4X6DE

Cd1a ternary complex with endogenous lipids and bk6 tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
200
structure length
189
Chain Sequence
EVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMSTSLPNAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1a
total genus 39
structure length 189
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dE02
4C56B 1CTNA 4C83A 4GUPB 1RMFH 1CXLA 1AE6H 2W0KA 2GSIB 2W9DL 2OQJA 4JO3L 5FYKH 5F7DB 5C09A 2A77H 2UWEF 4OTXH 1YC8A 5C0NC 1MHCA 1N64H 3BAEL 3GMNB 5FV1L 4L1HA 1AY1H 3KPRD 4AEIL 4ZS7L 5CILL 2WBJC 4OT1H 4KKLD 4Z95L 5JR1H 2V2TA 3UX9B 3TT3L 4TVSa 4Z0XB 4YAQB 1BFSA 1ZLSL 4DN4H 5D5ME 3FRUA 2X40A 5KJRL 1CR9H 1DP0A 5E5RB 2BSTB 1KELL 1NC4D 4FQXA 2EDHA 1FL5B 4TUOA 3PIQB 2X4OA 2BVQB 2DQTL 3UYRL 4OV5B 4YDJA 1CG9B 3EYVA 3P40A 2OZ4A 1ZA6B 1RJYA 3FO2A 4IIQC 3KPLB 4JY6A 5AYUH 1NAMA 4P4RB 2VLRD 1HIML 5DT1L 2Q8AL 4K3GA 5E8OB 4OD2B 2X41A 5F9OL 1MCWW 1KCSH 5KVFL 4J1UA 2H2PC 2AJSL 2YWYA 3IDXL 3L6FA 5HHOB 3NCCB 4Y16A 2CR6A 3OZ9H 5I71B 5FA4A 3UTTB 4C55A 1HQRB 2A74B 5C0CD 5CUSH 2AI0H 5HI4C 3EOTH 5HHOD 1U8NB 3BZ4B 1D9KC 4Y2DA 2C3WA 3GMMB 4TSCL 3WFZA 4JZNB 5C0AB 3FO1A 2PF6A 2NYYD 2W38A 1OPGH 1X44A 4BFGA 3AAZB 1UKQA 1D7FA 4G6FD 1VGEL 5FGBC 4BUHA 3RVUC 4NN5C 1RZFH 1RIVL 4RGNE 4BH8B 4NIKB 1OAYH 3VXUA 4ZYKA 5AUMB 3MCKA 3S3JA 1T22B 2A6KA 4I0PB 4EQ2A 2QV2A 3MRDB 4XNZC 3BH9B 3WN5C 5IFHH 1BREA 2FJHA 1UH3A 4H1LH 2A73B 4F58L 3L5XH 5KSAA 2R0ZH 4YGAB 4K7FA 5E8DL 1MQKL 3M17A 3GJFH 2FCBA 3I9GL 2FLRT 2YRZA 1A3LH 1VEMA 3VFUB 4I4WA 3SGKC 4O51A 5GRUH 1NGZA 1FNSL 2BDNH 5B22A 3G6JF 2DQGL 3HAEB 1KCSL 1I8MA 3D9AL 4WEMB 2PXYB 3O45B 3W5NA 4P2QB 4PG2A 3VA2C 3MLYL 5FDWB 1OGTB 2NX5B 2ZG1A 1H3PH 4DZBA 1IQDB 1ZA6A 4F2MA 5K9JL 4HCRH 3HZVB 4TUKL 3I3BA 4NKDA 4RGNC 2YBRA 4NN7B 3INUH 4M9OA 1X3DA 4LGPB 5KW9H 3QUYA 1TZIA 4HZAA 1N6QL 3OF6A 1JE6A 1FLRH 3LPWA 3QFJE 4Z7VF 4U1KB 1ZANL 3EYUL 1KEGL 2MQCA 3DRQB 4P9MH 1RFDH 4QO1A 2AXFA 4U33A 1GAFH 4GS7C 5ICYA 3DIFB 4RAVA 2DAVA 4LLAA 3CXHK 2FH8A 2IPTH 4QHKJ 4I3GA 2J2ZA 4OZFH 1EHAA 5JOEA 3GSOB 3KXFA 3KPQA 5DD5H 1IM3A 1KEML 3HLAB 4JFEB 3FO1B 4HW6A 3AS0A 3RU8H 4OLXL 43C9A 4CMHB 1JTOA 3PNWA 4UOW0 3GKWL 3ILQD 2CLRB 3VRLF 4PJ5D 1VPOL 3FHAA 3EOAB 5E2WH 4RFNC 3KPRB 4QRUB 5F1KC 5I1KL 1QBLL 1OWRM 3HI6H 3EGSB 4GAYA 4JPVH 2WUCL 1T0PB 1C08A 1XF4A 1YEDA 3ZDXE 3QXDB 3ZKXC 4LRNH 2IFGA 1P7QA 5DEFB 4WV1A 1GIGH 4LVHC 3PHSA 1NL0H 3I3EA 5F88B 3EIFA 4WTXA 3TFKD 1J1PH 1T89C 2UY7A 4HPYL 1MLCA 3M45A 4YHIB 3NGBB 5B39B 1S7QA 4KQ4H 4D0CB 1H3WM 5L88H 3MO1B 1V7MH 2VDPL 3PWPD 2DQEH 3RWFA 2JF1A 1F11B 1MHHB 1Q9LA 1QFOA 1S7VA 2R1WB 3TH2T 1U3ZA 3AS1A 4GQPH 2B5IB 2VN4A 4XVJH 5TDPB 3GMNA 3TJEH 2YK1L 4MAUH 1LVEA 4DUXA 4CAGA 5LJYH 4ZFZA 1AGFB 3CAFA 1MPAH 1J05A 1UGNA 3BH8B 43CAB 1G0XA 1U3HA 1H8NA 1RURL 2ZPKH 4D0BB 5IV2A 3VU2A 5D6CB 2B4CC 1CFQB 4Y4HD 4KUCF 4PJAF 2CPCA 1RU9L 4IBLT 2B8OT 5DO2C 2Z8SA 1T7VA 4NUGL 2Z35B 2MMXA 3VI3E 4ERSL 1B0RA 2DBLL 3U79A 1GC1C 2V9RA 5T3ZD 5IHBA 3DI3B 4X6BB 1CXKA 1LEGB 5E2TL 3MLVH 2WW8A 5EOTB 3CFIC 4JDVB 2VRAA 4U7SA 4RIRB 3DWTA 1FYTB 4WFFD 3RNQA 3IJYB 1MCOL 1P2CB 1TJGH 3K74B 2X2YA 1BQUA 2FX7L 3QEHB 5C09E 5TDNA 4MZ3A 3TO4A 2D7TL 1T0NB 1MHPL 2XKNB 2P5WE 3BKJL 3UYPA 2ADGB 3QXVA 3BZFA 2BSED 5HY9A 2VZ1A 1BQHA 1H5BC 3CC5B 3NZ8B 5D5MA 5GZND 3RGVB 4I3RH 2VQ1A 5I8EB 2DLFH 3O6FA 1JPSH 4PBXA 5EBGA 4KVCL 5DC0A 2XQYG 3FFDB 3SGJA 3EO9L 4YEFA 3L9RB 1NEUA 3BGMB 4MJIE 2C26A 1MFDH 1NCTA 4G8FB 5CBAA 4X7DC 1MY7A 3SPVA 4OD3L 4DKFH 1QFUH 4G5ZH 2EYRB 4YZFF 4XCNB 4JFFE 4XVUC 3V9FA 3VG0H 5DJZB 2H2PD 5CJQL 5IF0B 2B4CL 4Z7WE 5GGUB 3WLBA 4M1GL 1R0AH 1IC1A 5C8JB 2IBZX 1LEIB 3SDXB 4X4YB 3DMMA 3L6FB 1AXSA 2VABA 1WGOA 2EDOA 5FKAA 3WNKA 3J7HA 4HWZA 5HYQA 1HSBA 1K85A 1QHPA 3RTQA 1XF3B 4D8PA 4YE4L 3OJDA 3SKUD 5IESL 1XH3B 4NKDB 4U3CA 3T3PF 3EYVB 1NLBL 5EZLA 3DHMA 4YHLL 1LNUB 2Z91A 2WIIB 1CDGA 3P9MB 2VDRL 3RZCB 2ERJB 3NOIA 4G6KL 4M7JH 4HXAL 3GUTB 2Y06L 4JB9H 2YR3A 1BQSA 4KZEL 5JLZB 3RQ3A 1DBJH 4LNRA 4UV4L 3RPIB 1WFOA 3O4OB 4I2XB 3FCTB 4I3RL 5ESVB 3OKDA 4X6DA 2JIXB 3QR2A 4LLQA 4HS6B 3UO1H 1JPSL 3IXAA 3CDFA 5DJYA 1RUPL 3U7YH 1CICA 1MH5B 5F96H 4H0GA 2CR3A 5H2BA 3P4OA 4M3KB 5F7LB 5GS0D 5IEKA 3BIKB 2RAMA 4P3DB 4KK5D 1VGKB 1R3JB 5E95B 3WIHA 3CFEA 1G7MA 3EO0A 3TEUA 4GMTL 2BJMH 3V4VL 4CADA 4N8VG 2BVYA 4U6YB 5TQ2L 3O3EA 1FZKB 1K4CB 3HC3H 4KHXH 4U1IB 1NJ9A 5EU5A 3H0TA 1BZ7B 4QY8B 1DQLH 2QADB 4ZDHA 5K9QI 3UCRA 4NQVA 4XP5L 3V6OE 4XVSH 4OZHE 1TJHH 4P2RA 3T1WA 2RCSH 4L4VE 5AYUL 1IQDA 4JFFD 3QUKB 3RA7H 4CVWA 5JZ7D 5LCVL 3FTGB 2NXYC 5JTWA 2DDQH 4MB3A 3WXVL 3KJ6L 4HGWB 3MR9B 4LPXA 4LSUH 4EIGB 4NQCE 4ZSOB 5FYLL 5TJWK 5GRXG 5GHWL 3L3DA 5AWNH 4UQ2B 4OZIE 1WFNA 5LKNA 2D7MA 3LEYH 2A9ML 4MA8H 4X9IA 3MOBL 3S4SB 2BXZA 1EHLL 2FJGA 3NFNB 2DS4A 4HHAA 3BJLA 2OJZH 4UDTA 4ZUSA 4TSBH 4I0PC 4LCYA 1I3GL 5CMAA 2P4AB 1MVUA 1P69B 4XNQB 5EU6A 3HE7C 1KIUA 3IFPA 3MRQB 4IRSB 3RGHA 2YUZA 3G5YA 3AUVA 2H2SD 1KB5L 5D9SA 1IGTB 2VLRA 3PWPE 3STBA 1YDPB 3FT2B 4RISL 1NGQH 3NABH 3GKZA 5AYQA 4X6EB 2JIXA 1NEZG 3CFCL 3O8XD 5DK2B 1H3TA 4I9WD 2BOBA 1C16A 3CFBB 5F6HI 