4X6DE

Cd1a ternary complex with endogenous lipids and bk6 tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
200
structure length
189
Chain Sequence
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSTSLPNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1a
total genus 39
structure length 189
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dE02
3C6LB 1FCCA 3H9SB 5J7CC 2HYMA 5D5MF 1SJXA 5JW4M 4PJDA 5IB3B 1RK0A 2X41A 3GM0A 5KVEH 3BRFA 4LHQB 5A3ID 4OD3L 3P4MA 2QL1A 4YFLI 1IM9B 2MNUA 4BFIA 2DDQH 2VIRB 1MF2L 1A9EA 3QP3A 3ZT5A 4X6EA 5EU4B 1A1NB 5IM7B 2F54B 2SEBA 3LPWA 1OWRM 3QDJD 2HWZL 4KH2A 3NH7H 4Y8DC 1LDSA 5DFVD 1WCBB 2YSSB 2B0SH 3ZHDA 3OKKA 1C5BL 5F7NC 1X5IA 4GAFB 2DBJA 3FQUA 2XQYG 2PETA 2CGRL 3U9PH 4OGAD 2AV7A 4HK0B 5DJ2A 1AO7D 4XXCA 35C8L 1JZ6A 4LOUD 4JFQA 4FQ1L 1OGTB 4DWHA 3FQWA 3BT2H 3NIGF 5HI5C 4MNQA 4LLWB 4ZFFA 5CBEB 4HQQH 2CRYA 1TVDA 3BZFA 1FNHA 5DJCA 4JFEB 2R9HD 4UAOB 4OCSL 1A6WL 3GSNA 1C16A 5EZLA 4XB7A 3KLDA 4U0RC 2DB8A 5EUOA 1OAZH 4XP9H 2AJ3A 5ACMA 1F4WH 4TSBL 3RX8A 3UTZA 4D8PA 2XXMB 1MCKA 1IL1B 1JGUL 4WTZA 3T0XA 3TBWA 4UNUA 4FFZL 4P2QA 1QBMH 4XCFH 1UXWB 5FHBH 3O41A 1RUML 5F7UA 5GZOC 1RURH 5DD1L 2VDQH 5L2KD 2RGSA 5SWZD 3LPGA 3UDWC 4PJGA 4RMSA 4X98A 3RY4A 3MFFB 1NUNB 4A6YA 3SDXE 5F1OB 4BFGA 5EN2B 4EZMA 1NCDH 1A02N 1KELL 3C5ZB 3QNZB 1HDMB 1G7MB 2ZNXA 2ID5A 3I50H 5MEND 3BPCB 4GG8B 2YUWA 1MHPL 3MOBL 1N5AB 5E4EB 5H35B 1T0NB 5KG9B 5IB1A 3OBAA 5TE6L 4OZGE 3V52L 4FQXD 2V7NA 2HN7B 3MLZH 4XI5C 1MHHA 1FH5L 2Y25A 4KDVA 1NAKH 2ZWLT 5E03A 1U91B 5C92A 4F7PA 1KTKE 1GVIA 3GJFH 1GZQB 4NNXA 4QRPE 4KZEH 1OF2B 4O2EB 2EDWA 1BBDL 4JM4H 3BOVA 3GSVA 3B8YA 4LCUB 3MRMB 5IB5B 1HCVA 4YDJB 1N59B 2GFBA 1R3HB 1OP3H 1QPPA 4MJ6B 4I4WB 3TIEB 2FO4B 3MJ9H 1DUYB 5DSCA 3MGOB 4XWOD 5KANG 4LLUB 2JK5B 4DW2L 1RZKH 1DQQA 1MAML 3GJFA 4RQQA 3MRHA 1G6RH 2BSED 5AZEL 2Y5EA 4NO0D 2ICEA 4PTUA 1A9BA 1BP3B 4U7KA 5C7XL 5FHAH 4HS3A 2ITCA 5L6YH 4KPHL 3HB3D 3BP6A 3OKLB 3I3DA 3MRNA 5KZCB 4WWID 2NY3D 1QEWA 2ADIB 5DZNA 5AYUH 3EZJB 5CSGA 2RFXA 1AXSB 4Y4KC 5GGUA 3K2UL 3G5ZA 4NO3A 2CPCA 2J5LB 4EN3D 5KVFL 2R1YB 4K9EL 2GY5A 3K8LA 1ZEAH 5HYIA 5T1KA 1QRNA 5ICZB 3D69A 1ZAGA 5GGRY 1F4XL 3DX6A 2APVA 2OM5A 4XVUC 1K2DA 3N1GC 3CUPA 3HHRB 2P5ED 3RUGB 3WNKA 3VA6A 4FQXB 4I18C 2Z4QA 4F2MB 4Q9RH 2KQNA 1AGEB 1RULH 5ITFB 4ZUWB 3L5XH 4NZDA 4XMPL 1GGTA 2MSPA 3BDXA 4QHNB 4KTYA 3SKNB 1T6WA 4GFTB 2K7QA 4KJPD 4QWWC 1LEGB 2DQDL 2C3VA 3OJDA 4I1NB 3VGAB 5ID1A 3W0WD 1FHGA 5DR5L 3HS0A 1WIPA 1RUKL 3F8UB 2H2SD 4XI5D 1E6OL 5B39G 3NIDE 4WUKL 3WIFA 3DLQR 4LLDA 3ELAT 1CFNB 1CDGA 3NA4A 4MZ3A 1MHEA 4PG2A 1A6ZA 1TXKA 4NN6C 4PB0L 3HC0A 4UIKL 5IGXH 2CKBH 2X4PB 3E6HA 4G6JL 4E9LA 4P4KB 1XR9A 2FCBA 5DD6B 4FFYH 4GAGH 1PFCA 4AIZB 2VDMH 4KHXL 2FDBP 4BM7A 5I8OL 2G75B 4FXKA 3S8WA 2GJ6B 2IEPA 1S5IH 3BMVA 5BRZA 4J8RB 2ORBL 5JZ7D 4W6WB 5JO5B 2OL3B 5FB8B 4YC2B 4ORGA 3V6FA 3TLRA 3B9KD 4X6CE 4YH6A 1TNMA 4MNQD 4XP4H 2JJWA 4XNMB 4Q9BA 4JFFA 1MH5B 1YN7A 4KKLD 1WAAF 1XCTA 4JZJA 1YEKL 5CLTA 1SBSL 3RDTA 1JNNH 4XX1G 5A1AA 3BGAA 2BNQB 5FKAA 5E70A 5IK3B 2R2BB 3K3QA 3SGEH 1D5MB 1N64H 5B3JE 5E6IB 2D4DA 4YXKH 1V5JA 1ZEAL 2HFFA 5EC1B 3VGBA 1ONQA 4MD0B 1F2QA 3OKYA 2XFXB 2ILLA 5DLML 1HQRB 3J8F7 5JW5A 3QR2A 3W5MA 4CADA 3OAZK 4N5EC 3WSQL 1T1WA 2VTFA 5GISH 4KRPD 4CGTA 4YDVB 5D1XB 1MCWW 1FZJB 1UJTA 1NKRA 1HNFA 3INUL 4PLOB 1I9JH 5J1SC 1BOGB 2I9LB 3IJYA 4LHUA 4R7DB 3L5HA 2DQHH 5ERWA 2CO7B 2JB6B 4JO3L 2A6IB 2Q8BL 3GRWH 5FYKL 3PF2A 1YEFL 3F7VB 1SEBB 4KUCF 4BFIB 1EIBA 1A9EB 3M8OL 5HBBA 4IJ3B 3U7WL 1A1NA 3IAPA 5CEZE 1E4KA 3C09B 4DUVA 1JF5A 4XMLH 3Q1SL 1ED3B 3ARBA 3ME0A 4R7NB 3TBYB 5IVNA 2VJXA 1FYTD 2OTUA 2R39A 5F44A 5J6HA 1R5WB 4LK4A 1CD1A 1J18A 3O3AB 4HK0A 4TUKL 4APQA 3OR6B 2Y36H 5TE7H 3QDGE 5KSBE 4E42A 3DECA 2M2DA 4OZGB 4YX2L 3MLZL 1UJ3A 2EIZB 2N7AA 2R0ZL 4DVBB 4U1JA 3NCYS 3PL6B 1Q72L 5DJAA 4M93B 3TBSB 3VFSA 3EDEA 3ARFC 4NO5A 4PJ5A 3DUSB 3N9GL 1JGVL 2PW1B 5JUEH 1JGDA 1RZIB 4NHCL 2WIMA 4CN4A 2XOTA 1T04B 4Z7VF 5FOJA 3T4YB 3UTZB 4JHWH 1J11A 4RDQF 4C83B 5J11B 1E27B 5CEZL 2ATPB 3VG9C 5I76A 4X4YA 1IL1A 4JLRB 4BZ2L 5FFLA 3STLB 3U36A 4Z7NF 4NQVB 4OCNC 3O41B 5B3NA 3NCYP 5FAAA 5GS0L 1EHNA 2EO9A 2GTZB 2FIRT 2FIKB 3B3IA 1T1YA 1U8LA 2DQTL 4I0CC 1AO7B 5DC4B 3WKMH 5SWSB 2W65B 4KKAD 1KG0A 3ARTA 2RHEA 4OLVL 5I9QC 1UM6L 4ERSL 4QLRA 1IC5H 3SGDH 4H88L 2EKSB 4MGXA 4NM4L 1QLFB 2JLLA 2XN9A 3QUZA 3ZDZE 3ORJA 5H35A 1BVKA 5J6GA 5AD0B 2XXCB 4EXKA 4NZJA 2AI0L 4WI5A 1YNKL 3JTSA 1I8IA 3NFNA 1EEQA 5IVXA 2A0LC 1BFVH 1FYTB 4B41A 1TQBB 4UDTB 5FA4A 2UZIL 4F9PC 5J12C 3DGGB 5GHWH 5I73B 2UZXB 1BEYL 1AC6A 1H0DB 1NBVH 4B7LA 5ESQA 3U9UA 1OP9A 1E28A 3ILQC 2LQRA 4RDQG 4ZO8A 4FTVB 3MNZA 4N0FB 4CN1A 5T3ZD 4Z76B 1KCSH 1PGRB 2HVJB 2JKXA 4GRWF 2JELL 5TQ2L 3HMWL 1FO0A 1ZWIB 3BGMA 1OM3H 3RWGA 2X9XA 1NCBL 4LRIC 1OD7A 1NDGB 2FO4A 2NXYC 1IAKB 4JB9L 4KVNL 3WJJA 5DSCB 3D0VB 4LLAA 5D8JL 4WJ5A 1IC1A 1W72B 1DBAL 1AHWC 5F88B 3MRHB 4Y19E 5D8JH 5HYFA 5KSAD 3MUJA 3D39E 4PBWD 5F9OH 5DUMH 1QBAA 4AMKH 1NCBH 2E6QA 1U8JB 1LO4H 5BZWA 3SDDC 2YA1A 4OZGF 1GIGL 2XG4A 1FDLL 5HYJB 