4X6DF

Cd1a ternary complex with endogenous lipids and bk6 tcr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRYFLPTQGMGAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1a
total genus 60
structure length 241
sequence length 241
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dF02
1YEFL 4HUVA 1JYNA 3FO0L 5DYOB 4XNXH 3W82A 4JM4L 4A2LA 3TFKD 4IOFD 2GJZB 5F3HA 3ZO0A 3KJ6H 3IDJB 4X6BB 1YJDC 4MJID 5B3NA 4JY4B 5DMGD 5LCVL 5GSVB 3BPOC 5I74C 4AM0B 3MV9B 3N0PB 3WFHB 3WIHA 2YD2A 1FNGA 1SM3L 1MFDL 2X9WA 1ZA3B 4NO0A 3VFWA 1UXWB 5C3TA 1JF1A 1J0ZA 5D7KD 3SDXA 1PG7L 3F58L 2F74B 4G6KL 1CU4L 2ZPKH 2ZSWB 4ODBD 4PJFE 1I3GL 4MJ2A 2BFVH 1ETZB 2EH7H 4ZFOA 4APQC 2DBJA 2ICCA 1CDHA 1VADB 4BSVA 3X3FL 4D9LH 5IHBA 2XACC 5T3ZD 2JK5B 1NMBH 2R1XA 3MMEB 4F7TB 4F80A 1I9EA 5E1HB 4KVCH 5ISZD 3QFJE 4D9QE 4HKBB 1RZ8A 4UDUA 1AY1H 3MLTB 4K3EH 2EDWA 3LKPA 2I60L 4QRSB 3WUWA 4H5SB 3MV8E 1RZKH 5HYEA 1RJCA 1T1YA 5CP3H 2GK0B 5FYKU 5ECJE 2OXGA 4MHHI 1FZJA 1U0QA 3L5JA 4HX1B 1JZ4A 2FIKA 4OF6A 5TQ2H 2DTMH 3QUMB 5CD3A 4JANA 4JQXA 1YC7A 3LRHA 2GTZA 4WFGD 4WFEE 2OTUA 2BVYA 1VB9A 3MJGX 2OSLA 5DVLA 1RZ7H 2IAND 5D6DC 3SDAB 5F9WC 1JGDA 4OZHF 1RK1A 3T8XA 3LKPB 5F71A 4M6OH 3N85L 5C9JA 3D0LA 3HMXH 2APFA 3MLPA 3PGFH 5MHSE 2ZNWA 4ZUSA 1VPOL 2DQEL 2QHRH 4Z0BH 1VACB 4CDHA 2GTZB 5DJXA 4V1DD 4EN3C 4JFDB 2EECA 5HI3C 4C56A 2FIKB 4M7KL 1GGCL 4CW1B 1FJ1B 1LVEA 5TDNA 1WBXA 3WFBH 5AD0B 2AGJH 5T3XH 1JZ6A 5AG9A 3GUTB 2XKNB 4L3EB 4R2GB 3FHAA 5CJ8A 4LP4A 4NO0D 7FABH 2H8PA 1LNUA 4HUWB 5E1AB 3HRZA 1ND0B 2XWBB 1BFVL 4KVCL 5F9JB 4C58B 3H2WA 2ZUQC 5ENWB 5EBGA 2J8UA 5FYJD 2V6HA 5HHOA 2BY2A 5IV2B 1L4IA 4JRWA 2EDLA 1ULVA 1S7VA 3BWUC 4P5KB 3QZWA 4MD0A 4LSSH 4RIRA 1U8OB 3QUML 1W72H 1T2QH 3C60D 3NFNA 4ODSL 1FYHB 1SEQH 4N5EC 1KC5L 2BCKA 1WWBX 2FECI 1IQDA 3A6CL 1JPTH 