4X6DF

Cd1a ternary complex with endogenous lipids and bk6 tcr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRYFLPTQGMGAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1a
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 241
sequence length 241
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dF02
4OFPA 1MLCB 5FYJD 5I2IA 4XAKD 3D69A 1ETZA 3G5XA 3QHZL 4H25A 1OP5K 3V6OC 3FT4B 4BH8A 1E4WL 1Q9OB 4WY7H 2ICEB 5D7SL 4I3GA 4Z95L 4LDEB 3AS0A 2AJXL 5HHOA 4YC2B 1B88A 2VO5A 3N0PB 3BGFB 1XF1A 3DRTA 1HQRA 3F7QA 3OG6B 3CCHB 3TFKC 3ME0A 4P23C 4KTDL 1IGYB 1IRAY 1NCAH 1WAAA 3WFDH 1XGRB 3LEXA 4HWEL 3H0TB 5FGBC 2WIIB 2EYTA 1B0RA 5GRYA 2CMRH 3QYCA 4MA1C 5FECB 3QWQB 5CFHA 1CICB 1IGIH 3OZ9H 1S7TA 5FUCC 3HFML 5ID0B 4DEPC 2OTWB 1M6OA 1U95B 5TJWK 2C1OB 3SO5A 2NMSA 5DWUH 4D2NA 5C9JB 1I9JH 1IM9D 3NA9L 4G6FD 1DN0A 1DVFB 4KUZL 4QRRB 5HVHC 4MXVE 3V5HA 1QTYT 3RVXD 4NC2B 4U6XB 3MX0A 3TN0D 5D9SB 2KKQA 3QUYA 5J13B 4YPGA 3W5MA 4GSDL 4KDTA 2KUTA 2CD0A 2FGWL 1HHIA 1CU4H 3ARGA 1T1ZB 1AQKH 3PP4H 4FQCL 5HGBB 1H3XA 1JPGB 3A67H 5HHOE 3DYMA 2AK1L 4QXUL 2VDNH 1KELL 1T0MB 2WUBL 4BK5A 4PJXF 4XXCA 3QEQA 1Y0LA 3B9EA 5CBAA 1FFQA 2R2HA 3QJHB 1D5MA 3IXAB 2BY1A 1KB5B 1TETH 1NCBH 1DP0A 3OG4B 5C09D 3X14B 5DQDH 3QPXL 1EJ6A 2G2RB 4GKSB 2EYRB 2MHAB 3P4OA 5JZ7D 5ETUA 4Q58C 1S7VA 2UVEA 1MFCH 5E2TH 4WGVB 3ARDA 4GQ9H 2MKWA 2CKBL 1I9IH 4AH2B 1A6PA 1FZMB 5ADOL 4ZDHB 5HY9A 2OP4H 5I18H 3E1F1 3GJFB 3DUSB 3KDMB 4XNQB 5IHBA 5T3XD 3MCLH 3MR9A 3PWLB 5DD5H 2ZOKA 1PEWA 5FOJA 4NN6C 1YDPB 2BSSA 1TZIB 4WNQA 5GS1C 2DJ4A 3O3EB 1TZHB 3W81A 3WFEH 1QQDA 1TIUA 2R15A 4M48H 4Y4KB 1BBJA 1AGDB 4M61B 1LO3H 3OKEA 5E8DL 1FNFA 4JO3L 2BNQD 1Q1JH 5GGRY 3T2NH 4JJ5B 2G5RA 5E6YA 1UJTA 4L8BB 4NHCH 2PUQT 2GTZA 5ISZD 5ELIA 5CBEA 1WEJL 3QEQE 3VXUD 5I2IB 2ZG1A 1QBAA 3D69B 1ETZB 4KWUA 1N6QH 3G5XB 1RVFH 4H25B 1XGYH 3MACH 5EZIL 4BH8B 4EDXA 5IHUH 2OL3H 4X4MA 4XVSH 5T1KB 2VXUH 2E3VA 1X4YA 1YYLH 1DQJA 5HHOB 1WJ3A 5E0QA 1KEMH 2DQIH 1MCOL 3DRTB 1HQRB 4M3JA 1QFWI 4APQD 4JQVA 1TLKA 2EDFA 4NO0A 3LEXB 2XKUA 1X5AA 3B5GA 3BJ91 2EKSA 4GH7B 2R29L 2EYTB 2Y4SA 1U3YA 5DRWA 1B0RB 2JJSA 3RVXC 3ZE2F 5EO1B 3OWEA 3WIFA 2A6KB 3QG7L 3GMMA 3B9AA 4HLJA 4XPGH 4HWBH 3TN0C 1Z5LA 1NBZA 3CSPA 5JNYA 3DO7A 2LVCA 1MAJA 1S7TB 3BVNB 2FLBT 2VDQL 4LSTL 1M6OB 1DFBH 4AENA 1S7QA 3QUMA 5CJQL 1P6AB 3P9LB 1DBKL 5CJXA 2CDEB 1RZKL 1JGDA 3FMGH 1FHGA 3LY6A 5E4EC 1C12A 3BT2L 1CG9B 3FL7A 4XX1E 5I75B 5HGHA 1NGXB 3ESUF 2DBLH 2YD2A 4I0CC 2P5EE 3PP3K 5A2LH 3QUYB 1UFUA 3V0AC 3TO4D 4Z0XA 5JZ7C 2WAHA 3C9NA 1HHIB 1NCUA 1S5IH 3ARGB 1A64A 4X4ME 1EO8H 1TENA 5SWQA 4PB9H 5JOPD 3DGCR 2A0LD 3H7LA 4XTRD 1PJ9A 1OW0C 2NY5L 3KJ4C 3WLBA 4NQVA 4NZJA 5GHWH 3QEQB 1Y0LB 5CBAB 2XRAL 2Z91A 2R2HB 2GI7A 3SKNB 5C8JA 1YEGL 2VQ1A 3LHPL 3I6KA 3MLXH 3HC4L 4DUXA 3OJDA 3FQTA 5FF6A 1R0AH 2QV2A 4X9IA 4YHOL 1EEZA 3P4OB 3O3UN 3DXAD 5D7LA 2H26A 1S7VB 3QB7C 2J8OA 5I76A 4PY7A 1J1PH 1JGLL 4FFZH 4NOFA 3EDEA 3HMXA 1CE6A 4AEIH 2OK0L 3B2VL 1HDMB 4X5WA 5AWNH 4UV4L 5JDSA 3SKJH 2CRMA 3MLVH 2F8VA 3T08A 5J7CC 3X17A 4PRBA 1U8NB 1JMXA 1DBML 5C6TL 5JHLH 5E8NA 3BQUD 1OHQA 1EIBA 4KFZC 3V4VL 2JJVA 4F9LC 4WNQB 4A6YA 3OJMB 4WTZA 2NY3B 4UILL 5D72H 1CFNA 1YEJH 4Y5XA 4RMRA 3LRHA 1QQDB 5AYUH 3WFBH 4DKEH 1BBJB 4LKCB 4PP2B 4APQC 3OKEB 5FK9A 2PXYD 5DZOA 2P5EB 5ESVB 4K7PH 3ZKSD 4CUCA 2B1AL 3ZT7A 4XP9L 2YD4A 5I8CA 2GTZB 2BVOB 5CBEB 2V9TA 5E56A 2EXYD 3D9AL 2VWEC 4HC1A 4X6DA 5MENE 4YXHH 4N5ED 4YGVB 1YQVH 2F53A 4ZSOE 4G6MH 4DVBB 2JJWA 5JR1H 1GOHA 4TSCH 2GTWA 5DHVH 1UM5H 3VRJA 1FV1B 1MHEB 1LO2L 2NY2B 4OZIE 4G7YL 4AG4H 2YRZA 5DJ0B 4ZAKD 4R97C 2DLEA 4H0GA 2YD5A 4OFVA 5BRZA 4Z8FL 1V3KA 1IGIL 1HHKA 3OZ9L 2FECI 3LEVH 3L1OH 2BSED 3GMMB 2ITDB 4BSVA 1VFAA 1WBYB 2VL5A 1Z5LB 2NR6D 1UH2A 1NBZB 5JNYB 5D7JD 3DO7B 5INDA 3HB3D 4KJQD 4JFHD 2H32B 3TO4C 1ZHLA 5DWUL 5B38B 5EZJA 1I9JL 1FGVH 1FC1A 5SWSE 1S7QB 3QUMB 1SM3H 1RZ7L 1ULVA 2OBGA 4JFXB 4RDQF 3U7YL 2A0LC 1JGDB 1ZKAA 4XTRC 4OCSH 1C12B 2W60B 5ESAA 3C60B 2AJYL 5HGHB 1JP5A 1BJMA 3MCKA 2KDGA 4MD0A 1W72H 4OJFL 2ERJB 2BRRH 5EOCL 1ZWIA 3H9SA 4KUCF 5FO7A 5DD1H 4ODTH 3MJ9A 5DMIL 3OR7A 4Z0XB 4WI2A 3S4SG 2I24N 2C4XA 3C9NB 4F80A 1INEH 2F53E 4KI1A 2ICES 5DRNA 3BHBA 5I6XB 3ARYA 1EAPB 3RA7H 1CYGA 5GGVH 5AD0B 1T5XB 2G75A 3WLBB 4NKMB 4YHKL 4NQVB 2R39A 4M7ZC 5CP3H 1D9KA 2ADIB 5DQDL 4ZXBD 1YMME 5C8JB 3I6KB 5FKPB 4YLQT 5HVGB 3KYNB 4ZSOB 4WI7A 4JG0L 5FF6B 3IF1A 3OKNA 5IFHL 2Y23A 5BRZE 1EEZB 2XNAA 2LU3A 4RISH 3BQUC 4U31A 2H26B 4XP4L 2YZ8A 4DKDC 4KTYA 1ITCA 2MPAH 1KLUA 3MRNA 1I9IL 4CU7A 3W9DA 4OZIB 1C5BH 4IIQC 3G6DH 1JZ6A 4V1DD 3VG9C 4HAGA 2XQBL 2FATH 5CZVL 1CE6B 3L5XH 2P5WE 3AY4C 4ODVL 1D6VH 2PXYC 3CK0L 4YK4C 3BH9A 3O45A 2XZAL 4OM1H 3WD5H 1HH6B 1WC7B 3NACH 4NKOA 3S88L 1IVLA 3ZDXE 3IETA 5EBWA 3MYJA 1AO7E 4PRBB 1QO3A 2EXYC 2Z4QA 2GT9A 5IW3A 4KC3B 3MJ7A 1CGXA 5E8NB 1O0VA 4N5EC 5E9DD 5MERA 1GC1C 5BZWA 2F74B 4A6YB 1NCDH 3H9SE 4C56A 2H2SD 5FO8A 4XB8A 4M48L 4M6OH 4Y5XB 4WHYG 5B3JF 5HJ3A 4U1KA 3O8XA 3UJJH 1A02N 4NN7C 5FK9B 4XP1H 1UM6H 4ZAKC 3FT2A 4HK0B 3U9UA 5I8CB 4XPTL 1U2HA 1RVFL 3LVEA 