3TN0D 3C6SA 2F74B 3LD8C 3FONA 3GSWA 3V0WH 1HHIA 2QSCH 4ZTPH 1RAMA 3KNBA 2RFXB 4PGZA 1U8NB 4RISL 1ZT1B 3Q2CA 4OGXL 4TNWF 1I7ZA 2CK0L 2QQNL 1CDJA 1NEUA 3BO8B 4ODWB 1CFTB 1DP0A 2CD0A 2QQKL 5ICZA 2E3VA 3VXMA 5F3BA 5BRZE 4KVCH 1KB5H 1KYOK 4K71C 4JPVH 1Z3GL 3OF6D 4FZ8L 5GGTH 4KJYA 2DQFB 2NY1C 2Y6SC 4MX7B 3LEYH 3TYFA 3VWJD 4ERSH 2VL5B 5DO2D 4HT1H 3ZDYE 3TBVB 4BFBD 5FM5O 5ITFA 3FAWA 1N0XH 3P2TA 1FGNH 2HFGL 1UB5B 4XC3L 1MJ7L 1DFBH 3CVHL 3ZT6A 4HBCH 3TT1L 3G04B 4KZDL 3H2WA 3O9WB 1QVOA 3C60B 3GSNH 4OD1H 1MWAL 5JMOC 3CFJB 5CEZH 5H2BB 1HHKA 4ZFOL 4XRCA 5MHSD 2BVYA 3DMMD 3LH2H 3QAZB 5IJVA 4HUKB 4GG6F 2NY5L 1MHEB 3V95A 4ZAKA 1NCTA 4PR5B 3FFCE 3QHZL 1F3JB 4TQEL 3HC0B 43C9A 2G2RB 3MRPB 4K3JH 5J3HC 4HAGA 1K8IA 5DD6A 1KENH 2YOCA 4I8DA 3UBXI 1CXIA 3FOMA 4PJHE 1WZMA 3U0WH 3TN0B 1S5HB 4NBXB 5F7EH 2LAAA 5FUCE 2EE2A 3HPLB 3F7PC 3S4SG 4G5ZH 4PJAF 3U2SA 6CGTA 5ISZD 3GKZA 3OL2A 1L9NA 3L7FB 3VW3L 4JGMA 3SKMB 4XAKD 3ARFA 5C0CA 1YEGL 5EBLB 3QRGH 1YY9C 3VXSA 3NIDF 2DLFH 4NFDA 3WD5H 3EYFB 3MV7E 4MS8C 3WNOA 1AR1C 1I1YB 1MREL 1FQ9C 1RJYB 1ZLSL 4HH9A 3LZFL 4HMCA 1UZ6E 3QCUH 3R8QA 4F57H 1ROWA 1PYWA 1PEWA 2Q8BH 1J05A 4PJ8B 1FNSL 3L1OL 4HIJA 4HCRH 32C2B 1I9JL 3KPOB 3IGAA 4KFZC 2ZUTA 1RJLA 3SGJA 3QUZC 3GFUA 3P4OB 3RWDA 5E8PB 3UO1H 5J0BA 1K5NA 1H5BC 2P48B 3BSZL 5BZDA 2FX8L 2YD1A 2NW3A 4MNGB 3PABA 3AXLB 1A2YB 2YPLE 2R2EA 2X1OA 1CDBA 3W11C 2IC2A 3V5KA 1JPFA 1NBQA 5C0NC 4X0KB 3ZHLA 5TDOB 3OJ2C 1P7QB 4PJ7A 4WRLA 4NDMB 2LU7A 3BP4B 5DWUL 1KLUA 1G7HA 1OAKL 1DN2A 3WN5C 3VXUB 4GRWH 4TULH 5CZXD 5C0FB 5I1JL 2I9LA 4LHUB 1IE5A 3CVIL 5ERWB 3RWCB 2A9NL 2JB6A 2V5YA 3DXAE 4MA1B 3QDJE 1MCWM 2BXYA 3BP5B 5D1QB 1JF1B 4NQED 3QWRA 4Y4HB 1XF1A 3SOBH 3BH9A 4M6NH 1QFPA 1ZHBB 2J12B 4NP4L 3ARBB 4HWUA 4WI3A 3O6LH 2FATL 1AIFA 1UC6A 2IG2L 4JFFE 4KK5C 4KAQL 1FRGH 2VABB 3VXQA 1N6QL 2VLRD 2FSEA 4U1GC 4X80L 1CFVH 3O3AA 2CRZA 4L4TB 1GPOL 1PZ5A 1BFOB 5J1AB 1OWWA 1NLDH 2NY6B 5HDLA 4GAGL 4CVUA 1E4WH 1YPZF 4PYHA 2LU4A 3CXDH 4OM1H 4Y1AE 3AVEA 3IS1X 1B4RA 3CSBA 3Q0HA 1KIPA 4BZ1L 5DJAB 5I66A 1S7QA 4PJ5B 1S78D 5HPOA 1GSMA 1HSBB 2ZCHL 5EOCH 3TESA 2CXKA 4OM0L 1G7LA 5L0QC 3T4YA 5JIHA 1FNLA 4NKQB 4WNQB 1G0XA 1G6RA 2YPVH 3IFNL 1PG7L 3WLBB 1YQVH 3OXSB 4NQVA 3HAEA 4Z7UA 3VD5A 1HWHB 4GW4B 4OLYL 4ZS7L 5AUMA 5LGJA 3ULUL 3SDAD 3WUWB 3ES6A 2FZ3B 3CLEL 3S5LG 1B90A 3WNLA 1DEDA 1ZANH 5BO1L 5CIPA 4KROC 4IHOA 2EC9T 2UWEB 1ACZA 4B53A 4WEUD 4JFHE 4O00A 4HLZH 1K4DA 2W65A 3NACH 4ZQKB 4ZFGL 2YC1B 4FQQB 1OB1A 2VLJB 3P0VH 4MB5A 1D9KC 3C2SA 4DK6A 4KROD 3FTGA 1FNFA 1I85C 3W9DB 3QDMA 1I75A 5CEXA 1T7WA 1GC1L 2PO6D 2LABA 3PGFL 4PY7A 1IKNA 2IH3B 3SDAC 4M1GL 2F54E 2XKUA 4U1LA 1FSKC 3NIGE 4WTXA 4M1DH 3EDJA 1BGXH 5CUSH 4K9EH 5ESQB 1GPOH 3DVNA 2ADFL 3PP3K 1FRGL 4O2CA 3LD8B 4UB0L 2DMKA 2H26B 3VG0H 3CVIH 3EKCA 3VFNA 1BM3L 5DURB 5I71B 4FP8L 2DQDH 2MKWA 5GXBB 3QXAA 5DQDL 4O02L 4Y4FD 3LSOB 4ZUTA 1CXEA 4LVHC 4NN5B 2ZUSA 3EJZC 3E6FB 1M71B 5I17A 4Q9RL 2VISB 5JPMB 1KPRA 1U58A 5GGSA 3VWKA 3V4PH 3G08A 5FK9A 2A2QT 4GRMA 1R5IB 1NL0L 3MX0A 4X7SH 4OJFL 1WF5A 1ZT4B 5E5RB 1HH9B 1JPSL 1KB9J 5F7DB 4JM4L 4P57B 3QWQB 3W39B 1CK0H 3RIFF 3MNWB 1R24B 2FGZA 4IOIB 3BDYL 4UTBH 3WIHA 2R15A 1H9VA 3FFDB 4PJFA 3TT3L 1CFTA 2YWZA 4HSQA 3T2NL 1YEJL 5CAYB 1QSFE 5CZXC 3PWNB 2N56A 2CUMA 3HZKA 5HI4C 4M03A 1I9IH 4FN0A 3O2DH 3R1GH 4XPTH 2YZ1A 4Y8AA 5A2KH 3VDBA 1J1XH 5F7EL 1WK0A 5CD3A 3QI9B 1QO3A 4XP5L 5F6HJ 3A6CL 2IGFL 5KS9B 4HGWA 5FUOH 4FQ2L 4UIMB 3UROR 1FNGB 3ULVF 3IXTA 3QUZD 3EJJX 1C7SA 3G5VA 3RI5K 4PP2A 3GDBA 3FT2B 5GIRA 4R3SB 4PJXB 4R2GC 4NWUH 1N7MH 4DGYH 5D7IF 3LQAC 1WFOA 2CXGA 4WHCA 2QLVB 1KENL 4R26H 1ZGLP 3IFPB 3MV9D 4EQ3A 3ARWA 5FXCH 2MQ0A 2IQ9L 3HI6L 3OKNA 4X5WB 4U3XA 4JY6A 2AABH 4Q6IC 1W0WA 1Q9LA 3ARYA 1VA9A 2AEPL 2A74B 4YGVB 4CJ0A 4WI2A 5H8DA 5TFSH 3JV6B 2FH6A 4MNQE 3U2SB 3BKCH 1MRDL 4EI6B 4D9LH 4YHKH 1NCWH 5ID0A 2E27H 2HH0H 4F7CA 1EEYB 3GMMB 3NOIA 4P2CG 4APQD 3PGCA 1RJZA 3GHEH 2C3XA 5AG8A 3BN3B 5EBLA 1ETZA 4KUZL 4HBCL 3TT1H 3EYFA 1JWMB 2X9WA 5IWLC 3LV3A 4QXTA 4BZYA 3H7LA 5IW6A 1RJYA 2OTPA 2QQNH 5TGBB 4GJTB 3EOAA 2WMPA 4TRPL 4QKXB 1XIWD 1E4KC 1PYWB 4OCXH 1A7OH 5FKPA 2Y4SA 3DMMC 3ESUF 4Y2DB 3IKCA 4M5ZH 1S3KH 3I85A 4R4BA 5I1CH 1WSST 3KPOA 4U0RB 5F8RC 2HT2C 4AEHL 3U6RB 3GSXB 2R0LL 4IOFD 2BNRB 4BA8A 4Q2ZB 2CQVA 2X70A 3KLSA 4BQ6A 5BZDB 2ICES 4M3JA 1A3LL 5F9OL 4MNGA 2HMIC 1RZ7H 3VFVB 2VZUA 2HJFA 4PRNB 1JN6B 2FJFA 3T65B 4RGNE 4PS4L 5HHQB 3V5KB 1JPFB 2MCG1 1PKQE 3LN5B 3N50A 1A1OB 5GRJL 1OTTD 3DI3B 1ZSDB 4NC2B 3T8XA 3BKYL 5LXGL 1P7HL 4J3WA 5E5UB 2OZ4A 1G0DA 1XH3A 5KS9F 5FOBB 1B0WA 3TWCH 4EBQL 1L7TH 3O6FC 1HYRC 4OF5A 3QXDB 3B6SB 3EUUA 3G6JA 1B6DA 2L7JA 2QQLL 1A6TB 3BP5A 5ANMB 5TF0A 1JF1A 4BQBA 2WBWB 4UT6H 3OKEB 3TIDA 1WBXA 4YHPA 2UWEE 4NOFA 4MD5B 3DXAD 2BVTA 2X4TB 1H8SA 3NZHH 1U42A 2QV2A 5JNYA 4LPWA 4HHAA 2BVOB 2P43B 2VABA 4JANB 3VXQB 4QF1A 4MNGE 5JOPD 2AK1H 2J8UF 1EDQA 3VU2A 3HNSH 3OKDA 2HH0L 1IM3A 2UZIH 4JO2L 5KSAC 2JIXA 1BFOA 4QTHA 4X9BA 5CILL 4PRPE 1A14L 2DM4A 1T0MB 3ARUA 5JIPA 4LDEB 3DURA 1Y6NR 4PJCE 4JFFD 5KSAA 1U8IA 4ODSL 5EPMA 4QHKJ 1UACH 5ICXA 