3EDDA 2AJYH 1FYTA 4WI3A 2NNAB 3TVMD 3PUCA 2ZUTA 2D2OA 3QUXA 2E7BA 3ZSTA 1P4IL 4TNVF 4XVSL 1CDJA 4H20L 3TF7C 3HS0B 3SN6N 4HUVA 3JTSA 2RCSL 1BEYH 2IBZY 1RUAL 2PW1B 1XGRA 1QSFE 2XTJE 3X13B 1NUGA 2MHAB 1U0QA 2ITDB 4QYOA 2AV1B 4E5XA 3D9AH 1BZ7A 4QY8A 5FUOH 5SWQA 4YZFE 3TO4C 4EKXA 2NY6D 3NN8B 3SDYH 5ECJE 4PB9H 3L7FA 3C60D 5DQDH 3L3JA 3DMMD 4IRJB 5IVXE 3C5JB 3VD3A 4F15B 3QULB 1FL3B 4JZOB 4F7TA 3F5WA 1RZGA 1QBBA 3AXLB 4NDMB 1X4XA 4XBEL 3MPCA 1FZMA 5AG8A 1KEGH 1EHLH 5EOQL 1OHQA 4GG6B 3O6FC 4YAQA 5IB2A 1BJ1J 1CLYH 3F12B 4HGWA 4P46D 3ECBA 5ENWB 4PGCB 5L6YL 4P9HH 3AVEA 4M8QA 2P42B 4NNPH 5BVPL 1J0JA 5IF0A 1N0XL 1MFAH 4Y2OA 4JRYE 1A6UH 2ZSWB 3LCYA 2Y07L 4QRRB 5FUCE 1AHWA 1CXFA 1I7ZA 1FCCA 1I1YB 4Z9KB 3QUML 1MVFA 4NZUH 2OP4H 5ISZA 3ZTNH 3D3VE 3K1KC 3GKWH 3TA3B 3U9UA 2YD2A 2APXA 3HUJF 1AXTH 5C7XL 1KLFA 2HJFA 2YD4A 3EO1A 3GGWB 4HUKB 4LVOB 4FG6D 5EPMB 3ZL4L 1W72A 5KVEH 3IRZA 1A7RL 5FGCB 4OT1L 5DSCA 3QUYD 2AK4A 4JVUA 1IE5A 4TVPL 3OF6D 2MPAL 5L7XH 4J4PA 1N7MH 4F7EB 1KIQB 3D0VB 2D7OA 1N6UA 5DDHA 1YN7A 2R15A 4LRNL 4N0YH 4KDTA 3BZFB 1DN2A 3T4AB 2N7BA 1UWEL 5BQ7B 2Y7QB 3QDHA 2P5EE 4ZFFA 2UYLA 5E4EB 2CQVA 2O93L 4O4YL 4JQXA 5T3ZH 3OKDB 3EAKA 4RBPK 1BD2B 3U1SL 2PR4H 5E99L 4GRWF 4WCYH 5C0CE 5EH1A 2BNRE 3ELAT 1MRFH 2Z8WC 4NQTA 1CCZA 1CDYA 2A6IA 3GSVB 4KKCC 3RUGA 2V5SA 2NY5L 4TVPD 5FO8A 3M17B 1BVKB 5F9JA 3MRMA 1S3KH 2GTWB 4NBXB 4U1LA 1UYWL 1SYVB 5BVPH 3TVMB 5IROA 1MJ7H 1NGYB 3LEXA 4LDOB 4ZXBD 1T2JA 4H1LG 5D2NE 3T0AA 1RZ8B 1BQLL 3HZMA 3ZDXF 1FLTX 2EYRA 1YEHH 2EXWC 5HVHC 5T1DH 1RZKC 3ZO0A 1F4AA 4NNYB 2JKXA 2R4RH 2GTZA 4ZOEA 1VFBB 3VXSB 4S1RH 3WFEH 3GJEA 4TUJB 4MQXD 4X80H 3HUJB 3NPSC 4XHJC 4BFBD 2X4RA 4NRZB 4ZS6C 3GI8H 3LDBC 4Z78B 3PV6B 4WGVB 3P73A 1DCLA 3TBYA 3DVGB 4G43B 5DK0A 1HK6A 1PLGH 2YRLA 5ICYB 1F3DH 4PJ9A 5GGTA 3TH3T 4PD4K 1RJLB 4PRHB 1QLFB 1XH3A 2HKHH 3VGAC 4FOMA 3GSXB 4HKZA 4HEME 4LSTL 3KPRE 1QR1A 3SKNA 3GI9H 1XCTB 4YHPB 4M7LT 3QAZC 5E99H 4JM4L 3ARDC 4PV8B 3UDWC 2PETA 1MCHA 5E00B 4HG4K 4MJ4A 4K9EL 4OV6F 3O2VL 2YC1B 2UZYB 3MLZL 2F5BL 3FCTA 4Z5RA 2VLMD 5ESVA 3RKDD 1I9EA 4OZFG 1B3JA 1QFUL 1OGAB 3LN9A 4YXKL 4GAGL 2AJVH 2GSIA 2BSSB 3HC4H 3D1MC 3QXDA 4E41E 1CLOL 2FX8H 1R3LB 5DMIL 5D7SL 3L7EB 2DQJL 1FNHA 4HDIA 4HMDA 5ERWA 1A0QH 3BUTA 3C5ZD 3D85D 1SYVA 3PABB 2IALB 4JRXE 1K6QL 1WBZA 4WVRA 5BV7C 3QNYA 1IAIM 3HMWH 1QHOA 5FB8A 4IS6A 4LKXA 4BH7A 4CVXB 2ZCLH 2ATPB 1IGYB 2E5EA 2A6DB 4PJIA 1U8PB 4APQD 4ZSOA 3QIWA 1IILE 5GZOD 3PJSB 3QCVH 3MNVA 3OMZA 4HJ0C 2FHBA 2C4FT 4XBPA 3ZTJG 1BOGB 4QGTA 4D0DB 1VFBA 3CVIH 1OAKL 4EEEA 5AG9A 3GBNH 4RQQA 1Z9SA 1CFNA 4JZJA 3V5DB 5LQBL 5ENWA 1RV6X 1QSVA 4Y16C 3WN5B 1QKZH 4Y4FC 1FYTE 5DK0B 4DGIH 3M1BA 3JWOH 1QA9B 4P9ML 5CS7A 3UO1L 3CSGA 5CEYA 4KKCD 4YHMH 5LGHH 3R0NA 4NBYB 4K9EH 4L4VD 1ZA3A 3BT2H 2ITCA 5JORB 1ACYL 3ZDZE 5E4IA 5EU4A 5EU7C 4PJXA 4L9DA 5IW6A 1CL7H 4CNIB 1X9QA 2BCKA 1FGVL 3TJEL 3HE6C 1DVFA 2D7QA 3QPXH 2DKSA 5KS9B 3FQNA 3KPOA 2A6KB 2V7NA 4I0PA 4OZGF 4KK9C 3U0TB 4E42A 4NJAH 4M93C 5I66A 3G6DL 1TDQA 4XCYB 1K6QH 2QADD 5GS3A 3EDFA 3RWHA 1EXUA 1HQ4B 2NNAA 4R7DB 1J12A 3U6RB 1TETL 1U2HA 4R26H 3D25A 2WWMC 5DJCA 1MJ8H 1B6UA 3ZTJH 1Q0YH 3L3HB 4WHTA 5GGSY 4NBZB 4MXQD 1DBBH 3SGKA 3KYKL 3I6LD 3V6FB 1PG7L 1N5YH 4MNQE 2X1PA 4JQXC 4HS3A 5HTSA 2HYMA 2IPKA 3S88H 3SDXE 3A6CH 1EGJA 4XP9L 1UQSB 2VXUH 3LQAC 3GO1H 4I18C 5I75B 1ACZA 2JLLA 2H26A 5C2BH 4KVNL 4F9LC 1T03H 4AG4H 4P3CH 2NMSA 5JUEH 1UZ8A 1QRKA 4KAQL 2P5WD 5SX4H 1E4XH 4U1MB 3KYNB 4K9EC 7FABL 1D3CA 5IBLC 2H32A 5HGHB 2X42A 4JFFA 2W59A 2WWKT 1FG9C 4GBXC 1JZ7A 1V05A 2PYEB 4Y4KA 1GCFA 3LB6D 4OAWA 2ZUWA 4XGZA 3CH1A 4PJBB 2FATL 2I9LB 3FO9B 4YPGB 1I9JL 3KS0J 5DJ8B 1JI2A 3U0PB 1NBVH 2W0FB 4OSUL 4Z95H 1JHLL 1ITCA 4ZOBA 5TGBA 3G5ZB 5GSRA 5ITFA 4ODHH 4KI5C 4EQ3A 3AB0C 3HI5L 5C0BA 5EWIL 3B6SB 4GKSB 4R26L 2PCPA 2GJ6D 4H1LB 4FQCL 4K3JL 1UEMA 5CWSA 4KI1A 1DQQB 2BFVH 4HIHA 5TE7L 5E7BA 3BN9D 2OMBA 2YN3A 1MFBH 3IFOB 4NQXB 1H8OA 1PG7X 4G9FE 3FHQA 5K59F 1QLRA 4KY1H 1CN4A 3DYPA 4BM7A 5TFSL 1FBIH 1FNAA 1NFIA 5J1AB 3DLQR 2Y7QA 5IESH 2AV7B 5BJTB 4QHLB 3O8XA 4HIIA 1KTLA 3JVGA 1IZKA 4ELME 1JGVL 5D72L 5JW4N 3TVMA 4FXKB 5CGYD 1AI1L 2DLFL 2W9DH 2Y5TA 3QEQD 2R0WL 2VJXA 5C0RL 3STZA 6FABH 3K8LA 3T0EA 5KSAB 3L3IB 1O0VA 3DSFH 1G9MC 1R5WA 3QWRD 3B9VA 1KXVC 4OFKA 3RAJL 2HVKA 3GEWB 3CCHB 3SO3C 3GSVA 1MAJA 1QNZH 4QRTB 1VGEH 4JFDE 4PJ8D 3LEVH 3RWEB 3WSQL 4ZUTB 1FIGL 4ZFZB 2X4TA 5GIRA 43CAA 5FOJA 3KYNA 5DJ0A 4HGKC 3C60A 3OKKB 3MV7E 2AKRB 4TSAL 3FO0H 3ZZ1A 2VL5B 1BM3L 3V0WL 3N1FC 5FYKU 4L4VA 3O81A 4ZPTB 2CK2A 4X6FA 1T1WA 4HH9A 3NZHH 1CGVA 2JJTC 4R0LA 1MNUH 3QIWC 5CINL 5INCA 4RAHA 4YE4H 5F9OH 1JF5A 5M94B 5EIVA 3ZKNC 3K81A 1RZIB 4RWYL 3FMGH 2G5BA 4LLVB 3IU3A 5IBTH 4JM2A 4XHQA 1YN6B 2FEDD 1IJ9A 1OQOA 1HI6A 2EIZA 2K7QA 4CVZA 4FABH 4IRSA 1JWUA 4DEPC 1IL1A 1H15B 5D1QA 2CXGA 2XWJA 1INQB 5JQHC 3P9LA 3WHXB 2VLJE 4GW4A 5DZNA 5IMOB 2CLZB 1IMHC 1JGEB 4YDKH 3ARGD 1H3PL 3MODH 4JN2B 5HGGS 4XX1E 1V7NH 2OS7A 5CEZL 3QJFB 4G6AC 4MNGE 2VZUA 1OP5K 3EFDH 3BPOC 3BPNB 4GO6B 3PNWB 2V9QA 3KPMB 2BP3A 1N3NB 3QUXB 1YEGH 2HH0L 3MOBH 