3MRIA 4ZO7A 4L4JA 5EPMB 3MACL 4OCYL 3MLSL 2OL3L 3QQ4B 4Y16D 4FQLL 3WYRA 2NR6C 2F53B 3HR5B 4QTIH 1WWCA 1TQCC 2DQTH 5D1XD 2PTUA 5D7JC 1V5JA 3HB3C 4OCLC 4BYHA 1ZGLA 3OKMA 2C7UA 4KJQC 3SDDA 1T04A 5E6IA 1HKFA 4WFHE 3VRJB 3RRQA 3VWJD 4M5ZL 5FUOL 4JCMA 4M7LL 1U3HD 2Z31D 5IK3B 2FX7L 3MSPA 5I1HL 1YMMB 2C3GA 4JO4L 2O5XL 5T1LA 1R5WB 2AQ2A 4WFEE 5GRWA 2P45B 5BRZB 4I0KA 2IPUK 2IWGA 1HHKB 3ROLA 5F1OB 2YPVH 1QSFA 4Z5RA 4BSVB 2V7HB 2VL5B 1Y6KR 3GSNA 5DJAA 3SJVD 1RI8A 1MY7A 1DFBL 3WJJC 4LKXB 1RUAH 4EI6A 5EZJB 4YNYA 4MA3B 2P5WB 3ARZA 2KL6A 2ZUQB 3RTQD 3NFNA 4K3JH 3VXSA 2F8OA 2X40A 4Z0BL 3KAAA 1UB6A 3TZVB 3BFOA 1AO7B 4OQTH 2FB4H 1JNLH 3MCKB 1FO0L 3PXHA 2RFXB 4MD0B 4RGMB 4ZXBC 3VGBA 1HNGA 2R23A 1ZWIB 3H9SB 4N8VA 2VJXA 3BMVA 4L4TE 1CFBA 5KW9H 1S5IL 5EU6A 1QHPA 5ICXA 3NIGF 4XT1C 1ZVSA 2B5IB 4PB9L 1UA6H 2UY6A 2APVA 4P3CL 1G9MC 1A7QL 5TPWL 4OZGF 4NJAH 3MRHA 4Y2DB 5DRNB 3BHBB 4FQJH 1U8JA 5EO0B 3WV0A 2G75B 2DQGH 4PJHE 4O02H 3L95A 3NPZB 1WBZB 3MRGB 3V6ZB 4FZ8H 5ABDE 1KG0A 1ZHBB 5I16A 3BSZH 5FYLD 1K5NA 4Y89A 5E2JA 3IF1B 3ZYOA 3QFDB 4OLEA 3ZKMD 4R7DA 5F97E 2XNAB 1MWAL 5C0AD 1KLUB 2ZG3A 3MRNB 1SY6L 3T09A 2H2SC 3W9DB 4PJ9D 2QR0A 4LK4A 3IDNA 4LLWA 1LQSR 1B4JH 4JZNB 3REWA 3SKJL 5FGCE 1JF1B 4P9HL 3MZGB 4XI5D 2E9IA 2UVFA 3VXSE 5B39A 1GPOH 4NKOB 5JHLL 3IETB 5EBWB 2VLKD 2ADGA 3MV7D 5D5MF 1QO3B 2Z4QB 4QT5A 3GHEH 3MJ7B 3U9PH 3WHXA 1WAAF 4Y16C 1MF2L 4DN4L 4LNRA 4EI5D 3OXRB 5MERB 3ULSA 5BZWB 3AS1A 5KBNC 5D1XC 5FO8B 1GGTA 1H8NA 5EU6E 4AL8H 3PGDA 1HINH 5JPNA 4U1KB 3O8XB 3V52H 3VWJC 3MUZ1 3PXJA 4MNHA 5B21A 3M8OH 1DANU 1U3HC 2Z31C 5DA4A 4ENED 3IKKA 5KVFL 2J8UF 3FT2B 2QQKH 1N2RA 4JO2H 5FYKH 3MRIB 2A9NL 1YQVL 2R1YB 1K3ZA 5LCVH 3KS0J 1F3DH 4P46A 1FLRH 4HG4J 4TSCL 1ZGLB 5T1MB 3SDDB 1UM5L 1A9BA 1T04B 4M43H 1F11A 1CICD 5CHNA 3JUZA 4PJHB 3RZWA 5J1TC 3LKNA 5ICZA 3TPUA 3FHQA 1HZHH 2YA1A 3RTQC 4N1HB 3MOBH 5T3ZL 1ZS8A 3I50H 5HYJE 1KEGH 3CMOH 4JO1H 5T1LB 3T8XA 3LEVL 3TT1H 5LGHL 1L6XA 3ROLB 4QRRD 1DVFD 5C0IA 2ZSVA 3HI1A 4IRJA 1OSZA 1OSPH 3GSNB 5DJAB 1PX3A 4GMTL 3VXRA 1IGCL 4C83A 4RGNE 1CTNA 4JLRA 3V4PH 1S7WA 1SM3L 1IKFL 5FDWB 1EHLH 4OCSL 5FGCB 1R3JB 3GEWB 1EHAA 4N8CL 1G7HB 3NFNB 3SKOB 3VXSB 3WJLA 1ZA3A 2DQJL 1KTDA 2XZQH 1UB6B 1NFDE 4I18C 3QXDA 5DVKA 2AXGA 3AVEA 2X4OA 2R23B 3IXTA 4N8VB 2YK1H 1XCTB 4OLXH 5EU6B 3OL2A 3ZKMC 5KG9B 1XF5B 2EEDA 5LGJA 2FX8L 4PJ9C 3RZCD 1U8JB 2VN4A 4CADA 3IAGC 1N0XH 3FO9A 3HAEG 1XAUA 5DQ9A 3GKWL 1I1YA 4H8WH 3LPWA 3P4LA 3L95B 2X89D 5L9DH 2Z8WC 4XI5C 1KG0B 5I16B 1K5NB 4RISL 2W65A 4JN1L 2GKIA 3LDBC 1LWRA 2XKSA 4HWZA 4EI5C 1C5BL 5C0DA 1DL7H 1P4LA 1KC5H 2VDLH 3GK8H 2LU7A 5D7IF 1RAMA 3VXRE 2QR0B 4OFYA 2DDQH 2ORBH 5HYJB 1MCSA 4ZUTB 3IDNB 5C0EB 1D6VL 4GRLA 3REWB 1CXKA 1FSKB 1P84K 3ZDYE 4RWHA 2NX5E 3UTTA 4WWID 3QXAA 4K23H 1RUPH 4OM1L 5GZND 3WD5L 3NACL 2PYEA 3RVVD 4YC2C 1IFHL 4ENEC 3I02A 4Y4KD 1KTRL 3BGFC 5B39B 1PVHA 4PJFA 4QKXB 1FG2A 4RDQG 2ADGB 1A4JA 4GMSH 1T6VN 4RGNB 4Y1AA 3HKFA 4QT5B 3WHXB 3VGDA 1F4WH 3ULSB 5FV1L 1HOCB 2H6PA 2QADD 3VH8B 1EEYA 1XR8B 2YN5A 1CICC 3PGDB 5F7MC 5JPNB 5T1KD 2BMKA 1Q8MA 2X9YA 1NFDB 5D8JH 1RJYB 1YPZA 5HHOD 4F33B 4HPOH 1KV3A 4KZEL 1JIBA 4R7NA 2ZCKH 1N2RB 1P7HL 2IMMA 5DRXA 1C8PA 4QTIL 5EZOL 2DQTL 1DVFC 1FGNH 3T77A 1WFNA 5EN2A 4P46B 5HBBA 1OAUH 4HCRA 1A9BB 1UT9A 3B9KA 1F11B 3JUYA 5CHNB 5J13C 5F3HA 3LKNB 5ICZB 3TPUB 4LIQL 3TVMA 3WCYA 4NM8H 1INDH 2EH7L 3T8XB 2CXKA 2XG5A 3H2WA 2P7TA 2YPVL 3UTTE 3HN3A 1P9MA 2PYEE 3QAZB 2ZSVB 5EULV 4IRJB 4ZO8A 1OSZB 1I4FA 2Z93A 1RUAL 4YE4L 2NTSP 1QG3A 2JELH 3ILPA 4JG1H 3VXRB 1ZXQA 4C83B 4Y1AE 4JLRB 3QUYD 1S7WB 1M05A 1QSVA 4ELMA 3F62A 2UZYB 1DLFL 2NX5B 2VUYA 4K3JL 4PJ5A 2LAAA 3RZCC 1MI5E 3ARGD 3RVWD 2YPLE 4KK9D 1VHPA 4OGXH 4XC3H 3QXDB 4NZUL 2AXGB 4Z7WA 5C92A 4Z7UA 1GYAA 2X4OB 2O93L 1LO4H 3QEQD 5SV4A 2PKDA 3IXTB 1LDPH 4ZUWA 1CBVL 3ARVA 4WHCA 3E6FA 5EBLB 4P9ML 3X11A 1W0VA 1KIQA 4M1DH 3G5YA 5LGJB 4QGYA 2F19H 5E2WL 2DWEB 1U36A 5TQ2L 4B7LA 4CADB 3GRWL 5A2FA 3FO9B 4O02L 2APXA 3BKCL 2VDKL 1SJEA 4FZ8L 4ODWB 1G1YA 5GZNC 1QVOA 3RVVC 4P2RE 2QSVA 4Y4KC 1EGJL 2VDRL 3NCYS 1W0WA 2OM5A 4XNXH 2P46B 4L1DA 1P53A 4YJZL 5I8OH 2AEPH 5GGSY 4NC1E 2HTKD 4M6NL 1XEDA 2C9AA 1ERNA 4JHAL 1JZ8A 3QXTA 5A2KH 5KN5A 5JIHA 2QKIA 4HWZB 2EE6A 2VC2L 4XCFL 4PLOB 5C0DB 4JQIL 1FVCA 1K4CA 5HHNA 1NEZA 3AC0A 3AREA 4LQFL 5C6PB 3EYVA 4X6DF 4HIXH 4F3FA 4Y4HB 4GRLB 3EJYD 2NY3D 4NCC1 3UTTB 3QXAB 4PJ5E 2PYEB 2WWKT 4XCCL 2EIEA 1XF4A 4MAUH 3I02B 3GHEL 5HHMB 1AI1L 4ODXB 2P5ED 3NMEA 3CVHL 2BERA 4Q97A 1A4JB 1V7MH 4Y1AB 4Z7WE 4G6KL 4LVNB 3E8UH 4K7PY 3WNPA 2W92A 2CGRH 4FABH 1VACA 5C6WH 1XF2A 1I1RA 5JQ6L 3EO1B 1EEYB 3FAWA 1RZ8B 3K4DA 2A2QT 3EYUH 1MI5B 2YPLB 4I9WE 2BMKB 3H3PH 3S96A 1MHHB 2J7LA 3BWUC 4TNWK 3GNMH 2PW2A 1YNKH 4R7NB 5CJBA 1HKLH 2X6MA 3HG1A 1OD7A 2NY2D 1KJ2L 5DRXB 3V5KB 2V5MA 1FRGH 5I75C 1CIDA 3T77B 1FLRL 3LS4H 3R0MA 5EN2B 2BCKB 3MBEA 4UT6L 4G5ZH 1NC2B 1BX2B 3B9KB 4MA8H 3RHWK 3QUYC 5TE7H 1MRDH 3QG6A 4PJCA 5F3HB 5SWZE 3IYLW 4LDOB 2AEIT 5BW7A 2Q20A 3MMEA 4P2RB 3TVMB 1N4XL 2BZDA 2PETA 4X6EB 4HMDA 4BZ1L 3ARGC 3RVWC 1BVLA 1Z3GL 4KK9C 