4X6DE

Cd1a ternary complex with endogenous lipids and bk6 tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
200
structure length
189
Chain Sequence
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSTSLPNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1a
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 189
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dE02
5IMLB 3TP4A 4M9PA 4HIJA 4G80A 1BQSA 1HILB 2Q3AA 5DVNA 3IAGC 4D0BB 4KI5E 4KJWD 1KCRH 4L4TB 4TSAH 2FWOB 3OG6B 2ERJB 4R4FL 1CZ8L 5B39B 1KJ2A 4ZTPL 3C8DA 1YN7B 5CJQH 4PJAE 1FFOA 2YD4A 3MBED 4PJGF 4KVCH 3BQUB 1E0OB 1K4DA 1NMBL 5DK2A 3H9ZA 3B5GA 4PBWD 4JFED 3UP1A 3QIWD 5KS9F 1CXKA 2ADGA 4PTUB 3TBSB 2MKLC 3WJLA 2AGJH 4K3EL 1WFNA 1FLRH 2BVQA 3DO7B 5C0AD 3GKZA 3OAZH 1LD9A 4F37K 2A9ML 4UDUA 2VZ3A 1X5LA 3QAZC 4HIEA 4DN4L 4Y19D 3EOAB 2UZXB 2Q8BL 4GUPB 25C8H 4IRSB 3T0BA 4PJ9A 4MJ4A 3KDMA 1ZT4B 3ZTJH 4ZS6C 4K8RH 4YQXH 2EEBA 4G7VH 2ZNWA 4JFOA 4NC2B 3RY6C 3HCVB 4JVWA 5ANMA 2JJTC 3D2UB 4KUCF 4N9GB 5AUMB 2PO6C 3ROOB 1DQJB 5B8CA 1A6VL 3VRIA 5EO9B 3DXAB 3T77A 3N50A 5B4MC 3S36X 4LHUG 2RFXA 2DICA 2BRQA 4RX4A 3S4SA 1BEYH 5LVEA 3TFKD 1H15A 4XGZB 4R26H 1A7OH 5DEZA 1ZWIB 4QOKA 4ONGH 4EDXB 3VE0B 1H3TA 5CP3H 3UTTA 4JFDB 4J4PC 4GRLD 3VA2C 4N8VB 3QI9D 3RIFF 1JV5A 4TVPH 1M7IA 3RVTC 4C4KT 4HFWB 4HK3J 2YD5A 3KJ6L 2R9HD 1SYSA 2P5ED 1K4CB 1JGVH 3RUGB 3PL6A 1FVDA 4F8QA 4L4VA 1XT5A 4CNIA 1XZ0A 3L5JA 1IC5H 5FOBB 1P7KA 3O4OC 4XXCC 3GNML 1UCTA 1L7TL 3MNWB 3RWGB 1MJJB 2YC1A 1BD2E 1B0RB 3E0GA 5C0EB 4CRPA 2HT2C 1OAXL 1TDQA 1J0IA 4CGTA 1ZHLB 3BP7B 4MVBC 3H0TA 3BZEB 1HYSD 2VWEE 4HH8A 3T8XB 2V2XB 2GHWB 3PHQB 5TDNB 1UXSA 5HXMA 2VZTA 5C6WH 3MV8E 1R0AL 3VFGL 1AGFB 5FK9B 1MF2H 1F3JA 3UXFA 4L8DA 3D1MC 2WWKO 3F7RA 4R4ND 4JFPB 3D39E 3LRHA 3LZFL 3NZHH 4WW2A 4FP8H 2XG5A 3U9PH 1SYVA 1NCCL 3H3BC 5FM4A 3CDCA 3MGTA 4IIQB 2XZCL 4EBQH 1PKQB 3CCHB 4IRZL 3BD4A 4QRTA 1KLGB 3PWPE 3QDMB 3QEQA 5KOVC 1TNNA 3GZKA 2BVYA 4XCNA 4F37F 1MCFA 4J12A 3ULSB 4RAVB 4FFWD 3DVGA 3MRBA 4OQTL 5F44A 2GUOA 1F13A 4NKDA 2VLRA 2CUMA 4P49A 1UJ3A 1BOGA 4HJGA 1JIBA 3CFDB 2R2EB 4MJIE 3BW9A 3IDMB 4OI9A 1QRKA 4LLMB 2YEZA 5DD0H 3QFJD 1WJ3A 5IESL 3HE6B 5CUSL 1W72H 2PYEA 1EK3A 5GGVY 3UBXG 2OZ4H 4JFZL 1C5CL 1VEMA 2YA0A 1ZT1A 1E4KA 1LP9F 2VITB 3G6JA 1JE6A 4Z18A 4PLKD 4ZFZB 4HPYH 4LSSH 1T7VA 2NXYB 1X5KA 2JCCB 1IARB 4IOFC 2G2RB 3WDJA 4AEHH 3KPSA 3DMMC 1CFSB 2DL9A 3GRWH 4KTYA 3SDAD 5KSVB 1TFHA 1XGTA 3GMRA 3ZDZF 4OB5H 5BRZE 4JZOB 2X4TA 4XNZB 2R23A 5KSBE 1TZIA 1FNLA 1IGCH 3NCMA 3QUZB 5F8QC 1KSRA 5E9DD 5MEOA 4P2RE 5E6IC 4ZTOL 1NDGA 2AV7A 3U4BH 2VDNL 2QADB 1JPSL 4PJ5E 4WUUA 3HAEH 1HQRA 4DFHA 2CO7B 3I85A 5DHYA 4P5KA 3DURA 4XCFL 1R3LB 3GMLA 1OLZA 5JW4Q 3B83A 4PRNA 1Z9MA 4M7ZC 4LPCA 2IALA 2HJLA 4POYA 1T04B 4FOMA 4OD1H 1ZHBB 4F7EB 3L95A 1R3IH 4Q6YA 4V1DB 3GEWB 5C07A 1T03L 3OR6A 1J88A 5IFHL 2J7LA 3I2CH 5LGHL 1EAPB 2YPVH 4X5WA 5INDA 3GJFB 3HFMH 5CJOL 3R06A 4KQ3L 4OLVH 1ULVA 1XF3A 4MA1C 2ZOLA 2BFVL 3BVNA 3STZB 4QRPA 5DJ0B 1Q0XL 4FZEH 3DLQR 4ZUWB 1QBLL 1AKJA 2QSQA 3GHBL 4TNWK 4GQ9L 3TPUA 5DJXA 2DD8H 1FZJA 1OP5H 4DGIL 2GSGB 3FMGL 5DRNA 4Z77B 2CDGA 5I1EH 4KDTA 1OAKH 1NEUA 4UOW0 4JFYA 5H8DA 1FQ9C 3FT3B 2AI0H 4M61A 2Z31A 1A6AA 4LHJB 5B3NA 1NGWA 1V8HA 4XCYA 1WWCA 3PWJB 5DC9B 3FN0L 1IL1B 5JIPA 4S11A 1A9BA 4LPUA 1JGDA 1KEGH 1J8HA 2OTUA 4WFFD 4A6YA 5CEYA 3J8F7 3UTSD 4M8QB 5JOEA 3GSNL 3SE4A 4JFHE 5BJTA 1CN4A 2LQRA 2VDKH 4OCRH 1H3VA 2AJSH 1CGXA 2IAND 3O2VL 1UZ8A 4YJZL 1OTUD 3SCMB 1CDCA 1IAMA 1A1MB 1QO3B 1VKXA 1LK2B 4F7PB 3VD9A 2VQTA 4XMPL 2OQJA 1WC7A 3F58H 2L7JA 3HS0B 5HHXL 4KJQD 3AC0A 5DGQA 1R5WA 3Q6FB 3CIQA 5LXGH 2VH5L 1LO2L 4HKXB 4RWHA 1NFIB 4O58H 3VFRA 4HKZA 1A7RH 3R0MA 4KK9D 1FYTE 1L9MA 2EDDA 1T7WA 3ARBC 3LKSA 1KXVC 3GSRB 3PUCA 5IIEA 1CI5A 1JHLL 5HGDB 3CDGA 1EIBA 1LEKB 3SDDA 4MLIA 4FXLA 5C86A 2FHCA 3HZVB 2DMBA 4HCRH 3E8UH 3FB7A 4LOUC 3TF7C 1KBGL 4PJAA 4QRRA 3CH8A 1SY6A 4J6RL 2NZIA 4ODHL 1YPZF 5IGXL 4W6XB 3UO1L 3X3GH 3UCRA 5HI5C 3MRFA 3DGGA 1OTSC 5IBTH 3T4AA 4LCUA 1C08A 4R90L 4UB0H 4NSKA 1EVUA 2X6MA 3TNNB 5GHWH 4OAWB 5CSGA 1FVCB 1WK0A 1T5WA 5CSZB 2R1WB 1MCOL 3OKLB 4QYOA 4WO4D 4KZDL 2R69L 1PDKA 4HGWA 4DUVA 1IAKB 4TNWF 3I3BA 4RMTA 5F7FA 1U8HB 1F11B 4PJHB 4LFHG 1DBML 5BW7C 3UJTH 1ZLUH 2WUBH 3LN4A 2ZCKL 3MRNB 1DLFH 1VADA 4OF8A 2JIXD 3G5ZB 3ULUE 3AY4C 2A6DA 1FHGA 5BZWA 3RL2B 5EZOL 2JJUA 4G6ML 1S9WB 2GITB 3Q6GL 1P69B 4KUZL 2WBJA 4XP9H 4LCIH 2SEBA 1DJSA 4GW5B 5K33A 1YEFH 1F4WH 3QDHA 4B7LA 1AXTL 4XPTL 3JTSA 3S37X 1N26A 1MFDL 5DVOA 4JVUA 3RWCA 2CKBL 3CGTA 3BQUC 2QQNH 4MAUH 2BMKA 4GG8A 2D03L 1U8LB 4ZPVB 2MJWA 1YNLL 1EERB 5CSBA 4DZBA 4DUWA 2R56H 2XPGB 1YEDB 4R7NA 4O2CB 3TA3D 2ZCHL 1S7WB 1F58L 3GMNA 3HPJA 4MNQB 4QY8B 4LARL 2Z8SA 4OF5A 3WFDH 5J11B 4QF1B 3MLSL 4Y16D 3ALWA 1YEEH 1C1EL 4AENB 2D0HA 5DLML 3GJEA 1MHCA 4IRSC 2NY4D 2RBLA 1WZKA 3UTQA 3MRJB 3UAJD 2JK5B 5L88L 2XIDA 1DFBL 1KENL 4EUPH 3FO0H 3WXVH 3M17A 2CJUL 4ZFOL 5T1DL 1JN6A 3QULA 1U3HB 1FE8H 4OGYH 5EIQA 4C57C 1AGBA 1DTUA 2IH3B 5D7LE 2AJVH 2X41A 4MAYA 4NT6A 3IJYA 5M7QA 3VA6A 4Z76B 4NM4L 1KF9B 3MV8A 