1II4E 3JWOH 3NH7H 2FIRT 1YYLL 3SOBH 4Y4HB 3T0DA 4X6BA 1PG7X 4HXBH 1FN4B 4ELME 3FOLB 3OKEB 3TYGH 4Z7UF 3JZ7A 3HCVB 5F1KC 5J9PB 3MBXL 1DBKL 3MV8B 3CFBA 4HIJB 4CAGA 1T4KB 2GJ6E 3FQWB 1WCBA 4RGOL 5HHQA 4XGZB 5I30H 2BVPA 3V6OE 4KTEH 3CSPA 4O2FB 1K3IA 4EUPH 4MWFA 1A7PL 4YX2H 3BJLA 3L7EA 5A40E 5CEZL 4PB0L 1MHEB 2X4TA 3P4MB 4OZ4B 3RWDA 1ZA6A 1D5MB 2GCYA 4PGEA 4XMPH 5DD0H 4HMDA 4KHTH 4ZFFB 3VFOA 5GRWA 3WXVH 1P4BL 5D96B 3CXDL 1OGTA 4L9LB 3C8HA 3X11A 4O58H 4M61A 4XHJD 3WO4B 4EDXA 5E8OA 5ICXA 2OP4H 3KYMB 4GSDH 1ZAGA 4LOUC 4DK6A 1FC1A 3I50L 3VA6A 3GI8L 4GRWB 4RAHA 4BSWA 2EEDA 2WIIA 1T83C 3LKSA 2IBGA 3MLXH 3SJVB 3S5LG 5TE4L 4BFIB 4EQ3A 3RPIB 3TA3A 3B5HA 3C6LC 3IU3B 3CVHB 4Y5XC 3QFDB 5IJKC 3TJEH 4M43L 3NTCH 1MEXH 1RZ7L 4ERSH 4Z77A 3N9GH 5DA0B 1L6ZA 4RIRB 3OTTA 5DSCA 3Q1SH 3MLSL 4LLWB 4DGIH 4U7KA 5DJ0B 3EW3B 4JHZA 4NC2B 1R3HB 4AIOA 3FRUB 4NNPH 3ET9F 1FLTX 3MRLA 3CMGA 4OB5H 1HKFA 5EO9A 3MYJA 4K55A 4PREA 3LZFL 4X9FA 1XGUA 3L6FB 2DQUH 4PV8A 2FX9L 5C2UB 4U3XA 1WSST 3MGTA 2G9HB 1QBLL 3UBXA 4EKXA 2E7HA 1HOCB 1LNUB 2UVFA 2I07B 5A2FA 4Z76A 4DGIL 1PZ5A 2R1WA 4MMZC 1WT5C 4G80B 5AZEH 2AI0L 3BP7B 4MVBD 5AD0A 4UNTA 1VGKA 4P46D 3IJHB 1S9XA 1MRCL 4S1SH 4I3GA 4RDQF 4MDIA 6FABH 3MC0A 4NUGH 3LIZL 1C7TA 4PJXA 1G7JB 1C16B 3S97C 4JREC 3VMNA 5KW9L 3V52L 2MHAA 5C3LD 3MLVH 4TN9A 1M6OB 3EO9H 1GGUA 4XPBH 4TTDC 3X3GL 3HR5B 4GSDL 5IM7A 4XVJH 4UU9B 4L29B 4Q0XL 4ZO8A 1YMHB 5FIEA 4K8RC 4MXVF 2A0LC 2R2BB 4JG0H 1K4CA 2CKNA 2ENYA 1Z5LA 4LRIA 1NAKH 2YUZA 3DUSA 3G6JE 3KPNB 1QBMH 4PD4K 1CR9H 3ZT6A 3F7YA 3I75A 1TZIA 3SKJH 4U1KA 3KLHD 3KPPB 4K8RL 5IG7A 1NDMA 3WNPA 4KK5D 5I1JH 5ICYA 3QULB 1S7RB 3WS6A 1F3JA 2PXYB 1A7PH 1VFAB 4FQLL 2GJ6D 2EDTA 5C92A 3GMOB 4I5BB 2Y7QA 5C0CB 4J3WA 1ZT1A 5H35B 3P0VL 2IPKB 1CLOH 1JNNH 5D9SA 1WWAX 4MAYD 4YGVB 1S9VA 4MYWB 