2JJUA 4GAJL 4MA7L 2P7TB 4BH7A 4Y8DC 1Q9LB 1MCIA 3C60D 4R96A 3KJ6H 3DYOA 4UOJA 1I4FB 3D0LA 1H5BA 3SDCB 3RPKA 5CUSH 1EO5A 4XZUA 3ILPB 3VDBA 4N0FA 3HLAA 3JWOL 3QI9A 4Q6YA 1QRNA 2QQLH 4W4OA 4ELMB 4Q9RL 4OF0A 2FH6A 2W91A 2XZQL 2VLLA 4PJ5B 1ZLUH 3TJHD 5GS0L 5HDQH 1GHFL 2E6QA 3DHJA 3BPOB 4LVEA 4HJGA 1P7KA 1VGEH 4JRWA 3BUTA 2QQQA 4F9PA 4X9HA 3OXSA 3WN5B 4Z7WB 4IRSB 4Z77B 1NC4A 5IVNA 3FOMA 3HI6H 5GGVY 5I1AA 4OLXL 2Q87A 4QRUA 2HTKC 2MWCA 4JDVB 1HCFX 4TVPE 2NW2B 3X11B 3B5HA 3PGCA 4U1HB 1W0VB 1UWGH 2D4FA 4HLZG 2D2OA 3G5YB 4P49A 4YGAB 3BPLB 1N0XL 5D7KE 1U8MA 4HT1L 5L2JB 2D3VA 3DVFA 2YSSA 2YD1A 4AMKL 1CGTA 1VFOA 3ULVF 4B41A 4EOWL 1SBBA 3EJYC 1SJEB 2NY3C 4O5LH 2G9HA 1N3NB 3D0VA 5CINH 1QVOB 3S36H 3T1FB 2D9QB 2K1MA 1UZ6E 2R0LH 4RMTA 1UKSA 1IZKA 3K8KA 1ZANH 1F90L 1SYVA 3NOIA 2VDLL 3GK8L 5KN5B 2EDRA 4Y4FA 5SWZB 1FVCB 5HHNB 1NEZB 3AREB 4G8EA 1BIIA 3EYVB 1SEQL 4K23L 1F8TH 4NQUA 1QRNE 3U7WL 4ZFZB 3RDTA 1XF4B 4QOKA 1MIEH 1SYSB 4GMSL 4JRXA 1EX0A 3VFVB 4JQVC 3MBXH 2NY2C 3LKQB 4X7EC 1F4WL 1F6AA 3QCUH 1WWAX 4NYLA 3VFMB 1MCKA 3O2DL 1VACB 5D2LA 2W59A 2IANE 1RQ5A 2JJSC 3RIAK 4J23A 1B0GA 3KYMA 5D8JL 2F53D 4POUB 3DO3A 4CL7A 3S96B 4QF1B 4UDUA 2GY7B 1AC0A 4WHYH 4NQSA 4Z78A 5HVFB 3UJIH 2PW2B 5L2KE 3RPIA 3QP3A 1I1CA 3CX5K 1DQLH 4OCWL 4ZPVA 1FGNL 2DLIA 5CJXC 1YMMD 2QL1A 2QSCH 2HVKA 1T3FA 2X7LB 3C60C 4OI9A 1OAUL 4JGUA 4L8DA 3VA6A 4UIKH 3RWJA 4ACPA 3MBEB 5BRZD 5H35A 4OZFA 2EC9T 1MQKH 3GSQA 1EJOH 2ERJC 4XX1G 2GK2A 4OBRA 4NM8L 1CDGA 4JREB 1S7RA 2P43B 3TJHC 1IC4H 2BFVL 5ADPL 4XC1L 5CKGA 2W0LA 3QQ9D 2P5WD 1KLGB 3NIDF 4J3UA 3VXOA 1BVLB 4RGOL 4BH7B 5I6XC 3K8LA 3WNLA 3QXVA 5CIPA 3IDXH 4JG1L 4QOKE 5DJXA 1AO7D 1H5BB 1PAMA 4FHBD 3BP4A 4FQ2L 15C8L 4XZUB 3GMLA 4NZRL 3BZ4A 3HLAB 5DXWA 1QRNB 3H9SD 4H88H 1A6ZA 1BQLL 2E7CA 2VLLB 2VDOH 3ZE0F 5FYJL 3OXSB 4FQ1L 4Y2DD 3QWOB 3I85A 1GRWA 1NC4B 1Q0YL 1NGWA 3FOMB 4Z6AT 1OCWL 4DKAA 1BD2A 1GC1H 2IANB 1NANH 4TULH 3DVGA 5DURB 3SDYH 3L3JA 4I3SH 5MEOA 2DJUA 2F19L 5D71L 3U0WH 3IFOA 4JY5H 4Q74A 2YSSB 3K0WA 3KPPA 3IFPA 5GS2H 2VMFA 4RMUA 4WFHD 5L2KB 2FRGP 4WDIB 1YEEL 1JMZA 3NCEB 4OF7A 2HT4D 4NKQB 4Y5XC 3NN8A 1F6FB 4LNVA 3EFDH 4XNXL 5F8RC 2OX5A 2AEPL 4WFED 4M7KH 4X4YB 1HHJA 1F6LL 4F8QA 2HFFA 4MS8D 5FA4A 5IBTL 3PDDA 5IQ9B 4L9DA 4YHLL 1TVHA 1XIWB 4RZCB 1U3ZA 3QDJE 3WNOA 4G8EB 1BIIB 2IQAA 5DJDA 1ORSA 4WGWB 1K2DA 1PG7L 2BVQB 4X7DC 4KI5F 3WMSA 1AHWB 3QA3A 3GIZL 3O8XD 1EMTL 4QOKB 4UAOB 4WEUD 1V7ML 3SKMA 1TDQA 5IEHA 2CGRL 3NABH 1UM4H 4XGZA 4XP6H 4NYLB 5I66A 2A77H 3DRQA 4XPFH 5CZXD 4JKMA 4L29A 1QZ1A 4UINL 4F7PA 4HUMB 3KYMB 3H3PL 4LSVH 4RFOL 3LRSA 2MJWA 2J5LB 3SDDD 2E7LA 3GNML 3W0WA 1G7IB 3MGAA 5ITBL 4UDUB 2IQ9H 2WINA 5FHAH 2R4RH 2HFEA 3QQ9C 4UIMB 1G1CA 4ODHH 2Z8SA 3UYRL 2ZUQC 4ZPVB 2D7TL 3KYAA 2ICWJ 1R3IH 2HVKB 1T3FB 4JB9H 1JHTA 5T1LD 4L8DB 3TZVC 4JFQA 1BAFL 1AKJB 3RWJB 5C71A 1BGXH 3KPOA 4NZTL 1G9MH 4WTZG 1MRDL 5H35B 5IT2H 3WLWD 4RGMC 3WO4B 1S3KL 1BQHB 4FQIL 2AGJH 2GHWB 1TTGA 3T0WA 3O3DA 5JOFA 2AJUL 3HUJE 1QLFA 5D96B 2IG2H 1S7RB 1MFNA 1UWEL 5DHVA 2DQEL 3F7PC 5T3XL 5TF1L 3NIFE 2B5IC 2FO4A 3SE3A 4JR9L 4Z7NF 4LLQA 4YDKH 4Y2DC 4LFHD 3VXSD 1UH3A 5K59E 3GMPA 5CIPB 5L7XH 1NGZB 4PRIA 5FFLA 1BJ1J 3QIWB 4O00A 1N6UA 5KVEH 1X5XA 5DJXB 1ONQA 1G9NH 3QDJB 3AAZB 3SOBH 3LKOA 3IJSA 1KCSH 3ZL4H 3RWEB 3BZ4B 1RUQH 4P3DA 4MWFB 5HDQL 3K2UL 1ZLUK 1A6ZB 5EU6D 1LEGA 3MPCA 4NZDA 5CSBA 3RWDA 4P4RA 3NBNA 1FH5L 5JW4R 2XA3A 5DI8A 5BCAA 4R8WL 3HI6L 1DN2A 3W0WE 2HT4C 1MCHA 5DJ6A 3TC9A 1NGWB 3RNQA 1N64H 1PW3A 1OD9A 4WJ5A 1BD2B 4S2SA 1U8PA 3L3JB 4MS8C 1A7PH 1NAMA 5MEOB 2VLRA 4LLDA 4FA8A 1CLYL 3IFOB 4HEPG 2YMXH 4PJFF 2UWEF 3RWIA 3KPPB 3IFPB 5F7UA 2HFTA 5CINL 3S36L 3T3PE 1M7IA 5HYJD 4LVOB 4U1MA 1F58L 4LCCA 1ZANL 3O8XC 5CP3A 3WIIL 5IJKA 3T0AA 2HFFB 3MRBA 4J3OC 5E99H 1C1EH 5DMGD 5FA4B 1YPZF 2JTDA 1F3RB 4ERSL 4QNPF 3ROOA 4MVBD 3HUJB 5CZXC 2IH3B 4P2QE 4RGND 1EO7A 2P8MA 2A6JA 4OGZA 4GFTB 1EDQA 4JJHA 1KBGH 3OB8A 1QR1A 4QHMA 3QFJE 4DZBB 1ORSB 4X6FA 4OI7A 4XNUH 3SDDC 5A1AA 4JDTH 5EUOF 5D1ZA 5CEZE 3IT8D 4JE4B 2X4SA 2DIJA 4OD3L 2DLFH 1I75A 5IEHB 2X1PA 4ZTOH 3DWTA 2DD8H 4XGZB 2XYCA 1JRHH 5I66B 3DRQB 3CFBA 4ZFOL 4CU8A 4F7PB 3WLWC 5HTSA 4UV7H 4P46D 3UROR 1RULH 3W0WB 5KSVA 2CDFA 2XZZA 1IC7L 4NUJA 2WINB 4JFEE 1JK8B 3EO9L 5BXFA 2VH5L 5I1LA 2AJVH 3TBSA 4ELMF 5FYLH 32C2A 4UIKL 1M71A 1JHTB 3NTCH 5DR5H 3SGDI 1L7TH 4JFQB 4PRPA 1MQKL 3KPOB 4X9BA 4LRNH 4Q7DA 2O61A 4QHLA 4PLKD 4IRJD 4CN4A 4LDLB 5C08E 4DN3L 2EO9A 4JM4H 2K7PA 4GQPH 1G6RL 4Z7UF 1CXEA 1HCVA 3VXRD 3WXWH 5DHVB 3MRJA 4K2UH 1QYGL 2DWDA 4GXUM 3FB5A 3L3KA 2NX5D 4M1GH 1FZJA 2UUDH 3VD3A 1NSNH 4JPIA 2P8LB 3GMPB 4PRIB 4XCEB 5JHDE 3BRGC 4HSQA 4FS0A 4P2QB 4WFGE 3KPRA 5GGQL 3Q6FA 3UO1L 2A6DA 3IJSB 4H88L 1JGVL 3TBVB 4LLMA 3QFJB 4P3DB 2A9MH 5DC9B 4XPAL 5I30H 3W2DL 1UCTA 1YYMH 1LEGB 1OLLA 1DBBH 3RWDB 4P4RB 1QR4A 3B8SA 2XT1B 1FBIL 5DI8B 3WXVL 4D0DB 2R2BB 1AGFB 3MRLA 3AROA 5HPMA 3VGFA 2WQRA 2DRUA 3Q3GA 3OPZL 4S11A 5DJ6B 1R3LA 1GC1L 2NYYC 4TULL 1FSKC 3RNQB 4HUUB 4WJ5B 1I1FA 1W72B 4I3SL 3WNKA 5J57B 2VLJA 4MJ5A 1X7QB 4S2SB 1NFKA 3QEUA 1RURL 