3DVFA 2MTPA 1KTRL 4XC1L 4LSTH 4HWZB 5H94A 2APTA 4Y2DC 1QBAA 5EDXA 4GH7B 4YR6B 4DN3L 2A83A 2NW2B 4NCC2 5FCUH 3RKPA 1FJ1A 3D39A 5KSAD 4KQ4L 2ESVB 4O4YL 4P5TD 1UWEH 1H8NA 3QUML 4NO3B 4AIZA 3VXTA 4EVNA 3U1SL 4WU7B 1Y6NR 4HC1H 5D1QD 4ZO8A 3U30B 5K9OA 3HMXH 3KYNA 1MH5A 2R4RL 3IDIB 2CDEB 2KKQA 4YH6A 3VXRD 1N0LA 1R3KA 1VFBB 1PG7L 1IQWL 1XIWA 1B6DA 3W0WD 3X3FH 5I8CA 3HUJA 3WFBL 3JZ7A 4XMLL 4URTB 1B0GB 1T5XA 5DUMH 3TBYB 43C9A 4XBPA 1FO0L 4H8WH 1EMTL 1BECA 4Z7WA 1CLZL 4NWTH 3MREA 2AAVA 4MNGE 4N0UE 4MNHA 2G9HB 4LNVA 1OM3H 4LVOB 3WFCL 4PYGA 3UJIH 4OLWH 4BZ2L 3GBMH 5IWLC 3CFKB 3BPOB 4EN3A 3JTTB 4DVRL 1OTTD 3SJVB 5EBLA 3CZFB 4NC0B 4MLSA 3RNKA 5TQ2H 1QFOA 4NHCH 4DQOH 3PXJA 3CD4A 3S4SG 3V4PH 1QFUL 3I6LE 3QNYB 1YEIH 2GY7B 3B3IA 3IXAB 4PIRF 1P4LA 3SE9L 1FIGH 1D9KA 2O5ZL 3ARXA 4P46C 4KMTL 1I7TA 2GJ6A 1MQKL 1R24A 1BAFH 4NO2A 5CS7A 2B4CL 3TZVD 1T21B 4IIQC 2XFXA 3MZTA 1JTPA 1KTDB 3RA7L 3SKNB 3O9WA 2Y06H 3GSNB 3ESVF 1S7VA 1MI5B 1ORSA 2D0FA 2GJZB 1D5BA 3K4ZA 3OWEA 1XGUB 2BY3A 3HG1E 4OLXL 4UT7H 2F74A 1MHHA 3F7YB 4S1RL 4NNPL 5GGRB 1ZTXL 4JCLA 1EH9A 2AW2A 4WI8A 3CVHH 1BIIB 1T3FB 3LS4L 1S9YB 2P5WE 2ZZUT 5JUEH 2H32B 3N1MC 4EI6B 3GI9H 5J1TC 4PJCF 4TYUA 4KI1A 12E8L 4HH9B 4UBDC 3VWJD 1FL3B 4CN1A 2FSEB 3MODL 1K3ZA 4ONFH 2ZJSL 3UTPD 3OXSA 1HHGA 2FATL 5FYLD 3GBNL 4QT5B 1TJGL 4RGND 2FX8H 3HZKA 3ALXA 4L4JA 3KYAA 4APQA 2F54E 1RIUH 5GSVB 4M62L 1A9EA 1BREA 4F57H 1KPUA 4B7IA 4I77L 4OCLC 4XNZC 1RK0A 4XVUD 1XGRB 2EH7H 3ZL4L 1WSST 1KJMA 3QUZC 4G6JL 4OZHA 3ILPA 3NZ8A 5TH2B 3PGCB 1NBZA 3MV9E 3T65B 1BMGA 2C5DC 4LLQB 4P2QA 4UNTA 1ZVSB 2QADC 1IZJA 2X4RB 2AQ3A 3KG5A 1OB1B 1M4KA 4LHUD 3FQRB 1GOFA 4JAMB 4KKNA 4CN6A 4OGXH 2VB5A 2B1HH 5D1XC 5IMKB 3QNXA 3O3DB 1J7VR 2PF6A 1RULH 4G6FD 4FS0A 5IQ9B 4TVPE 1PQZA 4F3FB 1GHFL 5TF1H 1HINL 1R5IA 1GZPA 1NMAH 5CIPA 4DAGL 5JOFB 3SGKA 7FABL 3PDDA 3MRIA 5A1AA 3WDHA 1MVUA 2GK2A 4X9HA 3P0GB 3GK8L 1N4XH 3PWPB 5GISH 32C2A 3BWAA 4AG4H 1T7XA 3D69B 2PYFB 1WITA 5CP7A 1OD7A 8FABA 4RZCA 4ODVH 4JPIA 1U8OA 1FYTA 1WIOA 4FTVE 4U6HA 1NCBH 1AO7E 4C55A 1F45A 4LLVB 3CFBA 2VR9A 4BZ1L 4MJIB 3BE1H 1MFNA 2CKBB 1M05A 4KKCD 2CLZA 3S9DB 3WJJA 5TF0A 5FA3A 2UY7A 5T1LB 3UTZB 4X4YA 1BBDH 3ZT5A 3O3AB 4PS4L 5CEXB 5K59F 4MMXC 1IM9B 5DUBB 4OZGE 3O6LL 3TBTA 4EQ3A 1OWRM 5E2WL 2XZZA 1UEMA 2NX5E 5INCB 1KB9J 1CICC 2E8YA 4U6VH 1WT5A 3QUYD 3ZYJA 4NM8H 1QSEB 5AYQA 2R4SH 1XF4A 3V0WL 3JWOH 2C3XA 5DJAA 5KSBB 2QQKL 1G7IA 3QUXD 2MQ0A 4P4KB 1N2RB 1ZGLA 5FB8A 4Z8FH 2P47B 3RVXC 2CIIA 1QR1A 1N59B 1FFPB 5E8PA 1MCPH 4Y5VA 1HEZB 2AJUL 1MY7A 3QUKA 2QR0A 4NOBA 2F19L 5D93B 3LB6C 5FV1L 2IWGA 1NC2B 5AAMA 4MB3A 2VC2L 2YD8A 1NFDE 5ISZA 4ETQB 5CEZL 4X7EC 1QSFB 4ZXBB 3C60A 5LCVL 4FQLH 5JPMB 1OD9A 3LS5H 3O41B 5F7WC 3ARWA 4ONHB 4P3DA 4D3CL 1PSKL 5CILL 2YUWA 3EJJX 3UBXI 4BQCA 1MIEL 1X4YA 4Q9BA 5F7YC 2DIJA 4JRYE 3BPLB 3MMEB 5T3ZE 2YSSB 4D9LH 5LWYH 2HFTA 5D2NE 1S7XA 3EJYD 4Y1AB 4N8CH 2OS7A 2YRPA 5IK3B 5DR5L 1BFTA 3OV6A 3P2TA 2P44B 4Z7OF 4OSUH 1JYNA 3KPQB 4I3SH 3SKJH 1KPRA 2DLIA 1C16B 4G3YL 4NZDA 5EC1A 3WFHB 1A4KA 4B50A 3CU7A 4G5ZL 1XF2A 4WHYH 4DK6A 4JJHA 3GSVA 1DVFD 2QBWA 5EO0B 4I4WA 2GFBB 1ERNA 4JHZA 3WS3A 3HMWH 4UQ3A 1KCRL 5BO1H 1REIA 3RVUD 2EDFA 3SPVB 5FEBA 2F5BL 1KPVA 5CJXA 5D7LA 3E2HB 5KVEH 5EUKA 1P4IL 3PP4H 3U79A 4I3RH 5T3XD 4NIKB 1NLBH 1Y0LA 3DETC 4DTGL 3L5WB 3ZYZA 3GMQB 1CDJA 4LQ1A 1I9JH 2IH1B 5DQ9A 3D6GA 2FO1A 4XPHL 1U91A 3I75B 4NNYA 1FLRL 1K2DA 5DZNA 1NLDH 4OZFB 3VGAB 1WBXB 1OP3H 3QNZB 4P59H 4G8FB 4WHCA 2YPLA 35C8H 3G9VA 4Z6AT 4LGSB 3LIZL 5E6ZA 4NQCD 5BVJA 5GZOD 5J11C 4KDTC 3VXNA 3OAYK 4GSDH 1ZOXA 4RIRB 4XWGL 5DJCA 4BH7B 4XNUH 1X7QA 2DOCA 4AEFA 1OW0C 3KPMB 3MGOA 5D2LA 2GEEA 4IDLA 4GFTB 3DVNA 4I2XE 4MNGA 3HRZA 2J2ZA 3RDTB 4ENED 1J05A 5HHOA 4MB4A 1QFPA 1WBYA 5I1GH 1U3HC 3B2VH 3QCUH 4Y4KB 1DL7H 5E70A 1QSVA 5DUPL 4R26L 1A7OL 3LQAC 1A0QL 1WV7T 5EO1B 5KW9H 3WIHA 4LU5L 4PGCB 2FO4B 2OR9L 2P46B 3RU8H 3WIIL 5IMLA 5D1ZA 1PEWA 4RMVA 1HILA 3H3KA 2W07A 4YHPB 5GIRA 4LPVA 4P9HL 1T4KA 1XGPA 3CX2A 4LQFH 1F4HA 4HW6A 5HHPB 3NABH 2Q87A 3VXMD 3DRTB 3U0TA 1FNAA 4PJFF 3U30C 4BYHA 1EFXB 2GT9A 4CN4A 3QRFM 2GQHA 4ZNEA 3U9UB 1WZ1L 1IC5L 1RZKL 3E3QE 3EJZD 2VRAA 5EU6D 3PP3K 1I1RA 1QEWB 3NCJH 3TYGH 3D25B 1AXSB 2ED7A 5DEFB 1HYRC 4WFHE 1ZEAH 3TBSA 4KI5C 1SMAA 3SDDC 4U7MA 2HT4D 1I9IH 3DO7A 1BQHA 5HGGS 1EDQA 2E3VA 1YMHA 4NO0B 4JM2B 2UWEE 5EUOE 3P30H 3SKOB 3VGHA 4L8SB 3T0ED 1Z3GH 1W8NA 4Q74A 2Q20A 3HR5B 1MF2L 1P7HL 1ZT4A 3WO4B 3BPOC 1B3JA 1U8PA 5E56A 1BZQK 3FFDA 4U2YA 4HIIA 5C2UB 5AUMA 3U9PL 3KAAA 5IW1B 43CAB 2G75B 1BJ1J 4LFHD 5EZIL 3SDYH 4OZIE 2JB6B 3WHE1 3ZE1E 2W9DL 3VFTB 4TTDC 4EBQL 4HLZH 3DXAA 4PREA 2EDQA 2FHFA 2DF3A 1DDHA 4FQQA 3SGDH 4YXLH 1VSCA 2QJDA 4LCYB 1G7MB 1A6ZB 2Z93A 3QJFA 2K9UA 1ZWIA 2DS4A 5HVFB 3OB8A 4Z7UE 1OQXA 4QRSB 5DC4B 2V9QA 4MDJA 4N8VA 2OZ4L 1EJOL 1Q9LB 3U36B 3DARA 1NCTA 3VXQB 1FPTH 3MLYH 5L2KD 1A14H 4HPYL 2IFGA 4LSSL 3RUGA 4PTTA 3P9WB 1GYAA 2C1OB 3DX8B 4AEHL 5EG6C 4HUUB 3U46B 2V17H 1V7NH 1LILA 3UTOA 3GRWL 1CFQA 3AXLA 1JK8A 4M7JL 2AKRB 1PZ5B 5MEND 1WTGT 1G9NC 4OB5L 4G43A 1PEZA 4YEEA 3RBSA 