4ZYKA 2AJXH 1PZUB 5HGBA 5I66B 4GBXC 2M8XA 1QBLL 4A2MA 4FG6C 1HSBA 1S3KL 1FNEA 2IFGA 1FVEA 1J1XL 3C5SA 5CBAB 1S7VA 3H9YA 1UM6H 4HK3J 2A6JA 2ED7A 3EHBC 1P2CB 1Z5LB 2DIBA 1I1AC 3OAUH 3BPNB 2A73B 2A83B 5SX5K 1G6RB 1MCOL 1YEHH 2F8XC 5EU3B 1EPFA 1YEEH 4P2OC 1T3FB 2NY2D 3QXWA 3MRFB 2GY7B 4L8BA 3RKDD 2J6EH 3RTQB 3WUZA 2J5LC 5E24E 1DDHB 4XBGA 5FUOL 4PRIB 4U1HA 2AAVA 3D9AL 5D1ZB 2UWEA 3LEVH 2H1PL 5F3HB 1LO5B 3PQYB 4U1IA 5EZIL 3BKML 4Q6YA 3ZE1F 3S3JA 3VFGH 1A7NH 3TFKC 4HV8A 2KZ1B 1OB1B 4X9GA 4XWGH 2FEDD 43CAA 1Y18B 3G6JE 2PTVA 4OFKA 1F4AA 3QJFB 3GHBH 3QA3A 1Z2KA 5IBUB 5FIEA 4OZ4A 5HHNA 4U31A 3VXNB 3BE1H 5HI3C 4HJGB 4LKCA 2DJ4A 3LS4L 5J06A 3WE6B 3ZYIA 2DYPB 4TNVF 1URLA 2NCMA 2IH1B 1RIUH 3KPSE 5JHDE 3FCTB 1J0HA 4JO3H 4N0CD 2EDHA 1LDPL 4P46B 4BK4A 1XGRB 3VFNB 2FWOA 4JDVB 5HDQH 4ALAH 1HSAB 1QFUL 3CU7A 3TP4A 3KLHD 3E6FA 1I4FA 3HR5A 4M7JH 5JPMA 4X7SL 1KPRB 3VWKB 4J2XA 3U7WH 5GGVY 4LFHG 3G08B 5FK9B 4PJDB 2VLJD 5IB3A 4GRMB 1KT2A 1OLLA 3KPLB 4OCYH 4B5EA 4M62H 3TZVA 5IESL 3QQNA 3KPSD 3Q48A 1HH9A 3JWDH 4PRPA 4LSVL 5ANME 1DBBH 1KULA 1JPGA 1KPUA 1EK3A 1NBYB 1YEDA 4MXQC 3W39A 1UZ8B 5IM7A 1RUPL 1NKOA 5FO8A 5I8CA 4YBHA 5LWYL 4QRQB 3IDXL 1CL7I 5M95B 1IKNC 2R8SL 1YUHA 3ETBF 5ITBL 1WCBA 2YSSA 1PD6A 3O8XA 2A77H 2ZUVA 1IGYB 1X7QB 4KRPB 2DQJL 1S7UB 4M1DL 1ZMYA 4F8TA 5DJ2B 4I5BB 4LQFL 5F72S 5KVDL 3VMOA 2DQUL 1TJIL 4JKLA 5DZLA 4WY7H 3JXAA 3IFNH 2VXTH 4MQXD 3HZKB 4HUWA 4DUXA 4XPHL 3RUGF 5CBEA 1R3JA 5I8EA 2ICCA 4JKPL 1T22B 5CFHA 3VI4E 1ZT7B 1UJ3C 1FE8L 2DMCA 1EEZB 2AJUH 3PV6B 4F7EB 4O5LL 1XIWA 5EZLB 5T3XL 2YKLH 6FABH 3HCVA 5EU5A 3X14A 4TNVK 2OJZL 1RUAH 2NY0B 1RQ5A 2LAGB 1F58L 1BVLB 3G5VB 4N0RA 3OPZH 4YHZH 3PHOA 1FL3B 5GRYA 3U0PB 2VZ1A 4QXUL 4R3SA 2O5ZH 1ZHNB 5FGBA 3AUVA 1AXTH 1BGXL 1BD2A 3TNNB 1UA6L 1MEXL 3RU8L 3MBEC 3MLXH 1H5BA 3REWB 1W0WB 3ARQA 5EN2A 4UIKH 4EQ2A 1A6UL 2HKFH 3GSRB 3RU8H 1WWBX 1KFAH 4IOSD 4M6NL 4YGVA 5B39A 4QOKA 3C5JB 1NFDE 3ZO0A 1HIML 2F5BL 2YKLL 1D5XB 4KKCC 4Y16B 2Q6WA 1CF8H 3VH8A 5DMJB 3OR7A 1Q8MA 4NOBA 2I26N 4F7CB 2ZPKL 3MNVB 2FEEL 1CLOL 3PWJB 1U91A 3BW9A 4LMQI 4ZS6C 1KF9B 4WUKH 1GZQA 4NNXB 3WFBL 5SX4H 3O6KL 2V9QA 4YHIA 2FATH 2DL2A 3LV3B 4YBQC 3RZCD 3T77B 1YQVL 3L5XL 1FZKB 3FQRB 4N9GA 5AEAA 3EOAB 2Y06H 3MOAL 4YDJA 1R3HA 3HI1B 3IRPX 3O2VH 4Y2DA 1FORL 4LP5A 3V9FA 3RIFK 2VXTL 1P7KA 5GRWA 1XCQB 4R8WL 1RUPH 4XPHH 1TZGH 3VWJC 1P5VA 1S9KC 5TH2A 2R0KH 3K7UA 2PTUA 5JOEA 5D7LD 4Z9KB 2EDLA 3A6BL 3T1FA 1JZ4A 3VRJA 2JB5L 2EE9A 4RGNC 4UINL 2ITCB 5EZJB 3EDKA 3QUXD 1G6VK 1M05A 3IDXH 3SEPA 4FTVD 4KUCD 3SBWC 5LWYH 3LN5A 3GB7A 5AYUL 2LVCA 3T04D 2DM7A 5HHMD 2W0KA 3VD7A 4NO3B 2G5BA 1P84K 1FYTE 3U4EA 3QUXC 4Z7VA 3CFKB 4L8SC 3SDDD 2IAMC 3VJ6B 4M62L 4TUJA 3T2OA 5FOBA 1G6RL 4I0PA 5MEQB 1IAIH 3D69B 4LCYB 4JPWL 2WBJD 3BZ4B 3DX6B 1UWXH 4WW2C 5DJ0B 3MJ9L 3GM8A 1EGJH 1X5YA 1K2DB 4KI1A 1L4IA 3D18B 3K46A 2X1PA 4QTIH 2CKNA 2D9CA 3H3BC 2Z4QB 3QDJB 4I3RL 1S9WB 1IKFL 2EXWD 1LEKB 3D3VA 2X4TA 5B21A 1WV7T 2O93L 2P5EA 4ZUWA 4Z8FL 3H42H 2R23B 3QIWB 3MA9H 4BUGA 2C3HA 4MQ7A 2YRZA 2ZOKA 5K9OB 1ZA6A 4YXLH 3KWWB 3CDCA 1NEZB 3TZVC 1LP9E 4MXWL 3HNVL 2GJZB 3LS4H 3BPLB 4EN3A 4M00A 2F8OA 3RVTC 2MHAB 4EIZC 1QRKA 3HRPA 4BSVB 4JKMA 5EPMB 3GI8L 5BV7B 2XG5A 4ZYKB 5ICXB 4I48B 5ETUA 1NAMA 5JOPE 5HGBB 4NC0B 5JMRA 1X5XA 1NANI 4JFED 5MERB 4XX1E 3CXHK 4OFYA 1RI8A 3DYOA 3F5WA 1FNEB 1L6XA 1LILA 4GW1B 5DHXB 4YHMH 4PGDA 1JPST 3ARPA 2EYRB 1X5LA 1MCOH 1OGAB 1A7NL 4P4KA 1XR8A 2NYYC 4B0MM 4HBQA 4EDXA 2Y7QA 1Z5LA 3BUYB 3KPPA 4LAJH 3RY6A 2A73A 3VXSE 2A83A 4CDGC 4APQC 4LVEA 1PY4A 4YBLC 2W60A 1KCUL 1FPTL 3D9AH 3RTQA 3MBXL 3NFSH 4RAHA 3RGVC 4YQXL 1DDHA 3V8CA 5CP7A 4PRIA 3SGKA 3ULUF 4FQLH 1JGUH 4J1UA 1MJ7H 2VSCA 2X2YA 3DSFL 3RUGE 3LEXA 4QRSB 5DMIL 5EA0H 5F93C 1WCQA 4JFFB 3EOYG 4JDZA 4MJID 1YN7B 5HJ3B 3U7AA 1FDLH 1TETH 3VWKC 4IIQB 1I1RA 1ORSA 2GT9B 1QSEA 5MEPA 4NZTH 3MV8E 4HULB 1T03L 3QULB 4NIKB 3VXNA 2AGJL 3OG6B 1QP1A 4OGZA 3F7RA 1A14H 4EI5A 3FFCB 1JTPA 1IQDA 2B5IB 4U2YA 3ZYJA 1D5MA 2ICWI 4M5YH 4F7MA 4ONOA 5I1HH 4AK1A 3DV6A 4F33A 2AK4D 5T33L 2Q8AL 5CZVH 2AK1L 4P46A 1CI5A 4JFPA 5EC1A 1ONQB 3TWCL 4G9DA 3HNTL 4JPKL 4YIQA 1NJ9A 4JM2F 4CADB 3DJ9A 3B9DA 4J4PD 4JCMA 4X6CF 5D1ZD 1IGIL 4J6RL 3PDOA 4PJAB 3O3EB 4H1LG 2Z92A 2FHBA 3EIFA 4HIHB 2ZJSL 2JJSA 3QIUA 2FHFA 1CFQB 3BN9C 4OCWH 5F6IB 5KVEL 5AAWA 1KT2B 5E5MB 1QR4A 4AEIH 4RGMC 5L8LB 1JF6A 2A6IA 2VXUH 3GUTA 5L8JB 1YY8A 2XWTB 2AGJH 5MEOB 2ZUXA 5ADPL 2GW5A 5I1KL 1YMMA 2H9GB 1BOYA 3NZ8B 1KCRH 5I8CB 1S9VB 5CS7A 3O2DA 2V6HA 5DJ6B 4AH2B 2JJTC 1QSFD 3FZUC 1HZHL 1S7XA 3S98A 4F9LC 1NUGA 3O8XB 2VDLH 3BX7C 2Z91A 1CYGA 4HIEA 1M7DA 2JTDA 4P3CL 2XA8L 3O6ML 1VFMA 3OAYH 5EIQA 1ZS8B 4YDKH 4JM2C 4JHZA 3D39D 4NFCA 1T03H 3UTSD 1GOHA 4AMKL 4HJ0D 4DVBA 4H88H 4LCWE 4U1JB 3MBXH 1R3JB 4JAMA 5I8EB 4Y4FC 5I1CL 2FNBA 2H45A 1H15A 3NA9H 4WW2A 3ARGA 3T0EE 3FFCD 5I18L 2IBGA 4X9IA 3CZJA 4XPBL 3DUSA 1BZ7A 1G9MC 2H32B 1WLHA 2PXYB 1YDPA 3QJHA 4OIBA 2BY3A 1FGVH 1IGTB 4FQLL 1BZ9B 2BCKA 4JG1H 2ATPA 5MI0B 1FG2A 3U36B 3ULVH 3D3VE 3WN5B 1F5WA 5IMOB 4ZPTB 1NGPL 2FIKA 1MRFH 1PBYA 4C55A 4FXGA 