5FIEA 5DMGC 1NAMB 2VLRB 4LLDB 1B2WL 3V5DB 1NMAL 1BZ9A 1MAML 4GG8B 4MVBC 4K3DH 1B0WA 4PRPE 2R56H 4FZEH 4RGNC 1ADQA 3RWIB 3LOWA 4O4YH 4LFHG 4JFEB 3O6ML 3MLTA 4M6ML 3EDFA 2ICWA 5GQBA 1OT2A 3BO8A 2CLRA 1FFNA 4OFYD 3D39E 1M7IB 4M7KL 1T4KB 4S10A 4Y4HD 4U1MB 3EZ8A 4LCCB 4GRLD 1HXYA 1EXUA 4N0RA 4RX4D 3UTTD 5BS0E 1LP9E 2PYED 4TRPL 3MRBB 5E08L 3H42L 5C08B 1M4KA 4MMXC 5HHMD 1CGVA 1IAOA 2GUOB 1FE8L 4LCWA 3UJTH 1MVFA 2XN9A 4MLIA 3VD7A 4Y1AD 2P8MB 3KPRE 3WNNA 1NCNA 3BAEL 1IT9H 4RFNB 2WK2A 4MNGA 1QR1B 1YECL 4P46C 2HJLA 4X6FB 3I9GL 3V0VA 5D1ZB 4H20H 1MI5D 2YPLD 3OQ3B 3UYOD 5JHDB 1X5KA 1JZ3A 2X4SB 3NABL 1BVKA 1T20B 4H0IA 4PJCF 2J3SA 5IFJA 2WWMD 4XPFL 4TUJA 3MYZA 2IFFH 3CFBB 3P4NA 2MCPH 2VLJE 1FORH 1KNOA 1A6WH 3ES6A 3QAZC 4KH2A 1BFSA 4OV5B 4PLKC 3GSXA 4IRJC 4QRSB 1H0DA 1TPXB 1UCBL 2F54A 2R4RL 5KSVB 4HKZA 4RMQA 3B9KD 4FXLA 5AUMA 4U7SA 4NUJB 5LAXA 3ALXA 5BXFB 5B39G 1AP2A 3LSOA 5I1LB 1U8HB 1RD6A 4P2RD 3TVMD 3GJFH 3WJLC 1M71B 1EHNA 1XGTA 1EA9C 4C55A 4S1SH 4X6CE 4PRPB 5AG8A 2DLGA 3RU8L 2YHGA 2O61B 1F2QA 4QHLB 1I1AA 3EDJA 5K33A 2IG2L 3BMWA 3SDCD 3CPLA 5E6ZA 3OF6A 4OSUL 2AJZA 3D39B 1OAKH 3MRJB 4U6VH 5GISL 3V4UH 3F6IA 3TJEL 2OSLA 3FB5B 2H9GA 5BS0B 1FZJB 4PJ5D 1LP9B 2YA0A 3FO1B 2RR3A 3LQAH 5CEYA 5IMKB 4JPIB 5F72S 4PBWD 1VB9A 3MGTA 1A6TA 4YFEA 5DVLA 3SOBL 3O6KH 5J1SC 1MCWW 2IJ0C 3I6GA 3TBYA 1T03H 3KPRB 1KPVB 3Q6FB 4IRSD 3R0NA 3UCRA 1MFBH 3CLEH 2F5BL 2IPKB 1D5XA 2YD9A 3L3DB 1WLHA 4LSRL 3BKMH 4ZUUA 4CKVX 4I9WD 1CF8H 1VFMA 4PJDA 5J8OA 4MB4A 1J5OL 3IFLH 4X99A 1EFXA 1RUML 1YEIH 4XCYB 5T33H 2F54E 5HPMB 3HNVH 3Q3GB 4Y4HC 1RZJC 4GRLC 5IVZA 2IALB 3S35X 1A7PL 1I1FB 4KKAC 5ANME 2CO7B 2VLJB 4MJ5B 3QEUB 3CDYA 1XH3A 3WL9B 5FYKE 5F96H 1A6VL 1UJ3A 4TN9A 1BFTA 5IGXH 1VGKA 3C5SB 5KOMC 3MXWH 4HLZH 1MJ8H 2Q8BH 3GKZA 2FIKB 2ICWB 4AJ0A 3BO8B 3ARED 2CLRB 4GAYA 1FDLH 2RIKA 1FFNB 2DQFA 3ZYZA 5D2LF 4R90H 5M95B 3UPRA 4QHNA 1HXYB 1EXUB 4X6CB 1WCBA 4P99A 2M1KA 3L5WB 2XG4A 4J6RL 2WWMC 2O5ZH 4MDJA 5DUMH 4Y5YA 1IAOB 1IGFL 5GSVB 1MIMH 4N90E 3VA2C 3F12B 25C8L 3MNWB 4XNUL 2GW5A 5IHLB 1CWVA 4W6XB 4L8CA 3MFFA 2HJLB 1HI6A 3MRRB 4OCRH 3V0VB 1BJ8A 3B9KC 1L4IA 4K71B 5EG6C 4PJDE 5TQ0L 4AIXA 1AC6A 5DD3H 1BVKB 4MB3A 3O6LH 4BQBA 5IFJB 1CGSL 3TVMC 3JBG7 4WFFE 5D1QA 4YX2H 5ITFB 4D9LL 1CLOH 3X3FL 2X4NA 4NC1C 3MV8A 3P4NB 4TVPD 2YD6A 4UV7L 4KKLD 4JPWH 2HP4A 1KNOB 2DLTA 3ES6B 3G9AB 4GW4A 1HH9B 4NGHH 2GCYB 3JTTA 5JORB 1H0DB 3MBED 5D7KD 1XGQA 3S5LA 3SDCC 4EI5B 2F54B 4JKPL 3O2WH 3EKCA 4HKZB 4ISVA 1F4YH 5F7LB 5AUMB 1J8HA 5FYLL 1YZZA 2AJSL 1P4IH 1AP2B 4HMCA 4LVHB 3LSOB 5ANMB 5TH2B 4H1LA 3U46A 3QO1A 3PJSA 3LEYH 3BPOC 1HN1A 1T1XA 1XGTB 4PPTA 4ZNEE 2X70A 5T5FH 3WN5C 1CDIA 3SY0A 4IRSC 4XNYH 3MXVL 4EDWH 3NZ8B 1I1AB 1MCPH 4OGYH 3R1GH 3EYSH 2AS5M 4LAJH 4K2UL 3CPLB 3MLZH 4O2CB 2AJZB 5J3HC 35C8H 1J8KA 2OJZH 5GSRA 1I3GL 4M1GL 1QRND 4TUOA 2OSLB 2UUDK 4KJWD 2CKBA 1ZT7A 1I8MA 4N9GA 1F5WA 2X1OA 2IBZX 3GFUA 5CEYB 3SGJA 1U6AL 1A6TB 5HSFA 4BZ2L 2GK0A 1KIPB 2BP3A 3I6GB 3TBYB 4XBGA 4GAFB 4FNLH 3WFHA 1NC4D 1PBYA 3C08L 1D5XB 3PIQA 5HDLA 4ZUSA 2IAND 1R24B 5DURD 2IADA 3VE0A 2EE2A 1RMFL 2F5AH 4WHTA 4GOSA 2H8PB 4PJDB 1C16A 4GAGL 4RWYL 4D94A 3TYGH 4X99B 2VZSA 3LH2L 1EFXB 3T0EA 2ZCLH 3AREC 1JYWA 2ZJSL 5IG7B 2GQHA 3WSQL 5L2KD 3FN9A 4JFZL 3P30L 3DIFB 3CC5A 4JY6A 1BFVL 4PJEF 4TUKH 3ZHDA 1FYTA 3Q6GH 3MNZA 4RAVB 2JCCA 1EBPA 4K3DL 1XH3B 4HKJA 2R56L 4FZEL 3FT3A 4GKNA 1A3RH 4NBZB 3RNKA 5IB5A 2L7JA 4PIRF 5BV7L 1VGKB 3P0GB 1SMAA 4OLVH 1XIWD 1QKZH 5DEZA 2YUVA 4LLVB 4P5KA 2IBBA 4GAYB 2DQFB 4RMVA 3UPRB 5DLMH 2OQJA 4QHNB 3TM6A 5L0QB 5KSBF 1WCBB 1HYSD 2R4SH 4NQDA 3JV0A 1MJUH 3UJTL 4QOKD 4G8GE 2FX9H 1NGQL 4Y5YB 2GJJA 2F15A 4W6YB 4WO4A 3IVKB 4KKLC 5C2BH 3W39A 1CR9H 1KB9J 4QO1A 1ZGLM 4RBPH 4AK1A 3MBEC 3ZE1F 1HI6B 4P4KB 5CD3B 1IQWH 1U2CA 4LCYA 1IAIM 3F8UB 1Z0MA 1EVTC 3VD5A 1NBQA 1KB5L 1CQKA 4JREC 3VCLA 3T0EE 1A5FH 1YEHH 2FHFA 5BW7C 5EWIL 2VITA 3SDXE 3SQOH 3SEPA 3LN4B 2MCPL 1FORL 1BPVA 4Q6IB 2X4NB 1HWHB 4RA3A 2N56A 1FYTE 4GW4B 2JCCE 3PABA 2IAMB 1QBML 4PB0L 1H5BC 3S5LB 1RU9L 3VMNA 3JZ7A 4ISVB 4WI9A 5IFAH 4HAFA 3F7YB 4OZHE 1F42A 3HMXH 3G6JE 3RKDD 4KJWC 4U1GB 3GJFK 2YEZA 4J12A 2F58H 4PV8A 3U46B 4JPKL 3KXFE 4S1SL 4CNIA 1T1XB 4WW2A 4F9PC 2OR9H 2X70B 3L3GA 5KS9A 3SY0B 4NQDE 1B90A 3B9DA 4OCNC 2GYSA 4IHOA 3QDJD 1CT8B 5IP4A 3VFTA 4A6YH 4PV9A 3FCTA 4FFWD 1F13A 4TUOB 4OB5L 5E94A 3U4EA 5IUSA 2R1XA 2VTFA 1IARB 1DCLA 2CKBB 1ZT7B 5E1HB 3FB8A 1I8MB 4N9GB 3IKCA 3O6KL 1T03L 1YQ2A 4HXAH 5HHVH 2LE9A 5TF0A 2GK0B 2NPLX 5L6YH 5GXBB 5IB2B 1DUYA 5DZNA 1MFBL 3CLEL 4MMZC 4XBGB 1NDMA 4HC1H 5F9JA 4QWWD 1A9EA 3PIQB 4LCIL 4ZUSB 1BD2D 5HYQA 3FN0L 1CF8L 1BEYH 3VE0B 2VE6B 1GJIA 3IFLL 4NO3B 4WHTB 1MOEA 1YEIL 5T33L 1XIWC 4D0CA 4CMMB 1LGVA 3T0EB 3LIZL 3SDXB 3GJEA 2JB5L 1G7PA 4G9FA 3GBNL 3GHBH 4JY6B 4YDIL 5DRZA 1HYSC 5ALBH 5LKNA 1AHWC 2FR4A 5K9JL 1AY1L 5F96L 1FYTB 4YR6B 2JCCB 4UAOC 3N9GL 2JF1A 5FUZL 1HSBA 5IGXL 4MHHI 3UMTA 1PD6A 2EYSA 5IB5B 3GSWA 2LQRA 3MXWL 2Q8BL 5J1AA 1OGAA 4HH9A 4OZHB 1VDGA 4JM2A 3OR6A 1JTTA 1JFQH 4R90L 2W0FB 4P5KB 1J0ZA 5IOPA 2AK4E 