1LHZA 4HIIB 4U6VH 1JV5B 4NQSA 4NRYB 3TNNB 4KH2A 4E41D 1BJMA 3ROLB 4KJPC 1GAFL 5FK9B 3CFKA 1X7QA 3VXRB 2R0ZL 4NO5A 4Z76B 1ZXQA 4LSSL 3REVB 1KSRA 4OKVA 3QDGA 3K4AA 4TSAH 1GHFL 3NN8A 4QOKB 4RISH 5BO1H 1A22B 2GAZB 1MRDL 4M48H 4BQCA 1AGEA 1W72H 1TITA 1JPTH 3DX9A 1L0QA 2X70B 3IDMB 1TJHL 2AAVA 4EDXA 5E08L 3VXSD 1SY6H 1ZLUH 1GGYA 3PABA 5F7UA 3EYOB 1KC5L 2CKBB 5IG7A 1UADC 4L4JA 2PTTB 5IBTL 5T5NG 5I6XC 2BSTA 2DDQL 5FKAB 5IBUB 1I8MB 4LVNC 1T1WB 5DA0B 3TO2A 1WZKA 1QYGL 3D2UB 2CDEA 1FL6A 4ZXBA 3MRRB 1RK0A 1HXMB 1IKNC 1CVRA 3KXFB 4B5EA 5FUOL 4S1QH 4U1MA 5H35B 5C0BD 5E9DB 3L5HA 5HYJB 1TLKA 3WL9A 4F80A 4Q58C 4L29B 5ILTH 2VKXA 4JRYA 2DQEL 2IBBA 1QD0A 2WMPA 4PJXF 7CGTA 4BZ1H 1RD6A 5B8CC 1FZOB 4NT6B 2AVGA 3MROB 5CCKH 2YD6A 3CXDL 3QI9B 4O9HH 4S2SB 2QSCL 3WJJC 3CUPA 1G9MH 3GBLA 4R4BB 4LSSH 2AP2A 2AK4E 4BYHA 1J0IA 3MBXL 1MFAL 3NIFF 4V1DD 2AXGA 1SBBA 1AR1D 1F3RB 4PGBA 5BO1L 2H8PB 3U83A 1DQMH 4NYLA 1PX3A 4PGEA 4BFEA 2IAMD 3R06A 4OCXL 5GS2D 4WWKB 1R5VB 5DMJB 1IGIL 4GKZB 4KGJA 3BPCB 1FH5H 4ZTOH 3G08A 2ICWI 1BD2D 4FQQB 5I1CH 5CP3H 2VXQL 1KFAH 3KPPB 3DX6B 3O3UN 5IB1A 3U4BL 1BBDL 4NKOA 3MLWH 2PN5A 2WBKA 4XMKH 1AJ7H 1J1XL 2YZ8A 5K9KA 2O5ZH 3LS4L 4PRBA 3D39A 3TIEB 5HHMB 3QJHB 4W6WB 4GG8B 3MRCA 4IOIB 1EMTL 5CD3A 5E0QA 4XBEH 3FOMA 4DGIL 1EFXA 2NW2A 4LQ1A 3C6SA 5IHUL 2PXYA 4Q9RH 3FRUB 2NLJA 3UBXB 4UU9A 4EOWL 1VDGA 3CXHJ 3V5HB 1N59A 3MRGB 5D7LB 5HHMD 5HJ3B 4BZ1L 4IMKC 4I48B 3BPLB 4APQA 1DZBA 4K94L 2OSLB 1XGQA 1OVZA 5TH2B 3PV7A 4DUWA 4O2CA 5D71L 4N0UE 1OLZA 2HFTA 5T5FH 3ARGA 3TBWB 2CXKA 5J6HA 1S3KL 1WV7T 3GSNL 2B1AH 2DJUA 1P84K 4UNVA 2JB5H 1KG0B 2PNDA 4HLZG 4AENB 4DVBB 5HD8D 2NZ9C 1ZVYA 2Y6SD 3LH2H 4JJHA 4Z8FH 3KYMB 5EFIB 1LNUA 3DV4A 2EEDA 4DAGL 4S11A 3BQUD 4P4KC 1WWWX 3LQAH 2GUOA 1UWGH 2VIRB 1JHTB 3B5TA 5HHQB 4P99A 2D7PA 3W0WE 3BXNB 3CFJA 4QCIB 5E8EB 3KPRA 1NFDF 4P5KB 1F02I 1XGRB 5DVOA 4PYGA 1DVFD 1ZWIB 5IHZB 4OIAA 4HXBH 3G6AA 3HTLX 4JFYB 3RJDA 3GSRB 4I0PD 3N85H 5I1DA 4RGOL 2Z93B 4EUPB 4W4OC 1NC4A 2HKHL 2R23A 1P4LA 1PKQB 1TQCC 3SJVA 5FOBB 1TVBB 3HG1B 5GGVY 2BC4B 4HF5L 1LO2H 4P4KB 4Y5VC 4FXLA 3FQUA 2WP3T 4G5ZL 3MRCB 4IOIA 4G7VL 3T8XA 2ARJA 4XVTL 5CD3B 1MFCH 4PRAA 1NMCB 3LRGA 1J9CT 1B6DA 3RL1A 4QLRA 2FATH 4HLZH 3QO1A 3C5SA 5BW7C 1PJ9A 2YPVL 3MLZH 2BHYA 5AAWA 4DFIA 4YHZL 4ETQB 4MX7A 4PJIE 2FRGP 1YN6A 4HWEL 4WI5A 4EN3D 4ZNCD 3BKML 5ADPH 4PG9B 1IGMH 1YPZB 4JFEE 2F8VA 1X6NA 32C2B 3QG7H 3HC3L 4WENB 5EC2B 1E4KC 5A2LH 5HDLA 1EVTC 1KG0A 4HKJB 4X6FB 4HH9B 5JHLH 2I07B 2VDRH 4L4TE 4XZUB 4E9LA 4Z7VA 2AEQH 4GRWH 2K1MA 1LEGA 3BD5A 4V1DA 5J7CC 1KIQA 4M7JL 3QH3A 1UVQB 2WBJA 3P9WB 5DDHB 4Y1AE 2Z91B 1NKRA 5A1AA 4D94A 5MENA 4OZIF 1CGUA 5MEPA 1DBJL 4PJGF 5I74C 4BQ6A 3CVHB 3EDEA 1OM3H 3HMXL 3ARVA 4LCWD 2Y36L 3B3IA 4LPWA 2D0GA 2XWJB 3KLHC 5DRNB 2DI8A 1U8KB 25C8H 2XKNA 2A9MH 4MA8L 5DJ6B 5EBMA 1KYOK 1FE8L 4MQXC 4K2UH 5D7KD 3KPSA 5DJ2A 1TQBC 4XNYH 2HT4C 4AM0B 1OP5H 2V2WA 2YA1A 4RCAA 2Y4SA 5I76B 5I8OH 2HKFH 4U7MA 4JY5L 4P5TB 2CD0A 4JEGB 1G7QB 1MCPH 2DL9A 4LPYA 1NGZB 4J3UA 4YXLH 3ZE0F 4NKIL 1ETZA 4HS8L 1AR1C 2CKBA 1S9YB 2Z31A 1JYWA 3IDGA 3L95B 1OQXA 5FECB 5ADPL 3STLA 5DURD 3BIBX 5FGBA 4M7LH 5LCVH 5DVKA 1BFVH 4YC2B 1M05A 5SWZD 5IOPB 5DEGB 3LZFL 4NQED 3VA6A 4H20H 1NAMB 4XPAL 1ZLUK 4UIMA 3HUJA 1OAKH 1CD8A 3VMNA 4DKEL 2H45A 4WRLA 2EDXA 3SDCA 3GJFB 3FOLB 5A43C 2P7TB 2BOCB 4MXWH 3H9SA 5FA4B 2PYEA 3IU4H 5CHNB 3UTTA 3QQ9D 4OF6A 3RDTA 4MLSA 1A1NA 2BY3A 4X4ZA 4X7EC 4DQOL 4Q6YA 5JO5B 5HYFA 1A7QH 4X6BA 1C16B 3CFBA 3T3PE 1T1YA 1KT2B 5EO9A 5FUCC 5ACMA 1YYML 3O4LD 3HN3A 4M5ZL 3D18A 5FO7B 2GT9A 5EOQH 2X4PA 3BKCL 3RNQB 1T03L 2Q3ZA 5D6DA 5EN2A 3E8UH 3SGDH 5JMOC 1W72B 2NY2B 4JQVA 1R3HB 1YEFH 4LSPH 2QQLL 4XMPL 3LKOA 3CSYA 3WUWB 2MHAA 3TLRA 5JXAL 1N0XH 5EU6E 5LBSH 3U4EB 1KCUL 3H3PL 4WFHE 3UAJD 2NPLX 1EH9A 1DEDA 3OKMB 5I1EH 2VXSL 1P4IH 2RFXB 4BSVB 5E7FA 5HYSB 3PWPA 4NZUL 1U58A 2VDLH 3FZUC 3PL6B 1QZ1A 3S37H 5LGKA 5DURB 2NYYC 3X17A 2P24B 2Q6WA 1IAKA 3WIIL 3FT4A 1DBAL 3O3DB 5IB3A 1E28B 1NCBL 2DYPB 1PKOA 5HXMA 3MGOB 1JHLH 3P30L 1J5OH 2NQCA 1LO5B 4ODHL 1JBJA 3MJ8A 1PG7H 3O3BB 3MOQA 1RZKL 5FYJL 4JN1H 5BS0B 4PRIE 5E8PA 1JTPA 2X4QA 2P8LA 4W68A 1D5XB 5CGYC 2M26A 3T0EE 5E24E 2IEPA 3VRIB 3TBTA 3V4PH 2VQUA 3ZKXB 4EDWH 3WFCL 1DEEA 1G6RL 5CCKL 3BMWA 4NQDE 2VDOH 1AI1H 4R0LB 1INEH 1AGCA 2MNUA 5IJVA 2Y25A 1HILA 1CFTA 4ONFH 3W0WA 4I2XE 5JW5B 2CIIB 8FABA 3CZFA 3BFOA 1LP9E 1YQVH 1H3UA 3JWOC 3QP3A 4O2CB 3O2WL 4P2OC 3RI5K 2DIAA 4ODVL 2NXZB 3IRPX 4TVPH 3HZYA 3SBWA 1A21A 5B8CA 4OCXH 4H8WH 1N7ML 3DXAA 1MQKH 5T1DL 5J13B 3O6FD 5DK2A 1CK0L 5CD5D 1A6WH 3HE7D 2HFGL 1J11A 1YUHA 3WD5L 4XX1G 5I18H 5I9QB 3OHXA 4RNRB 3VWJD 1MOEA 5D5MB 5JXEC 3RUGB 5BXFA 2DQGH 5FYJH 4YNYA 1X5IA 2J8HA 2YD9A 2DD8L 3MLXL 1F90H 2IAMB 4MVBC 1CD1A 3TN0B 5D96C 5C6WH 4NO5B 2F53E 2O5YH 1N6QH 2AJUH 5F72S 2UV3A 2VLKB 4I0KA 4N8CH 2C1PB 3CZJA 5I19L 2OJEA 4RMSA 4U2YA 4O51B 1OAQH 5L8LB 3RVUD 3H9SD 2P46B 3IVKA 3HR6A 2LU4A 1I9IH 4V1DE 3Q6GH 2HH0H 3L95A 1N5AA 3V7MA 4R4FL 4GBXA 1RVFH 3EYFA 3RVXD 1AR2A 2DTSA 1I8IA 4Z8FL 5DQ9B 5FEBA 5JOPD 3CH1B 4PJBA 2ZSVA 