3DBXB 3LRSB 3NCFB 3IKKA 5E8OA 5TFSL 4YHML 4NKOB 2IBZY 2OLDA 1JHLH 2BFVH 2X6MA 1CFSA 3FT3A 3GI8H 3H9HB 4FHBD 1KCVH 1J87A 1Z0NA 4G42B 1RZJH 4R26L 1ZGLM 5FCUH 1D5BB 3VXOA 1I8IB 4QRUA 1NFDB 3C5ZD 5FA4B 1ZHKB 4RGNB 3X12B 3RZCA 1PKOA 4JVPA 1OY3B 5ESVB 1E28B 3EO9L 2OK0H 5JDSA 3DRQB 2WSKA 1CGSH 5LCVH 3FO9B 3MNZB 4XP5H 2YPLD 5C0GA 4N9GB 1IKFH 1FAIL 3X13B 3H7BA 4TN9A 1NMBH 5D1XC 2KL6A 4MQSB 3HE6A 1ZWIA 3BGMB 3RWGB 3SGEI 3UEZA 5JUEL 5DVMA 1IAKA 3ALPA 4P2RE 3D0VA 5EUKA 3IJSA 2VYRE 2XZCH 2MMXA 2PXYD 4QOKD 4JFOA 3GMNA 1DTUA 2V5SA 2W91A 5F88A 4XNZB 2JB5H 1ZE3C 2Z93B 3ILPB 1OP5K 1X44A 4G8FA 1ITBB 2XTJD 4P23D 1U8JA 1M05B 5FDWB 4HAFA 4R4ND 1LHZA 3V4PL 3KLHC 3MLVH 1CZ8H 1YMHB 5LBSL 1GRWA 1DVFD 4XB8A 5HYSG 4QYOA 4HKJA 3KS0J 3WHXA 1OAYH 4WUUD 5HYSB 1U2CA 3IDUA 3A6BH 1I8LC 4M48H 4X7FC 5C0CD 4GMSH 4TUJB 5IEHB 4PTTB 1MQKL 4ODWA 5BVJA 4HMEA 4I0PB 2XA3A 5MEQA 1F2XK 4LCYA 5EULV 1NUDA 3BZ4A 1HHHB 4U1MA 4G80B 4JN1L 1DSFL 5I1GH 4HC1L 4YK4C 4KRMB 2D03H 3ZTNH 4KHXH 5C0BB 1RJCA 1RZGA 4LNVA 2DQHL 4O02H 3S96A 4XWOC 1UVQB 1JP5A 4Y7MA 3QIBD 4KK6C 1WZLA 1KTRL 3VD4A 2YK1L 3ZSTA 3NCBB 1IEBB 3V2AR 3PIQB 4Y19B 5JW3L 5KJRH 1MI5B 3E2HB 4V2CB 4PB0H 5ACZA 3OXRA 2ZOKB 4CMHC 5K9OA 4ODUB 5B8CC 3BEWB 1NEZA 3KYNB 3MLXL 4DZBA 1MAKA 5L9DH 2O5YL 1EO8H 3L3DA 4IRZH 5FYJL 1GAFH 2MHAA 1FLRL 2AK4A 1CF8L 5EU6D 4OCLC 4UUJA 4NM8L 4FQXC 1QHPA 1A22B 2GSGB 2HKHL 3ARZA 5T3XD 2ESVE 3T0AA 1F3JA 1U36A 1KUMA 5AZ2L 3PGFH 4GAJL 3MRPA 4FFVD 4HKBB 2VH5L 3MRIA 4ZOAA 1EX0A 4Q9QH 3WKNA 3KS0H 1E4XL 1V8HA 3FQNB 5ILTH 1IZJA 1MCQA 4JRYD 5JW4Q 3NGBC 4WDIA 4TTDC 3VA2C 5EOCL 2OMBA 1YPZA 1DVFB 1MJJA 5DHVB 4RAUB 3L7FA 4UNVA 2VE6B 4KMLB 4O4YH 5LVEA 4CJ1A 3RL2B 3SJVD 1OAYL 3RA7L 4XMPH 3LEXB 2DJSA 5IHBA 4QRSA 5I8OH 1BQHB 3DMMA 4X7EC 3QG7L 3AS1A 5E94B 1ORSB 2GT9A 4N0UA 4XTRD 3L6FB 2ZCHH 4NHUB 2FX9L 4RGMB 5I2IB 1XGPB 1T83A 2BSTA 4D3CH 5HI4D 3SOBL 4KDWA 2HT3D 3P4OA 4ZAKC 4MMXC 4L3ED 4F33B 3BGFC 3GMLA 5KSUA 1CL7L 4YZFF 2UY7A 3IDGB 4LCWA 4HK3N 1MOEA 3DUHA 3AXLA 2VR4A 2LV4A 2R2EB 1CG9B 3OB0H 5ALCL 1NJ9B 3O45B 1K8DA 5L6YL 2QHRL 2VN7A 2NR6D 5E4IA 1KXQE 4DZ8B 3WFEH 4DKFL 4Z7WF 3PDOB 2GSIA 3NBNA 3C2AH 3BZEB 2GHWB 5D2NB 3IYLW 4LSQH 1A8JH 3MMEA 3BP4A 3O3EA 1KLUB 3O6LL 4JEGB 4G8GA 4K8RH 5DJYA 3U83A 5JA9A 1CT8B 2YK1H 1YNTB 2R2HB 4LLMA 5C0FA 4Z5RA 1CFQA 1BBJB 3AGVA 2XV6B 3RZCC 3MRKA 4OT1H 2MOVA 1JE6A 1JV5B 1UXSA 2YA0A 3V52H 2VLMD 2NY4C 1IRAY 1ZXQA 1K6QL 4PJIE 3TA3C 1RZJL 5CJ8A 3U48A 2MPAL 2NZIA 1FVCB 3JWOL 4PG9A 5I0ZA 1YMMB 4OQTL 3QH3B 3NZ8A 2NTFA 2R1XB 1HH6A 1KBGL 5MENA 1YJDH 4KKCD 5DD0L 3DHMA 3QCTL 5HHVL 5B22A 2AV1A 3D85B 5DZOA 2OJEB 2WANA 4EI5C 3I2CL 5IW1A 1Q9OA 5EG6C 3VFGL 1YYML 2EIDA 4QT5A 4NNPL 1UWEL 3QDAA 4V1DD 4WFFE 4Y5YA 4C4KT 5BW7C 3IU3B 3MROA 3QAZC 5IVZB 3O81A 5FCSH 4TYUA 2OMNA 1N8ZA 5I1EL 4EJ1C 4NJAL 1WISA 1MAMH 4WIQA 5C8JA 1JZ3A 5CHNB 4KV5E 3H9SE 3LZFH 2PO6C 3GIVA 4C58B 5I16A 1RZFL 5CINH 1FJ1B 1MFEH 4OFYD 1WBYB 1I7RB 4XH2B 3CMOH 4KHTL 4WNQA 3FB7A 3WDJA 4XHJC 4L1DA 4R2GD 1BWWA 4H1LA 2BHZA 5IR1A 3QRGL 1WZKA 5LGJB 1UEYA 2KUTA 3BP7B 4YHYC 3VFTB 3DPBA 1KV3A 4ACPA 3WN5A 4ZPTA 4S2SA 4X8JB 5CIPB 5BV7L 4NSKA 4G5ZL 3U1SL 2UVFA 4MZ2A 5MENE 2H32H 5D7IB 4NKMB 3MUY1 1DEEB 2DL9A 4NKOA 5C3TA 3ZYZA 1E0OB 1U8OB 3KXFE 3I50L 3BWAA 2VUYA 1JHLL 5KSVA 2AJXL 2R1WA 3EAKA 3GMOA 3V5HA 5JXEA 5IMMB 5CEXB 1QRNE 4ZFZA 3B5GA 2JJTA 4YJZL 5BXFB 3VXOB 2OQJA 4YPGB 2NX5B 4CVZA 2GITA 4POZC 3HNSL 4PGCA 4PJAE 3QFJA 4PV8B 1N4XL 5JDSB 1MCSA 3HI5L 1NFIA 5CEYB 3KYOB 1UM4L 1T20B 2D7TH 4PGEB 2VAAB 2AXGB 4PRAA 1MVFA 2DQCH 4XC3H 2QQKH 4WHYH 3MV9E 1AP2B 4C54A 3F62A 4KZDH 4M4PA 3L9RB 2BVQB 1OPGL 5K93A 2A9ML 2FH8A 4OLEA 3LSOA 1CN4A 2V7HA 1M71A 5GJTH 4DKEH 5I17B 4FZ8H 5GGTL 2RCSH 4OB5L 4TSAH 1V3MA 1QG3A 5D7JD 3L3GA 3GIZH 1P4LB 1AGCB 4AEHH 3BT2L 2DI8A 4ZUVA 1T5WA 1IEAB 3BIAX 5FO9A 3BUTA 5A2FA 4XVSL 3HG1A 4NZRL 1MUJB 1U6AL 4LCCC 4NWTL 5FDWA 3MO1B 4P57A 4QOKE 4RMQA 2XKNB 4MVBC 1OAXH 5GJSH 3QEQB 4NCC2 3MNWA 2X4OB 2B0SL 5DJ8B 4DFHA 3VXUD 3DSFH 4HDIA 5HDOA 2QR0A 4ZTPL 2FEDC 5D7SH 2GJ6D 3LKQA 1NMCB 4A6YH 1S8DB 4OFVA 1YPZE 2HG5A 3C5ZC 3QUMA 4PJDE 2X42A 3GHEL 2P8MB 4M5ZL 2I07A 4DKEL 1NAML 2AJYH 3U79A 2G9HA 5ABDE 4JB9H 4ZDHA 3RGHA 3QB7C 2NY2C 2ERJB 3LQZA 1IGCL 5DMGD 5I74B 2ZJSH 4DFIA 1RSFA 1IEBA 3MV7D 4KQ3L 3QI9A 1TPXC 5HYQB 1LE9A 1MI5A 1BJ8A 1EH9A 5D7KE 3OX8A 5F97E 4PJIF 1KEGL 4PJBB 3TV3H 2VUOA 5KS9A 4RIRA 2PTTA 2AABL 4GKSB 3VXRD 1IFHH 3E3QE 4K8RD 3HNTH 1BAFL 1EAPB 1G7IA 3L3DB 2AXFB 3IETA 5EBMA 4PV9B 5FYLH 4GBXD 4O51B 2AS5M 3FT2A 5K9JL 4LEXH 2ICWA 4D0BB 4PJXA 1FIGL 4I18A 2X4QA 1GYAA 2DWDB 4ZXBC 5B38G 4N8VG 4NM4H 1A6PA 1WIUA 1IBGH 2IQ9H 1AGDA 2EH7H 2VN4A 3ARDC 4KHTH 1TCRA 4OZHA 5E9DD 3A6CH 4GBXA 4XP1L 3EJYD 2R4SL 4GKNB 3PWVB 5EOTA 3JV6A 3H6JA 4Y1AD 1U92B 2ZCLL 3R1GL 2DBLL 3A0OA 5DHVA 2X09A 5HHOB 5ID0B 1Q9KB 4XXDA 4XC1L 3EO1A 5CJBA 3IVKA 4MCZA 3GMMA 1FFNB 4FQ2H 5KOVC 5J56B 3DUUA 3SE8H 3PGCB 5DK3A 3O6FD 4L4VA 4GRWE 3HE7A 1LE5A 3HAEG 1U2HA 3MXWH 3GJEB 4CW1A 2B4CL 4MJ4A 1BQHA 1CD8A 2DN7A 1UB6B 5JORB 1JGVH 3O2DL 4YXLL 2DWEA 1FV1B 4H8WL 1OAQL 1HILB 5HVHB 