1NEZB 4PRDB 4YHOL 2YD6A 2EDOA 3DRQA 1Q38A 3BZEA 2E8ZA 3VDAA 5HI4C 4FTVA 3VG0H 1N64L 4M1CD 1AO7A 4MA3B 3L3IA 3O81A 1FORH 1AGFA 1EGJA 5FK9A 5GGTA 2ICEB 3DUUA 2VLLB 2BCKB 1GPOH 2ZUQC 1W0YT 4PLJD 5LBSH 2C4FT 4OD1L 5I75B 2X4SA 2P8LA 1G6VK 4FQ1H 1ADQL 2N7BA 3IU4H 3I2CL 1YY9D 3F12B 2XV6B 3V5HA 3RWDB 2YPVL 3FRUA 3T2NL 4OLVL 3ZSTA 3I6GA 2CK0H 4RAVA 4JO1H 1INEH 3DVIA 4FZEL 4JFFB 4RBPK 5T33H 1FL5B 4GRWF 4PUBH 5I1DB 4MD0B 1J1PH 3DUSB 4HXAL 5KAQF 3ARVA 4LLMA 3HE6A 4JY5L 2H9GB 1A02N 3D85A 5ACZA 3O3EB 3D5OF 3ULVL 3OKMB 3BYYA 2XZQH 5I1EL 4XVTH 5HYJE 4PJ9D 1FFNA 4GKSA 4WHTB 1X5JA 2AI0L 2G2RA 2EE6A 4L9LA 5CGYC 2RR3A 4GBXA 2D31A 4YDVB 3RWHB 1NFDA 4LKXA 1HXYB 3TV3H 2BOCB 2ZUTA 5TE7L 1QVOB 2AXJA 5BV7H 4ZUUA 1CXEA 5FM5M 2CDFB 4JO4H 5J13B 2VLKA 2X9XA 4OLYL 4WFEE 4NQUA 4RX4D 3OQ3B 4X98B 1AP2B 5H2BA 1CTOA 1CWVA 4MJ5A 2VDKL 4OCRL 4QGTA 5IV2B 1RUAL 2DLHA 1UZ6F 3RTQB 4JRYA 5JA9A 5MHSE 5BXFB 4QOKD 2ID5A 5DK0A 5D2NA 2V2WB 1F6FB 2DQIL 3REWB 1CGYA 2F54B 3OKKA 1DANU 2NY5L 2P8PB 4K71C 5T1KA 1JNHA 3F58L 4NZJA 5FDYA 3WUWB 1ZHBA 4YK4B 3AU1B 2XTJD 2VAAB 1QBML 4O58L 4PRPE 1IBGH 3P11L 3PL6D 1XCQB 4HWBA 5DD6B 3QEHA 4L4VD 3P4NB 3ARDA 1NC4A 1GOGA 1RIVH 4NRZB 5D93C 2XN9B 4P3CH 5HHME 3SBWA 5ICYB 3K8LA 2YPKB 5B22A 1N3NB 3TGXA 3KPLA 5F6HI 1JZ8A 5E8DH 5IMMA 4MMZC 4ZXBC 2B1AH 1RZ8A 2I9LA 5DFVD 2FJGB 3BH9A 3QH3A 4HIHA 5E2VL 3NCEB 4PG2C 4ALAH 3IKKA 5D5ME 4U1HB 5FO8A 3OJMB 1NUGA 3CLEH 3RJDA 1ORQB 3UMTA 4JY4A 3VXUD 3P4OB 1IL1A 3AS1A 2BNRB 2X4QA 2HKHL 2VDMH 3QEQD 3U6RB 5DI8B 5AZEH 5IEKA 1KB5H 4H1LH 3VJ6A 1I7UA 2WUBL 4IBLT 3SE3C 4P57A 2VLRD 3RI5K 1AY1H 3VFNA 4U1JB 4IHOA 1S78C 1HSBB 4RISH 3PGFL 5DRZB 1PY4A 1UC6A 4MS8C 1JGEA 4KK8C 2DLEA 2PYED 4XH2A 1KN4H 4MXVF 1N5YH 3GGWB 4OZGB 4XP9L 4LCIL 3HS0A 1F4WL 2NX5B 1RMFH 4X9BA 1E6OL 1YYLH 2XWJA 1NUDA 3JVGC 3CPLA 5HDBF 4CAGA 3BIKA 2V9TA 1CU4L 3KPSD 2YN5A 2HT3C 1HZHH 4CVZB 2QQNL 4JZJC 3QO1B 3QR2A 4MAUL 4XNQA 2X1QA 2B4CC 2M26A 4HK0A 1U93B 1TETH 4FFVD 1BBJA 2F58H 1KT2A 2N1KA 4YHNB 4RAUB 3B9VA 3VFWA 4CMMB 3FJTA 4LP4A 3IJHB 3QDGB 4GAFB 1W72B 4PJEA 2D7OA 3MLUH 3WFDL 1XEDA 4I13B 2DTMH 4RRPG 1BJ8A 2FX7H 3AS2A 1YEEL 3MA9L 2BHUA 4WUUD 1ZT7B 1LO5B 1HHIB 1WWAX 4RMUA 3P4MB 3BIBX 3N9GL 3O6ML 1SJXA 1X5AA 5E5MA 3FO0L 3WXVL 4PB0H 3EW3B 1OAQH 1OHQA 4W4OC 1BVLA 3X13B 1PG7X 4P2OA 1MRCH 5C07D 2AJVL 3RDTC 3QT2A 4OLZH 1OARH 3O8XC 4JQVA 3KGRA 2E7CA 4KKAC 4ZFFB 5FYKD 1X5ZA 4WIQA 5A16B 5DD5L 3JV4B 4HV8A 4OV5A 2DWEA 3RX5A 2VDLL 3G6AA 3GSOB 4K9EL 4QRPD 2MOVA 5FCUL 1WT5C 5HGBB 3HAEB 2BNQE 4WDIB 3DV4B 1AKJD 1BJ1H 3K74B 1FSKB 3MRGA 3EFFB 3RL2A 2OK0H 1UWEL 4RDQF 4OZIA 1NGZB 2EXWC 1Z0NA 2GITA 4HC1L 4UV7H 5B38A 5SWSA 3KXFB 4QHMA 4NN7C 1WBZB 4H0GA 4WWID 3WHXB 2FJFB 4NWUH 3TH4T 4PBXA 4M6AA 2JLLA 1FNEA 2Z31D 4N0RA 1PKOA 3IFNH 3MUHL 3G9AB 3ULUC 4OQTA 3RI5F 2NY0B 5DHVH 5JZ7D 3MOBL 5B3JF 3EO9H 3OZ9H 1GC1H 1S9XB 4JLRB 1J8HD 1BVKB 3HI1B 4U1KB 1OM3L 1VERA 3KR3L 1HXMB 2RCSH 3UJIL 3C6LA 4MCZB 1S7WA 2HVJB 4QWWD 4K3DL 1YUHA 5IUSA 4JM2C 3OG4B 4TRPL 3ILQC 1Q72H 2HP4A 4L8SC 4OJFL 3IT8D 4Y5YA 2HFGH 1K5NA 1HNGA 3WO4C 4JFEE 1CDHA 3MV01 3V4PL 2A73A 4PJ8C 4KC3B 4BKLA 1ZLSH 3LY6A 4HAGA 4NKMB 3QIBA 3UZEA 1OL0A 4R8WL 4ODTH 1ROWA 1BAFL 2Z0BA 3BGFB 4F9LA 4TSCH 4U1SA 3QDAA 4OT1H 4RNRB 2XTLA 5IW6B 1I3GH 2NXZD 2CKNA 1FNSH 3O6FB 4AH2B 5FYLH 5B39G 1MWAH 2GSIB 3U0WL 4X6DE 5K9JH 2XG4A 3AMLA 1N5AA 1VB9A 2NW2A 3IDJA 3J7HA 4KI5F 4M3KB 5JUEL 3VXOB 5C0CA 2OYPA 2G60L 1BQLH 3GI9L 4YX2H 4QRRD 4PJAF 4ONFL 5GS2D 3IDIA 4QHNB 3W82A 2NY6C 2AS5M 3CMGA 1MOEA 3UYRL 3BH8B 3MFGB 4X7CC 2XKNA 2DLTA 4PB9H 4WHDA 5J9PB 1B0GA 4NKOB 3RWIA 5JW4M 4OF6A 2QTEA 1BLNA 2PCPA 2D9QB 1PG7W 3E1F1 2G9HA 1D3CA 1AD0B 3T0XA 2AK4A 2I5YH 3CFKA 2XQBL 2P5EE 4MJ2A 1BZ7B 4UUJA 3JTTA 1J1OL 1ZMYA 2WIIA 1UKSA 1XH3A 2X09A 5CZXD 3U4AA 1CE6A 1IGIH 1T2JA 4CKVX 5F97E 4OGXL 1JRHH 4KH2A 5DMJB 2VLJB 4HMEA 4PJBB 2OJEB 5BOPA 4XBEH 1G7HA 2UWEB 5I75C 4I18A 2WBJD 5JQ6H 2YUZA 5CHNB 5JO5B 4TTGA 3ME0A 3MLVH 2VABB 4PP2A 1HH6B 2Q7NA 1FAIH 3TO2B 1IEBA 4NFCA 4G6AC 4RA0C 5TF1L 1OLLA 4N8VG 4K94C 2X1XR 1NMAL 5GS0C 3VFVA 5GZNC 5DMGD 3V7AG 3G5VA 3NACL 1XGUA 3FTGB 4M02A 3TESA 4KDVA 3F7YA 1TZHB 5IVXE 3B9DA 3BUYA 1TVBA 3O45A 3CUPA 3R4DA 1T3FA 2VERN 1N4XL 5J3HC 2H32A 4AG4L 4F33B 5I76A 4EI6A 1NGYA 4I9WD 4ODVL 4J1UB 1S8DB 1DBKH 3FZUD 1NCBL 2DQFB 1FL3A 1INDH 2VUOA 5F7HA 2A0LC 1NH6A 2V5SA 3U7WL 2FB4H 1BF2A 1Q0YH 4Z7UB 3MR9B 3MUY1 4ERSH 4X6EB 2XOTA 1QLEL 4PJDB 1EUTA 1JHTA 3B8SA 2QHRH 4JDVB 4XX1E 3QFJE 4L1HA 3CX5J 5FF6B 4C56A 1RI8A 2FIRT 2I9TB 3VW3H 2W38A 2E7HA 4MAYD 5J13C 2XZAH 5GRYA 2LTQB 1QA9B 2W1NA 5TH2A 5CJBA 5C0IA 2E9BA 3PGCA 4U6VL 5E1AB 4X8JA 1FBIL 2R4SL 4LLQA 3RTQC 4U1MB 2Z35B 3D39D 1OB1A 4K8RC 2R8SH 3BD5A 3L7EB 4S1DC 3SOBL 4G42A 4EUPB 4WI2A 1KNOA 5IMKA 3OKDB 5K9KB 3EHBC 4Z8FL 1OF2B 4LBEA 4Q2ZB 4WTZG 4P2CG 4X99A 3PV7A 5LGJB 1MCPL 2APXA 4OM0H 4YK4C 1NDMA 4YIQA 3OKEA 1XIWD 2FD6H 3C8KB 3G6DL 5E9DE 3SHSA 1JNLL 4YFDB 4F3FA 5AZ2H 4Y2OA 1DUZB 4PGBA 2CUHA 1RU9L 3M45A 2R1YB 3OR7B 4O02H 1SJEB 1MCRA 2ZG1A 4FQLL 2NPLX 3LS5L 2LAAA 2JJVA 4NGHH 4GO6B 5K9QG 3V6OA 3G08B 1ZS8A 