2J4WH 2FHCA 2V5YA 3KXFB 2Y36H 3VGAB 5IVXE 1FZOA 5IESL 2J5LC 1Z6JT 5JLZA 5DUML 2COQA 4NQDB 2ENYA 4JKWA 3CXDL 3RY6A 4KMTL 4EZMA 1MIML 1CFSA 5E4IA 4AEHL 4WUKH 3FFDB 5F3BA 3GMOB 2JJTA 2B0SH 2GITB 5C0FB 3OGCA 1HILB 4WO4B 4AM0A 2XY1A 1VEPA 3MJ9H 3W39B 3CIQA 1N59A 4CJ1A 3KWWA 5K9OA 4L9LA 4IMKA 4G6FB 4M5YL 3O0RL 3B4NA 4MQ7B 4LCYB 3IS1X 3D85A 2PR4H 4NNXA 5DD3L 4AT6B 3O6LL 5D96C 1OARH 2FBJH 3MLUH 3RKDC 3W0WD 3VCLB 3QNZB 5DSCA 2VITB 5IMMB 2HRPH 1IGML 4JPWL 1FFRA 2HKHL 1Z9SA 1E4KA 3CDGA 4NGHL 1ZHNA 3D2UB 4NUGH 4XMKL 3D3VA 3QDGA 5KTEL 3PABB 3QIWC 4OF5A 4LSDA 1F4YL 1YC8A 4PGJA 1AR1D 3STLA 1R5VA 3IU3A 3W5NA 4Y19E 3HZYA 4NWUH 2EEBA 3LEYL 1T7VA 4S0SD 3H9ZA 2YEZB 4PV8B 2E5EA 3AB0B 4CNIB 2VAAB 4DGIL 4WW2B 3UX9B 2Q7YB 3L3GB 2VWEE 4CN6A 4HV8A 1I3VA 1F4XH 1UQSB 4RNRA 1M7DA 4XAWH 4PRID 3ULVH 4QWWC 4IHOB 5JMRA 3ULUF 3AXLB 4P2QD 4X7FC 3N1QC 35C8L 2OJZL 3HHRB 12E8L 3VFTB 2YUXA 1ITBB 2AK4B 1HHGA 4OZ4A 4PJXA 2FJGB 2I9TA 3NZHL 1ZT4A 2R1XB 5GRUH 4JFYB 2VSDA 5CEZD 3FB8B 2LV4A 1JHLH 1T1YB 1MUJA 2VDMH 1DE4B 5BQ7A 1KCVL 1NDMB 3QNYA 4LVOC 4OZFG 5F9JB 4IDJH 2EE3A 5E03A 4YIQA 1NH6A 4IJ3B 3DUUA 1A9EB 1TJHH 2BVPA 1IAMA 1RSFA 1V7NH 2F5AL 4HIIA 5HYQB 4W6WB 9CGTA 1VEMA 1AD9A 2ZNXA 3M45A 3TYGL 2VLRD 4G42A 3OB0H 3DSNA 3QDGE 4OFKA 5DHYA 4D0CB 4MZ3A 1IAIH 3QIUA 1A6UL 1NBVH 3GJEB 4JFED 4MX7A 1G7PB 3UTPE 1DSFL 1OGTA 4G9FB 4TUKL 3O3AB 1JWSB 4KV5F 5DRZB 3TIDB 4ALAH 2VRAA 1FFOA 3FHAA 1A3RL 3WKMH 1NDGA 2WUCH 3GSNH 2J12B 3G5ZB 2EIDA 3GSWB 1U93A 1QKZL 6FABH 5J1AB 5C08D 2WBJB 2WBKA 1OGAB 1KACB 3KPMA 2CRZA 4PD4K 3QUML 4JM2B 4Y19B 1CGYA 3OR6B 4GRWF 2VZUA 4GG6F 5IOPB 4PJXE 1ED3A 5IJVB 1A3LH 4EKXA 2R4SL 4D0BA 1FZOB 3NAAH 4UT9H 5DMJB 5EORH 3V9FA 3SE9H 2E7LC 2QJDA 5JLZB 5D1ZD 1WWBX 3FONA 2EIZB 5JHDD 4B53A 4P2OA 1CFSB 3O2VL 4WFGD 4WEBL 3ZT5A 5A2IH 2ZSWA 5F3BB 4QEGA 5C2BL 2JIXA 1QOKA 3OGCB 1VKXA 1JI2A 4CVXB 3OKOB 1N59B 1BF2A 1EEQA 2G60H 3UTOA 1MJJB 3LV3A 3KWWB 5CEXA 3QCVH 4YXLH 5K9OB 5FOBA 4L9LB 3IJHA 4OAWA 1AR1C 4XP5H 1BBDL 3D85B 2BNRA 4AYFA 3RL1A 4TPRH 1A5FL 1BREA 5DEFA 1I3RA 5E5UB 4KQ4H 4MD4A 5DSCB 2AXJA 4YDJA 3OBAA 3TWCH 3SE3C 2VXTH 3C87A 1FO0A 5JMOC 1QLRA 3CDGB 1ZHNB 1KOAA 4EN3A 4FP8L 5CMAA 1MEXL 3IDYB 3QDGB 5IKCB 2B2XL 4PRPD 1PLGH 4GRMB 4BQ8A 4PJIF 1CN4A 1K9TA 4KQ3L 4PR5B 3OAUH 3S3SA 1ZA6A 4MCZA 1DBAL 1R5VB 3IU3B 3HZYB 2F58L 5GRJH 3D39D 1HQ4B 5MEQB 1QFOA 4OF8A 4YHIA 1RUKL 4JHWL 5I19H 4ONFL 4OM0H 4IM8A 3CVIL 5BS0D 4PLNC 1GGBL 2BHUA 4L1HA 3SGKA 4A6YL 4JFDA 1JI1A 3PUCA 2DJSA 4TQEL 5FYKU 3KPRD 2Y06L 5JXAH 1JNHB 1A7RH 4OZ4B 3KR3L 1MWAA 4PJXB 2EDLA 4DW2H 5E8OB 1OAZH 2I9TB 4ZS6D 1J87A 4FQHA 5HHVL 1A47A 5D4QA 1CDUA 1A2YA 2FO1A 4OCXH 3ZE2E 1I3UA 2BNRE 3LKPA 4H26A 1MFEH 4X83A 4U6HA 2UY7A 3ZYJA 5BQ7B 4HXBL 3C09B 3UP1A 4LCCC 5HYSA 4YIQB 43CAB 3DUUB 1IAKB 1Q9KB 2BVTA 2VLJD 4HIIB 1I8LA 1IBGH 5HHPB 4Q0XH 2FECL 4UZGA 4NKIH 3BIAX 2ESVE 5DHYB 4G9DA 5IB3A 5F1IA 3AFLA 3QIUB 3EW3B 2V9RA 4MX7B 4DAGH 3U30B 5JO5A 3B43A 2ZUTA 2B4CH 5DFTA 1FFOB 5D1ZC 1JWUA 3IDMA 1DQTA 1Q0XH 3MZTA 5FO9A 4G80A 1NDGB 1JTPA 4KPHH 4EBQH 3LN9A 2HJKB 1U93B 1JFQL 4HS8H 4JFDE 1P2CA 1A7OH 4UTBH 3QUKB 1T6WA 3KNBA 1ED3B 1P4BH 4DJMA 1NMBL 4CU6A 1T2QH 3GSVA 3WUZA 1GAFL 2YR3A 4R4FL 4S1QH 5F7FA 2FIRT 2WP3O 1TCMA 2X4PA 2AQ1A 3HAEA 3REVA 1DBJH 3FONB 1IKNA 3PHQB 4AIZB 4YHYB 3VFSB 3WEXA 2B0SL 3BDXA 3MRPA 1PYWB 2ZSWB 2JIXB 5CKAA 5E1AA 1D7FA 3GI9H 3GMQA 1MRCL 4JAMA 3I2CL 4ZO6A 1WBXB 3LV3B 5CEXB 4I3RL 4WU5B 5GJTL 3IJHB 4OAWB 1QFUH 3P40A 2BNRB 1X5FA 3RL1B 5DEFB 2F54D 1I3RB 1VA9A 1MFAH 3GMNB 3LRGA 5F9WB 4MD4B 5DJ2B 2HRPL 1IQDA 2ZPKH 4YDJB 5DEGA 2DYPB 1NFIA 3S37H 4N0YH 3HI5H 3LPGA 4Z7VA 1CK0L 5CILH 2MMXA 1VFUA 3X3GH 4GS7B 1MLBA 4EN3B 5FYKD 2ESVB 2M26A 4MAYA 1F3JA 5DJCB 4WW1A 4DGVH 3QRGH 1I1AD 2PYFA 4NWUL 4O51A 4OCMC 1JRHI 3A6BL 1RZJH 3MQIA 4G6AD 3FQXA 4ZS6C 3UZEA 1RZFH 2AV1A 1A7NL 1VADA 2XXMB 3G6AA 4YHIB 1QPXA 4X8JA 2I07A 2V5SA 5I0DA 3IB4A 4NWTH 2R2EB 2SEBB 2EICA 4XAWL 2PCPA 2F9BT 1J0KA 1KJ3L 1UYWL 4HGMA 4PUBH 5TE4L 2OLDA 4JFDB 2WW8A 1WIOA 4PLJD 1I7RA 4N90D 3EDKA 1KPRA 4KHTH 2HJFA 1WTGT 3DX9A 4Q9QH 5GRUL 4IEFB 4N68A 4FQHB 1JYXA 4PGCA 1BQUA 3L3HA 5GGTL 4OLWH 4H26B 4XMLL 1EFXD 3IRPX 2VB5A 1NKOA 1QEWB 1TJHL 3BDYH 4WFFD 5DK3A 1V7NL 1KSRA 5HYSB 4ZYKB 3ALPA 4N9OB 1VSCA 2Q8AL 4HWNA 4OKVB 3OB0K 4HCRH 3BP5A 5J0BA 4V2CB 1IAIL 3MRQA 4PJ7F 1FAKT 4LSPH 1S9WA 3O3BA 1KENH 1OAYL 5C07A 2J1KA 3EYQD 2C1PB 4I77L 5IB3B 1KF9B 5F1IB 4TSBH 4ALAL 5JO5B 3OAZH 1DJSA 4DCQA 4FG6D 4WUUA 5EIIA 4OUUB 3MCG1 3UBXA 1JWUB 3IDMB 3AMKA 3GSNL 4K71C 4G80B 1SEBA 3QRFM 2HTLD 1CIUA 1S5HB 1I7TA 5KANG 3CXHJ 4NCC2 4J3TA 1T0NA 5C86A 4MD5B 5ALCL 4R0LA 2DIBA 3BN3B 2CDGA 5I9QB 3SPVB 3MRFA 3PNWA 3ARUA 4P57A 3NAAL 4UT9L 3RBGA 3GSVB 1OWWA 5F7WC 3TEUA 2HKFH 2KQMA 4LASH 1IM3A 1N6VA 5I15H 4P4KD 2X4PB 4M3KB 3HAEB 4BFIA 1FAIH 2CK0H 1D5IL 4XMPL 3MRPB 1WICA 4N5UA 3AM8A 1L9MA 1A21A 4LVHC 3MV7E 3MOQA 1WSST 4YPJA 5E1AB 2Z9TA 3GMQB 3GIVB 3MV8D 4BK4A 1MHCA 4WW2F 3QUZA 5CCKL 4TPRL 3DX8A 2XXCB 5EU3A 5KS9F 1I1AC 4CJ0A 5EZLA 1LK3L 2BOCA 4G6AC 5C07E 3TWCL 3UPCA 2VXTL 2XZCH 4I0PA 3UTZB 