4RNRB 3S35H 5MP6L 1TDQA 3I84A 4HF5H 4FFWD 1IGMH 2OYPA 4XNYH 5D71H 2BSTB 1GHFL 2W9DH 3UAJD 2NY4B 4XCNB 1DZBA 3C6LA 2YD6A 3RBGA 3OMZA 4Q2ZA 4YGAB 1TQCB 5FGCB 4G43B 1B4JH 2DOCA 2VXSH 3IDGA 4LCWB 4AQ1B 3GRWL 3P4MB 2HJFB 3QCTH 2JIXD 4M4RA 2FJFB 5DD0H 3MRRB 4JFXA 4QXGH 1K8DB 5L2JA 5JXAL 2GUOB 4GKZB 4DZ8A 4Y4FA 1A6VH 2SEBB 4QHUB 4L3EE 3WFEL 4DKFH 3WFBH 3Q1SH 1CS6A 4JG0H 5F7FA 4LLMB 2FB4L 1K6QH 2XRAH 1QD0A 3MRKB 4EKXA 4D2NA 2CLZA 5DUPL 5FYKH 1ZVHA 1OCWL 4YHLL 3B6SA 1AO7E 1JUFB 4PG9B 1N6UA 5INCB 1VFBA 5GGRA 3OKEA 4KMQA 1VADB 2DM3A 1H3PH 4B7IA 5F7KC 3ZTJH 4U2ZA 3VXTA 3FHAA 1JNJA 3P73A 3VG0L 1AGBB 3RWJB 3VG9B 1IC4H 1BMGA 4OCMC 2OJEA 4YDLB 2WP3T 4PY8J 3RWFA 4ELKB 4OSUH 3Q5YA 1PVHA 3Q5OA 3FJTA 5TQ0H 2AJ3B 2VWEC 1V3JA 3KPSB 4UINH 5JW4R 1RU9H 3W0WB 3MROB 1CLYL 1RMFH 3RGVD 4ZS7H 3DURB 5FO7B 1CE1H 5CJOL 3THML 3P40A 3CLEH 1OHQA 3MSPA 4RA0C 5HGDA 4X6BB 4NUJA 3RVXD 2VQ1B 4LVNB 3PDDA 1J8HD 5T1LD 3M17A 3IF1B 1T7XA 1S5IL 2MFNA 3GIVB 1DBJL 4AL8L 3MFFA 5DEFA 1FE8H 2C4XA 3V6ZB 4A6YB 1FJ1A 4YXHL 3LKRA 4XH2A 4W6YB 3QQ9D 3GI9H 4NZUL 1QR1B 2CDGB 3ZKNC 1D6EA 1KTLB 4OZFB 1E4WL 4X6FB 2GCYB 4X4ZA 4OLYH 3ULUH 3VFTA 1LP9F 2P24A 1T0NA 3B2UD 5SWQB 3CDFA 4JQXC 4ODVH 3I6KB 1T21A 1KJMB 5F71A 4TUOB 2YR3A 2AJVH 3DVIA 5JDJA 4GG6E 2Y72A 3MV8D 3B9KB 1EO8L 4AJ0A 3CSYB 2VDML 1PKQA 4HV8B 1IGJB 3O3DB 1T7ZA 4X5XB 2F5BH 3ECBA 3BWAB 43CAB 4JO4L 4QRTB 1KLGA 3VD3A 2Q7YA 4NKIH 5IMMA 4LCUA 4GW5B 3OSKA 4P2YA 5IGXL 2YD2A 5EWIH 3RIAF 4PJ7E 5LAXB 3OV6A 1KXVC 4NQDA 4PLKD 2KPNA 5I1GL 2PYEB 4HJGA 3TVMC 4LKCB 4JKPH 3BZDA 5EIIA 5GGQL 2DYPA 4PGCB 3VRLF 1X4YA 2XTJC 5DFTA 4KROB 4PV8A 1UQSA 5D7LE 4M7JL 1NFIB 2G60H 5C09D 1T20A 1QZ1A 5A40E 2GJJA 1RY7B 3KJ4C 4FMKA 2OSLA 3BPLC 4MA8L 2FWOB 4WWKC 1I9RL 4YEFA 4DEPC 4Y16D 2HAZA 1I8MB 3RVWC 1D9KB 2XQYK 5LBSH 4YEEA 2NLJB 2JJSC 3EGSB 1YC7A 2BNRE 3CVHB 2VDRL 4ISVB 1KGCD 4WI4A 2R1YA 4NQCA 3FRPG 4NFBA 1OARH 1OP3K 1P4LA 4HPOH 1SYSB 3L3KA 3I9GL 1A7RL 1KNOA 3TPUB 4PRPB 4LLVB 1HXMB 1U8QA 4TVPL 3NAAL 4P4RA 1NBYA 4UILL 4UV4H 5FO8B 4LSUH 2PR4L 5M94B 4JZJC 5I6XB 1MREH 4LNRB 1C5DA 2QR0B 3BKMH 3GSOB 4BH8B 3GSUA 4DAGL 1F13A 3SKNA 1MY5A 1VEPA 3IAGC 4NQEE 4GAYA 1T4KB 2EYTA 4QXGL 3VRIA 5BMFH 2P49B 5ID1B 3HZVA 1J9CT 1FLTX 1UWXK 4HD9A 2Q76B 2OK0L 3VXUE 3BRDA 4L3EB 4M8QA 4TSCH 3U46B 3WIFB 1NAKL 1ORQA 3SE4C 3RI5F 3UTOA 3SBWA 1AH1A 3P9LB 5CJXA 4WFGE 1KSRA 3DV4A 3OTTA 2O26U 3O3BA 2X4PA 3E6HB 3KPMB 4G6FB 4OFPA 4P3DB 5CJXC 1M7XA 1QSZA 5GS1B 4NN6B 1MRFL 4IRSC 1EAPA 1G7IB 1CIUA 3QEHA 3TNMA 3IETB 4PV9A 1LP9A 3P30L 4JFZL 4O51A 2GI7A 5D2LB 2R69H 3ZE2E 2G75A 4FXKB 3U0PA 3WO4C 1REIA 1NGPH 2YD5A 2X4QB 5E8EA 4JRYE 1MRCH 1PG7W 4U1NB 1BD2B 1KTDA 5IFHH 2D0HA 3QG6A 3TV3L 4DN4H 4AIXA 1Z6JT 1ZLWK 4OV5A 3OJVC 3LN4B 5ISZE 3GSRA 4PRPD 2ZCLH 4GQ9H 1M7IB 3HUJB 1IGCH 1F4WL 3P4NB 3C5JA 4TSBH 4EVNB 3QIUD 4KI5F 5JLZB 1D5XA 5GRZA 5CWSA 5EO9A 1MFBL 4K2UH 4MQXC 1G0YR 2H8PB 3G6AB 15C8L 2EH7L 3CSGA 3RFZC 2H1PH 4XCFL 5FHBL 2BXZA 2YRLA 1KPVB 2VDQL 4KJQD 1U3ZA 4YDKL 4AQOA 5FKAB 3V6OE 2XA8H 4KMTH 1NCUA 2J3SA 4HWZB 3AMLA 2YMXL 1ZKAA 3QNXA 2VKWA 4XPBH 2GTWB 4MD0A 1FV1A 2DLHA 1IFHL 2XFXA 1N2RA 4WEMB 5F89A 3W11D 1P7KB 1T1WB 1NC4B 4MAYD 4XCNA 4FS0A 1MJUL 3VDCA 1FBIH 5BVPL 3IJYB 1VPOL 4AENB 1NANH 2NXZB 1P9MA 1B2WL 4HGMA 5F7YC 4F15C 4IMKC 3SQBA 4KVNH 5EORH 2L0DA 4RZCA 4C59B 4N5ED 4DVRH 3WHE0 1HWGB 3HC4H 1OPGH 2Z31B 2C9AA 1LD9A 5DRZB 2MCPH 2CIKA 2ZSVA 2HVKA 4RAVA 5IHZB 4F3FA 1XGUA 1KJVA 5GZNC 5KAQF 4Z7VB 4GQPH 3QIBA 4UT7L 3VJ6A 3SGJC 4Z7WE 5J6HB 1MF2H 3TJHD 2HFEA 2ZUQB 5EC2B 3SCMD 4F58L 1BFVL 1CD1B 1MRDH 1Y6KR 4HFUL 5CZKA 3BD3A 5DJ0A 4HIIB 4NZRH 5INCA 1MLBB 3M1BB 3OR6A 1L7TL 4Z6AT 3BESR 4E42B 3T3PE 3HMWH 1VADA 1AE6L 3UXFA 4HZLB 5E08L 5EBGA 3D3VB 1IC5L 4M61B 1JWSB 4JPKH 4HUXB 4JY5H 4L9LC 4AEFA 1BD2E 1S7WB 1A21A 3VFSB 2CR6A 3W9EB 3LOWA 1Q9WA 2PW1A 4P2OA 2HLFD 2A9MH 2KH2B 2X4NB 5E6ID 4M5YL 2Y1VA 4Y5XA 5D93C 3HUJF 1KJ2A 4KMTL 1JWUA 3TBTB 4M6AA 3V4VL 3LRHA 5FEBA 3U82B 1E27A 3VMNA 3MRJA 1PG7X 3STLA 5D7JA 1KCUH 3TH2T 3N0PB 4NUJB 3FO2A 1EJOH 3KPQA 3C6LC 1MFBH 5LKNA 4XNQA 1FPTH 3M17B 3IF1A 4JO1H 4UU9B 1I1AD 3QPXL 2OS7A 4D9QE 5C0RL 3VMPA 3B3IB 4UNTA 3O4LA 1UCBL 4PGDB 2PNDA 2DQTH 4TRPH 3LKRB 3CAFA 3BUYA 4U0QB 5SWSA 3GZKA 4HKZB 4GRWB 4FG6D 3JV0A 1YA5A 3TEUA 4WI6A 5K9QI 2XN9B 5E2JA 5J6GB 5SWQA 4OLZL 4LIQL 3GBML 3UTTB 3RL1B 1JHTA 4NQCE 3NCJL 2NY7L 4UDTA 3MLTB 2E27L 2X1QA 3IXAA 4TUKH 2P45B 4M1CC 3DX7A 3DGGA 1EMTH 4MMZC 2OX5A 1LO0L 1SYVB 5JQ6H 4QRTA 4FTVA 2Q7YB 1Q72H 3BPNC 1DQTA 3D25B 4MXVE 4GW5A 1DUZB 3E8UH 1HOCA 2HVJA 4PREB 4R9HA 1C08B 1FO0B 4K07A 1KJ3H 2PYEA 4I3RH 3UPCA 3KPTA 2DQGH 3CFDA 4UAOC 4U1KA 3I6GB 1BIIA 4WJ5B 4UQ3B 1I9EA 5E1HB 3OZ9H 4LSPL 3L5WB 5DTFB 4NQDE 4IDJL 3U30C 3WFDH 5CSZA 1O7SA 1OTTC 4Y4KD 3H42L 3WSQH 3PE9A 4MA7H 2IPTH 4JKWA 2NY5C 3CPLB 1BM3H 2DYPD 2NXYD 5HYJA 1T66C 4OF7A 5KS9E 1HHIB 3MV8B 4PJ9B 1MIMH 1QNZH 2VDKH 1U8NA 3GSQB 1F02I 5IFJB 2FL5B 3RZWA 1KN2H 2BK8A 1KBGH 4UZGA 1TTGA 2Y23A 4H5SA 3GUTB 5BRZD 4NQDD 1P1ZB 1HXMA 1U8QB 2FX9H 4PYGA 1OT1A 4GUPA 4L8DB 5IEKA 1OSPH 3O6FA 4L4VD 3SDCD 2VL5A 