2E8ZA 1CFTB 5I1GH 1I1YA 3BQUB 3P0GB 4Y5YC 2D9QB 2OK0H 1TNNA 5DMYA 3RI5F 3O0RL 2X1OA 3EKCA 3GJFA 1I8LC 1J0KA 3CX5J 5I18L 1REIA 5E08H 2R39A 1J8HD 2AK4B 1WFUA 2VLRB 4MQ7A 3CDCA 5DUBA 3U2SA 1IC4H 4TQEH 3IXAB 3GSOA 1NL0L 3GHBL 2EE2A 4PRPA 2GCYB 3KPQB 5GGTH 1YN7B 5EU4B 2NR6C 3ILPB 1WC7A 4RGND 1DANU 2J88H 1RI8A 1R3JA 1NFDA 1BQHB 3TZVA 3QQ3A 3HR5B 4O2FA 3CC5A 3NZ8A 4ZFGH 2CLRA 2B7DT 5ERWB 1B4RA 3P4NB 3CSYB 1T4KA 5B38A 3ULUC 3LQZB 1T5WA 3OAYH 3EZ8A 1YJDH 5ILTL 2X9YA 1OAUL 3DPBA 1S9XA 3D2UD 1X5AA 3G08B 4FQQA 3VE0B 2EZ0D 4AM0A 4LHUA 3VXME 3QUKA 4XCNA 1UCBH 5ELIA 3PWVA 3OAZH 1HYSD 4GS7B 3VH8G 1NCAL 1G7QA 4ZUTA 1N4XH 3B9KD 1G1YA 3WXWH 3WBDA 4I9WE 3WLBB 4YHIA 1BX2A 2DBLH 1AH1A 2EECA 5DJ0B 1HINL 4BELD 1PBYA 3VMOA 2PW2A 2X1XR 2ZCHL 4FFVD 2OK0L 1A7PL 4NUJA 1QFPA 1T04A 4XP1L 4Y5XC 3LKQA 1MY5A 1Q9KA 2JK5B 4S1SH 3S4SA 4U0QB 3ARPA 4NZTH 1YPZF 4XC3L 4DGVH 4ZFOL 2Z31C 5BZWB 1BFOB 2JJUA 4GAFB 5FO9B 2EDJA 4MA3A 3KJ4B 3NAAH 3Q0HA 2DM3A 1E4JA 4MJ2A 4J8RA 3E6FB 4OB5L 5B3JF 1CF8H 1VFUA 4UIKL 3V7AG 2KL6A 2FBJH 3NIDE 2GJJA 1MHEB 4Y4HA 3BP6A 2FHFA 4LNRB 3SDXF 2V7NB 2NY1B 5DUBB 1A1NB 4XPHL 4P2CG 1BVLB 5F1OB 3QZWG 4XI5D 1A2YB 1TIUA 4MA7H 4TULL 1Q9WA 5DR5H 2DLIA 2HKFL 3VFPB 4DTGH 4POZC 5DXWA 4OCMC 5GSVB 1P7QB 5DEFA 5D7JC 3IFLL 5J9PA 3Q1SH 1KCKA 1T22A 5C0BB 1I7TA 4H1LA 3MLUH 4L9LC 4JJ5B 3O4LB 2HRLA 4YXHL 2YPLE 4CADB 3IAPA 1T20B 2YD8A 4K3EL 5JA8B 2KQMA 5KANG 1R0AL 1MJUH 1ZT4B 5L0QB 1GJIA 1NANI 5GGSA 4AH2B 1T83C 1GGTA 1U93A 4QXTA 5ESQA 1HH6A 2F5AL 2F53D 4ORZC 3NCFB 2ICWA 3U7AA 2QSVA 4Y8DC 3O3DA 1U3HB 1Z6JT 4XNXL 5KVFH 3LAFA 5HI5C 2V5YA 4GG6A 5GRJH 4Z7OE 5INDB 3KWWB 4ODWA 1FO0L 1MLCB 4OIIH 4P2YA 4QXUH 4DVRL 4KQ3H 2A6DA 2OBGA 4PJIB 3LEXB 4PJDE 5JDSB 2E9WA 3IU4L 1XAUA 1FFNB 1AGBA 4KI5F 1M4KA 4KY1L 1YPZE 4K7PL 4HPYH 3TO2B 3PIQA 2J12B 4OV5A 4PJAA 2H6PB 3WE6A 5C1MB 4HMCA 4TRPH 2R1XB 4O02H 1NQBA 4GXVH 2HLAA 1R24B 1OPGL 1YEIH 1F3JB 4X4YA 4YBQC 5T1LA 3V52H 4L29A 1HSAB 4MJ5A 1MLBB 4PRPD 1K8DB 4NC1C 2F8OA 3AMLA 3MFFB 4YHKH 2Q8BL 5DGQA 3TP4A 3MYZA 1JGLL 3DVGA 4G43A 1SYSB 3R8BB 4TNWK 3SKOB 1AXIB 1U8QB 3QNZA 1HHKB 4HUXA 1NAKL 4ZTPH 1K9TA 1I85C 5D7IE 1YMHB 4QRPB 1NFIB 5C07A 2BCKB 1MF2L 4MSWA 1OGAE 4N9GB 2VL4A 2IG2H 1XGYL 2C3VA 1AFVL 4JREC 5E56A 1U41A 2DWEA 5KBNC 3G9VA 4OGAC 1CXIA 3B8SA 3NZHL 3O4LA 4HC1L 1TPXC 2R0KH 1KLUB 4GKOA 1CZ8L 4L8BA 4PJCE 5TFSH 4KUZL 4Z77A 3F7QA 5IW1A 1UB6A 3RBSA 1T2QH 4XNXH 4PJBF 1R5IB 4JHAL 4PB0L 2EE3A 5FO8B 5JHDB 1R3KA 5FXCH 2HLFD 2YS4A 4QRSB 3LV3B 5GHWH 1EJ6A 3BEVA 3MXWH 4DZ8A 4MJ6A 4ZNEA 2VISB 1ES0A 3QEQB 5IEHB 4UT9H 3GFUA 3QYCA 4OCLC 2BMKA 5T1KD 4KKBD 3VG9B 1LP9F 4HUUB 5IFJA 4LARL 2J5LB 4KDTC 1I1RA 4LHUB 1RMFL 3GK8H 4CDHA 3V52L 2NY4D 1INEL 3SE8L 4JFOB 5AZ2L 1KJVB 1HNGA 3O3AB 2H32H 5D7LA 1F58L 2J6EL 3VJ6B 3B2VL 4Y19B 5DFVC 4OM0L 4DKFL 1FC2D 2YMXL 5D7KE 1MCEA 1NAKH 4M6MH 3VCLA 4PRPE 2GQHA 3MNZB 3VG0L 1NEZB 5I1HH 4L3CB 3CLEL 4MJID 2EE6A 4JFDA 5JW4M 5HYQB 5GGRB 2GIYA 1T1XB 2ADIB 4AJ0A 2HLFC 2Q7NA 2DQDH 5F9AC 1IAII 3V6ZA 1RK0B 3KVQA 1JHKL 4QGYA 2JELH 2GI7A 4WJ5B 5C0AA 4HKBB 4U6HB 3FQXA 2OL3L 5DJYB 2I60H 3DURB 3HLAA 2MWCA 5KVGH 1KPRA 1G7JB 2OTWB 3BRGC 2IADA 2ID5A 1G7PB 1NCCH 4RX4D 3E2HB 4NRYA 2FHCA 1RPQA 4HIHB 4FMKA 4Q2ZA 4GW4B 3P11H 5DFVD 3LKNB 4F33A 1V5JA 1V7ML 4TYUA 5CJXC 1OWWA 3F62A 3IETA 4XRCB 3OKEA 2W0PA 1I4FA 4GAYB 1Q8MA 2GK0A 1GGUA 2YKLH 1CFSA 2RFXA 5HHPA 3SGDI 3IDIA 3V0VB 3ZKND 2VQ1B 4WV1B 2ZKHH 2E7LC 5L2KB 3SJVB 5AZ2H 1QRNA 4JGUA 2LABA 4KFZC 3R1GL 4NNPL 3I6GB 4MNGA 1HHIB 4X5WB 4AYFA 1YEJH 3MJ9L 3D0LA 3IJSA 5F7FA 1ZHLA 3FZUD 5DUPL 3O3BA 5F7WC 4P2QA 2Q87A 4UUJB 4X0KA 1ZK9A 1AXTL 5DJZA 4XBPB 2R56L 5I1GL 5F6HJ 2Q86A 4P2RB 5J3HC 4C56E 3PP4L 3OAZK 3RWGB 4MA3B 1A7RH 5K59E 3C9NB 2DMCA 5HDQL 1A6TB 2LE9A 3TPKA 3BZEB 2G9HB 4Q97A 5GS1A 2Z4QB 1ZGLP 5IG7B 4S0TD 2MSPA 3LN4B 3UJTH 4NPYA 1NMBL 3UTSE 1LO4L 3BPNC 5C07D 3RWJA 1VFOA 1R24A 1A6ZA 1MFEH 2JB6B 2EKSB 1J1XH 2WINA 2WV3A 3G6JE 4LOUD 3U30B 1UWXK 1HXYA 2YXFA 4MCYA 4UDUA 1T3FB 4XP4L 2XNAB 4I3SL 4Q9QL 1XCQA 1CDUA 3LKPB 1P7QD 1DR9A 1S7SB 5KOMC 2YHGA 3A67H 4HX1A 3FT2A 3WNMA 4MCZA 1S9VA 4YDLB 4OLYL 1OAUH 5E1AA 4CJ1A 3ARSA 2FEEI 3PHQA 3C08L 4JVWA 3IS0X 4LSRH 1ZSDA 1KN2H 3QXAA 5SWQB 4LF3A 4HFWB 2NY1D 2VDOL 3F7VA 5K9OA 1KCVH 1BGXH 4U1NB 4K7FB 2B1HH 4WFGD 5T1KA 5J9PB 3QSKB 3S37L 3CFJB 5E8EA 5K9KB 2VLKE 1B4JL 3BDYL 3CFKB 1A64A 1EZVY 3PQYA 2VKWA 3NIGF 4GLRI 5INDA 4QRRE 1I8KB 4Q74A 1KB9J 2VXQH 3BWAA 2RQ8A 4MAYA 3GNML 3TZVD 4OKVB 2ITDA 3U4BH 4G8IA 4GJTB 4N8PA 2BVQA 1OOAA 5JW3L 1A1OA 1RUAH 1S78C 2HA1A 3NCYP 4ONGH 3SE4A 2EDYA 2F54B 4MJIA 1IARB 4WEUD 1FL3A 2R29H 3S3PA 1QPPA 5DHYA 3KLHD 5DK3A 2H32B 3IB4A 1S7RA 4JKKA 4KZEH 2VL5A 4LSTH 5C0FB 3SDCB 3DX8A 1YECL 4LCCB 1MAKA 4KMTH 2VDKL 3B83A 2CMRL 3EYFB 5KVDH 5BV7L 1LE5B 4M43H 5I8KH 4MA7L 1IQWH 3TC9A 2NXZC 2D03L 5TF0A 4ALAL 1ITBB 1A6PA 1WJ3A 1BD2E 3DROA 3G5ZA 3CGTA 5ISZB 2VOTA 3V8CA 2FGWL 1F4HA 3THMH 5C0CB 1F4XH 3TYGH 2HT3D 5EBWA 3WYRA 2R2EA 2X7LA 5JPMA 2ZOLA 4XNUL 4F57H 2BJML 5IMMB 3H8NA 4PLNC 2CH8A 4LLYA 3RPIA 2ATKA 4JAMA 2PO6B 2IH1A 2E9BA 1I9IL 4WJ5A 