4D9QE 3FB8A 1VGKB 4EN3D 4MQXD 1U6AL 4KWUA 5KANG 5F9WB 3AAZB 1GIGH 2BSTB 5C7XL 5ID1B 4JZNA 3W11C 2C1PB 1L0QA 1WZLA 2X7LB 4N8CL 4DZ8B 1LEIB 2CKBA 4NO5A 1VPOH 1Y18B 4O9HL 3KWWB 1D9KD 3SKJL 3UTZA 1LO3L 4RSVA 5KSBF 5E94A 4GLRH 5GGQH 3O3AA 5HHQB 3BSZL 2GJ6D 1CGSH 4J8RA 5T3XH 5F9DC 2FRGP 1RK1B 1SBSH 1FDLL 3HC0B 3E6HA 1PYWB 2VSDA 3JWDH 3LKPB 3O9WD 2F53E 5JHLH 4PJ7A 1JWUB 4QHKI 4QHUB 3HMWL 1W0WB 3PHOB 5FUZH 1DSFH 2E6QA 3BWUC 5BO1L 2VDPH 4M6NL 2BVOA 2NW3A 3ZT6A 5ICXA 5D70H 5EBMA 5E0QA 2YD1A 2IAMB 4JANB 3GM8A 4P4KA 1N2RA 1KLUA 3Q3GA 4ZFOA 4HJ0D 4I3RL 1N59A 4QRUA 1I1YB 3UTSE 5SV4A 1AHWB 3LQZA 4X4XB 5DJ2A 4YHZH 4KAQL 1OPGH 1D5MA 3WIFA 5JXEC 4MJ6A 4XTRC 3CH1B 1AQDB 3RGVA 3SE8L 2BNQA 5C0DB 1M71B 4HWEH 1QHPA 4UIMB 4APQD 1UG9A 2ZKHL 1IAIM 5FKPB 2ATPB 1NLDL 3VXSB 4YE4L 4XZUB 3ZHDA 2CH8A 5CD5D 3V5DB 4P59L 3O41A 3AGVA 4NQXB 5HVGB 35C8L 4PRPB 1HKLL 1SM3L 2O5YL 2VZOA 2DWDB 3QUMA 4XP1L 4JN2B 4NJ9H 5GRWA 4YHLH 4O5LL 5DJ8B 1X5HA 3GSXB 3NGBB 2IGFL 4P2QD 4LVHC 5D7IA 5I2IB 4XNUL 3ZKMD 1G9MC 4CDHA 5IVNA 2YSSA 4OM1H 4X6CE 3WNKA 1UVQA 5IK3A 1KIRB 4GAJH 2ADFL 3GMOA 3PWNB 2JKXA 1RZ7H 1FO0A 3UYOD 5I1GL 4QXTB 1NBQA 4I48B 3F5WB 5KZCB 3N1QC 3QCUL 4LSRH 1QLFA 1YPZE 1MFBH 2NYYC 5HJ3A 3ARFB 4IMKC 5KW9L 5GGUB 5FUCC 1Z0MA 3RU8L 3CFJA 4OFDA 5GSRA 3IVKB 1SJVA 4E41B 3QIWA 4MD5B 4Z0XB 2X4PA 3QDJB 4NUGH 3DYMA 4ZUTA 1XF5A 4JKWA 3B9EA 2FGZA 4LQFL 3IFOB 1FSKC 2EDYA 2HFEB 5LAXB 4P23B 4HUWB 4ODSH 5AYUH 2EYTB 2F5AH 3L3JA 4F7MB 3QIUA 3LEXB 3MJ9A 4KKBD 2GTWA 4M7KL 1FCCA 1F42A 4YAQA 4W6YB 1NL0L 3NCJL 3TYGL 5JDJA 1ZEAL 2IH1A 4L29A 4E5XB 1I9IL 1QRNB 3EO0A 2NY0C 1WBXA 3GUTA 3P30L 1CYGA 5A43C 1MAKA 3N85L 2I07B 5KVGL 3LN5B 1LDPL 3MJ8B 4PY7B 1WICA 4GOSA 5EU4B 3VFSA 3EYVA 3OAYH 1L4IA 4YC2B 3GIZL 5HYSA 5I1LB 4WFGE 1JRHI 5CMAA 4PRBA 4FG6C 3MJ7B 3KPMA 2H3NA 4ZUVB 1DBBL 3TWCH 3REVB 5HHNB 3GI8H 4FXGA 1IGYB 3IS1X 1WEJL 3LKOA 4GW4B 3A6CL 5AAWA 3BKYH 5D7JB 4S2SA 3KLSA 5E95B 1HNFA 3B9AA 8CGTA 1INQA 1G0XA 4Y4KA 2GIYA 2JJSA 4M48H 5B38G 5DWUL 5I1CH 1CFNB 2WQ8A 4HQQL 5HHVH 4D0CA 2VYRE 4GKNA 3ZYOA 4G8GE 3ULUF 5ISZD 1JMZA 5ALCH 2VNCA 4YHPA 3QHTC 3C60D 3PWVB 4R4BA 3MV7B 2WMPA 3B5TA 1VACA 2GCYA 1EEZA 5E6YA 1FPTL 3MLYL 4RMWA 1R3JA 1A14L 4JM2F 1H5BA 3ARZA 3HE7B 1AGEB 1C5BL 2VDOL 1A47A 3L7FB 1G7JB 2OLDA 3PP3H 4ZS7H 4PBVC 1FL6A 5IVXA 4L8CB 1KJ2H 4KK5D 4PV8B 4Z95H 3EDEA 4ZOBA 4FQXA 1CK0H 2QV2A 1RJLB 1AI1L 3KYMB 4LIQH 1Q9KB 1CTNA 3IETB 1RHHA 1GGBH 1I1FA 4AY0A 4GRWH 3VXRE 4HXBL 2HKFH 3G5XB 3HR5A 4ODXB 5E24E 1FH5H 3BGMB 1MNUL 2Y4SA 3E3QC 2Q76A 3W0WE 3H7BB 3O11B 3WNLA 1FRGH 5D8JH 1T22A 5KBNC 4JDZA 3KLAB 4HKJB 4LEOB 1GPOL 5DDHB 1HHHB 1EO7A 3EOTH 3ZKQD 3SDCB 4FQ1L 4WW1A 2VJXA 3IU4L 5FO7A 3D87B 1F8TL 4WV1B 2JB6A 4P2OC 4Q7DA 3EYQC 1WCQA 3FFCA 5H37G 4YPGA 3VWKC 3MBEB 2XXMB 4XVSH 1JZ4A 4RFEB 1WCBB 1INEL 3LHPL 4JFEB 5CLWA 1RZJH 2FLRT 3MPCA 4NDMA 5KSUB 5DURB 4PUBL 3EYOB 5F8RC 1J1PL 3TCLB 3P0VL 4E0RB 5HYIA 4K7PH 5C0AB 1OSZA 5JOPD 2ZWLT 4Q6IA 3MRMA 1FAKT 3OJ2C 2YPLD 2XZQL 4Y19B 1TQCB 4XVTL 1K8IA 1A5FH 1IC4H 2MNUA 2E27H 1D5XB 2KZWA 2ZUUA 5C0NC 1RUQH 2HJFA 4BFIA 3BX7C 4OF3A 1YNKL 3TV3L 2AKRA 2J1KA 1IQDB 3VGEA 1QFHA 1JBJA 3WS6A 5F7DA 5BV7L 1CLYL 5EC2A 1NKRA 2ICWA 1NEZA 1IKNC 2LVEA 1JVKA 1T0MA 2EEAA 5HHOD 2X40A 1CDIA 1XF1A 3PJSA 1YN6B 2VXUH 3FQWB 5IHZA 3TIDB 4JO3H 4B53A 4MA3A 4CUCA 1IMHC 3UTPE 2LTQC 5D1ZD 5AG9A 2AEPL 4F8TA 1D5IH 4FMFA 1TLKA 4QTIH 2ICEA 3D18A 5J1SC 4N5ED 1MQ8A 5FYLE 4DCQB 4UT9H 4GW1B 3H42H 2Z4QA 1MY5A 4RGNE 1P6AB 4JHWH 3QI9B 2CLVA 2HG5B 3C09C 4BK5A 5DVLA 3QPQC 3O4LA 2I60H 3WHE0 3VRJA 3OJVC 2P5EB 4EXPX 1A7NH 2X4NB 3RWDA 1I3RB 1G6RH 2XRAH 1Q9OB 1WIPA 2F53A 1NBVL 3KPRA 4R2GC 4ISVB 4M5YH 2PNDA 4DKAA 5I15H 4RBPH 4P0DA 4P3CL 4JFFA 3LSOB 3MLRH 3RL1B 2Y25A 4ORGB 5IKCB 4MD0A 4NZUH 3DUSA 5E8DL 3ES6B 5SWQB 2ENYA 3KS0J 1KG0B 1YJDH 2B1AL 5KJRL 5HDOA 3UC0L 4PJIA 2JF1A 3O3EA 2CGRL 1KFAH 2H8PB 4ALAL 4IDJH 1J1XH 3FT2B 4XI5D 4ODWB 5DS8B 2Q7YA 4KZEH 3P73B 3QQ3B 4WHTA 4HUXB 5F9WC 3CLEL 1I8MB 3QWOA 1P9MC 2ARJB 2DMKA 1G1CA 2VKWA 3JUYA 3QG6A 3SKMB 1KEMH 3INUL 3X14B 2DM4A 5E00A 4EDWL 1KGCE 2CDFA 3DXAD 2VDML 4LCWE 1VGEL 3I3EA 3FO1A 4H8WC 3MLTB 3PIQA 3UYPA 5JIIA 3DBXB 1HK6A 1KB5L 4X98A 1AP2A 3BZ4A 4JDTL 1WAAE 2YXMA 2DMCA 5IV2A 1AY1L 5JR1L 2DM3A 3DSFL 3P9LA 3SO3B 1F4XH 2OI9B 2F8OA 5EU3B 2R29L 1GZQA 2V2WA 5KTEL 3REWA 1HI6B 2V5RA 1FIEA 4XC3H 1GH7A 5FCSH 3HZMA 3QFJB 4IS6A 3BKMH 4UTBH 1N5YL 1C12B 2P8PA 3DTXB 1LP9B 1I8LA 3OPZL 3UPRA 3WUWA 2IAMC 1RMFL 2DI9A 3FN9A 3FO2A 2ZSVB 2VAAA 4NQSB 1YEJH 1XCQA 2I27N 2VKXA 1BHGA 1AHWC 1CD9B 2WBWB 2YZ8A 3P4NA 1I85C 3NVQA 3P9MB 4YUEH 1TETL 3SDAB 4X7TB 2F58L 3KYOB 4MYWB 4PJXE 2XN9A 5ELIA 5JW5B 2E7BA 2NZ9D 1LO4H 4ZAKC 5I1AA 4NC1E 3K4DA 2PW2A 2Y7QB 1U8NB 2GTZB 3PQYA 3QXAA 4UILL 3MLUL 2YD9A 5I19L 4KTDL 5MI0B 1T83A 5FYKH 4FTVD 3O0RL 5E9DB 1JZ5A 2FX7L 3IYLW 1C7TA 5JW3H 1D6VL 1HSAA 1AO7D 5E7FA 1EO5A 1QKZH 1P53A 3D0VB 4HJJL 2YR3A 3CMOH 4HDIB 3VMOA 5L9DH 4ZD3H 5DYOB 4OGZA 1URLA 1KIPA 5FGBA 1VENA 1ORQA 1IKFL 3MRHB 4PR5A 3TVMC 2ZUSA 4JPWH 1ND0B 1D6EB 1MRCL 5F96H 1RZGB 2R0ZL 3P4OA 3ZKNC 4DVBB 