3WDIA 3RPIA 4NQEB 2DQIH 5HYEA 4KK9D 4LNRA 1O5DT 4CU8A 1CLCA 3GSOA 1P4BL 2YD8A 4BH8A 4GT7A 5BOPA 1AI1H 2W0FA 2YUXA 4W70A 4HIEB 5KW9L 2FECI 2VLRB 1CWVA 3HZVB 5FGBC 2D9QB 2Q76A 1O7VA 4JQVA 4L4TD 2BSRA 4NKDA 4PB9H 5IBTH 4M8QB 5GPRA 4CVXA 1HHKB 2VXVL 3LVEA 4FFWC 4Z0XA 3ARGB 4LGRB 4OIAA 3RJDA 3RVVC 1M1SA 2UZYB 3QUYA 1T1XB 1IM9D 5DRWA 1EFXD 1RHFA 3P3YA 2H6PB 5E00B 4XCCL 1YDPB 4KQ4L 43C9B 2G2RA 3S7GA 2Q3ZA 3WXVH 3QIUC 2FJHA 3F6IA 1BZ9A 2BCKB 3F65A 3CCHB 1RZ8B 5CGYD 4QY8A 4OI9A 3TNMB 3FOMB 1JYNA 1JRHH 1G1CA 1ND0A 1NGXB 1VEOA 4O2FA 4XVTH 4QXUH 2YN3A 4LRIA 5FYJH 1TZIB 3QQ3A 3TO4B 2PYFB 4L9DA 1CIDA 4OFDA 1CGTA 5C6TH 2NW2A 1VFAB 2OL3H 3E3QC 5D6CA 2PF6A 4JRWA 4OV5B 5E8OB 5E56A 1HI6A 2BNUA 3TJEH 1PG7H 3ZE0F 4Y5XC 4EVNA 1I1YA 2CDEB 1UWGL 4QHLA 4ZOCA 5HHME 5I30H 1MFDL 3C9NA 3T3PF 1INEL 3MJ8A 4OM0H 2ZCKH 2VH5H 4MXQD 4WY7L 1CICA 4F9LA 2NXZC 4QRUB 4OI7A 1DQMH 4OGYL 3V7AE 4HIJB 3MODL 3X12A 1MPAL 3IGAB 2DQUH 2OI9C 1A7PL 2NMSA 5AYQA 4HWZA 4S11A 4JR9H 1X5AA 5DFVC 5T3XH 3RHWK 3PJSB 4WV1B 1XGTA 1P4BH 1U9KA 2GTWA 4OZFH 3H7BB 2L4OA 5F89B 2D7MA 5DMGC 2EYSB 3NCCB 5JHDD 3UYOD 4LLQB 5E6YA 3P11H 2R4RL 1TJIH 4NDMA 1K9TA 4ELME 4NP4H 4N0UE 3GMNB 1DBBL 3K2MC 4OM1L 2NZ9D 3NVQA 4AENA 2XZQH 3JWDL 3Q6FB 3KHOA 3X3GH 5KVFH 3QDGD 4OCYL 5ITBH 4RZCB 3BAEL 4UDUA 3LKOB 1UH2A 3AB0C 5D1QA 5BCAA 4JFYB 3QBTB 4RFEA 5C0DA 4AZ8A 5ISZB 1NCCH 3BH9B 4IRJC 4HKJB 4BELD 1BBDH 1ZHBA 4PJCF 1VHPA 1RFDL 2W9LA 3S3PA 5D1QC 1K3IA 1OQXA 4WVRA 4F3FB 4NNYB 1Q0YL 4PTTA 5AZEH 5D5MA 4ALAL 3DI2B 3MV7A 4ZOBA 3WJLA 1A4KB 5BVJB 3FO0L 2CIIA 4I9WE 1FH5H 2ARJQ 4PIRF 4L4TA 4I3SL 4CKVX 3DO7A 1D5ZB 3SE3C 1SMOA 3QWRD 4BK5A 5F7HA 4EUPB 5E2VL 3LKSA 4Z77A 5K9KB 3GHBL 5IB2B 1QBBA 3CFEA 3SGKC 1B9ZA 1EUTA 3KPRB 1MCHA 3QHTC 4NQUA 4NBZB 1S7QB 3PIQA 4Y19A 2WBJB 4DK3A 1JHKH 4HF5L 1HHJB 1NGYB 5ACZB 4H8WH 4P2OB 3OXRB 3AS2A 5EZIH 2B8OT 3H0TB 4DZBB 1IGFL 1JWUB 1J8HE 2YBRB 4MCYA 3PNWA 1RUMH 3D2UD 5ENWA 3V5DB 1HYSD 3MYJB 8FABA 1KIUA 2DBLH 1XAUA 3SDCA 3VFMA 4F37F 2ED9A 4RGOH 5BW7A 2W0PA 3L1OH 2BVEA 3FB5A 4HKBA 2EDDA 1N26A 3MRIB 4LBEB 4OCSH 4JFHD 5EUOF 1ZLUH 4J7RA 2J7LA 2Q86B 3FQNA 4XP9L 1K4DB 3NA9L 1S7TB 3OWEA 5I18H 4WDIB 4FQQA 4HPYL 1I3VA 1TNNA 1TVHB 4KVCL 4HQQL 5J13B 4PY7B 1YEGH 5DXWA 1VGKB 1EERB 3O6MH 2R29H 3QSKB 4U1LB 4XVUD 1HCFX 2VE6A 4P46C 1V7NL 3RL1A 1A64A 4S1RL 4P5TA 1KYOJ 1NMCC 2DS4A 4PJGF 4AEEA 4KY1L 2FGWL 5CILH 4RISH 4DTGL 3EFDL 4JY4A 5D6DA 3LPFA 4HWBH 2HT4D 3KHQA 3T0EC 3ZSSA 3HTLX 3FO1B 3NH7L 4F9PA 2VLLB 3MCLL 4U6VH 2O61A 1JYXA 1X4XA 4CRPA 3D25A 1PX3A 4M7LT 2WBKA 3CVHH 4UV7H 3EFFB 1FGVL 3J7HA 5B4MD 3MACH 3UJJL 2YD4A 2F9BT 3I6GA 1U58B 3KGRA 5IG7A 4LHUD 3RAJH 2ARJB 3C60C 1G7QA 4JREB 3ZE0E 4I77L 2BNRD 3EYQC 3FAXA 5ELIA 5E8DL 2EDYA 3WLWC 1WWAX 3T3ME 4RMWA 1S7RA 5FM5M 1CG9A 3S34L 3CPLA 3W0WE 3S5LB 3MPCA 4DKDC 2VLJE 5B38B 4X6EB 5EU4A 3BZEA 4DVRL 2F15A 3VFOA 1YNTA 2R2HA 2UUDH 3BQUC 5IFJA 4F7TA 2FL5A 4HT1L 2CDFA 2J2ZA 1SY6L 3FFDA 1W72H 3OKKB 2YPKB 2NY4D 5EBWB 1JV5A 3P0GB 3GIZL 3JSSA 2EDNA 3MRBB 4ZD3H 5C08A 3QNYA 4I2XA 4TSAL 2BNQD 4WO4C 5I8KL 2X10A 3CGTA 5JXED 1FZMA 2GIYA 4AG4H 4ELMF 2EDRA 5TJWK 4XPFH 4YR6A 5B4MC 5F70A 3D85A 2C7UB 2Z8WC 1JK8A 2HTKC 5TQ2H 1YY9D 2E6PA 4OBSA 4XNXH 1Q9OB 3T0DA 3ARSA 4Z7UE 3LMJL 3JVGA 1X5HA 2DKMA 1FNGA 2BSRB 2ZUUA 4MAYA 2VLKA 4NKDB 3QQ4B 1WZ1H 1MHCB 3O11B 4UQ2B 3SCMA 2WUCH 1N8ZB 2CH8A 3MBEB 1EJOL 4EDWH 5EU7C 5GQBA 1AHWB 1P4IL 3K8KA 1T1XA 1WFTA 3D0LA 1J8HA 5T1LA 3QEUA 1MCJA 3FRUA 1G7PA 1XFPA 2AXJA 2FJHB 4X5WA 4H1LH 1WBYA 3CNKA 4G7YH 3CCHA 1Q9LB 1EJ6A 1S7SA 4GS7B 2Z0BA 2PUQT 2FBJL 5E0QA 4NRYA 4MWFB 4UT9H 4JM2B 1D3CA 5HD8C 4ENED 1GGIH 4X7CC 1RUQH 2BDNH 4KI5D 1FL5A 4JY5L 4K9EC 3LHPL 2OI9B 1J1PL 3TO4A 2PYFA 4EI6A 4PGJA 1DLFL 4X8JA 5IBLD 4W4OA 3QO1B 4NN7C 2V7NB 1U8KA 1CLZL 1EEYA 1V7NH 3CK0L 4FQPA 7FABL 4NKMA 1JI1A 3BH8A 5HTSA 4PJEE 1K4CA 1HI6B 2BNUB 1A6AB 4JRYB 1RZFH 4MJIA 4Z7QF 1U8OA 3W2DH 5GGSY 2DI7A 3RNKB 1RZKC 5KSVB 4X7TA 4OF8A 3V5HB 4Y89A 5T5NF 1I9IL 5GSVA 5TE4L 5IB5A 3IDJB 4P3WA 3EYOA 4LSTH 4G8IA 2V5TA 4YPGA 2OP4L 4KI5E 2GITB 4RWYH 5FUZL 5TPWH 2LU3A 2UYLB 3SDYH 4RA3A 3QFJB 3GJFB 4QHKI 4QRRA 4RQQB 1I3RA 5DJXA 1FC1A 3ROLB 3BPOC 4HKXA 3KYOA 5F9JB 3R0MA 4PBVC 3TT3H 4PRAB 2ICEB 1UG9A 3VXRA 4DGIH 1XGTB 1A9BB 3F7YA 3CXHJ 3G6DH 5E95B 1F3DJ 1A3RL 3VFVA 5EH1A 3VGHA 2ZKHL 3EJZD 1MCCA 1WAAA 3BP6B 5HHQA 4KK6D 1U8HA 2VITA 3TN0C 4X4XA 1AXIB 4LU5H 2V7HB 3V0VB 1CK0L 5GGUB 2UY6A 2YPLB 3GBLA 3VFRA 1CGXA 3L3GB 2XN9D 1Q0XL 3BXNA 1AGCA 3Q6FA 2XQBL 5D4QA 5T1KB 1T5WB 4ETQA 2MPAH 4ZUSB 4KDTC 1YEFH 3QO0A 2EE3A 3C87A 4MD4B 1MUJA 4JPWH 2NZ9C 1VESA 5D7JC 2XKNA 1H3TA 4LAQH 5FYJE 4FQIH 5ADOL 5DJ8A 3TIDB 3WO3B 2QHRH 5DRNA 4YHPB 2JF1A 4YFEA 4LSQL 5GISL 1CR9L 2C1OB 3FN3A 4JPIB 3EDDA 4PJGE 4QHNA 1KJ2L 4LKXA 1XF4A 1CQYA 2ZG1A 4XNZC 4OFIA 2EECA 1LEGA 4IDLA 4OF6A 4Z0BL 5CUSL 3SY0A 2ZPKH 3IFOA 2W07A 1IM3B 2JIXB 5HYJE 1JGLH 2PKDA 1SMAA 1WEJH 4L8SA 2APWA 5EOCJ 1CICC 1FO0H 2FECL 5BS0E 2ZSWA 5GRUH 1BX2A 4Z77B 3DIFB 4HJJH 5D9SA 5KSAB 3CFEB 1KFAL 1SJVA 2I24N 2AJZA 2WBJA 5K9QG 2R69L 1A6ZB 1IT9H 1JVKA 1HHJA 3QZWB 