5C7XH 1A9EB 2DQIL 3GB7A 5I8CA 4G80B 4M9PA 5J1AA 4C83B 2AABH 4Y2DD 4P48A 4HWEH 3HPJB 5GRVK 3CVHA 5E6ID 1R3KB 1A4JA 1ULVA 3HR5A 5HVWA 3PP3K 4PJHB 4FFYL 3LMJH 4MJ6B 1XGPA 3BXNA 1DL7H 1T4KB 3LKRB 1HOCA 3OPZL 4M6OL 5B38B 3ARTA 4OFYA 4L8BB 5IW1B 1UB6B 2R8SH 2ARJQ 1NFDE 1ORSA 4WUUD 4OZGB 4P57B 2HRPL 3A6OA 3KPPA 4J3OC 1UZ6F 3DARA 5JIIA 1U3YA 3NCBB 2AXHA 4V2CB 5I16B 4PTTA 4U1GC 5CJBA 1MIMH 1Z5LB 1U2CA 5FA3A 2X4QB 3VDAA 1ZMYA 4J7RA 2EXYD 5FOBA 4OBSA 3RIFK 3T2OA 1ES0B 4N90E 2WWKO 4FRWA 1L0YA 4M02A 1W0YT 1JYVA 4QRQA 3Q5OA 5C0AE 1U8PA 1M71B 5CKAA 5HYJE 1F8TL 3ULVL 5CAYB 3CDGB 4IRSD 4RAVB 1YA5A 4P0DA 1JMZA 3CFCH 4LLWA 4XXDB 1HHHB 4R4NC 1JZ3A 3PF2A 5FO9A 1JF1B 3NBNA 1H5BB 1F13A 3SKNB 1T66D 5CMAB 1EEZB 1IL1B 1F4YH 4MA1B 3WIHH 3BX7C 1EERB 1QTYT 4L3CA 4JKPL 1JF6A 3EOAA 5D96B 4U1SA 3V7AE 3WXWL 2OR9L 2SEBB 5AD0B 4CN4A 4ZQKB 2N56A 3IAGC 5GZNC 3ARYA 3DV4B 4NFBA 1ED3B 4LAQH 5IT2L 1IC4L 4JHAH 1A7PH 4JFEA 4U6HA 4MXQC 4XP1H 2QEJA 2AS5M 2YPLB 3P4LA 4XWGH 1QQDB 3D18B 3KPMA 4NQCD 1PLGL 2V2WB 1IEBB 1KPUA 2ZG2A 3LKPA 1DN0B 2CJUL 3SO5A 3WS3B 5F88A 25C8L 1NUNB 3AREB 4P2RD 4P2QE 3ULSB 3KPOB 5E00A 1J8HB 3C09B 4UV4H 4R8WL 2XRAL 5FHBH 4LARH 4LKCB 3D48R 3O4OC 3OL2A 5MP6H 4KROC 1NJ9B 4JQVC 5EU5B 3VD9A 4EI5A 1U95B 1KIPB 2E27H 2KBGA 2APTA 1DBML 2GAZA 2VE6B 3IDNB 3MNWA 5T1KB 5HI3D 4YFLI 3KYOB 3UAJC 3MZGB 4MDJB 1XIWC 2NY6B 4UV7H 2M2DA 3RZCC 1ZLWH 5DD3L 2DN7A 1UCBL 2XZZA 4WO4A 1A6TA 2ICEA 2HJKA 3KPSE 3ILQC 3NA4A 1S7TB 5MI0C 3U4AA 1DBKH 1NCUA 2YA2A 1LEIA 1QLEH 5LBSL 4X6CF 1EEQA 4P23A 2NLJB 4UINH 3T0EC 1IGCH 1FVEB 1B0WA 3ALXA 5CP7A 3VXQA 4DOHB 1RJZA 3IDUA 3BE1H 1JGUH 4LCWB 3IDYC 1GRWA 1ZAGA 4LRIC 4YPJA 3HI5H 4MX7B 2XTLA 3X3FL 4K3JH 2DQFB 4M93B 2XQBH 1MI5E 2BRRH 2L4OA 3C2SA 2P5WA 3FB5A 3RP1A 4AZ8A 2C1OA 1MFBL 3U9UB 3AC0A 4NRXB 1U8JA 3PWNB 5BVJB 4XWGL 4M00A 3QI9C 2AW2A 3S34H 3QUXD 5ACLA 3QNXB 4IMLA 5AZEH 1MREH 3ZYOA 3AROA 1P5UA 1EUUA 4KPHL 4WV1C 3WKNA 5MI0B 4KQ3L 2FJFB 4OZ4B 2GCYA 4WCYL 1ZSDB 3CZFB 2ADGA 4JPWH 3QPQD 4RMRA 1EVUA 1MCRA 5EDXA 1JGDA 3E8UL 2RHEA 4MNQB 4RMVA 1I3GH 1UWXH 4FQXC 4RFEB 4K7PH 5J0BA 4N5UA 4OCYL 4OGXH 3W9EB 1XGUB 3WS3A 3O41A 4U2ZA 3BT2L 4H88H 5KSVB 2YC1A 4IRSC 1SVCP 3MRFA 1K3ZA 1FVCA 2APBA 1TVDA 1YJDC 5DJ6A 4P5KA 4ZXBC 1RQ5A 4FQ1H 3SPVB 4HBCL 1CT8B 3VXPA 4U1IA 4R9HA 1CTOA 4LLDA 4MGXA 1U3HC 5D1ZC 1TMCB 3UPCA 4WW1B 1T66C 1X5LA 1F6AB 1TVHA 4JZOA 3C2AL 3M8OH 5I8EA 2BX5A 4ODVH 5KSBE 2F5AH 2GTWA 4WFED 3ZE2E 4EDXB 4QKXB 2BC4A 4P4KA 3GI8L 2BNRA 1ZLVH 4OQTL 1Z3GL 2VABB 5LXGL 3MRJB 4PGCA 1UCTA 2HFGH 3MOAL 3OAUH 5F7YC 3IJHA 4L9LB 1U8IB 4ZNEE 4YPGA 4APQB 1N5YL 4M7KH 1I75A 4XCEB 2X4TB 5GIRB 1BWMA 3MYJA 2Q76B 4J4PD 1NDMA 3ARFB 3Q3GA 5D2NA 2VXUL 1ZGLB 5LVEA 3FQWA 4U1KA 3VDCA 2P5WB 4L4VB 3EO1B 3I6LE 3IKCA 5AAMA 1HHHA 3SY0A 2AJUL 5JMRA 5B4MD 5CKGA 3K80A 4MYWB 4OGYH 3QA3B 3RZCD 2FB4H 1HKLL 1XIWD 2XKUA 5JHDD 1BECA 1G7LB 4JRXD 1CLZL 3ABZA 3NMEA 1V3KA 3K46A 3ULVC 5JR1L 1KCVL 3H9YA 1KJ2L 4IRJC 3V8OA 4CVZB 1CGXA 1JVKA 4UZGA 5EN2B 2PKDA 4FQHA 4HK0B 3TFKC 4NJ9H 3F7YA 4K8RH 4X7FC 4C4KT 5E1HB 2J6EH 4H8WC 5J3HD 1KLGB 4ZPVA 5J56B 1CK0H 5FM5M 4I2XA 2J7LA 4PGEB 3MRBB 3LPFA 1JWSA 2XZQL 2ZUQB 5L2KE 1DQQA 1WAAA 3GSNB 3BW9A 3LN5A 2FSEA 5JW3H 4KUZH 5IB4B 5I9QC 1X6LA 4C58B 4U7KA 5EIIA 1D5MA 4J12A 1YY9C 4XC1L 2H41A 3F7PC 2OZ4H 3IYLW 2UUDH 4PJ5B 4XAKE 2AK1L 5I17A 4TNVK 4JHWL 4WFFE 1OLLA 3REWB 4PRDA 4R3SB 3UPRB 1AP2A 2FGZA 1KIPA 5D8JH 4E41A 4KMTL 5SX5K 1QKZL 2C7UA 4MHHI 1EFXB 2HJLA 5DEZA 4Q9CA 3L3IA 1L7IL 3RIAK 4LNVA 4WI9A 2XTJB 3T0BA 4WUUB 1DDHA 1RUKL 3RWIB 3B2VH 3EYUH 3MXVL 4LK4A 5DRWA 1HYSC 4U3XA 2XG4A 3MV8D 3V79C 4KJPD 1Q94B 4M6ML 2DQUH 2HJFB 3C8HA 3DGGA 2ZOKA 1K5NB 1Q1JL 3AU1A 2R9HD 4NJAL 1QLFA 5F89A 3U7WH 3VWKC 4WY7H 2CLZA 4XH2A 1MCJA 1BM3H 3V0WH 4PGDB 3L3KA 1H5BA 1G9NL 1GGCH 4FQLL 5EU6B 5GSRB 1NCNA 1OB1A 3BEWB 4YUEH 3HZYB 3QQ3B 4ZTOL 5I1CL 5E2WL 4BQ9A 4XC1H 3SGJC 1DBBL 1S7SA 1FV1A 5F1NB 5EZOL 1CE6B 1A9BB 5I15H 1GPOH 3RWDB 5FK9A 5HI3C 1XFPA 2YWZA 3X14A 3D85A 4PP1D 3ZHKA 2J88L 5IB4A 4XMLH 5C08B 4PJGA 4GUPA 3GIZH 3MZTA 4P4KD 3GSRA 5D8JL 4R2GC 4EVNB 4G7YL 4NOBA 4ZUVB 4PBVC 3QIWD 4J3VA 4JGJA 4NQCB 4ZSOE 2E3VA 4QXGH 5IHUH 1RZGB 1LO0H 4K23H 4POZD 2GW5A 1HHGB 2IALA 5DUMH 4JANB 2ZKHL 1LEKA 3RVWC 1FFRA 1D9KB 4Z7WF 7FABH 1T20A 1CI5A 2HTKC 4LPUA 4I3SH 4Q9QH 2C7UB 4JO2H 4Y89A 1VCAA 4W6XB 2HVKB 3VGAB 3RL1B 1XR8A 5IB1B 3HFMH 2ORBL 4F2MB 4N90D 2X4OB 3UTTD 1Q1JH 3HZVA 4QRRA 1KIRB 3WCYA 2K7PA 4WUUA 2VNCA 1ZLWK 3UC0H 3LS5L 4LMQE 2VR5A 4PFEA 3RWCB 2ZCHH 5CSBA 2J8UE 1F42A 1XGTA 3N50A 3C8DA 3F12A 2ED7A 1XIWA 1EIBA 2ZCLL 1WEJH 1KNOA 1KCLA 4FQLH 1K4DB 3TV3L 1IC5L 2DF3A 1CIUA 3VI4E 4GRLB 3ZT5A 4D3CH 5LGJB 1ZHKA 1WZ1H 4PRHA 1AKJB 4R96B 1KJ3H 3VXNA 2A9NH 5I15L 1Z9LA 2EYTB 5EOCH 4LCIH 2IBGA 4MMZC 3K1DA 4LLMA 1NGPL 5EA0H 1NANH 1DVFB 1H15A 1QYGH 5TGBB 4DVRH 5ISZD 4GRLD 4OI7A 1EGJH 3DI2B 3RUGE 2WLYA 4OLWL 1F6LL 1TFHA 2IANB 4U05A 5IIEA 4PTUB 1MCNA 3IXTA 4PJGB 3TIDB 1ACYH 1KN2L 3PWJB 4P59H 3U6RA 4MNQA 4X4XA 3RTQC 4XVTH 5SWSA 2P24A 3OG6B 4JDTH 2VDNH 3ZKMD 2DJSA 1Q72L 3MCG1 1E6JH 2NY4C 4F7TB 