1JGUH 1IQDB 1JCKA 4U2YA 5DEGB 2VXSH 3IDGB 1X44A 1X4ZA 1X5IA 4WUUE 1BWMA 3ZO0A 3FB7B 5AZEH 4GXVH 3RIFK 4MAYB 5B3JE 2Z8VC 4PLJC 2QTEA 4WW1B 3CH1A 1XCQA 2W9DH 3ORJA 2R1WB 1UC6A 5F71A 3FQXB 4NRYA 5I19L 3GRWA 3UDWA 1V3MA 4CBPA 1VADB 4OM0L 1T7XA 3G6AB 3M07A 1S8DA 2BSTA 3HZMA 4QHUB 4DOHE 5I1GH 3MODL 4X8JB 2I07B 1H3PH 4TNVF 5IIEA 4PJBF 5GRZA 3ARRA 3EYFA 1EGJA 3U2SA 4OZGA 2I60H 2FGZA 4PRDB 5JXAL 5EOQH 1CD9B 2ARJA 4LARH 1XT5A 1I7RB 4F37F 1KPRB 5D2NE 2HJFB 4FN0A 3DX9B 2V7NB 1TZGH 2BOBA 4HJ0D 1LO0H 1J0YA 2OS7A 1AE6L 4PGCB 4OCXL 3EYQC 2VIRB 3VI4F 3L3HB 3RVTD 3CZJA 4MDIA 3FQRB 4DGYH 4Z7OF 3T0ED 2D7MA 3PV7A 4FG6C 4MXWL 5T5NF 4F57L 2A6IB 4HUNB 3CD4A 2YN3A 4TVPH 4BFGA 1E4XH 3CVHA 5L0QC 5E2VL 3CFKA 4NDMB 4K9EH 4OFDA 4L3EA 2HTLC 4XHQA 4Q0XL 2Q76A 1FYTD 3ZSSA 4C59B 4NKIL 2ITCA 3MO1A 4K94L 3BP5B 3OX8B 1P69B 2XI9A 2R69H 4Y5YC 4YAQA 3LD8B 3O3BB 2IC2A 1F45A 5C07B 5MP6L 1ES0B 1NCWL 3NCYP 3MA9H 5D5MA 2X09A 3HS0A 2X44D 5F6IB 3WIHH 2EO1A 4XPHH 1TQBB 1Q0XL 4P4KC 4WUUB 3KXFD 2J2ZA 3UBXB 5L8KB 2AKRA 4JRYA 1SEBB 3DUHA 4CVWA 4NT6A 3NIGE 4NQDD 3IU4H 4HS8L 1RHFA 5EA0H 4PJAA 1A7OL 1QLEH 4LPUA 4OZGE 4G8FB 1T0NB 4R0LB 2CDGB 4Q6IC 1J1XH 1ZT1B 4WO4D 1T2QL 2J8UA 3MRFB 3PNWB 5DC4B 4DOHB 4P57B 1FNAA 4S1QL 2DM7A 3NPSB 4JY4A 2IAMC 3SCMB 4JZJA 4V2BA 4HHAB 3QBTB 1IM3B 3MLYH 1U9KA 2DQHH 2CJUH 1WISA 4BFIB 1FNHA 3LAFA 3DGGB 2ATPB 2QHRL 3C8KA 3D5OF 2FJFA 4XBEH 2JK5A 1NPUA 3P9MA 4U1GC 3BP6A 5D2NB 1IEBB 4YXKL 3Q1SL 1AJ7L 4HPYH 4JFFA 5DQJA 4YO0B 4H5SA 3D2UD 1MHCB 2KQNA 3QUZB 5EU3B 4KRNA 2EC9U 5EZLB 3VU2A 5B8CA 3WDHA 1BWWA 2BOCB 2ZPKL 2CLZA 3T2QA 4ELKB 3S37L 5DFVD 3JV6A 4I0PB 1ZLSH 2OMBA 3VW3H 1MCWM 5D5ME 5FKAA 3WE6B 3NA4A 2DICA 1WAAE 2HT2D 5ILTH 4UB0H 1GH7A 1EZVX 3L6FB 4LSSL 3SGJC 5ESQB 3D1MC 4PY8I 4YZFE 4M03A 3HZVA 4IS6A 3DSFH 1RV6X 3RZCB 1DANT 4M1CD 3OJVC 3CH1B 1XCQB 5F9OH 4Y88A 3DROA 4HX1B 4HJ0C 4ONGH 4NRYB 1IL1A 2AK4D 5CJ5A 3AUVA 4NWTL 1S8DB 1HIML 4FQXA 3GM8A 2AQ3A 4JHBA 1DQDL 1LILA 3RVTC 2E27H 3A6CH 3T0EC 4ZNCD 3EYFB 3TLRA 1K8DB 1ACYL 4LEXL 3U2SB 1SJVA 4OZGB 3V6BR 1JBJA 1CGUA 1MVUA 2ARJB 1NMCB 3CAFA 3UTSA 4Q9QL 3S5LG 3BD4A 1JGEA 4QHKJ 2Y07L 1ZE3C 1AXTL 4FXGA 1RIVH 2YKLH 4JFFE 3J8F7 2D0GA 3TT3H 2BJML 4H1LG 3PHOB 3G5VA 1UKQA 4HF5H 4MDIB 1X4XA 2EDJA 2MQ0A 1PKOA 4UDTA 4Z7QF 4PJGA 5JUEH 1JF5A 2VL4A 5DUBA 2NY7H 1KCKA 2XY2A 5D7IA 3VGAC 4TYUA 3WBDA 4G9FD 2QADB 4JKKA 5AZ2H 3CFKB 4L3EB 4HCRL 1ZGLP 3C2AH 2Q76B 1FNEA 1B6DA 4P59H 4OZFH 4LSPL 3R06A 3KPSA 1ZEAH 4RMSA 4JHZA 4JPVL 4YAQB 4WO4C 1FN4A 2KPNA 2VDPH 2WBJD 1OGAD 5D5MB 4JM2D 4Y19D 3HS0B 4DK3A 5I8KH 2XTJE 3OAZK 4YHZH 4LGRB 1NUGA 2Y5EA 5ID1A 1QNZH 3DMMA 3T65A 3I6LE 5T1DL 1B3JA 4U1NA 3VFGL 4I8DA 5BO1H 5CIPH 2P24A 2FZ3A 3F6LA 1QP1A 2X1QA 1JHKH 4NT6B 2D0HA 3BEVA 2IPTL 3B6SA 2C3XA 1UGNA 5DJYA 5L8LB 3WUWA 5C3LD 4TOYH 1JPSL 1KCUL 4XVJH 5HHXL 5IBLD 2DMBA 1ODAA 3UTSE 2J8UB 1WWWX 4HBCL 5I1CL 5MI0B 4JY4B 4NFDA 4X98A 3RL2A 3QUXA 4JZJB 2W9EH 4OD1L 2H41A 2R8SH 1DDHA 1DN0B 5DFVC 4KZDL 4UT7H 3D85D 4KHXH 3V5HB 5C0BA 3C8KB 2FJFB 2JK5B 3P9MB 5C2UB 3BP6B 1LDSA 2A1WL 2HT2C 4PGBA 3AB0C 1J0IA 3EYOA 3BEWA 4FFVD 4YPGB 5D7IE 4JFFB 4WW2C 3VGHA 1BLNA 1PSKL 3HC3H 1YNLH 4F58H 2C3VA 4G7VH 4M1CC 1MCJA 5LWYH 3QDGD 4FQQA 5ACZA 3KPSE 5B8CB 4PTTA 3DV4A 2RAMA 1MHPL 4NO2A 1KIRA 1Z0NA 2CLZB 4OLUH 2EDOA 4WTXA 3JV6B 3UTPD 2ZCHH 5IW6A 2R0ZH 4PTUA 5FKAB 4HG4K 1D5MB 4M9PA 3RI5F 2ENSA 4AIOA 5FM5O 2ILLA 1TJIH 4NPYA 1GIGH 1WZ1L 3HZVB 4IS6B 5ETUB 3P0YL 4I4WA 2XTJB 4IJ3C 3JWDH 4PGDA 3ARDB 5DHXB 1KT2A 1VPOL 1Z9OA 4XVTL 1GZQA 1IL1B 1J1OH 4ZTPH 2E6JA 3MV9A 5KJRL 4HFUH 1H3PL 4FQXB 2EH8H 4ZD3L 5H37G 5HY9B 1EUUA 3CFDA 2I60L 3ZT6A 5C9KA 1N5YL 3JTSA 3LZFL 5GPRA 3MLWH 3MR9B 4LARL 1K4DA 4M4PA 4CRPA 2ZOKB 5C0BE 4U4BA 1MVUB 1XR9A 1JZ2A 4U2ZA 3UTSB 1TZGL 4WCYH 1YY8A 2BSSB 1LO0L 4OT1L 2Z8RA 5HYEA 3OKLA 4FXGB 3IGAA 1HYRC 4DVRH 1DR9A 2J88H 1TFHA 3CU1A 4ZPTA 3IDUA 2WBJC 4KK6D 3EAKA 1NAKL 4JM2C 4XNMA 3G5VB 1PG7X 3MNVA 3TN0A 1L7IH 1BOYA 3QIUD 4UDTB 1S7XA 5D7IB 3T0BA 2FEEI 3VXTA 4WY7L 3M17A 3MOAH 1XZ0A 1CD0A 1FNEB 4EDXB 3RY6C 3KPSB 5C0ND 5IBLC 1NLBH 2JJTC 1DQJB 1VFBA 1YC7A 2DQCH 2JE8A 4ODSH 5D7LE 2DF3A 1NCAL 1II4E 3WFDL 2CUIA 1RIUH 5GS2D 1DTUA 1O7SA 4IMKC 4L9LC 4NO0B 3DMMB 5ID1B 4BQCA 2MKLC 3MV9E 4U1NB 3LKSA 2CMRL 2EKSB 4LU5H 3IU4L 5DRWB 2FZ3B 2GIYA 5BMFH 3WIFB 7FABH 3BEVB 3QDMA 3B6SB 4DFHA 4FFVC 5DJYB 3QQ3A 2JIXD 4Z7VF 2CKNA 3NCFB 4KTEH 4AENB 1MJ7H 4U6YA 5CEZH 3IDYC 4X98B 3RL2B 3DX6A 3QUXB 1I8IA 3TH2T 4PGZA 1DDHB 5C0RH 2BNRD 5CP7A 5C0BB 4CDHA 3TIEA 3D25A 4WI6A 1TNNA 2DYPD 2QQNH 4QYOA 1NAMH 3TYFA 2JB6A 1MY5A 1CU4L 4QXGH 4X6DE 5HD8D 1AQKL 3PP4L 3PWNA 5T5NG 2NW3A 1Y6MR 1D5ZA 2PF6A 4EN3D 2C3VB 2BC4A 3A67L 1I7ZA 2ESVD 2OTUA 4P5TA 5ACZB 2BNQA 5SWQB 4PTTB 2BNUA 2XQYG 4XVUD 2GY5A 2VDNL 1H3GA 4JFPA 3VW3L 2VQTA 1KIRB 3L9RA 4NO2B 5ISZA 4CDGC 1A4KA 3VXUA 1TETL 4PTUB 2MTPA 5DD0H 1NCBL 4UB0L 5DF0A 2Z91B 1MFDH 1VCAA 5A2JH 2VQ1B 4F9LA 4K3HA 1MCRA 3BE1H 3OJDB 3FQTB 3P11H 4L4VA 3ARFA 4PG9A 3UXFA 3VDCA 1MFCL 5E2TL 2FL5A 4WHDA 2ZWLT 3K80A 2A83A 5F9OL 3TA3A 4GQ9L 3UTQA 5D7LB 3VFNA 4IDLA 