1MEXH 2VXQH 5CBAA 2BC4A 3O2VL 2PTTB 5DLMH 3RA7H 2Y06L 1P2CA 4DEPB 5E1AA 2FO1A 4O4YL 2NY0D 1UYWL 4HFWB 3K74B 5EU3A 1R3LA 1NSNL 4JR9L 4P5KB 1N64L 3ZKXB 3MYJA 3O6KH 5BRZB 5T5NG 4I18B 2D7PA 1QPXA 5JO5A 1RK1A 1CLOH 4OGYH 5I9QB 3FB5B 4YXHH 1NPUA 2YPVL 4LBEA 2VSDA 3PWPE 3VFPB 1E4XH 5IB4B 5BMFL 5JHLL 4WEBL 1MJ8H 4NQCD 5EOTB 1U92A 4BZ1H 4IRJA 3QA3B 1MWAA 4JZJB 4G6JH 2CKBL 1V3KA 1VGKA 4LQFH 5I73C 4XXDB 5SWSE 1CLYH 2DM2A 5D72H 1FFNA 4P5TB 2YN5A 4JRXB 2VLME 4G6KH 3UBXA 1UH3A 4RFNB 1CD9B 3HE7B 1LE5B 2VOTA 2IH1A 2CO6B 3MUGA 1A7RH 4Y5VA 4ONGH 3FCTA 2AKRB 1FN4B 2MWCA 2CK2A 1OARL 1M6OA 5T1MB 3WS3A 3Q6GH 2VR9A 2KQMA 3HRZA 4D9RD 2OJZH 2EDQA 1CGUA 3EYSL 4LGSB 1MFAL 1A0QH 1NBZB 4JHAL 4PJBE 1I4FB 4YDVA 5D1XA 5EUOE 4EXPX 1FZJA 2DKUA 1JGLL 1LO3H 3LDBB 4NO2B 3SDCC 1JNLL 1RZKL 4JN1H 3UTSB 4YFDB 4Z7QE 4R7DA 5FGCE 1A47A 4WHTA 3MR9B 1SQ2N 3MLYL 1SEBA 1XZ0A 3MRRA 4PRHE 3FB6A 5IW3A 3FZUD 1AD0B 4Y0GA 1OAKH 1UZ8A 4LAQL 3W82A 3ULVC 4M6MH 5D7IE 3I6LD 4R7NA 4JGJA 2CDFB 2WP3O 1AR1D 4NKIL 4K71B 1QSED 3FRPA 4ZTOL 1F8TH 3AREB 5C09B 1NC4D 3DHJA 3BRGC 1S7UA 2YA2A 1VACB 3DRTB 4P0DA 3VFUB 5C08B 4QCIB 3KJ6H 5DHYB 1NCAL 5H37H 3ULSA 2NXZD 1WICA 4MB3A 4ESKA 3BISA 5DQJB 4ZAKD 5IBLC 4XVTL 4OZGA 4LU5L 4NQXA 2XY1A 2J8UE 2X44D 1IQWL 3VXTB 3FQXB 4GRLD 3PL6A 1T22A 1X5GA 3RWJA 2D0FA 1RIHH 3TBSA 3MGAA 2C4FU 4WWKD 3LEVL 5LCVL 3B2VL 5J3HD 1MCBA 5EU5B 5DD1H 3X14B 3IDIB 3EO9H 5JHDA 3KPSA 1T04A 1LO2H 1QFUH 4NPYA 2VXVH 3W0WA 5I1IH 4MDJB 5I76B 2ESVA 4UQ2A 3SCMB 1H3XA 3WFDL 4JLRA 4GMTL 1N5YL 1H3UA 3VXPB 3G6JF 4EIGB 1RIUL 2K7PA 2VQ1A 3VWJA 1AHWA 2R4SH 4JFEE 2X89D 3VWKD 1QQDA 1MCFA 4P2RB 2AXHA 1FCGA 1G7PB 1DJSA 4K7PX 5CJQL 3U7YL 3JTTB 1AFVH 1UACL 4QOKB 5T5FL 4OD2B 1QR1A 1QFWL 4MWFA 4FFVC 1G9NL 3V4UH 4DCQA 2GCYA 1FL5B 2A6KA 2P24B 3Q5TA 1JNHB 4R0LA 4JO2H 1L0YA 3C6LD 1KJMA 3JTSB 2H2SC 3WXWH 3KPNA 3KR3H 4U7MA 1MWAH 5TE6H 3ZKND 3QDHA 1QBML 2EIEA 4D94A 4OUUB 4JRYA 4X5XA 2NYYD 3ECBB 1CGWA 3MA7A 1FG9C 4BQCA 3RNKA 3BQUD 4LPUA 4WENB 4C56E 2DDQL 1KJ2H 5HVFB 4WFEE 2EH8H 1UADC 4ZNEA 4K23H 3RVXC 2LVEA 4U6XB 1AY1H 1D6VL 1NDGA 2ADGB 4N68A 1WZ1L 4JO1L 5DS8B 5JXAH 5EIIB 4Z78B 4LSPH 1BFTA 1TLKA 1W72A 3WNNA 4QRRB 5TH2B 3BKYH 3D48R 3CU1A 4HKXB 5F9JA 3CH8A 2VXSL 3SDAA 4NBYB 2NX5D 3VRJB 1W0YT 1I8MA 5K33A 2CK0H 1D9KA 3UJTL 5J9PA 2VDLL 2VDNH 1OAZL 4RMRA 4NWTH 4X4XB 2F74A 3HB3C 3FONB 3GSWB 5TDPA 3R4DA 5FYLD 5D7KD 5JR1H 4S1SL 1IGML 3DO3A 2B39A 3GB7B 1EMTL 3NPSB 2G5BB 4PLJD 3FMGH 1CCZA 1FZOB 4CL7A 4WHDA 5E08H 1I7ZB 3RNQB 4NT6B 3CFKA 3BXNB 2X4RB 1U3HB 1XF3B 4LGPB 4KGLA 4P23C 4ETQB 12E8H 2X9YA 1TITA 4D0DB 4Y4HC 5F1KC 3HC3H 2RIKA 5CKAA 4F58H 2WWKT 4KJYB 4CAGA 2D31B 5IVOA 4MX7A 5L2KB 3S97C 2PXYC 1RV6X 1AD9B 4I9WD 2EZ0D 3QDJA 4YDLC 2GKIA 3NFPA 1S9WA 5KBNC 2I9TA 2NXYB 1WVZA 2LFGA 3DVFA 1MAJA 3GSUB 4LSTL 5I1LB 4U6HB 1UM4H 4LKXB 5D1XD 1PEZA 1U93B 4KKAC 3T0BA 2FJGA 2VDOL 3E1F1 5C0AE 2ICWJ 4K94H 1T4KA 2EYTB 3W5NA 1GGYA 1CDYA 4M9OA 5DFWH 1QVOB 2UUDK 4ZO9A 2V5RA 1G9NC 3HZMB 1U8PA 2Y5TB 4HS6A 3MACL 3UJJH 1GC1C 1ORQB 5SV4A 4BSVA 4WFHE 3V4VH 1AGFA 1I1FA 3EW3B 4I48A 5ETUB 4LEXL 2HJLA 1MCPH 2AJZB 3SN6N 1T5XA 1TETL 3R8BB 3MFGB 4MAUL 3QZWA 4V1DE 4WFFD 4PR5A 3OHXA 4CMMA 5FYKD 4GW1A 1I8LA 3KPMA 4P3DA 3SKJH 3AY4A 4DTGH 4OCXL 1XR8B 5EU6E 5BS0D 1K8IB 5IIEB 1CGVA 3KPPB 4GSDH 3WKML 3QEHB 1Q94A 3ARFD 4MAUH 4EEEA 1R3LB 2I5YL 1Z0MA 4P5KA 4OKVA 4MDIB 2EDJA 1BQSA 1LNUB 4HFUH 3D3VD 3WJJC 4GLRH 5GS3A 4BZ2H 5KVGL 1NGZA 2N1KA 1I3GH 4E41D 5CP7B 5AWNH 5HHMB 5IHUL 3STZB 1JCKA 4BKLB 2VDPH 1T80A 4P9HC 2D0GA 4M43H 1DR9A 3TO2A 2I60H 4NHCH 4ZG1A 4U05A 3EJYC 4KDTA 3IRZA 5C0AB 5JOFA 2ED8A 4Z95L 3I3EA 3O4OC 5HHPB 5I75B 3GMRB 5JLZA 4KJWD 2GQHA 1JFQL 4LASH 4V2BA 4MJ5B 2AEPH 3NMEA 5CWSB 1YQ2A 4IIQA 3G6AA 2AP2A 3SJVE 5EORL 3L7EB 1OSZA 3DROA 1YEJH 3QULA 1RIVL 1SY6A 4JRXA 1MRCL 4N90E 32C2A 2AJSL 3QIWD 4JZNA 1FBIL 1RJLB 5BVPH 3FFCA 4JGUA 5I8KH 5DUBA 2JCCA 1ZOXA 3BDYH 4R0LC 3DV6B 5E8PA 1U95B 3FMGL 5H94B 1OL0A 2P5WA 3AMKA 3LIZL 4H25B 5HDBF 5SWSD 1M4KA 2B5IC 2C1PA 4G9DB 3GO1H 1UKSA 3HRZB 2IANE 1JZ8A 4G9FD 4OF3A 4MSWB 5JR1L 1DQJB 4M6OH 1FC2D 5TE7L 1EGJL 2Z92B 1NL0H 3SQOL 3UTSA 5E7BA 3ALXA 3IDNB 4XPTL 3QCVH 2E9WA 3DOSA 5CGMA 5C70A 3RWCA 2C26A 4NJ9L 4D9RE 5JW4N 1T83C 1IAIM 2R56H 4MAYC 1XZ0B 4B50A 2XWTA 1IAIL 2P5EE 1W2KT 3OAZH 4POUB 4K23L 1N6VA 4XMLL 3O2WL 1LD9B 5DRZA 4P5TD 2V17H 3ULVE 2CIKB 4IEFB 2ZSVB 3F58L 1L6ZA 5D1ZC 4RAVB 5IHZA 3VD9A 1YMMD 2PR4H 3AM8C 3RVWD 5C09A 2HRPH 5E2WH 3ESVF 3LAFA 1M7DB 3DRTA 1XT5A 1VSCA 1I85A 2AV7B 5DI8A 4HIIA 4LRNL 3QYCA 3SKUD 3M1BA 2P8PB 4AY0A 1BQLL 5J1AA 1KEML 3P11L 4Q97A 3VFWB 4KY1H 4D0CB 4HPOL 1OTSD 3QI9C 3TVMD 4TVPE 4YC2C 4H20H 4PLKC 4ZFGH 1KIPB 3L5JA 3U7YH 1TZHB 1NGQH 5DJCB 1FORH 3HLAA 3GSNB 1C16B 1Q9WB 5HY9B 3MOAH 3CZFA 4OZIE 1MFEL 3DGCR 1ZANL 1TVBA 5CINL 5BO1H 4S1QL 1PDKA 3HPJB 4TOYH 5F9WB 1CD0A 5IT2H 1SVZA 4G9FB 3ROOB 2QQQA 2PW2B 3HAEB 4Z7UB 4NJAH 3RJQB 3WUWA 3VWJB 4Y5YC 5C09E 1LO2L 2BX5A 4L4JA 4L4VE 4X98B 3DX8A 5I1IL 2RR3A 3O3UN 4FXGB 1A6UH 2HKFL 3LRSA 5DYOA 4NNPH 4HUVB 1BF2A 3AROA 3ALWA 1G7MA 5F9DC 2WK2A 2B20A 