1DBKL 1N64L 1PW3A 4FQPA 2H8PA 1AY1L 2EICA 3FN0L 3PWUB 5DTFA 1ZT1B 3MO1A 1J1OH 3S7GA 3H0TB 3NIFE 3VFVA 1AHWC 4J6RH 4N0UB 1CBVH 3BKYL 5L8JB 3KDMA 4FNLH 1EPFA 4Z7UA 2BVEA 1S9WB 1DJSA 1FAIL 3ME0A 3QDJA 1RJYB 4UT7H 4FA8A 1TVHB 4OLZH 2NX5A 4DZBB 4PJHF 4EI5D 4XCEA 2XN9A 3IVKB 1ZKAA 4X6CA 1OT2A 1U8LB 4X9FA 2BMKB 3QUYB 4Z7NE 3KWWA 4URTB 4QRQB 2IGFH 5CLTA 3V6BR 4TPRL 3UTZB 2GKIA 5L0QC 1FVDA 5E03A 3W5MA 4FFYH 3MFGB 4JFOA 3H9SB 3BP5A 2F19H 3V4UL 3BGFB 2GJZA 4HIJA 1ADQL 2ENSA 4R90L 4KRLB 1HXMA 2BSRA 3VW3L 5GQBA 2K3TA 4JG1H 5CEZH 3ULUE 4QXWA 3MV8E 1VEPA 1AE6L 2C4FU 4Q9RL 4BUGA 1LDSA 3QQ4A 1NCDL 4GXUN 3T4AA 4AQOA 4RWHA 4Y88A 4HAFA 4EN3A 1MIML 3VWJA 3SKJL 3RY5A 5GGRA 4NCDA 5CJOL 1RIVH 5C71A 4H0HB 1CGTA 1RJLA 4K8RC 1JUFB 1WUNT 3SY0B 5ALCL 2O5XH 4PJFE 5IMOA 4DW2H 2QKIB 1X5KA 5T5FL 5KJRH 4IRZH 3GMLA 5JOFB 5DWUH 3VH8A 4LSVH 3QXAB 1GHFH 1A6AB 3EGSA 1QQDA 3T0ED 4JREB 2ARWA 3RL2B 1O5DT 4RGMC 5MEND 5L9DH 2F74A 2C3VB 5AUMA 2JJTA 4KI5D 4D9QD 3LV3A 3JTSB 1XZ0A 5IB5B 2LFGA 4V2BA 4GOSA 4UT7L 4WWKA 1ONQB 15C8H 1KXQE 4FQCH 4BFIB 3ROLA 3SE9H 4QRRD 4Q0XH 1NAMH 1EZVX 4X98A 1M1SA 1T7YA 3N0PB 1CFSB 5C86A 2NY2D 4WU5A 2B5IC 2I60L 5I76A 3G5XA 4P2OD 2DMKA 1DQTA 3PGCA 3N1GC 1S5IH 3JV4A 4S10A 3HA0A 1M7DA 1U6AH 4X8XA 3UZQA 4C56D 5F6IB 1AQDA 4JE4B 3QT2A 1AC6A 4NC2B 4HKXA 1YMMD 3MBED 2GHWB 3QDGE 3N85L 5SWZE 3V95A 5JDSA 4OD2A 5C0IB 3BRDA 1U8MB 4YFDB 5KVMC 4PJEE 3KS0H 2CJUH 1Q94A 3HAEA 1KTKE 1NGWB 4HV8A 3T2NL 3TBVB 3PGFL 4G8GE 4LCUB 3MLTA 5KTEL 2FB4L 1L9NA 3BI9X 1RJZB 2ZSWA 2NZIA 4D0DA 1RZIA 3MRRA 4RBPH 1UXSA 2CIIA 8FABB 2XTJC 4UIMB 4BZYA 43C9B 1KB5H 4OFVA 5HYIA 1XIWB 2NY6C 4RIRA 5JXAH 3DNKA 4KHXL 3V5KA 3GRWA 1YEJL 3MJ9H 2BOCA 2VLJD 1F4YL 2GSGB 4MXVE 3B3IB 1C5CL 2IFFH 3ULUH 1ZVSA 1GGIH 2OR9H 5KSAC 3VXNB 4Y19D 2FZ3A 1OW0A 5CINH 4L3AA 4QWWD 4JRXB 2WZPD 1WBXA 2VDQL 3D25B 2AEQL 3LRSA 4XMKL 5B39G 4K7PX 5J12B 1IEAA 5KSVA 1OCWL 1XF5B 4I4WB 2Z8VC 5IHZA 4UBDC 3UBXG 2F58H 4LDEB 4HWBL 1BF2A 3DOSA 4XNZB 5L2JA 2VC2L 3OSKA 5E2VH 5ESQB 2EH8L 5FYJD 1VFAB 4U6VL 3GIVA 5D2LB 6CGTA 2YK1H 2HMID 4NFDA 1CLYL 1MUJA 1GZPB 2FECL 3B43A 3S98A 1OGAD 1S9YA 2Z31B 3GMRA 4LSRL 1ZT7A 1SHMA 1N26A 4YQXL 1MRCL 2PYFA 2VZVA 1YQVL 2FL5B 3LH2L 1PSKL 3C5SB 1LO3L 2NY0C 4ZS7H 1TXKA 3LPGA 1EK3A 1MEXH 3JWNC 1QRNE 3O3AA 2IMNA 4YDJB 5TF1H 4I13B 4LLWB 4UINL 4ZOAA 2Q86B 1WWAX 1F2QA 4YFLF 5I73C 2LU7A 1UM5H 4P9HC 5MEQA 3UBXI 3Q5YA 1TTFA 1P2CA 1C1EH 3KLSA 2XQBL 3WD5H 3EFFB 4QRPE 4NN5B 2BZDA 4N1EA 3BZ4A 4OF8A 4M1CC 5DQDL 4O5LH 4KQ4L 3WO3B 2EIDA 2WQRA 1G7HB 1UWEH 4Z0BH 2FYYA 3DO7A 2JJVA 5CZXC 3UTSA 4Y5YA 5GGQH 1PVHA 2J4WL 3A67L 4O2FB 3PXHA 1QFWI 3WNPA 4GKNB 4YWGH 3TO4B 3RFZC 1CFBA 4JO2L 1MFCL 3MCLL 4OFPA 1DLHB 2EH7H 3HRZA 1RZFL 4WI4A 4JKLA 3QUMH 4NUGH 4BK5A 2EDFA 3PWJA 5ID1A 3NCJH 4X4XB 3QUMA 2Z93A 1UH4A 5L2KA 2OR8A 4RZCB 1MEXL 3OV6A 2OYPA 4EJ1C 5HHXL 4OCRH 3T3ME 1MCOH 4Y19E 2CKNA 4JM2F 1JNJA 3CMOL 4FTVE 3T8XB 1IT9L 4WWKC 3TT1L 1ZT7B 2AJXH 2FL5A 4N0UA 5F93C 3S96B 2CRMA 2D7TH 4PD4J 4ISVB 3ORJA 1C5BL 3KYAA 3UTQA 3VXOA 5D7JA 5BS0A 1FNSH 3P2TA 1KJVA 1KB9K 1AQDB 3P0VL 1IAIH 2VLJA 3IU3B 2F54A 3VFNB 5H35A 2MCG1 4U0RC 5EUKB 1OD7A 2Y1VA 3VFTA 1BBJB 1BLNB 1VENA 3A6BL 3IJYA 5KANI 5DRZB 4ZPTA 1VA9A 1I1AA 4G8EB 5IQ9A 5B8CB 1MHEA 4Y4HB 4ALAH 1T83A 4X6DB 1JNHA 9CGTA 1T1XA 2ADIA 5C9KA 5KS9F 4JN2A 3QJFA 5F9DC 4RRPG 2D0FA 4K2UL 1SM3H 3RZWA 3VXMD 4UDUB 3FQXB 4UI2A 4M6AA 3WO4B 1G6RH 3LHPL 4WW2F 1CLZH 3DROB 3DX7A 5C6TH 4NHUA 5D71H 1YJDL 3O2VH 2YXMA 2XFXB 4RSVA 4TNWF 2A6JB 4B7LA 4PY8I 2QR0B 3K7UA 5E9DE 5DVMA 1S9VB 1KEMH 2FZ3B 3ARFC 1A3RH 4HS6A 3SJVE 5A16B 5I0ZA 1CLOH 2JCCA 4FNLL 4XRCA 4OCRL 4H5SA 1R5WB 4KC3B 3QRFM 4HIEB 3DX6A 1NLBH 2C1PA 3LZFH 5J8OA 3UTOA 3HHRB 4YFEA 4DWHA 5DMGC 5TE4H 3F5WB 1FZJA 4NDMA 2R2HB 4TVPE 2Y06H 4JB9L 2HP4A 4LEOB 4TPRH 4PJCF 2I9TB 1YEEL 2EDTA 4G8IB 4R4ND 4QOKD 4X83A 1OD9A 2VE6A 4NQUA 4XTRD 4GQ9H 4OZGA 4ZDHB 3TBVA 5J89A 5EZOH 4HWZB 4JM2C 1RHHB 4R90H 1J1PL 5EO0A 3P0YL 5T3XL 3BMVA 3TN0C 2VSCA 4RGOH 3AM8A 1FSKC 4PJAB 1TPXB 4JCLA 4JLRA 4UDTB 2X44D 4ZUSB 3NCEB 5FCSH 4CJ0A 3TBTB 3WL9B 2G5BB 1ZS8A 4QTHA 5C0AD 4WW2C 1KGCD 2OJZL 2DLHA 3QEGH 4CN6A 4QHNB 3PV6A 5IVXB 3KPNB 4NM4H 4QXGL 4P23B 1JWUB 3HNSL 1G0DA 4OAWB 3HC4L 1RJCA 4QF1A 1A6VL 2O5XL 5E6IB 4DW2L 2E7LA 5DJXB 1JWMA 1I3VA 4LCWA 1QUNA 3IFLH 2Y9RT 3VRLE 4YHZH 4GFTB 3OJ2C 3NABL 2LV4A 4HEPG 4LP5A 4R4FH 3E6FA 3RIAF 1HE7A 1HXYB 2J1KA 1G9NH 5BVJA 3ZDYF 3HPLB 1RIUH 5GJTL 1DBAH 1JHTA 4YUEL 5EC1A 5SX4I 4QOKE 3SE3A 3VXMB 1SVZA 3MUHL 1G7IA 3IGAA 1R3HA 5DC4B 4JO4L 2SEBA 2WK2A 3BH9A 4OCWL 4JRYD 3EYQD 4QYOB 3WXVH 1BOYA 4NGHL 3WFBH 2CIKB 1KPVA 3QI9A 4GRWB 2VAJA 1J0YA 1RZKH 3NPSB 1P53A 2HT3C 2CUMA 2O61A 3HPJA 5DD1H 5GRJL 4XAWH 4L8DA 1MCDA 1NPUA 3MLRL 4BJLA 5SWSB 4F9PA 3O8XB 1CGWA 3GIZL 5HGAB 4GQ9L 3BIAX 4AIOA 4ZAKD 3SDYL 1GZQA 5IM7B 3MRFB 5HDBF 2R9HC 3QG6B 3GMOB 5GGVH 2AQ1A 5TE6L 1QVOB 1B9ZA 3CJJA 3V4PL 5EA0L 1EBAA 1OAXH 4GKZA 4EIZC 3KAAA 2P5EB 3HE6B 1RZ7H 4N5ED 4GSDH 2P8PA 2F54D 2HJLB 5GISH 1NGQL 4YBLB 1RZ8A 1FRGH 3L7FB 5ABDE 4Z7UB 5JUEL 4QRTA 2A1WL 3MRPB 3K2UH 4HSQA 