5ADOL 3B9KB 5EBWA 4M6OH 3ARYA 1DQDH 4OZGF 5FDWB 2EYRB 3BP5A 1QTYT 4NNXA 5I8OH 3TT3H 4N0YL 4S0TD 2DJSA 3ARFC 3T2OA 3SO5A 1F4YH 3DIFA 5HY9A 4U1NB 4CADB 2X44D 3NPZB 3RVWC 1HSBA 4N0CD 5JLZB 3L5IA 4JFQB 3OSKA 4POZD 4A6YH 4WTXA 5FV2A 3HE6D 2BC4B 4PGDB 3V9FA 3D85D 4OI8A 3U2SA 3T09A 2J8UE 4NFBA 4NWUL 1LNUB 4XHJC 5D71H 2HVKB 4ZO6A 4JM4L 3ZMRA 2HH0H 1VEPA 2NXYD 4RGOH 1S5HA 5GRVK 1Q8MA 4ELMA 1NCWH 4CVZA 4GBXD 4X9FA 3AM8A 5IT2H 4G8GA 3RAJH 4LLYA 1U93A 4Z9KB 2X1WL 1NFDF 3OZ9L 2RCSL 4RAUA 2OX5A 2HTLD 2VLKD 3FOMB 4LSUL 1MCHA 3TC9A 3QDGA 3MA7B 1MJ8H 1MFCH 5IJKA 1WWWX 2YMXL 3NCYS 4OZ4A 3V4UL 4JRYD 1MCNA 1KJ3H 4UINH 5T3ZD 5JIHA 5D7KD 1LO5A 1HHIA 4K55A 2IANB 4EI5C 3GDBA 1AD9B 1MJUL 4K2UH 1AQKH 1DEEB 1TVHA 5GGSB 3RZCA 3GRWA 3MRKB 2AV1B 1LEGB 2CQVA 2AJ3A 4JO2H 3EDJA 1F5WA 3QEUA 1SY6H 4DW2L 1CVSC 4QRQB 1MAML 5BV7B 1O7VA 4Z0BH 3W39B 5GS2H 5D9SB 4TSCL 4OT1L 1QUNA 2Y6SC 1H0DA 4QEGA 4O2EB 5D7JC 2NY2D 1J5OH 3EOYG 2VXSL 3ARDD 1NC4D 2FZ3B 2ATKB 2N7AA 3MRLA 5A16A 5DF0A 3ZHLA 2B20A 5ESQB 3TNMA 4CU7A 1W8OA 3HAEA 4WDIA 3E6FB 4LSQL 3DOSA 1G84A 1UB6B 3MACH 4P2YA 1BQLL 4YX2L 3V52L 2K3TA 3TPKA 2EDBA 1YPZB 3JWOC 2A6KB 3L3HB 3LCYA 3KXFA 3QPXH 1ADQA 4M6MH 3RWJA 1SVCP 1J0ZA 4OZFG 3CDYA 3IDGB 4L3EE 3HE7C 4MZ2A 2X5PA 1AGCA 2EC9T 1RAMA 3NFNB 4NRXB 4RFOH 4TULH 2EH8H 4YNYA 3CSGA 2CRZA 4FA8A 3IXTA 1M7DB 4BSVB 3MQIA 1YC8A 3UX9B 1YY8B 4XPGL 3KLHC 2FR4B 1PX3A 2AEQH 3IS0X 3HI1A 4WO4B 5IB1A 4OLUL 3OJDB 5C9JA 2I5YL 2HVJA 5F9AC 1Z5LA 2ZOKA 2PXYA 3WSQH 4HS3B 1JYXA 2RHEA 4JKPL 4U49A 1GGCH 3VCLB 3F62A 1IGIL 2JIXB 4JPVL 1JRHL 5EU6E 4JB9H 4UOJA 1QPXA 4HG4K 3SCMD 1DQLL 5E7BA 4KJWC 4XBEL 3ALPA 3K80A 5BOZG 2C26A 4YLQT 4H25B 5JQ6L 1VDGA 3MLVL 2OR8A 5EU7E 1DQQB 1I1AA 4WV1C 3C6SB 4HLJA 5DJ6B 1A3RL 2Z8WC 4R0LC 2WP3T 4WWKB 1GOHA 1SVZA 4RNRA 3MBEC 3BZFB 1EXUB 4OD3H 1FG2B 3QCVH 1MFEL 1KB5B 4AH2A 4Q0XH 4H1LB 1XCTA 4ZODA 3S36H 4TPRH 4QLRA 2DQEH 1NGXB 3QIWC 2DDQH 3JV6B 2IPUK 1EHXA 1SHMA 2FIKA 1HIMH 1CD8A 4TUKL 4Z5RA 2XI9A 1BIHA 4ELKB 4NBZB 2YK1H 1DBKL 3S96B 3DV6B 3GSUB 4YHKH 4Y16B 2PW1A 2HLFD 4LAQL 4QHLA 6FABL 1TQCC 1INDL 1I75A 5KVDH 4XRCB 1MHPH 4LLWB 2FB4L 2FX9H 1LE9B 1CG9B 1ED3B 1P7QA 1Q0YL 4NBXB 5IOPA 2Z91A 3BH8A 1DLHA 3HHRB 5I17B 4GG6E 1XGYH 4XNMB 1FN4B 1P5VA 5I1IH 1IVLA 2XZAL 5EUOF 1T89A 3MLPA 4RFNB 2LVCA 2RIKA 2D7TH 5L2KE 5DVKA 2HFFA 4X83A 4KHXL 4MD4B 4J3SA 2X9WA 3TFKC 1XGQA 2NY1D 3LRSA 1FVEA 2R8SL 1IGTB 2EYSB 5HSFA 3AREA 5MENE 3CK0L 2WLYA 3MUGB 2VLJA 4P5TB 4GRLC 4PJBA 5ETUB 4LCWA 5C8JB 4OZIF 4W70A 5SWSD 3QI9C 1F3RB 3ZE1F 5TE6H 4RWYH 2R9HC 3TO2A 3WEXB 5AZ2L 1S3KH 4M1DH 4D8PA 1ODAA 3MXVL 2C3VA 5SX4H 5IG7A 3X12A 4FQ2H 3DROB 4ZSOB 3D9AH 4Z7UF 2APWA 5E8EB 4OCXH 1ZSDB 1SEQH 3C6LD 4UIKH 5E2TL 1HYSC 1S8DA 1RD6A 3TBWB 1GIGL 4LIQE 1NEZG 1H5BC 3BESR 1ZA3A 2MKWA 1GGYA 2NNAB 4LCCA 2MQCA 4IRJA 1MFAH 3FCTB 5EOTB 5IM7A 4GAGH 3G04B 4MCYB 5IVZB 3RY5A 4PJDA 3O2DA 1DBJH 3RHWF 4C83A 4R4NC 4MX7A 3QIBD 5DHVB 1HE7A 4U6XB 2EIEA 5GGQL 2FH6A 3M1BB 4L5FH 5F9JB 2V9RA 2DQHH 5T3XL 4U1LB 3TZVB 5CD3A 5A2KH 5JHLL 1QA9A 2O5XL 5FKAB 3EYUL 4OKDA 3UDWC 3CFEA 1WWBX 5FUZL 1DSFL 1EHNA 5E1AA 3NFPA 1ZHKB 3UBXA 5ADPH 1S5IH 2VDPL 3SO3C 4HPOL 4U1MA 3QXTA 2J88H 2E7LC 2ESVD 5C0CD 1MRDH 1NJ9A 4EUPA 3BXNA 3RJQB 3BP4B 4PJCB 1CXFA 1U92B 4PY8J 2VQUA 3Q1SL 5BQ7B 4JFXA 1OF2A 4JQXC 4X5LA 4LVEA 5ITFB 3P0YH 5CWSA 1K6QH 3VWJB 3BISA 4Y5XB 1X5IA 4MQ7A 4PLKC 1LMKA 3CFCH 4X4ZA 1S9VB 1C5DA 4QOKE 2UZIH 1UQSB 4QTHA 2WM0A 4Q9QH 1GAFL 1MWAB 4RGNB 1IAOA 3FHQA 4F7TB 2R1YA 1DN2A 3SDAC 3BUTA 1NBYA 4H26B 1A3LH 3GSWA 1FCGA 5CBAB 5DD3H 1J12A 3T2QA 1XFPA 3KNBB 4S1QH 2AK4D 5M95B 3FONB 4NJ9L 2A9NL 2XNAB 2COQA 5MI0C 5IFJB 1T2XA 5DMIH 3LMJL 5CIPH 4L4VE 1E27B 2FNBA 4HD9A 5HYQB 1NCAL 5DO2D 5ID1A 5I18L 3ELAT 5JXAL 4JHAH 4LHUB 1IE5A 2CR6A 1UM6L 4PRAB 3WN5A 3X11B 4GAJL 2JJWA 2G5BB 1U8IB 5FA4B 1RZ7L 1KCUH 2NQCA 4LSRL 4G6FB 4U3CA 1PZUB 1MFBL 3PNWA 4PG9B 5JW4R 2P8MB 1DN0A 4WU5A 1SJHA 4LRIC 1RK1A 4U31A 2B2XH 3C5JA 1ONQB 3HC0A 3WUWG 3RVVD 2DIAA 3T3ME 4NUGL 1UH4A 1W0WA 3S34L 2EO9A 1TCRB 3ARGA 3IU3A 4UTAL 5E2UH 4MHHI 2YBRA 4O2FB 4DKDC 3VXUE 3BEVB 1AC6A 3QEQE 3QQ9D 1GCFA 2ADJB 1FP5A 2VO5A 2V6HA 4MWFB 5HHMD 2EKSB 1G7LA 2WP3O 2VLRE 5J6HA 2AJYL 4AEEA 1RJYA 4X9IA 5FKPA 1M7XA 5F3HB 3VXSA 4C56D 1JWSB 2H26B 2DI8A 2PYEE 1FNGB 4CU6A 4HF5L 1W0VB 5MEQA 4QXGL 2PR4L 4X5XB 3G6JE 2XWBB 3T3PE 2AABH 3MCLL 5DC0A 3ULUH 1CFVL 4L3EA 5I1KL 3K2UH 4N0FA 5DJDB 5DGRA 3QUYB 4YGVB 3KPSE 5D5MF 4RQQA 3B5HA 1E4XH 3TBVB 5IB3B 4PJXB 5C0GB 4C58B 5GS1B 2A77H 3FRPG 3TWCL 3OHXA 2XA8L 1F6AB 3GI8L 5E08H 3Q5YA 1NGPL 1N8ZB 4U3XA 2FEEI 1OTUC 3QUXB 3MXWL 2EDTA 1OT2A 2FGWH 1A1OA 5C0FB 3BKYL 3PWNA 5I66A 2H2PD 4I48A 1NCDH 2W60A 4KJQC 1T0NB 4ZYKA 4M48L 1G7QB 2BHYA 1JJUA 5CJ8A 4KK9C 2AXFB 5E2JA 5C2BL 4WUUE 5IMOA 5JTWA 1KJVB 3QG7L 4YDIL 5ALCL 3KPNB 3QDJA 3GIVB 4NJAH 1HHJA 2HA1A 4XP5H 1FZMA 5LJYH 3IFOA 1I4FB 2OM5A 1A22B 1KTLB 5LAXA 5C07E 4P23A 2XKUA 1F90H 3B8YA 1S7SA 4NPYA 3FB5B 1MUJB 5FYKE 3FT4B 1QNZH 1AXIB 2BVPB 4ZS7L 5KG9A 3WLWD 5JHDA 1U8MB 4QRPE 3IGAB 4UDTA 4ZDHA 4Z95L 1KYOK 3R8BB 3S37H 1CK0L 1QRNA 