4HS8L 3MLSL 4DCQB 3KYKL 3FTGB 3W9DA 2A6KB 3SO3B 1EZVY 1MCEA 4YPJA 1JNHA 4G42A 4KK9C 1CICD 2A6DB 1IQWH 2O5ZL 5IB1B 1H3VA 1NCAH 4Z7OE 3KJ6L 2HN7A 4XP6H 2RAMA 3UTTA 5L9DL 1NFDA 4PG2C 3HUJE 3IXAB 3K81A 1ZHKA 3RZCB 1YNLL 4FZEL 1LGVA 4JJ5A 5ESVA 1LK3H 5KAQG 5A2JH 1B0RB 5I71C 3DVNB 3QEGL 1OF2A 4YHNB 3TZVD 3MA7B 2D7NA 5JW3H 1DANT 4O2EA 3S3SA 4W81A 3JV4A 1VCAA 2AJUL 2VLKD 4XBEH 3SPVB 3X13A 4CNIA 2GFBB 2BSSA 4I4WA 4AL8H 1RFDH 4ZUTB 3TIEA 2ADGA 2JCCE 2DD8H 2CKBB 3OAYK 5DMKA 1F4XH 3IJSB 1BIIB 1HKLL 5HHXL 1DQQB 1ZLVH 4JFOB 5DR5H 2MJWA 5DTFA 4OLUH 3SJVA 4ODHL 4YWGL 2A77L 3AU1B 2QSVA 3MXVH 4W6XB 5TDPB 2V5MA 4Y16C 3OGCB 2FD6H 1HINH 1FSKB 1QFHA 3WHXB 1T89C 1VENA 4IS6A 1AKJD 1TJGL 1SJEB 4IOIA 3QUKB 1ES0B 4NT6A 5IESH 2AQ2A 2AJVL 3I3BA 3TA3D 4PJFB 4JDTL 5HDBE 3GBNH 5HGHA 4BFEA 3S35X 1FNSH 3QUXA 1P1ZA 4K3EL 3NIFF 3CD4A 4LHJB 2ZG2A 2AEIT 1HNGA 3ARVA 4X83A 1OCWH 4YHLH 4DW2H 1NLBL 4F80A 5L2KA 1ZLSH 1XGQA 2FR4B 2COQA 2QHLA 3MUHL 2BOCA 4TULL 3SHSA 5FHAL 5IFAH 2G5RA 4U6HA 4NCDA 2C3GA 4WEBH 1QO3B 2O5XH 2C3VB 3OJDB 3TPKA 1KB9K 1NMAL 2Q3AA 2VLRA 5ILTL 4ODUA 3VW3H 4HGWB 3MLRL 3BEWA 4YBQD 3TJEL 1OP5H 3THMH 2HT3C 3S36H 3HZMA 3G9AB 4V1DB 2FX8H 2Y5TA 4HS6B 3WL9B 2R0WL 4U1GB 4KI5C 2Q1EA 1KCVL 3JVGC 4U3CA 1Q1JL 3DX9A 3PP4H 3CDYA 4NM8H 25C8H 4UUJB 4Y1AA 2V2WB 2GSGA 1RD6A 5DEGB 3QQ9C 3ARBC 3QUYB 4Q6IB 3OHXB 1JRHI 2YD3A 3MGTB 4K3JL 5I75C 3PXJA 4J3SA 4E5XA 1FFOA 1AC0A 3AM8A 2HLFC 3QHZH 4Y5VC 5E6IC 4MJIE 1QYGL 1XR9B 2EICA 4QY8B 4XWGL 2A74A 3RTQC 4AIZA 3RWEA 2C5DC 4DGVH 4GRLC 5AG9A 3MV01 3PHQB 1DVFA 4MDIA 3IDYC 2NY6D 1LNUA 1NGZB 1T2XA 5FB8A 4RAUA 5E2WL 3I02B 4JVWA 4JZOA 5DUPH 3RKPA 2OXHA 4U7SA 1RZJC 2W92A 1DSFH 4L29A 2DKSA 3TO2B 1ETZB 3PXHA 3RL2A 5JOFB 1CR9H 5E99L 5HHPA 3WV0A 5C86A 3NABH 4C57C 4GMSL 1K3ZA 4E41E 5E94A 1INDH 4K3DL 1RURL 3MJ8B 3RDTB 4JPVL 5FM4A 4NHUA 2BZDA 3L3HA 1CZ8L 1LK2A 1MIEL 1KOAA 2WLYA 3C08L 3BD4A 4Y19D 4OLXL 1XF2B 5A3IC 2P8LA 2BNRA 3F7QA 1U95A 5H94A 1BQLH 1CBVH 2HFFB 5JQHC 3AY4C 1IARB 3V0WL 1F4YL 1IC7L 5DGRA 2P4AB 4OD1L 4KK8C 3T65A 1GIGH 1HQRA 3NCEB 4MSWA 3UTPE 5I1KH 2LE9A 1J10A 1VGEH 4LLQA 5D7LA 4YBLB 5D2NA 1A1OA 4RFOH 2B4CH 3GNMH 4M93C 1ZSDA 1CT8A 3RGVB 3T8XB 3IDNA 4FQJL 3G5YB 2VAJA 1BOGA 1DQDL 5A2IH 1P5UA 4UT6L 2IPUK 3MJ7A 2BY1A 3BJLA 2IPTL 3C60D 3VXME 4YE4H 3QFJE 5MI0C 1VFOA 5C0IB 4R4FL 2R56L 5D2LF 1KB5L 1AQDA 4JRXE 5L7XL 1V05A 4WW2F 5C0BD 1A3QA 3JV5A 4XP1H 3TBYA 3WFCL 4NN5C 1OLZA 3AFLA 4WW1B 1FYHB 4OD3H 2BVOA 5EZOH 3E8UL 4JANA 4UBDC 5D5MB 1R5WA 3RX7A 5I1HL 2XT1B 1I3GL 3L3IA 5IW1B 1HHGA 1S9YA 1FIGH 3D39A 4IIQC 4Y5YB 2E5EA 4YAQB 2C4FT 2KZWA 1UJ3B 2CJUL 5L88L 5F7MC 1KN4L 3V7MA 5IB2A 4OB5H 1T6VN 3MLPA 3UJIH 5C8JB 2Z9TA 4WO4A 3S37H 2NY0C 3HLAB 1T89A 5FM8A 1MLCB 4M7KL 4Q0XH 5F1IB 1FIEA 3C5SB 4S0TD 1I3UA 5I16B 3LKNA 3KYAA 1ZTXH 3TCLA 5AAMA 3MLUL 5ESAB 1TVBB 2XI9A 1I7RA 3HPJA 3V7AG 3PNWB 2IADA 2EC9U 1B6UA 4X6DF 1DLHB 4YHKL 2ZP0T 3QHFL 1TMCB 4HWBA 4HX1B 5C2BH 2GTZA 5IHUH 1NCWL 4AT6B 1HK6A 3DX8B 1ZHLA 1D9KD 5D1ZA 1T1YB 1U8LB 2NY3B 5D7IA 2ZUYA 4OZHE 4MLIA 5E2UL 1KG0B 3TVMB 4YDIL 5EZOL 2YZ8A 2R0ZH 2IQAB 1WUNT 1TVHA 3QUZB 3TO4D 1HZHH 1BVKB 2A6DA 4ZFZB 3WFCH 2FBOJ 4X99A 4PJXE 3U4BL 3KJ4B 4NWUL 2NX5A 5H37G 4CVZB 1J1OL 3JWNC 1UFUA 1WBZA 4XNUL 2CJUH 1H0DA 4JJ5B 5IP4A 1B0RA 4LF3B 2BOBB 2AXGA 5D1QD 2P46B 3DETD 2CLRA 5E9DA 3SPVA 4JDVA 2ADJA 4EI5D 4PJ5E 4PJHA 3L9RA 4PD4J 3KDMB 2BSSB 4PJ7F 2RJMA 2XKSA 3NN8A 3S34H 1AJ7H 4TSCL 4OIIH 4XVJL 4HJ0C 1DN0B 3HI5H 3HR5B 4OCRL 5DD3L 4L3CA 2D3VA 3T4AA 4YE4L 5I1EH 1G7QB 4L4TE 1TENA 2CLVB 3ZLQC 4C4KO 3KPLA 2Z8SA 4ZUVB 3I6LE 4LARL 1UWEH 1KGCE 5BZWB 1QA9B 12E8L 5EOQH 4PPTA 3S5LA 3MZGB 5KN5A 3C6SB 4P4KD 3I2CH 1JPGB 1KPUB 1YEDB 1PLGL 1QLEH 4PJ5D 4HXAL 3FL7A 3CC5B 5TF1L 2X4OA 4LP4A 2YHGA 1N3NA 4YFLF 3VFOB 4F7TB 1ES0A 3EFDH 3X11B 1IGYA 1MFNA 3GKWH 3UJTH 4M7ZB 3VXMB 5F3BB 2HMID 4X8XA 5HYJD 1JNNL 4I5BA 3GGWB 4MNHB 1SBSH 1MIEH 3CFIC 2DQFA 4IOFC 5HXMA 1GOGA 1HKFA 1FZMB 2XICA 1C1EH 2ESVD 4K94C 2FR4A 4HUWB 3TBVA 3CMOL 3GMQB 3HZYA 3ZYOA 1H8NA 3NABL 4FP8H 4UOJA 4HPYH 2OZ4L 2APTA 2F8VA 4FA8A 4YNYB 1PQZA 4R96B 4MA8H 5HYQA 1LE9B 3T0EA 2EH8L 2IWGA 1NEZG 4FQCH 3O9WA 4RIRB 5D2LE 3C60A 4GQ9L 4RGOL 2K3TA 5BV7C 3CFJA 1T2JA 3QQ4A 2AXFA 5EBMB 5H2BA 1F6AB 3DYPA 4XRCB 1AKJB 1FFQA 5DD5H 2P5WD 4ZAKB 4Q6IA 1OW0A 3S4SB 1J8HB 5T1LB 5CCKL 4E5XB 1B3JA 3FRUB 4P5MA 1NC2B 2K1MA 3KAAA 4IMLA 2EDKA 4LLYA 3REWA 1DBML 1YJDL 4OZHB 1TFHA 1S7SB 1QYGH 4WWKB 3RWEB 4GKNA 1S5HA 1QSFB 1ZVYA 1JHKL 4JM2A 4ONFL 3KPRE 4D9QD 4Y16A 4Z8FH 3B9EA 5E6ZA 3S37X 3JWOH 2WWKO 4G6MH 3OR7B 1HE7A 3QO1A 2V9RA 2GYSA 3I02A 3MNVA 1U8KB 1F8TL 4BQ8A 1IAMA 3LS5L 3K80A 3KLAA 3BW9B 4AM0B 5BJTA 2QBWA 4HLJA 2UWEF 1PY9A 3HMXH 1TQBC 2EXYC 4JDTH 5IBUG 3VGAC 3T77A 2D2OA 3A67H 5F1NA 2A1WH 5DA4A 1DQLH 3WFHB 4L8CB 4LPXA 5IQ9A 4ELMA 4RNRA 3QZWG 1L7IL 1LK2B 2BJML 3EYUH 4PJ8A 2Q7NA 3V8OA 3S88L 1WJ3A 1JYWA 2EDTA 2UYLA 2UV3A 2IAND 3WFZA 2XZQL 1D5IL 3NAAH 3ROLA 3RWDB 1W0VB 3MTRA 4BYHA 1LEIA 3RPKA 2WV3A 1DL7L 2DLIA 4G43A 4K7FA 4J3VA 1FL6B 2H3NB 3IB4A 3EYUL 5FYJU 3VXRB 2PN5A 4YHOL 3GBNL 5GS0D