5FA3B 1PZUB 4KMLB 3IDJB 4OCYH 3AS2A 3H9SE 3QPXL 4OCNC 1FFPA 3VJ6A 1MFDL 5GRZA 3NFNA 5TQ0H 1QLEL 3MV8B 2G5RA 5HPOA 3I75A 3HB3D 3CDGA 5FYLE 5E5MB 5GRYA 1JGUL 2CUHA 1QA9A 4ETYA 4JPKH 4M8QB 3CIQA 2XN9E 5DJXA 4KTDL 4W6YB 1MJ8L 1WFTA 1E6OH 3JSSA 1M6OA 4OSUH 2DQTH 3UYRH 4Z7QE 1LK3L 5J12C 1TZHB 1AHWB 1SJEA 4H26A 5EUKA 4OLUL 1UVQA 1Q9WB 4J6RL 4HC1H 3RKDC 4GLRH 5CEXB 1MCSA 1CBVL 1C7SA 4NM8L 4KWUA 2DWDA 1CQKA 5I1JH 3OQ3B 5I30L 5GS0L 2EEAA 3Q6FB 3SDDC 2CK0L 3R0MA 3GO1L 3QWQB 4RMQA 1F90L 3EOBB 3W2DH 3MOAH 3OAUL 1MCFA 4I77L 3TN0D 1EGJL 3MBEC 4ODUA 1RUMH 1ZWIA 3VGBA 1JZ5A 1NC2A 3BP7A 1Z0NA 2NTSP 3QDMB 3GBML 5K9OB 1WT5A 2PR4L 3G5VB 4OI8A 5H2BB 5FM4A 2FEEL 3O6LH 1C8PA 1FFQA 5I19H 4XPHH 2GFBA 1PKQA 2Y07H 3VW3H 1DUYB 3MUGB 1OAQL 1A4KB 1QEWA 4ELKA 2VDNL 4YBQD 4PJHA 5C0GA 4R97C 3ROOB 5IJKC 5DR5L 3MUJA 5J6GB 2OLDA 2ARJB 3Q6GL 2HN7A 4DGYH 3UTPD 5IFHL 1D5MB 4RFNB 1X5FA 4POUB 4AY0A 4DKDC 1I7UA 4KXZH 2VYRE 4HIEA 3X12B 1NC4B 5L7XL 1FGNL 4I8DA 4MJIB 4JO1L 4WO4B 1J88A 1U8HA 3WIFA 1PAMA 4R3SA 3O0RH 5KSBF 12E8H 5EORL 1S7UB 4Y16B 3H3KA 4NO0A 2X5PA 4ORGA 1BMGA 1PEWA 3BWUC 3MA9H 5B3JE 5CEZD 3GGWA 3S96A 5J1TC 1I8IB 4IHOA 2JIXD 5AEAA 1J8KA 4Z0BL 4XXDA 4XB8A 4PJEA 4HHAB 2X89D 1MRFL 3QHZL 1MWAL 1BQHG 3JTTA 5FYLH 5EO9B 5C07B 4KJWD 3ARZA 5EBWB 1FNFA 5EO1B 1NCDH 1A3QA 1UYWH 1KTDA 3OB0H 2X4NA 5E6IA 4OGYL 3L5IA 4O02L 4F37F 5JHDE 5JQ6L 1FDLH 5GS2H 4JFDD 3PDOB 4O00A 3MRBA 2FJFA 2Z0BA 4OD1H 1T0MB 2V17H 3IFOA 2EDBA 2KZWA 4ZAKA 1FORL 3C6LB 4K8RL 4WEBL 3MLPA 4WDIB 3F7VB 4OFIA 5CILH 2R0LL 4XCFL 4CUCA 4KRPD 4YR6B 1GOGA 3DUSB 1IKNA 5HHXH 1XGPB 3RY6A 1P4LB 4HBQA 2VLLB 4OM1L 4OZHB 1O7SA 2DQJH 4Z6AT 3MRDA 5ETUA 2X4UB 1KPVB 4C54A 4KRPB 2IWGA 3X13A 4YDIL 4L5FH 2D0HA 3LVEA 1NBQA 3H7BB 1MRDH 2JJSA 4M48L 4P5TD 4Q0XL 5DHVH 5HPMA 2R1YB 4S1SL 1C5CH 4ZUVA 4R7NB 4AMKL 1A7NH 1JPFB 3T04D 4KK6D 4HWUA 1IAIL 1KF9B 1X5YA 2GEEA 3K0WA 3NAAL 3NTCH 3GM8A 4IDJH 1DDHB 1QRNB 2D4DA 4JPIB 4ODBD 4QRSA 4NWTH 3GI9L 1P9MC 4LCWE 3SQOH 3ARGC 1EJOL 2AKRA 2DI7A 1HEZB 3TGXA 2KH2B 2C3HA 5F7KC 3L3OB 3UTZA 3MMEB 4LDLB 1MI5B 5DJDB 4K07A 5L88L 3UBXA 3BD4A 4G8GD 5EO0B 4IIQA 1F4WH 3P4MA 1FQ9C 4GAGH 5JORA 3WFDL 3SE4C 4OZFA 3D6GA 1I7RA 5MENB 3PWLA 2Z4QA 4JFED 4GMSL 4FMFA 4NQEA 3UMTA 3ZSSA 5D7JD 1BJ1H 3FONB 2I27N 3LD8B 1F58H 2C3GA 2DIJA 4I1NB 3UJIH 1PX4A 3FQNB 4KKLC 3RDTB 5DYOB 4YXHH 2ZUVA 5T33H 3QO0B 2D3VA 3DVNA 1YMME 2IH1B 4LLQB 4KTEH 4F7EA 3VGGA 4KHTH 2X4SB 4PR5A 4QRPA 4BSVA 1MRCH 5DLML 4WW2B 1PSKH 3FB7A 4JFZH 5IWLA 3DURA 5C09D 2AJZB 5GJSL 1JTTA 1WBYA 5DQJA 3WJLC 1GPOL 1QFHA 3L7EA 5IR1A 4BZ2L 1A7NL 3SDAC 1IM9B 1TETH 3VXMA 1AO7E 2OM5A 4PRIA 4P2RE 1A14L 2FX7H 4ENEC 3BP4A 3LDBB 1IFHH 3MV11 1KFAL 4UILH 3KYKH 3L1OL 4JFYA 2A0LC 1I4FB 4NWUL 3T0VA 1UM6H 4KJWC 2F58L 3CDYA 4HCRL 1LO0L 4YHML 4FHBD 4EVNA 3QUMB 5DJCB 2HFEA 3MV9B 3RGVD 3A6CL 2BNUA 4XP9H 1XF2A 2BY2A 5BV7H 3BH8A 4DZ8B 5MERA 5CIPH 3J8F7 1OSPH 5T5NF 2V2TB 3KG5A 3FFCB 4ODWB 5IJKA 2DQCL 4ELMB 2X89A 3I02B 2IJ0C 4O9HL 4PG2C 4XXCC 2VO5A 5DS8A 4YH6A 1S9WA 1P4BH 1WAAF 5T3XE 3Q2CA 5BRZE 5HVGB 5IKCA 2E6JA 4GG6E 3K8KA 1T7ZA 3V2AR 1CQYA 3CX2A 4NO3A 4RFOL 5J4MA 2NY0B 5J1SC 2XKSA 1SMOA 4S0SD 1IGIH 4LL9A 3WEXA 1U8JB 3PWNA 4PGJA 4YC2C 1PZ5A 3G5YB 5C0FA 3VI4F 4LCCA 2HVJA 1OTSD 1Q0XL 2YD3A 1FP5A 5ACZB 1WZ1L 5I1KH 3CFDA 1MAMH 2I07A 1YQ2A 2IQAA 3MV7B 1T0NA 4A6YH 4CMMB 1ZHKB 5DD1L 3UJTL 2E6QA 4LASH 4X9BA 3BYYA 1CXEA 5FGCE 2HAZA 3W0WD 3B9EA 4PV8A 1AD9B 1DUYA 2QHRL 1M7IA 2NZ9D 2A6JA 3B6SA 3DUHA 4GKSA 5IHLB 3T1FB 4U0RB 3QIUD 2NY7H 2X09A 4PRIB 2ZUUA 2QQNL 3PQYB 3BGMA 2EIEA 4TTDC 2AV1A 3AY4A 4XP4H 4P59L 4E5XB 1JPGA 5GGRY 3T0EB 4Y4FD 3C6LA 4LVNB 5E5UB 1EAJA 4YO0B 3VXUE 5FCUH 1WITA 1KCRH 4WW1A 1BJ8A 3QIBB 2EH7L 1OF2A 1RUPH 4AIZA 4HFWA 1RULL 2BNQB 3GMQA 4HF5H 3SQBA 3KNBA 3JUYA 3L5WA 2Z92A 5KZCD 1X4ZA 1WT5C 4GRLC 2DKMA 4PJ7F 5JA9A 3H7BA 5IQ7L 5ADOH 2BNQD 1E0OB 5TQ2H 4KTDH 5ISZE 4ERSH 4WIQA 5DWUL 4ODSL 3FO0L 2WUBL 1B90A 2FBOJ 3MNVB 4JR9L 1A0QL 3V5HA 3U48A 1FFOA 5DRXA 1D9KD 3T4YA 4JKPH 3H42L 4U6XA 4L8SA 3SCMD 3MJ7B 5DMGD 3SBWC 1MNUL 2KKQA 3RZCA 1EEYB 4U3HA 2XWBB 4CW1B 5DD0L 1S7UA 1N5AB 3LN4A 3VCLB 4X99A 3SE9L 5IP4A 4G6JL 3MNZA 2IAND 5JHLL 3NA9H 3AU1B 1HSBB 4EXPX 3P4MB 3RWJB 3BP5B 4QEGA 2GY7B 1A1MA 3S35X 2ESVA 1UJ3B 4MNHA 5F9WB 1UXSB 1IM3B 1F2XK 4JM2B 1B2WL 4F7MA 5EOCJ 3OKOA 3SKJH 1S5HB 5CIPA 5MP6L 4UOW1 1Q38A 4ZFFB 3PL6C 4ZPVB 4OF7A 5JLZA 3KXFE 3OGCB 3OB0K 2E8YA 4MQ7B 4QCIA 1RK1B 4H25B 4PGBB 3R1GH 5J06A 4OZHA 2DMBA 1JWSB 2UZIL 5HGBB 1W0WB 3BGAA 4OD3H 2R2BB 3HE7B 3THML 1WBXB 2QKIA 4NM4L 1HZHL 1BFTA 3N1QC 1R3IH 3X3GH 3OBAA 2AJYL 3RX5A 3U0WL 5HHVL 3BIKA 4HLJA 3GMQB 1IM9A 4NQCA 3S3SA 3K8MA 3EDKA 4HT1H 4YR6A 5IWLC 1BAFH 1UB5B 2COQA 3KLAA 3EHBC 1KACB 2IFFL 3F7RA 4LBEB 4BFIA 3MA9L 4Z76A 1ND0B 4U6TA 4UB0L 3REVA 5IMKA 3KPTA 4ZFOA 4DCQA 4M61B 3IJHB 4HC1A 3D2UA 2DBJA 1UXWB 1KN4L 3KR3L 1IVLA 4XPAH 5DHVB 3UZVB 4C59B 2MCPL 2EDDA 2ZSVB 3EOTL 2VDML 3UJJH 3FQRA 2JJSC 1MVUB 3T0WA 3T2NH 4TSCH 3IAQA 1XGQB 3VXTA 1HSAA 2QLVB 4MJ5B 1X5XA 4J2XA 1EAPB 4QWWC 4P3CL 1BIIA 1JFQL 4OD1L 5IKCB 2PTUA 1CGYA 