2DQGH 3VCLB 5DS8B 3TNMB 3MJ9L 4G80A 4PJ7B 5DYOB 1C5CL 4KZDH 4OCWH 3QYCA 4GQPH 5DHYA 4L29B 3W39B 1RHFA 3SDAB 1MFCH 3KVQA 3HNVL 4S1RH 4OZIB 1T04B 3SDDA 2BZDA 2VQTA 3KPSD 5MHSE 3LRHA 2VLKB 5DI8A 4S1SL 1SYSB 4UU9A 2QQNH 4Z7WE 4JN1H 4O2EA 3SE8H 1GJIA 4C54A 3KLDA 4RAUB 4XPGL 2J6EH 3GSVA 4K07A 1U3ZA 4IJ3C 1CICD 1RJLA 4ETYA 3B9KC 1FNLA 5BRZD 2DJUA 4GG8A 3KPSE 1NCCL 1A6WH 1H0DA 5H94A 1T1YA 5GRJL 1N7MH 5FK9A 3V6FA 2ADJA 2JJSA 1MJ8H 4F58L 5A2KH 3MRMB 3TP4A 4PB0L 4PV8A 1E4XL 5CEXA 1YMHA 4KGLA 3NIDF 5BRZE 1G9MC 4YDVA 4AEIH 2VDLL 5EDXA 3GKWH 4O2FB 5IFAL 4WY7L 4BZYA 2Z31D 3S37X 1NCDH 5E03A 1N8ZB 1DBBH 4OLUH 4WFHE 3QUYB 5CHNB 4TNWK 3UZVB 2H9GB 1NDMB 3QUMH 3D85D 4BK5A 2EEDA 5IV2A 4QWWC 2O61A 5F1NB 3D3VE 1G9MH 1VFOA 3GM8A 1I9IH 1J11A 1DVFB 3VWKB 3BESR 4F8QA 5CD5D 4PJGF 4KZEH 1T66D 3L9RB 5BJTB 4NUGL 4KWUA 4LHQB 5E1HB 4HFWB 4U33A 1ACYH 3ZDYF 2YOCA 5D2NC 1FIEA 4URTB 3VD9A 1OAUH 4NT6A 4GKNA 3QO1A 3DSFH 4M7KL 1MFNA 1TZHB 4PS4H 3HTLX 1DN0B 4Y4FD 5E8PA 1NGZB 5M7QA 2XWJA 4X7EC 4LCCC 2P5WB 2QHLA 3K8KA 1KIPA 3T3PE 3BKCL 1DBJL 1AHWB 1DLHB 4GW4B 43CAB 5E8EB 1HILB 2YD6A 1BAFH 3JBG7 3V5DA 4WI7A 2A6KA 5BOPA 3CFJA 3KPQA 1QRNB 3WLBA 1YPZB 3VU2A 4PRIE 4F37K 4WW1A 4YHOL 3RKDD 2JCCA 3I6LE 5J89A 1X5IA 4KRMB 5FM5M 3UTZA 1FFRA 3R1GL 3W81A 1UJ3A 1JV5B 1KN4H 5SWQA 5F7KC 1T20B 1KJ2B 2PYED 2DYPA 2DQDL 4FFZL 1KELL 1U93B 1R3HB 5LGHL 4KJPC 1MQ8A 4WO4A 1U8IA 4YEEA 3QNZA 4JB9H 4X9FA 4XBEH 3TN0A 3ZO0A 5E99L 3G5YB 4R4ND 4N1CA 3IAGC 3OB0H 2YN5A 2FGZA 4G3YH 3I9GL 2FZ3B 4PYGA 2Q8BL 5TQ0H 4BJLA 4MJ4A 4PTUA 3PABA 4LSSL 3R4DA 1JFQH 1QYGL 4HFUH 3BN9C 4HIXL 4OFKA 2EIEA 4KTEL 5DFWH 4FTVE 3TH2T 1JGVL 5C6TL 2I25N 3D25A 1TMCB 3UX9B 4XP4H 4X8JB 3P0VL 4YHPB 2WW8A 1JNLH 5HHQA 1TZIA 1A6TB 1PVHA 5BW7A 1KJMA 1V8HA 2KZ1B 1EAJA 2FJHB 4PJIA 2F54D 4ZS6D 1S7RA 2F8OA 4I18A 3U48A 2PCPA 4R97B 3U7AA 4PJ8B 4LCUA 1FVDB 3TO4C 3HNSH 5FYKD 3VRIA 4OIBA 4FQ2H 1QEWB 4M1CD 5FCUH 3KPOA 1KPVB 4ZTPH 3B3IB 5FGRA 2X6MA 4FMFA 2NXYD 1H3GA 5FV1L 1TVHB 4IS6B 1A14H 2H1PL 1F5WA 4XBPA 4X6BA 3G6AA 4PY8J 2EDDA 5IT2L 3ARDD 4YXHL 3W5NA 4MAYD 5JXEC 3N9GL 1I7UA 3AC0A 3GMPB 1DEDA 4M5YL 4Y5YC 5EU3B 1JHLL 1NBQA 5F1IA 25C8H 2F74B 3K4DA 3RWJB 4D9LH 4M9OA 4MDJB 1HXMA 5CWSA 1EA9C 3MV8D 4QRQA 5TGBA 1MEXH 5H8DA 3VXUA 5JLZA 4G8IA 3SDXB 3BQUD 4JZJA 3AROA 1SJHA 5A2JH 1EH9A 3EHBC 2Q6WA 1QPXA 2H8PB 3QAZB 3TBVB 5D2LB 1GGBL 3C9NA 2ZPKL 3MV8E 4QRUB 1WCBA 3BWAB 3SDAD 2DLHA 1BGXL 1I8IA 2CH8A 1G7PA 3WEXA 5IFHL 4K23L 4PJ9B 1J1XH 5HDQL 3G08B 2GAZB 4PJXE 5BS0D 3CH1A 3FHQA 2Y5EA 5F6HI 5FDWB 3MV9A 1MWAH 4PJ7E 4X4YA 3ZYIA 3VGAB 1BFVL 5DJ6B 3AY4A 1JK8A 3DVIA 3BPCA 3GMQA 1J0HA 1P4LB 4IHOB 3WHXA 3ALWA 4XXCC 3WXVH 1FZJA 4XC1H 3I75A 1AD0A 2OZ4H 2DAVA 3LKPA 4PR5A 3VWJC 3RNQB 4OZIE 3ECBA 3UYOD 2R29L 2VLKE 5DMGD 5IMKA 3Q3GB 2Q76A 1AGCB 2CUHA 4F2MB 4CMMA 3DX7B 5K9JH 5E6IB 3U9UB