3C09C 4APQA 3FO2A 4JFDD 2EC8A 4I4WB 4PGDB 1JZ4A 5HGGS 4KVCH 4ZFGH 1GZQB 5I76B 2W9LA 2OP4L 4PY7B 5I18L 3MV9B 5I1KH 5IV2A 4KK6C 3ZHKA 5I73B 3S36X 4FXKA 3MCLL 1WT5C 2N7BA 4X5WB 5D6CA 5DD5L 3QIUC 3JTSB 5JDSB 1JNNH 1R5IA 4X7SH 1FL5A 4K3GA 3U30C 3QNXA 4UTAH 1XR9B 3U4AA 3ET9F 4PS4H 4NNPH 1YY8B 3QZWA 4Z9KB 3TT3L 3OKLB 3PE9A 3IGAB 4B5EA 3V7MA 3WFEL 3VXQA 5C0NC 4ZPTB 1CFNB 1LO3L 3VFOA 3LMJH 1Q1JL 3T2NL 4XNMB 5TE6H 2L4OA 4NHCL 5JUEL 1QFPA 4X5XA 2NY7L 5I1IH 5K9KA 2P44B 3JV5A 3IAPA 2QHLA 4F7MA 1N6QL 3V8OA 1X6NA 4NHUA 1XGYL 4X6DB 3VXTB 1WITA 5IHUL 4YHNA 1AGEA 4XVSL 2VXUL 4YHYC 1YYLL 2EDEA 4NRZA 4L4VE 2GFBA 1KEML 3D6GA 2DQIL 3EUUA 1VFBB 1KPUA 2X9WA 1EERB 1J12A 2GTWB 1G9EA 1QNZL 4KMQA 4UU9A 3K81A 5J9PA 3KPQA 5BO1L 1A0QH 4C54A 2I26N 4NP4H 3G9VA 4GKOA 3JWNC 3MV01 5T3ZD 4XPGL 4HWBL 3HRZA 1IAII 3TESA 5F9WC 1VFAB 4OF6A 4TOYL 5TDOA 3QDMB 1K6QH 5I8EA 5INDB 3ARBA 4F8TA 3FRPA 3QQ3B 5KVMC 1ZHLB 1ZV5A 2HH0H 5HD8C 4GS7C 2OR7A 4FTVA 3ULVE 4EN3C 1G6RA 2GAZA 3BIKA 3FMGL 4M62H 4GKZA 4C56E 1XGPA 4XVUC 1W8OA 1A14H 1LO5A 1AXIB 1P1ZA 2DBLL 2FH8A 2VZ3A 1CD8A 5ESAB 4IOSD 1OQXA 1A3QA 2XICA 3BQUA 5IR1A 3BW9A 4S1RH 3VRLF 3ZHLA 2GJZA 3N1MC 3WHE1 4H0HB 2VISA 2CPCA 3BXNA 5FO7B 4QYOB 4Y8AA 3HC3L 3QPQD 1M7XA 3TYFB 5LWYL 3OR7B 1EO8L 2W07A 1D5ZB 3C6SA 3HNTH 1ADQH 3AY4A 4OD2A 3SGKC 1I7ZB 2OTUB 3EOTH 4OLUL 2AEQH 4MAYD 4P5TB 1FPTH 2BNUB 4PGEA 3B2UD 4JFPB 2ZCHL 3L9RB 2R0ZL 5GHWL 1GCFA 1P5VA 2H1PH 1NLDH 3O6FA 1A4KB 4M7JH 5IB4A 1PFCA 1I7UA 2CO6B 4YFLI 2L0DA 2ARWA 2P8PA 3MLXL 1D9KB 5KVGH 4KUCD 4KKCD 1R0AL 3CFCH 1MNUH 2NY6B 3G04A 3GDBA 4OGAD 1YY9D 4L4VB 4PG9B 5C3TA 3ARFB 3OKNB 4MJ4A 3H7BA 3TA3B 2A83B 3UTQB 1QSFE 1CL7H 1G9NC 2E6PA 3FO2B 1T1WA 5JA9A 2FD6H 1J1PL 3L7FA 4FFZL 5DJZA 3FB6A 1I8LC 3I3DA 4FTVE 5IV2B 5HYIA 1HSAA 4AEIL 4ORZC 3V79C 3Q5TA 1BJ1H 5AWNL 3GUTA 3F58H 5J4MA 3MLVL 2CXGA 5DVOA 3BH9B 3O45B 2XWTA 4KMLB 2X05A 1RK0A 3BKJH 1FL5B 4GRWH 5J56B 3VD9A 3MYJB 4WCYL 2VYRE 3RGVA 2GT9B 3LB6D 4DVRL 5CSZA 5D72L 3UC0H 1RK1A 3QZWB 1YEJL 3IRZA 4C56B 3VXQB 2ID5A 5AYUL 3WFBL 4DKEL 5F6HJ 2IGFH 3NIDE 5HJ3B 2XA8H 1H3WM 3VFOB 1L7IL 4K7PL 1QD0A 3QEGH 3QXWA 4HD9A 5I9QC 4PJAF 4ZO9A 3RFZC 5C07D 1U8KA 4X5XB 1NGPH 5K9KB 2HWZH 4GLRH 5CJ8A 5JTWA 3RHWF 1PG7W 3U9UB 4YXHL 3WJJA 4F7MB 5E8EA 4IMLA 1MCDA 4WUUD 3ISWA 4YHNB 1F02I 1AGEB 4G6ML 5IB1A 1WFUA 5JR1L 4M8VA 2GFBB 3OKMB 2C7UB 4ODSL 2QSTA 3ZE0E 1FQ9C 3QO0A 3KLSA 5E6IB 4AG4L 4UU9B 5IBUG 3K8MA 5J9PB 3KPQB 2MQCA 4LU5L 5FM8A 1JN6A 1D6EA 1FNGA 1REIA 4IOIA 3SCMD 3L1OL 4ZMAT 5HYSG 4MCYA 4X0KA 3HRZB 2YOCA 4Z5RB 1QSFB 4KKNA 1B4RA 5TDOB 2AP2A 1FNSH 4LMQE 2B1HH 4PBVC 5I8EB 2R0KH 3ARBB 3F7RA 3QPQC 3EGSA 1FGVL 1Q94A 4KTEL 5IROA 5CEZL 1QFHA 4EI6B 4FTVB 4YNYB 2GAZB 3BIKB 3VXNA 4GKZB 4MAYC 2BSRA 1XGPB 3QUZD 3B2UC 1D5BA 1P1ZB 1LO5B 1JUFA 3TV3H 1MCEA 1NBYA 1I9RH 1W72L 3S35H 2BRRL 2QQNL 5IR1B 1IC5H 1KXVC 3BW9B 5E9DA 4I0PD 5DD1L 1CZ8H 2E7HA 2Z92A 4KKCC 4ODTL 3TBWA 4OGAC 2ZKHH 3BXNB 2Y9RT 1YY9C 4UNTA 3MUGA 1EPFA 2N1KA 2YWYA 4YHMH 1INEL 5ICXB 1ZVSB 1LEIA 1G0DA 1BMGA 4OD2B 5EC1A 3RA7L 4KI5E 5GGVL 3C5JA 5D7SH 4Z95H 1PX4A 3MRHB 4PYGA 5DS8A 3S7GA 4AY0A 4C57C 1CD1A 5DD0L 1CCZA 4LPVA 4KROB 3O6FB 1NEUA 1KJMA 5IB4B 1UH4A 1I7UB 5IHZA 2P8PB 3B3IA 5BVJA 3P11L 4HWEH 2I5YH 1YNTA 3I3EA 1YEFH 2MPAL 4R7DB 1CFQA 1U8IA 3LB6C 4KVCL 4ZFGL 3S98A 3G6DL 1T1WB 4PJGF 3L7FB 1J86A 2WIMA 3HFMH 4MNQA 4R3SA 2WNGA 2FATL 5DJZB 4K55A 3L5XL 3FB6B 4LLWB 1HSAB 2BY0A 3GUTB 3LD8C 4HIEA 3NA9H 2XWTB 2B8OT 1TXKA 4KUZH 1T7YA 2UWEA 3P3YA 2FBOJ 5F6IC 4NN5B 3SO3B 3RGVB 1TQBC 1NCDL 5CSZB 4LNRB 5AG9A 4R4ND 4M6OL 3RTQA 6CGTA 4L3ED 5DYOA 4LPCA 3UJJL 1OLZA 1PKQA 5TE6L 1Q9WA 1T7WA 2QLVB 5HGDA 4Z7NE 3E2HB 4XP1L 5I1IL 4MNHB 4R0LC 4QRQA 1CXLA 1NUDA 1UM6L 3BPNB 3EBAA 4FQCH 1U8KB 2AK1H 4QXUH 4H1LH 2VUOA 3NPSC 2WUBH 2Y7QA 3SCMC 5E8EB 3RBSA 2K9UA 4FMKA 4DKFH 3BD3A 3L7EA 5EUOA 3QPXH 4ODUA 1S9YA 3AM8C 2ADJA 2DMCA 5D2NC 2EDXA 3ABZA 1D3CA 3QO0B 4N8PA 1A0QL 4MNQE 3QUZC 2CKBH 1ZS8B 1RJLA 2J6EA 1FNGB 4DQOH 3MJGX 3N1FC 1K85A 2AI0H 3C5ZA 5K9QG 4X0KB 1T83A 4I0PC 1T5WA 3CJJA 5C0IB 3HI1B 4HEME 1F00I 3NFPA 4PJFE 2UWEE 5HHME 3EGSB 1E6OH 1Q94B 4KRMB 1ZLWH 4M62L 4LQ1A 3GBLA 4JFFD 3HPLA 3VXNB 2FLRT 1UXWA 1JUFB 2Q7NA 1ZA3B 3KYOA 1PKQE 4OQTL 1KTDB 1JNLL 2FB4L 2VLKA 3UBXG 1S7SA 3G6JF 5GS0D 3BIBX 3UDWC 1EEUA 1YPZE 3P2TA 3W9EA 4EI5A 1KYOJ 4QNPE 2Z92B 4MQTB 5KW9L 2APWA 3TBWB 2BDNH 3HNTL 1LE5A 2CRYA 3MUGB 1UA6L 1Q9OA 2ICEA 4QTHA 4I2XA 4NJAL 1LEIB 5EZIH 4LP5A 4FQJL 5EC1B 2UZXB 4U33A 5EUOE 4WENB 2H1PL 1NMCC 1A1MA 1FVEA 5DS8B 2DQGL 1NLDL 4MJ6A 4M7JL 1CD1B 1IGYA 3DURA 2XTJD 2CH8A 1QSEA 3ARDD 1KJMB 1A7BA 2D7QA 5DQ9B 1I1YB 5IHZB 3BSZL 3I6LD 4U7MA 5F1KC 2EZ0D 4FQXD 3VI3F 2WZPD 4KJPD 5GJSH 5FECA 1YNTB 4HWUA 3LQAC 2PW1A 2HT3D 5F7HA 2W65B 2L7UA 4EXKA 1E4JA 2ED8A 1CFQB 1U8IB 4GT7A 4D9QE 3VD4A 4R4NC 5SX4H 1H3VA 1P4LB 2QADC 1KFAH 3UTSD 4MNQB 4R3SB 3OJ2C 1B4JL 3RY4A 4LSTH 3QHFH 3WS6A 3F58L 4ELME 2EKJA 4YEFA 3RVUD 5CJQH 5DGRA 3H3KA 1DBKH 4QRRA 1GPOL 4HIEB 1QA9A 4O2FA 4PJFB 5H37H 5I1EH 2UWEB 5DD6A 5J12B 3U9PL 3ZDZF 1FG2B 3UC0L 3K3QA 4Z7UE 