1QYGL 2HYMA 3ZT7A 4ZFGH 2D7MA 4OBRA 3NCYP 4GJTB 2E6PA 4WO4C 5L6YL 1EHAA 3ROLB 5AD0A 1GGBL 4P4RB 1FFRA 3P77A 4JR9L 4OD2A 1FH5L 4OCSL 1DVFB 3U83A 1XR8B 1FRGL 5D8JL 4PJ7F 3PABB 4D2NA 5FECA 3A67L 3DX7B 5F71A 5I1LA 3MNZA 4K7FA 2P24B 3DECA 3IF1B 2ZCLH 1U42A 3ARUA 4P4KD 4Q58C 1J8HE 4PD4J 1QR4A 2EIZB 5FHBH 3HAEG 3BDBA 4LLUA 1QQDB 4JRXB 1E4WH 1RUPH 5SX4I 5FOJA 5EFIB 1MJ7L 2OTWB 3RGVD 2BNQD 1CFNA 4X0KA 1U9KA 1JTTA 4BQ8A 1PY9A 2C3WA 3IDXH 4K7PL 2DKMA 3V5KB 1JWMA 3MV7A 4S1SL 3NIGE 3S88L 2A6IB 2AK1L 2DRUA 3EYSH 4F7CB 4HIXH 3TA3C 4K94H 3WIHH 2E27L 3C87A 3CLFL 1T1XB 4NQCB 2DAVA 1KELH 1AGEA 4Y16C 1RUQL 4FNLL 1T1WB 3L7FA 3S35L 2O26U 1B0WA 2NY4C 2C3GA 3MFFB 3SKUD 5HTSA 4NZTH 4N9OB 3GFUA 3QCTH 3UROR 4EKXA 4R9HA 3UAJC 1T1ZB 4PV8A 1PAMA 2ZG3A 5IR1B 1N7MH 2VL5B 1S7UB 2BERA 4QRRE 4PV9B 4OKVB 1Q9KA 2W0FA 3BZDA 4RFNC 3G5XA 4ODXA 1U3JA 4NOFA 3SDXE 2Y5TA 4D94A 3I6KB 2H45A 4OCMC 1ZAGA 3O11A 4UT9L 3H42L 5J89A 1M1SA 1U58B 4JHWL 3T08A 1OP9A 5KSAC 3SDCA 3TN0A 1UWXK 2QEJA 3LKNA 1EZVY 3IDNA 5FYJL 4PJFB 4P5TC 3VXMB 4CW1B 3QIUD 3VGGA 4PJGA 1A7NL 5HYEA 1HKFA 5D1QC 5T5NF 1AE6H 5I71C 1G6RL 2XRAL 5C0BA 1MRFL 2VTFA 3H9HB 1X44A 4M5YL 3O3BB 5BMFH 4Z7VE 5I15L 1DUYB 5KS9A 1B2WH 1A6WL 1K3IA 1WCBA 2J4WH 4JN1H 2A6JA 3RQ3A 5KSUA 4X6DF 3CXHJ 4NZUL 5EPMB 1MLCA 1YJDL 1IGML 3MRQA 4H5SA 1KFAL 3T0EB 2PKDA 4IDJL 1J1XL 4A2LA 4Y2DB 1D5XA 3UZVB 4KZEL 4LP5A 2R1XA 2WV3A 3RWFA 1OTTC 4KVNH 1HDMB 4XBGA 2FJHB 1ITCA 1BFOB 1KEML 3CSPA 4H20H 4JGJA 5ACMA 4CVXB 4HBCH 4YO0A 5JNYA 3V6ZB 4HG4J 1I9RH 1RVFL 2A2QT 3D0LB 2Z92B 4KHTH 3GBLA 2ICCA 1GC1C 4I9WE 4Y4KD 5T5FL 5ICZA 5F7EH 3TZVC 4FABL 3WLBB 1F4XL 3BHBB 2BSRA 4M9OA 4M1GL 1JF6A 4HEPG 5TDOA 1LE5B 3H2WA 3I02A 5IJVB 4GG6B 4AEIH 4ZMAT 3BKML 4DCQA 4UTBL 1B6UA 3L3KA 1R3HB 2ORBH 2LV4A 3TIEB 5L2JB 1PJ9A 3IFPA 4NUJA 1DE4A 2FYYB 5ID0B 5L2KB 2IFFH 4LASL 3U0PA 1EGJH 1UFUA 2OR7A 3IKCB 5GGTH 5D7SL 3L3DB 3VWJC 1NFKA 4Y5XC 4YUEL 4LKCB 5HD8D 1QD0A 1WTLA 5MENB 2IQ9L 1FZKB 3LSOA 5C09E 1LO4L 4YFLF 4Y4HA 4RGNC 4Z7QE 2DL2A 1YMMA 1J10A 4GMTL 5IVXF 1P4BH 4FQXD 4P46B 3VXUA 3GHEH 5GS3A 1NCNA 4HT1H 4GKZB 5SWQA 3CC5B 3KPOB 1MHEB 1T1YA 4HHAB 3NH7L 1KB9K 4XVUC 1UM5L 1QKZL 1E4XI 4HIJB 4YBQD 2DQGL 4G80B 4ZD3L 1EHLH 3HUJE 5EZJA 2X4UB 4HUXA 4X8XA 2VXVH 4KK6D 2ARJA 1IC1A 4JKKA 3X14A 3NN8A 4XAWH 1DQML 4Z7WE 5F96L 1KJ2B 5T1MB 2V2TB 3PGDB 2EXYD 2LAGB 4M6OL 1FFOB 5EU5A 4U33A 3FFCD 5TQ0H 1R5VA 4HZLA 2EDHA 3MLTA 1RFDH 1GSMA 2M2DA 1G9MH 4EUPG 1UWGH 3ARQA 1K4DB 3JV0A 4NQEE 5DK2B 1L7IL 3TT1H 5GJSH 1F4YL 2QHLA 4GRWB 2Y1VA 4PLOB 2ADGB 1GL4B 3HI6H 2YD3A 5HYFA 1HI6A 4I0PA 2X70B 3RPKA 1JGLL 3BP6A 3LQAL 4UDUB 1C12A 1IFHH 4ZOEA 1TZGH 1CGWA 4HIEB 2R2HB 1CE1H 3U4EA 4KPHL 3DHMA 5D71L 2GJ6E 4PJ9B 3MYJA 3KDMB 5T3ZH 2ZSVA 5IB2A 2H2SD 4UT6H 1NCWL 1VHPA 1T7YA 5IT2L 3P9MA 3RAJL 5ANMB 5C92A 5D1XB 3FN3A 1ZGLM 4X7TA 2DQUL 5EZLB 3WD5H 3K4AA 5B8CB 3VRIB 4KKCC 3T77B 3TO4A 1ZANH 4DUXA 5CEZD 1JNNH 4D9QD 3VD3A 5I30H 2GTZA 4NFDA 4HWBH 2DQTH 1QLRA 1WFUA 4BFEA 1KJ3L 3VFMB 2IBGA 2FBJH 3D0VA 4QOKB 2BVUA 3UTTB 1AQKL 3QUYC 5FGCE 4QCIB 4TUOA 5GS1C 3ORJA 3TCXA 1JV5B 1M7IB 3O4LD 1CZ8H 4R4FH 1D6EA 3QUXC 1CF8L 2BOBB 5J1AA 2X05A 2JELH 1SYSB 1JUFB 4Z78A 2XTJB 3B9KA 5F70A 2W0LA 4OZHE 5LKNA 4HK3N 3PL6B 2EYRA 2F53D 3KPRD 4JPKH 5D6DA 4CNIB 1XZ0B 3ABZA 3C2AL 4KRPD 1NMBH 1VFAA 1P7KB 2YRZA 4P2QE 1ZXQA 4JFFD 3W5MA 2YC1B 4U1NA 4O51B 1MCWM 5FUOL 3MACL 5E99H 5JLZA 4JFQA 4KU1A 3DWTA 3WFEL 1EO8L 4AMKL 3H0TB 1JMXA 3NA4A 2XQYG 1CICB 3S3PA 5IB4B 1UXSB 2VZSA 2ZSWA 3I84A 4WEMB 5C0JA 2OCFD 2HVKA 1F3JB 1MCQA 4L8DB 2LU3A 1G6RB 1M6OA 5I8EB 4OBSA 4K3HA 2WBKA 4F9PC 4RFOL 4TULL 2EH8L 2BVTA 2QKIA 1KACB 3OBAA 4LEXH 2GAZA 2APVA 2EDEA 4G8IA 1HH9A 3F7VA 1SYVB 3EJYC 5KN5B 3MGTB 5CBEB 3QXWA 4GMSH 4QRTB 3QEQB 5KVFL 4XCNB 3C5ZA 5HGHA 1JGUH 4LL9A 1JPTL 1ZA6A 3HNTL 3WSQL 1G9NL 1IEAA 3DVGB 3MRBB 3MBXL 1GGCL 2GUOB 3P4LA 4NKDB 3BEWB 1UJ3B 3AS0A 1BOGB 1DVFC 4HJGB 4JB9L 1I7RA 3BW9B 2E7MA 3H9YA 2YEZB 4FFZH 4X6CF 2Q6WB 2FEEL 5F1NA 3RVUC 5GRXG 1OGTA 5E8NA 3K8MA 1JFQH 2W65A 1EEYA 1ZT1B 4LLDA 2FEDD 1HHKA 5L7XL 3KJ6H 5IF0A 4AJ0A 4PRIB 4OD3L 3MLZH 3O3UN 3KPSB 3W2DL 2FZ3A 3SDXA 2ATKA 1AC0A 4LPTA 5DSCB 3IAPA 4TPRL 5SWZB 2DKSA 1UACL 1XGTB 3MO1B 2DDQL 2XN9D 3JWDC 3E6FA 2VZVA 2X4TB 1HIML 2R23B 1TZIB 4XHQA 3PQYD 1OAXH 3C08L 2Y36H 2Q86B 1RZIB 2YK1L 4F2MA 5MEOB 4YHKL 2A6KA 3L3HA 4H88H 2AV7B 4G9FB 4Z7VA 1MHPL 1YDPA 1RY7B 1DR9A 4WUUB 5C9KA 3QHZL 3IDGA 5GZOC 5TFSH 1NSNH 4P5KB 3DURB 1IGJA 2VN7A 3GMLB 5E4IA 4PRNB 3V2AR 2IALB 2OP4L 3QXUA 5ISZE 3EYFA 2R0LH 3LZFH 4XMKL 1M7DA 3L95B 1CFBA 1NAKL 1YY8A 3S98A 5C07B 3U7YL 4LF3A 1L6ZA 2UVEA 5DRXB 4ENEC 3VGDA 3OJDA 4IRZH 3OKOB 4X5WB 5INDB 5D6CB 1JHKH 1XF3B 2BNUB 2Z9TA 2ZOLB 4WFGD 4OQTH 2GI7A 4Y89A 4QRPB 3VCLA 5GRUL 4MA7H 3QEGH 1MCIA 3TPUB 1QFWM 1X4ZA 1MCKA 5DJXB 1JF5A 1FC1A 2KH2B 3EDDA 1FZJB 5IESH 2MCPH 1J11A 5TE6L 5ILTL 4JFZH 3LPGA 1C5CH 3MNVA 5DRNB 2CDGB 3SGJC 4WWKA 1S3KL 1S7TA 4JFYB 4Y4FA 2Z31B 1A6AB 3BZFA 4YDLC 1NGWB 4G8GD 3D9AL 3EJZC 4UU9A 2XICA 1MCDA 1YQVL 1A9BB 1JGDB 5D96C 4R7DA 1KYOJ 5HGAA 1J8HB 2OTUB 4A6YB 2HT4C 