2I9LA 3FO9A 4L8CB 4IIQB 4HWNA 5BZWA 3U7YL 1H3XA 3RNKB 3QCUL 2EH8H 1AO7A 3N9GL 1T1ZB 1F8TH 3FT3A 3ULVH 4OM0H 4HS8H 1RIHL 2DYPD 4HG4J 5DMKB 3HI1A 4OZIA 1I1FB 4NNXA 3I84A 4FQ1L 4N9GA 1KPUB 5I1HL 4FQJH 1MCQA 3AGVA 1JV5A 2MTPA 1YDPA 4NQSB 5C9JA 4YDVA 2IQAB 3FRPG 1LO3H 5DYOA 1K3IA 2EXWD 1P7HL 4HX1B 1BFVL 4PYHA 4OZ4A 4PJ7E 1S9KC 4N0RA 3BPCA 3VH8B 4KV5F 3BHBB 2JCCB 3KPSB 5DJ2B 3ZHDA 2LQRA 3VFOA 4WNQA 4NHCL 1Z9MA 4IRJA 1DFBL 4PJ8A 3QWOB 2AEPH 3UEZA 4K8RD 2GFBB 3DHJA 2WBWB 2R29L 3MUGA 5A2FA 5JW4Q 3TVMC 4G6MH 4Y5XA 3CX5K 5DD6A 2V2XB 3JV0A 3KJ6H 4PRDB 1C12B 5FB8B 5I1JL 1GZPA 3MLSH 4M1DL 3UJJL 3STZB 3MTRA 4ODXA 3SCMA 3VFSB 1UG9A 3ULVE 2E9JA 5IFJB 1S7WB 3SDAA 5KSAD 2ED9A 5I74B 5M95B 2DRUA 3P3YA 3F65A 4WTWA 2YA0A 2BNUB 2J4WH 5I1LB 1WSST 2NY5H 4LSPL 5C0RH 4UTAL 4QHUA 4KRMB 3C60C 1CIDA 2ZUSA 3RWIA 2HJKB 5ITBL 3O6LL 2BVOB 1PZ5B 3FOMB 5D1QD 4TTGA 4CBPA 5C07E 1A47A 1WVZA 5EUOE 1T80A 5T33L 1FVDB 3LEVL 3WSQH 3HG1E 1A5FL 2CKBH 4ISVA 1XF3A 4D8PB 3CFDB 1B0GA 3QEQE 5D7JB 1BQLH 3WJJA 1A6ZB 4JFZL 3O4LE 3DO7B 4ZO7A 2EIZB 5FYKD 4MS8C 4PBWD 2DL2A 4QT5B 3MLWL 4Q6IC 4WFEE 3DVIA 3DBXA 4MNQD 2C1OB 5EC1B 3UDWA 2O5ZL 3LS4H 4JN1L 1GIGL 3EYSL 2CK0H 1EMTH 5CLWA 2BRRL 4EBQL 2W07A 5KOVC 1NGXA 5A2JH 1IM9D 2BXYA 2JCCF 1I1AC 5HI4D 3T77A 4PB9L 3QQNA 2V5MA 1NCWH 1DSFH 1FO0B 1MFEL 1SEBB 2FDBP 2I5YH 2O61B 5JHDA 5C09B 3E6HA 1MHCB 4RFEA 3IDIB 3V0VA 3DYMA 4F3FB 1IEAB 2DTML 2WLZA 4J3SA 5EB9A 3A6BH 5HDOA 4NZJA 3LQZA 2FJHB 4B0MM 3QZWA 1GGBL 2HWZH 5FYKL 4OTXL 3C08H 3QDGB 5SWZB 3WS6A 3MXVH 4FQXB 4FXGA 3O11B 1XEDA 4XHJD 2NY1C 4UUJA 4X0KB 2DIBA 1IRAY 2Z8RA 1IAOB 5H8DA 1FFOB 2EO1A 3AY4C 2R23B 1UJTA 1G84A 2YPVH 3RWGA 4P49A 1RZJL 4KROD 2NR6D 4D0BA 3NVQA 5IEHA 3FTGA 2W65B 2OI9C 4U1JA 1FN4A 1NGYA 3VFTB 2BVOA 32C2A 1U8MA 2DQHH 1IC7L 1DEEB 4PLJC 1M71A 5EZIL 4Z7WB 2A74A 1I3RA 5K33A 4OM1H 1OP3K 4HQQL 1HIMH 2NY4B 2KDGA 1D5ZB 1Z3GH 3M07A 1Y6NR 3UTQB 3SKOA 3GMMA 3DV6A 1BHGA 4QHMB 2NCMA 4K94C 2C5DC 1Y18B 2LTQB 4P4RA 1FYTD 3CPLB 2VXVL 5JNYA 3QHZH 1P1ZA 5KSUB 3MGTB 3ARBB 3OKYA 2CGRL 4ZYKB 4M8VA 4Q9BA 2D9CA 2GSGA 3ZYZA 3OXSB 3EOBA 1SM3L 4KKBC 4XZUA 4Z7VB 1BVLA 5T3XH 2V7HA 1C7TA 4M43L 5I8KL 1OSZA 1A9EA 2NTFA 4HKBA 3QHFH 3NPZB 1CGSL 5IK3B 3G6AB 2MJWA 3OKOB 1G7JA 1S5HA 3FKUS 1DUZB 5J11C 3GHEH 3LRSB 3MJ9A 5I8OL 1XR9A 5IVZB 3FT4B 5C0GB 3KLAB 4MNGB 4D9QE 3BEVB 3DRTB 4DN3L 2D31B 1KB5A 3D85B 4XPFL 4C56A 4RX4A 3UPRA 1ZHNA 2VMFA 3TPUB 4DFHA 3VXPB 4LKCA 5A16A 4L5FL 5DD5L 1ZT4A 5F7DA 2NW3B 3FFCE 4PJDF 4PP2B 4PLJD 1UM4L 3UP1A 3S36X 1QOKA 2G60L 1VERA 2N1KA 3ALPA 4L4TD 1JCKA 1LMKA 4KJQD 2P48B 4N0CC 4Y4FA 5T1MA 4TOYH 1RIUL 1D6VL 3C9NA 2BDNL 2P45B 1U42A 3BZEA 1KENH 1E4KA 1E4XI 4HPOL 4YHLH 4JZJB 3V5DA 4YHNA 3GHBH 5H94A 5F3HB 3SQOL 4PY7B 4DJMA 2R8SL 1AGBB 2P7TA 3HI6L 3QWRA 4DKEH 1K5NA 4L9LA 1TNMA 4PP1C 3QDAA 1JWMB 2X9WA 3INUL 4NN6B 5FUZL 4KPHH 1N59B 3MRGA 5I1LA 3MX0A 1UXWA 3RY4A 3BQUA 4LPTA 2JB6A 1AGCB 2OTUA 1ZANH 3MSPA 4JM4H 1F3DJ 1TENA 1VSCA 4CNIA 3WFDH 4KAQH 3TA3A 4OZIB 3I75B 3ARBA 1HCVA 3ZE1E 3TWCL 2Z35A 2F5BH 4I5BB 2CLVA 1SBSL 3VWKB 4NKIH 3RTQD 3OB8A 5F7EH 3D3VA 3GHEL 4L8CA 1G6RB 3DXAB 3DGCR 4OLXH 5GZOC 4WTZG 5HBBA 1QSED 1YY9D 2EYTA 4YBHA 1CICB 4JM2D 1AQKL 4WNQB 5TQ0L 2OTPA 4FFZH 1QSEB 3I2CH 1DN0A 4NNXB 1XCQB 4P23C 5F70A 5I1EL 1FNGB 4OCWH 3W9EA 4KMQA 1QBLH 3TNNA 1K2DB 2G60H 3RY6C 3MGOA 2QHLA 4GKNA 4O58L 1T5WB 1C12A 4P5MA 4XPTL 4NKMB 2P5EA 3HE6A 3QFJD 2BFVL 3X14B 1UWGL 4JFHE 3B2UD 2P47B 4LAQL 5IT2H 5LWYH 3OJVC 1S7WA 4JHBA 3SDAB 2ICES 1J5OL 1AD0B 5HYSA 5FECA 4JFXB 3QFJB 4OLEA 4MDJA 2RBLA 4JVPA 5B4MC 4WI8A 2VDMH 5I17B 4ELKB 1VFAA 1BVKA 3IDJA 5F9JB 1TCRA 5EUOA 1FFPB 5I30H 2H1PH 3L3HA 1NBYB 1BX2B 5KG9B 1CFQA 3MA7A 4Z0XA 1JMXA 4TSBL 3G6JB 1OAZH 4ONHA 3OG4B 2P8PB 3BKJH 4XMPH 5CP7B 3VXQB 5KSBA 3RVWD 1CXHA 2KUTA 3DSFL 5HHME 4EDWL 2CO7B 4FQ2L 5GS0C 1JIBA 4G9DB 4U49A 4ETQA 1CL7L 1LD9B 3E1F1 2IANE 1FGVH 3FB8B 5E8OA 2VAAA 3E3QC 2A2QT 4DGYL 1P6AB 3DBXB 4G9FA 5C0ND 4GXUM 3VFRA 4EXKA 4LSVL 2FLBT 2PO6D 1NCBH 1LK3H 1UA6H 3OR6A 3HZKA 2B0SL 4JCMA 1BIHA 1AC0A 1MAML 1Y18A 4NZRH 1ZLSH 4NP4H 4DN4L 2A83B 3TNMA 4A6YL 2NY3C 3QG7L 4KK8D 4ODSH 4Y4KC 4YLQT 3NIGE 2OZ4L 5GSVA 1H0DA 5M7QA 2FECI 3E6HB 1A4JB 2IADB 1VFMA 5KZCB 1ZVHA 4BH8A 1FNGA 3W82A 1A02N 3CLFL 1ZOXA 3PDOA 3RVXC 5FKPA 2DYPA 4OF3A 5CWSB 1MCLA 3FB6B 3FQTA 4JFHD 1KGCE 4P57A 2QQNH 3WFCH 2HT2C 5FFLA 4PTUA 3WFHA 1DLFL 1OM3L 5C2BL 3MODL 2IMMA 3O2DA 3B9KB 1Y6MR 5E94A 4PTTB 1A1OB 4ZD3L 2I25N 3IFNH 3OXRA 4P9HL 3QDJB 1G7MB 2XZAL 4J23A 3MUY1 3HCVA 4AEFA 1A4KA 5BS0D 1VKXB 3BAEH 3ZYIA 1VACB 1UB5A 3WIFB 4H88L 5KTEH 2BNRB 2X6MA 2YD5A 1LILA 4X6CB 1K4CA 1UJ3C 3DMMB 4IRJD 2B20A 4XWOD 1QO3A 2HT2D 3TT3H 3W39B 3BJ91 1N2RB 2V5RA 1Q72H 3W81A 4ELMA 1PKQE 4JO1H 4LIQH 5CZXD 4XXCA 3RTQB 3U7WL 4D9RD 4FTVD 3PGCB 3TA3D 4M1GH 3R8QA 5D2LF 2MFNA 4HGMA 5ICXA 3ZL4H 5KVEL 4P2OA 4N8VA 1W72L 2FX9L 1J1OL 4N5EC 3Q3GB 5D2NB 1ZGLA 3SDAD 4PJFB 3L5XL 1U9KA 4L4TB 3MRNB 1BBJA 3GUTA 4NP4L 2NY3D 4YGVA 5MEQB 3ARDD 4XWOC 5E5MA 1FJ1B 3FOLA 4U1SB 4GBXB 3I3DA 5AD0A 2X7LB 5TE7H 3QXUA 5HSFA 2DKUA 1QG3A 5JPMB