1ND0A 1CDYA 1JE6A 3TCXA 2H6PB 4YDVA 4AL8L 4X6BA 2VKWA 1HINL 4HH8A 2Y1VA 3V52L 5GRVK 1PKQB 3M8OL 3PWUA 4X4XA 1RHHA 4I2XE 3KPSD 1JPGA 5M7QA 4QRQB 1LK2A 4NCDA 3P4MA 1YPZB 4KKBD 2QQKL 4I5BA 4JO2L 5MI0C 4UUJA 2NY5H 5FYKL 3BPCA 5INCA 3IXAA 1KB5A 2Y7QB 4JZJC 4F2MA 4NO0D 5LCVL 3DMMD 3GMRA 4W70A 2Q3ZA 3ARWA 2G2RA 3OV6A 4GKSA 3HC4H 4C4KO 5EUOB 4M43L 1S9YB 2ADJB 5HI5D 5JA8B 1HZHL 3MOBL 1DEEA 3I50L 3MRKA 1KEGL 4U6TA 2PN5A 3CMOL 1QPPA 4JO1L 4KDTC 2ICCA 4G43A 3JWOC 5JW3H 3WIHA 1RJLB 3TT1L 5B8CC 3GGWA 3QUXD 4XNQA 5JPMA 1AIFA 3C5ZB 3DPBA 3MUJA 5GS0C 2OK0H 3B2VH 2VZOA 1OSPL 3BWAA 2R0KL 3WO3B 5C0BD 2Z93B 4XXCC 3V4PL 4X7TA 4XHJD 5D70H 1YDPA 1MAKA 5C6TH 1EHLL 1M05B 3V4VH 2D7OA 3O3EA 3HPLB 3PWPA 5IQ7H 4BZYA 4J3SA 1UXWB 4XCNA 3QEHA 2C3HA 3KYOB 3C6LA 2XTJC 3HE7A 2ATKA 1IC5L 3ARDC 1S7SB 3FFCA 3SN6N 3RUGF 1H3UA 2EDQA 4XWGH 3C8DA 3EOAA 2RBLA 3W9EB 2ZKHL 4Z7UB 2EZ0C 2B1AH 4FQXC 2YK1L 4XP9H 4KJPC 4YHML 5JW5A 3HG1E 4ZUWB 3EOBA 1MCBA 1LE5B 2HT3C 3D9AH 3E6FB 1WK0A 1JVKA 3MGOA 5T1KA 5MHSE 4QTHB 1KIQB 4I2XB 2YXMA 4WIQA 1A1MB 1FVEB 5D7LD 4MJ6B 4H8WL 1JF6A 3DURB 4J3VA 3A6OA 4PJCE 1QSEB 5L9DL 3L3OA 3RVUC 3Q5YA 1LO2H 5J11B 4G7YH 3QSKB 2I5YL 3MV9D 3RWFA 1YEFL 1W0WB 5EO1A 1T66D 2A6KA 2WWKO 1FL3A 2PW1B 4Z8FH 3O9WA 1DL7L 1KC5L 4XWOD 3BVNA 2QKIB 2DKMA 2DDQL 2ORBL 3DNKA 4ZS7H 1K4CB 3ESVF 3V8CA 5BV7B 1OQOA 4F3FB 3P9LA 1RUPL 2CDEA 2OZ4A 5HGAA 4OF3A 5D6DA 1VEOA 1RZ7H 1CG9A 3PWPE 1SVZA 1BOGA 5JXEA 2DQUH 4KKBC 1NGXA 3U7YH 3OMZA 1QA9B 4LF3A 4O2FB 2AJYH 5DD6B 3FFCE 5KSUA 5CZKA 4NBXB 3DMMC 1UADC 3MLRH 1ND0B 4OJFH 5EOCH 1XF2B 4YDVB 4BSJA 4X6BB 2ZUUA 4NOBA 5DMIH 4NNYA 3PWUB 5HI5C 4X4XB 1UXSA 1RHHB 5C1MB 4HPOL 4PG2A 1LK2B 3P4MB 2ZCKL 4I5BB 2BXZA 3LPFA 4HKBA 5B22A 4UUJB 3BPCB 5INCB 3SKNA 3HG1B 1J9CT 3QUXC 4YHKH 4DKFL 3E3QE 4F2MB 1YJDC 4UNUA 3GMRB 5LGKA 4JG0H 2RJMA 2WV3A 5IFHH 4XHJC 2Q86A 5HDOA 3QDMD 3QG6B 4XP4H 4PJCB 1DEEB 3MRKB 5IM7A 1INDL 4LLYA 4G43B 3MMEB 4DQOL 4HIHA 5FXCH 2AI0L 4MZ2A 2P49B 2XQBH 5IMLA 4LPXA 4NO5A 3CU7A 5CZVH 3GGWB 3T2PA 1HDMA 5JPMB 1AIFB 4ODVH 4F7EA 2AAVA 3CK0H 4DTGH 3BWAB 5DK2A 4R96B 2JELL 2XZAH 1U8NA 5FGRA 3S88H 1E6OL 3D0LB 3WHE0 4D3CH 4JRXE 5BZDA 1VERA 4X7TB 3S8WA 1ZLWK 4N0FB 1CDHA 3L5HA 1GXEA 3P0VH 3QI9B 2I9LA 4U49A 1ZVHA 3EZJB 4OTXH 3PWPB 5D2LE 3GI8H 4EIGB 4YWGH 4XCNB 5L8JB 3QEHB 4OGXL 4LKCA 4PP2A 2WLYA 5AYQA 4IBLT 2W0PA 4XC3L 3C6LB 2P5EA 1P7KB 3QWRA 4HJGB 5ESVA 4P5TD 3HE7B 2ATKB 1BFOA 3FFCB 4NQCA 4OKDA 3EOAB 1LO4L 3FAXA 1LDPL 1CTOA 2BDNL 2BVOA 2EDYA 1IEAA 3CFIC 5I73C 4JN2A 5I1AB 3OTTA 3B5TA 1T66C 5JW5B 4XPTH 3EOBB 1D9KD 4QRUB 2Z35A 2X4UA 3WUWG 1MREH 2XFXA 4YGVA 4OCYH 4M1DL 3MLSH 1CDCA 1C7TA 1MCQA 3MGOB 3PGCB 4OIIH 5HXMA 4XWOC 4DVBA 2NY6D 3IDIA 4FQLH 2YD3A 4L4VD 3ARFD 4KRLB 1U8MB 4RAHA 5A43C 3TA3D 1FV1A 3BD5A 1MHEA 4GBXA 4CMHB 4M5ZH 5FUOH 3L3OB 4M7LH 5DJ0A 1NUFA 2G9HB 3D0VB 2FX7H 5GJSL 5I1HH 4AEFA 5I8OL 1N5AA 4JO4H 2O5XH 1PZ5A 3RWFB 4JKLA 1FL3B 2ITDA 1WBYA 1SYVB 3O9WB 1KFAL 1N0LA 2H32A 4Y4FB 5B38A 3CUPA 4HIXL 5FDYA 1BHGA 3QHFL 3ULVD 2Y72A 4JFXA 4PJEA 2YRPA 5HGAB 4C56D 4MAUL 3NGBB 2I25N 2W60A 3DHMA 1BOGB 1ACZA 3C60A 3RDTB 5I1EL 3WKNA 4U1JA 4LF3B 4Z0BH 3NFSH 4JRXB 3BZEA 3NH7H 3CGTA 3DVNA 3E8UL 5KSUB 4FABL 1FO0H 4NQCE 1F6AB 4I48A 3LN5A 2CUHA 3EYUL 5D2LB 1BD2E 1B0GB 4WTWA 2ZOLA 5KSBA 4NNYB 1UXSB 4JVPA 4P3CH 1EAPA 5AD0A 3U4BH 1A7QH 5TPWH 5E8PA 1T5XA 1YNKL 2XTLA 4NBYB 3N1GC 1HKLL 4Z78B 4NKMA 4NQSB 4HKBB 1OP3H 5E6ID 4M7LT 5I1DA 3RPIB 5MENA 1FRGL 2ADIA 3UPAA 2PTVA 3LS4L 2ED9A 4JZOA 5FKPA 3KYNA 4ZSOA 4HUXA 4G5ZL 2VSCA 3DV6A 5TGBA 2Q3AA 4GUPA 3ZYIA 3ZSTA 4RCAA 4MA8L 5TE7L 1K3IA 4OZFB 2PNDA 2Q86B 1QSFD 4JGMA 3GSQB 4IOFD 2IEPA 3SBWA 1MWAH 4OZIA 3ARBD 5JW3L 4ZOCA 1SY6H 5IM7B 4FTVD 4LLYB 3VMPA 4HIHB 3HC0A 5IMLB 3VXOB 4PJEE 4NO5B 4P5TC 3KJ6L 4F7EB 1HH6A 1WC7A 4P9HH 3DBXA 4G3YH 4M93B 5CUSL 5DK2B 5D70L 2DTMH 3BP4B 5BZDB 1D9KC 5EFIA 3GMLB 5I0ZA 2QQLL 3K1KC 5SWSA 1FC2D 1TVBA 2F74A 2I9LB 1MF2H 4DN4H 4TNVK 5IQ7L 2NY6C 1L0XA 3ARFC 4LGSB 4ONOA 1FP5A 1VGEL 3TA3C 1EVUA 4E5XA 5KSBE 2BHYA 4XWGL 3GSUA 5BOPA 4F37K 1BFOB 1KCLA 4NQCB 4HK0A 3RWGA 4KROD 1IEAB 3O6FD 5EPMA 5KVFH 3BZDA 4JN2B 3QQ4A 4G8IA 3P9WB 1UWGL 2Z35B 2X4UB 3DVGB 2A9NH 2XFXB 3BRDA 3HR5A 4XH2A 4X9GA 3ETBF 3ZE1E 3IDIB 3OHXA 2DAVA 4YBQD 4RSVA 2W38A 3CFEA 3ULVC 3ALWA 1WZMA 3TF7C 4GBXB 4O5LL 3RKPA 5IK3A 1YMMA 2XQYK 5KVDH 2R0LL 2PO6A 1R5WA 5T3ZH 3NN8B 4OV6F 1N5AB 3HAEH 1PZ5B 1DQQA 1IC1A 1HHJB 2V7HA 5LGHH 4ZS7L 2HRLA 4PRIE 4X5LA 4LKXA 1TVHB 3RGVD 3UAJD 3CUPB 4GMTH 1IGCH 1F8TL 4MA3A 4LLAA 2P5WA 2IQAB 4MHHG 5DJDB 1IKFH 1UENA 2DQUL 4PJEB 1K2DB 1MIEL 4N8CH 3QA3B 3TZVA 5FEBA 1AO7A 4U1JB 2DQJH 3MBXL 1U8QA 5E6IC 3SDAA 3KYKH 5I71B 1F2XK 3SKMB 3BZEB 2RFXA 3QCUL 3DVNB 3QT2A 3MLRL 4Q9BA 3D18A 1CE1H 4I48B 3AMLA 3RX7A 2VABA 3LN5B 5FHBH 3IFNH 4L29B 2CUMA 2EDTA 3CZFA 2ZOLB 5KSBB 4IOFC 4KI5D 2VLRE 3J7HA 1U91A 2KZWA 4Y2DA 4DFIA 3LRSB 3ARBC 4QRPA 5EO0A 5E8PB 3UJIL 4EIZC 2FX8H 3PL6A 1ROWA 1DQLL 1KN2H 2HFEB 1WBZA 4YDLB 5I1DB 3MRGA 5MENB 3V6ZA 2QSCL 5DMKA 43C9A 3GKWH 1ZHBA 2DB8A 4JZOB 4RAUA 4KXZH 4HUXB 1O7VA 3DV6B