4UIKL 1RJZB 1JI2A 3QDGD 5DA0B 5IEHA 5EU7C 4H0IA 5BS0E 5BJTB 5JPNB 3DV6A 3GSUA 4L1DA 4J3WA 3H3PH 2BHZA 4ZTOH 3T0EC 4EOWL 4NYLA 1X5GA 1MFAL 1UZ8B 5C09A 3RZCD 5E5UB 1GGIH 3L5XH 2V7NA 4M3JA 2OQJB 1WC7B 1TITA 4P48A 3QXDA 2FL5A 2JTDA 5JOPE 2DQHL 2EDXA 1R5WB 4U7KA 4FQCH 1T03H 4HWUA 2AXGA 5IB5A 1IGFL 2HLAA 2YPLE 5LGHH 2NXZB 3QQ4B 2OL3A 3A0OA 5CJOH 4KQ3H 4MD4A 3BT2H 1S5IL 2BFVH 3SDDB 3CAFA 4MSWA 5D2LE 3RKDD 2P42B 1Q0XH 1OT1A 3MJ6A 1S7QB 3MV11 1MRDL 4L3AA 4X6FA 4KTEH 5ITBH 3FB7B 1H8OA 2BRRL 2BP3A 1A6UH 4PJAB 4WHYG 1A4JA 1Z6JT 5HHOE 3P0YL 4DGIH 3FQUB 3KXFD 1K6QL 1X5XA 4D9RE 3FMGH 5MERB 1MCWW 4NQEA 3WEXA 3MRFB 1OGAE 3DGGB 3RY6A 3MRDA 5T5NG 2A38A 2ED8A 3T4AB 2UZIL 4LCUB 4Q9QL 2JJTA 3PDOA 4NSKB 4TUJA 2PO6A 5HVHB 2NR6D 3DROA 4WVRA 1AGDA 1T5WB 4L4TE 5IROC 4HGWB 4S1QL 5E1HB 3STLA 15C8H 4HX1A 2PXYD 3ULVD 4D0DA 3LN4B 1YYMH 4ZNEE 4M1CC 3QRGL 4JHAL 5I0ZA 3A6BL 2A6DB 4J4PA 5EOTA 3WKML 3LV3A 4G8EA 5BZDA 1DBAL 1V3JA 3QFDB 4NZRL 3TJEH 3TLRA 4PLJC 1KCUL 4AYFA 3R0NA 2UZYB 2WBJB 1I1AD 5HHXH 1KCVH 4U2ZA 1FZOA 2OMNA 1YY9C 3JTSB 5CLTA 4U1LA 3GSQA 2B2XL 1LO2H 1A64A 1AR1D 3RWCB 3O6FD 4M7LT 1D5ZB 1S7RB 4XXCA 4NQDA 2BMKB 1U95A 5IFAH 1P1ZA 2FHBA 4AM0A 3WJLC 3HNVL 1I8KA 5C08A 3ECBA 4PJCA 3GMNB 2IADB 3BPCA 3DXAE 3L9RA 4FZ8H 3HTLX 1U8QA 2X1OA 5ITFA 3GJEB 1MHCB 4ODHH 5IGXH 4PJ9C 4NP4H 1P7QD 3FB6B 4LK4A 3WYRA 2ZUQB 2D3VA 2X4OB 1H3GA 3O2WL 1BD2B 4JG1H 3WXWH 3VD4A 3HB3D 3S8WA 1JPGA 3M17B 4LSDA 4R90H 1RZJC 3QULB 2DI7A 5A2LH 4H26A 5CBAA 3L1OL 1AGBB 5B8CC 2NY7L 4NT6B 4KZDH 3GB7A 2R69H 3IJYB 3V7AE 3FONA 1Q1JL 1MEXL 3MV8B 1CD1A 3SEPA 3ULUL 5DEGB 3RUGE 1A8JH 5TJWK 1DBMH 5H94B 1N0XL 2CR3A 2A83B 4OV6F 3QWQB 2DQJH 1FJ1B 3D39B 2IJ0C 4CJ0A 2BVEA 5E08L 3ARED 1NQBA 4U0QB 3H9SA 2BSSA 4CVWA 2FGWL 2VLJD 2ICWJ 2IBZY 3VFUA 1KGCD 4LCWD 5ACLA 3X11A 4EVNB 1U8IA 2ED9A 3Q6GH 3FOLA 3KYNB 1MH5B 2AJZA 1NCDL 1R3KB 3HI5L 3EFDH 1DANT 2XTJC 3AROA 4PG9A 4DEPC 2B7DT 4XPTH 1B4JH 3DMMA 5I8CB 1PVHA 3PL6C 1WAAF 1NAML 4KJYA 4Z7NE 1G7PA 1T5XB 3JSSA 43C9B 4HLZG 5J6GA 2D03H 4B5EA 4HS8L 5CGTA 4NJAL 1YNLH 1JL8A 2YD7A 4XP5L 3MREB 5F6IB 1HCVA 5L8LB 3K46A 2FH8A 1TJIL 1ACYH 2MHAA 4KMQA 1DCLA 2ZCHH 5E6IA 1F58H 5ENWA 5GRJL 2W91A 3DNKA 1PKQE 4EN3B 4V2BA 5DFVC 5EBLB 1L6XA 3MLSH 1N6QH 2MMXA 4MWFA 4IRJD 3RNKB 1YNTA 4JG0L 5BRZB 5L88H 3NTCL 1DFBH 1KENH 4K71B 4PJXF 4PRHA 4N5UA 3B3IB 4WW2C 2CJUH 1P4LB 1H3PL 5T1DH 1D9KB 1CGTA 1I7TB 1RUKH 3KYKH 2H26A 1U8KA 2GJ6B 1R24B 4NO2B 4P2RB 1II4E 1W0VA 3N0PB 4XPBH 2XFXB 4L9DA 1WZMA 5EN2B 1YJDC 4NM4H 4PJ5B 1LHZA 1S7VB 1ORSB 3HPLA 3IDUA 5EWIH 1D5BB 2JCCE 1KOAA 5DJDA 5IB3A 2ENSA 4WRLA 2F74B 1MHHB 2WIMA 5C0GA 1UJ3C 1UENA 4LDEB 2CXGA 4OIIL 4KQ4H 2RB8A 3QUMH 3QISA 4NRYB 5DJYB 3U1SH 2VLKE 3S35X 3ZDXE 1E4KC 5I1HL 2DYPA 2VDRH 1E4WL 2VDQL 4NHUA 1PGRB 3BMWA 5I16B 4DKEL 3PV6A 1PG7H 1IQWH 3MRCA 4KJPD 5EULV 3WFBH 5FM8A 1MSPA 5D7KE 3HZKB 1KJVA 4PPTA 2VR5A 4APQB 5I6XB 3O6KH 4FFVC 1FO0H 4RRPA 1KPUB 3WBDA 5HPMA 1EMTH 2JB5L 5F88A 1CLZH 5B21A 2R2BA 4WNQA 1OAZL 3RWEB 1I4FA 4HIXL 4K94L 4V1DE 1KJMB 3WIHL 5GS0L 3ILPB 3NZ8B 3C8HA 4WEBL 1BFVL 2J8UF 4J3OC 1KELL 1NBZB 4K3JH 4GT7A 4P2QB 1EBPA 3FB5A 5ESVA 1Q94A 1ES0A 3N1PC 2EIBA 3QCTL 4TN9A 3DJ9A 4TSAL 4MXWH 5F3BB 3ZYIA 4MXQD 4UQ2B 4J23A 3MROA 4FQHA 5CJQL 3MJ9H 1ZLWK 3L6FA 3PHSA 5BS0A 4DGVH 5CCKH 1PQZB 4KVCL 1I8IB 2CLRA 3ARBA 4JZJB 3D3VA 4Y7MA 4LNRA 3HRPA 4HS6A 5HDQH 3RA7H 1GZPB 2WINA 5CIPB 3ARGD 3LD8C 2AGJL 3GO1H 4NNPH 2K7QA 5HI3D 1MVUB 1U3YA 3LDBB 32C2B 3BWAB 8FABB 5CP7B 4RZCB 4BK4A 4JPIB 1AE6L 25C8L 5F89B 1U8OB 2VQ1A 5F1IA 12E8H 5DJZA 1FYTB 1KIUA 5JW4N 1A7PH 4U6HB 5BMFL 4JRXA 4K8RL 4YQXL 4G7VL 3CFBB 4JEGB 1B2WL 5D6DC 2J4WL 4JN1L 5EFIA 4L3CA 2OTWA 4KXZH 2FATH 5DD1H 2Z31C 1M05B 3OX8A 2CLZB 1TJGH 4X4YB 3VXSD 4M62H 5JZ7C 3O8XB 4KY1H 4EJ1C 4C59B 3CSBA 3V79C 1E4JA 1BEYL 1HWHB 3OGCB 2GYSA 4XP4H 4G6JH 5BW7A 1E28A 1PBYA 4QWWC 4L3ED 4PGJA 3SE4C 1OGAA 3BI9X 4KVNL 2C7UA 4ONGL 1XF4B 1T1WA 3AY4A 4B0MM 4Q97A 4EIZC 1FC2D 1V7MH 3MFFA 5FIEA 4D0BA 3VGFA 1PX4A 1G7IB 3NMEA 4L4TA 4TVPL 4EEEA 4NKIH 1ZGLB 2FWOA 1I9RL 5DZOA 4NN7B 4KHTL 4OIAA 5B39A 5DRWB 1QR1B 4YBHA 1YN7A 5E8PB 1JGVL 2XYCA 1KXQE 4PJEE 4Y5VB 4PV9A 2R39A 3QUKB 3K7UA 4JY6B 4BFBD 2NXZC 3BQUA 3QZWB 4P9MH 1HINH 2VZ1A 3TJHD 4AEIL 5ISZB 3QDJD 1CT8B 3RNQB 4PTUA 4FFYH 2UVFA 3AVEA 1N6VA 1UWXH 2ORBL 4P23D 4P3DB 4PJFA 3HC3H 3GK8H 2IFFL 4CW1A 3K0WA 4NCDA 4HEME 5GGTL 3EOAA 4GUPA 2DKUA 4IRSA 2ZUWA 4PJHE 1U8JB 5KOMC 1DUYA 5F9OH 5JHDD 4PJ8B 3PWLB 3HCVA 1NAMB 3NZHL 4FP8L 2YRLA 3D2UA 4N9GA 1P4BL 5HVHC 3CX5K 1QRND 3ROOA 1DQJA 1KPRB 5EO9A 1CR9H 1WF5A 5SWSE 4PGZA 5EC1B 2OXHA 1A4KB 5E2WH 1WQVT 1XF2B 4LPWA 3GSVB 4XGZA 1EHLL 4Y2DA 2AJXH 4ORZC 3WS3B 4UQ3B 5TDPB 2W92A 2YD2A 4YZFE 2YA1A 4EDXA 1YQ2A 3VE0A 5CZXC 5DD0L 4XAWL 4JFDA 5J12B 3NIFF 1W72L 2WWMD 4KROD 4GG6F 3V6ZA 5D7LB 2W0PA 4KRMB 5TQ0L 4HFWA 4JGUA 5EUKB 3D0LA 2KZ1B 1RFDL 2NY6B 2WBJC 4MNQE 1G9ML 3UEZA 1UWGL 1K4CA 4YDKH 1JZ6A 1H9VA 2AJUH 1ZHNB 5DVMA 5GJSL 1V3MA 5DQ9B 4J7RA 1MIMH 1HN1A 5FOBA 1U91B 3NCBB 1LE5A 1AH1A 5DMGC 4NNYB 3MNWA 3RWGA 1K2DB 1MJJA 4OUOA 5IJVA 4FXKB 1B0RA 5CEZH 5C0EA 1IFHL 1IGCL 1XAUA 3MV7D 1IT9H 5LCVH 3CDFA 1CE1L 1ZHLA 3BP7A 5IHBA 2YPLB 5IWLA 5L2JA 1U2CA 3MJGX 4M00A 4D3CH 5T3ZL 3T8XA 1FGNH 1PSKH 2FYYA 3U4BL 2V2XA 5ID0A 3PHQA 5TDNA 4OGAD 5BVJB 4U0RC 3VXNB 2V5YA 3FZUC 3IFLH 3L3DA 4YBLB 1UXWB 5DJCB 5A3ID 1X7QB 3F8UB 5D2LB 3MGOB 5F21B 3B2UD 2XY2A 3DVNB 4MNGB 4JFPA 4ZOAA 4N0UB 1ZANL 4V2CB 3FQNB 1R3IL 2ESVE 1J05B 1JNNL 5C0CE 5CKGA 5HHOB 4P46A 5I30L 4HWBL 1WBYB 2DQTL 2Q8AH 3PF2A 3KPOA 1EAJA 2VWEC 3F7QA 4IIQA 1PKQA 1P84K 3CCHA 2LFGA 4HHAA 3QA3B 4G3YH 4EZMA 1KLGA 4MAYC 3QDMA 3HFML 2FBJL 3ULSA 4G5ZH 4HULB 5KVMC 5D1ZB 4HGMA 3K3QA 2VL4A 2X4UA 4WTZA 5GIRB 4ESKA 3CFDA 2QSTA 2DLGA 1T4KB 2R2EA 1XGPB 3IDMA 3SDCD 3TN0D 1SEBB 2DD8L 5T1MA 2V2TA 3PGDA 2JELL 3U0TB 3OB0K 2F5BH 1GXEA 4F15B 3N06B 2HRPH 2VITA 1KXTB 5C0BD 2AK4E 2RGSA 1P4IH 4JPKL 2GT9B 4ZFZA 1OAKL 2JCCA 1XIWC 3HG1B 3SJVE 4DTGH 1CFSA 1GGUA 4JQIH 5DURD 2HN7B 5KSVA 5E99L 2P5WB 4XPHH 4JZOA 1KEGL 2X70A 1BQHB 1YMHB 5F6IC 3WNOA 3QUZA 2R2HA 4R3SB 2ZUXA 4I5BB 2HAZA 5GRVL 5JA8B 3LIZH 4EN3C 3OKNB 4MQXC 2NLJB 5BVPH 1U8PB 2AJSL 4KUCD 4RMRA 5LQBH 1MI5E 3FFDB 4LEXL 4XWGH 3Q2CA 4HIIB 1NUFA 1R3LA 5D1XA 5EZLA 4DK3A 1B4RA 2O61B 3NPSB 1T04A 2BSED 4POUB 4GMSL 2AQ2A 4F7EA 3GMPB 4PREB 4V1DA 3V7MA 1D9KC 3IRPX 5LXGL 1DDHB 4FQQB 1JGUL 1A7RL 1EAPA 3MV9B 5DUPH 2Z93B 3V0VB 3GJFA 1A0QH 3QJFB 3VFMA 2W0KA 4NCC1 4LU5H 3O9WC 1UKTA 2OR9H 3WIIH 1UB5B 3STZA 4FFZL 5DJ0A 4ZUWA 4MDJB 4HCRL 4QCIA 3E8UL 4P9HH 1JFQL 4LSVH 4C56E 2GSGA 2BOBA 1JUFA 2E6JA 4PTTB 4Z77A 3MLZL 1DZBA 4HJ0C 2NY3D 3X3GL 4XB7A 3VDBA 4KXZI 1CFQB 3AXLB 1TTUA 3BJ91 1JK8B 5IBTL 3FT3A 1WZ1H 1RZKH 4UB0L 4GXUM 4K7PY 4G43B 3T3MF 3BMVA 5GHWL 1CDUA 3CFIC 4Y4HD 4O51A 1YMMD 3FKUS 4APQC 3DHJA 3PWJA 4K3GA 5I6XC 3DRQB 4WW2F 4U3HA 2Y36L 3VI4E 4BA8A 2IQAB 1OAUH 1CLOH 5CD5C 3BPNC 4FTVB 4H88L 1CICA 4M8QA 4A2MA 1AO7B 5IB4A 3L3IB 2IEPA 3UJTL 2ARJQ 1CVRA 3R1GH 1DLFL 5TFSL 5GXBB 3DUUB 1NSNL 5I8EA 1G6RA 1IEHA 3ZKMC 4XWOD 2PETA 4FQIH 2X4SB 2R0LL 2P8LB 4BSWB 2ZUVA 3AFLA 3SCMA 4LGRB 1A1MA 1QO3A 5EZIH 2ZPKH 1LK2A 4F7PA 1L9NA 2HRLA 5KN5A 2EDLA 2W9DH 5CBEA 3V5HB 1YEFL 2D7PA 3V6OE 3FRUB 5I73B 3Q6FA 1KIQB 3G6JF 1JHKL 3I6GB 4HKXA 3OXRB 3T3PF 1NFIA 2FDBP 4YFLI 5CJ5A 3BEWA 3GSRA 3DGCR 4KV5E 4MA7L 3BAEH 5HGDA 3QEGL 2VMFA 4I0PD 2R56L 1LEKA 1KULA 1IAIH 3SGKC 2MCPL 2Q6WA 2KQMA 3HZVA 3D85B 5ACZB 1EJOH 2Y23A 4DKFH 1HWGB 3LDBC 5I8KH 3MX0A 1FFNB 1FV1B 4GKSB 2KPNA 4LVHB 2WANA 3CU1A 2W9EH 3HN3A 1ZVYA 4PRIA 4KKBC 3ZKXC 4L9LB 4PJ7E 4KKLD 4GBXB 5DSCA 2D31B 4PYHA 5SWZA 1NFDB 4LKXB 1QSEE 4M7JH 3MO1A 4XAKE 5JQHC 4ZUUB 3TNNA 3TO4D 2KL6A 3WJJC 4OAWA 1FE8L 4OGYL 4LSPH 4YHOH 2VLKB 1FVCA 5CSZA 3S3JA 2R1WA 3OKLA 3SGDI 2Q86A 1RZIA 1IAKA 4QNPE 5AEAA 5H2BB 4B41A 3ZSSA 4OFYA 4MJ5B 3H3PL 1U8HA 4JRYB 1F11A 4PJHA 1N64H 4G9FA 4G9DB 4LSTL 5DK0B 3LKQB 2Z8RA 5D2NB 2HMID 2UV3A 3MRNA 3OKKB 2R15A 3G5ZA 1GGIL 3L5XL 3F6LA 5DK3A 2YKLH 1XR9B 4BSJA 1EEQA 5T1KB 1JNHB 3CSYB 1S9WA 1QSFE 1T66D 2D4DA 1ADQH 3HMXL 4FQCL 3B9KD 3NA9H 4YPJA 1P5UA 5DRXA 3T1FB 4GW5A 5DMYA 3N1GC 3QEHB 4ZOCA 3OKOA 2NY2B 3T2NH 4Y5VC 3EUUA 2CRYA 5JMOC 5D6CA 3ARDB 1NC4B 3Q48A 3X3FL 2BNUA 3BT2L 4QXWA 2DJ4A 2ICWI 2R2CA 3P3YA 5D7IE 5DUML 1QHOA 5AG8A 1CDBA 2WQRA 1U8LA 3PG2A 3KPLB 4H8WL 4ZPVA 4DWHA 4KTEL 5ITBL 2AEIT 4NWTL 1BJMA 4HXAH 5IMMB 5IBLD 4Y1AE 4WJ5B 1A6UL 2XPGA 5DT1H 1YEDA 3C60C 4O2CA 3RBGA 1RZ8B 4JY5H 2I9LB 4OLWL 3THMH 3GBML 3ULVH 4AL8H 1ZE3C 3BH9B 3QH3B 4MNQA 4YXHH 4HIHB 4WI9A 4QY8A 1MCBA 4QF1A 3BYTA 5FO8B 3AMKA 4AENA 4PP1D 5TQ2L 3MCKB 3MUZ1 4NHCL 4DQOL 1OW0A 3S5LB 1D7FA 3MCG1 3MRJA 2JK5A 4JY4B 4WUKH 1YEIL 4FHBD 5TE7H 1FIGL 3QHFH 4KK5C 2X4QB 1U3HA 3NIGF 15C8L 1RJZA 3C5ZD 4OLYH 2X2YA 2IH3A 2NTFB 5IEKB 1EJ6A 3LPWA 3VJ6B 1I7UB 4Z76A 5JPNA 1YYML 2Y06L 4P57B 4X4MA 1RUAH 3VFNB 4IHOB 3RIAK 1BX2B 4UT7L 4HWZA 3IAQA 1U2HA 4YR6A 1QPPA 2DQIH 4I2XB 1JGEB 3CVHL 3TJEL 4XH2B 2NY5H 2ESVA 3DYPA 5J12C 5TPWH 4NO3A 3WL9B 1KCVL 3EOBB 4WU7A 5CJXC 4LVNB 1OCWH 2XWJB 3CPLB 5F93C 3BIKB 2CDEA 1QBMH 5F1KC 1VFBA 3P11H 3QQ4A 2X1PA 4H0HB 4OFKA 1LO0H 4XNQB 5IFAL 4HK0B 3MLWH 3SDXF 1BBJB 2FX8L 1KT2B 1RIUL 3TBYA 3SY0B 2K1MA 4F57L 4JREB 1S7QA 3VFWB 3W5NA 3UZQA 3OL2A 1RZFH 3H8NA 3LKRB 3R8QA 4PJEB 2EH7L 4FZ8L 4ACPA 3FQUA 1JF1B 1JYWA 4X6BB 3ET9F 2F15A 4C4KO 4NP4L 1TCMA 5E2VH 5MERA 3EGSB 3SJVA 4Z7VF 3CZFA 5EORH 4JG1L 3WXWL 2EZ0D 5E5MB 4YBLC 4IM8A 3V6BR 3HKFA 4JCMA 2IPKB 2B1HL 1BVLB 3BN9D 3QNYA 4P2OB 5EUOB 1LWRA 3IXAA 3VWKB 1SBBA 1RULL 2HKHH 2C4XA 3NAAH 3RPIB 1I3VA 3H6JA 1T21A 4HV8B 5K93A 4OV5B 2DWEB 1KTDA 5D4QA 2LU7A 3SKNA 3G6AB 1QACA 3GSNA 4JHBA 4FMKA 2DQJL 5TE4H 1MI5A 2NY1B 2GJZA 5D1ZC 3MRGB 1CDYA 1A7QH 3PGFH 4N5EC 5GGRA 3RZWA 4OZIB 1AR2A 2IPTH 5DZLA 5B38B 1BIIA 3QFDA 1S9YA 3GMMB 5SWSB 5GISL 1V3LA 2ERJC 4QHMB 1U36A 3QWRA 5SX5K 3EFDL 4Q9RH 4WWKD 4OFPA 1SQ2N 4FN0A 4HH9A 1E6OH 1B4JL 4F15C 2FSEA 1IM3B 1FNEB 3KHOA 4Y4FD 1CU4H 4IEFB 4MDIB 3WO3B 1D5ZA 1S7RA 4EXKA 3BE1L 2HTKD 3O2DH 3VFOB 4QT5A 3NBNA 4F58H 3RIAF 2WNGA 1A1NB 1BBDL 1YA5A 2J6EH 5GSVA 2YS4A 1ACYL 1PFCA 3C6LB 1CXHA 2IADA 1YUHB 1XGRA 3FFCE 3QJHB 4LMQI 5C70A 4QO1A 1N6QL