1VFBB 2PYEB 2QSQA 3EOAB 4H1LH 4JFXB 3SO5A 4PGDB 1W0WB 1QBBA 3WNMA 1KEGL 5L8LB 1IAII 5DQJB 4F3FA 4K3DH 1M7DA 4YPJA 3FN3A 3GI9L 2HFEB 2BNQE 1QSEA 2DRUA 4PJ5D 5F7EL 2PR4H 1A2YA 3EYUL 3PNWB 3MBEA 4K94L 1ZLWK 5MEQB 5CJQH 4YNYB 1MCLA 1YQVL 1MCDA 1FORL 4OLEA 3O6ML 3JWDC 1E0OB 4GBXC 3HZMA 5KTEL 3QUMH 1PKOA 4XNYL 5C0CA 3QXDA 5F9WB 5JW3L 2AJXH 5KSVA 1IGYA 3SDYH 4G8FA 1BFOB 1N8ZA 4NO3A 1ADQL 2H41A 4L4TE 4IRSB 5F88A 4U1LB 2XN9D 4IMLA 1FZMA 4Z9KB 4P2OB 3BP6B 5T1DL 4U1JB 1R3KB 4MXWH 3ECBA 4UQ3A 2JLLA 1AKJD 3VD7A 1GOGA 3H0TA 4KK9C 3RWEB 2ATKA 2VZUA 3VGGA 4GG6E 1FZKB 3QUXA 4O5LH 1P7KA 4H1LB 4NCC1 3QG6A 4KC3B 2F8XC 3QDHA 4KZDH 1KJMB 1S7XA 5C0BE 4XNQA 1M7XA 3K4ZA 1BFSA 3BDYH 3RTQD 3O4LD 2Y25A 1PEWA 5IVXA 1TLKA 3U7WH 4OGYH 4WU7A 3HMWH 3FOMB 4ISVA 3KPRE 5KSAB 3ES6A 3O2DA 5GGUA 5TPWL 1LO2L 1CE1L 4LPUA 3EGSA 1DEEA 4EJ1C 5K9QI 3O6LH 1WEJL 2YPKB 4NBYB 2OR9L 2VDNH 1CXHA 1UJ3C 4KRMB 2VLLB 3VD5A 5HDBE 4X5LA 4PLJD 1U8MB 5F3BB 1KT2A 1NUNB 2VZOA 2P47B 1I9IH 4CBPA 3RWJB 3ZDZF 4WCYH 5HDBF 4K9EH 5E8DL 3WFCL 1DUYA 1CLZL 2Y1VA 4U6XB 3VXME 1JE6A 3EGSB 3U0TB 4CMHB 1PKQE 4FXLA 1KXTB 2AK1H 5D93B 2QQLL 3VXUB 3ZDYF 2B5IB 3QT2A 1RU9H 2R2HA 1ORQB 1CDGA 4DZ8A 2J4WH 5AYUH 2D7NA 1YEGH 1Z2KA 4WTZG 3BZFA 5IK3A 1FNFA 1T66C 4Z18A 4P23B 5DUBA 3ARVA 2X42A 4JQIL 1UJ3B 3OHXA 2J2ZA 3MRMB 5KSBB 1QFUL 4MMXC 1OAXH 4DQOL 5ILTH 3AMKA 4JPKH 4A6YH 3RRQA 4X99A 3QEGH 4Y19D 3SBWA 2R2HB 4HZLA 5F7FA 3ZDXF 3S98A 5I1GL 1I8KA 1T0PB 3MBXH 3M45A 4A2MA 2YD1A 1JNHB 4YFDB 4ZNEE 2WIMA 1A9BB 3TO2A 2VQ1B 3TYGL 1UWEL 1SM3H 5FM5O 4LPXA 2VXVL 4HUXB 1E4XH 2ESVA 4I3RL 3CX5K 4X6CA 1A7QH 4XVTL 5ELIA 2J88L 1AP2A 1IE5A 1GGYA 1FVEA 1JV5B 4FQHA 4IHOB 3QPQC 4FABL 2GJ6B 1WZLA 43CAB 4D0CB 4KRNA 1IKFH 5FGBC 4D2NA 1OOAA 1YPZE 4PJEA 1IEHA 4Y5VB 5ALCH 3GIZL 3QO1B 3GSUB 4UT9H 5K33A 2VR4A 3MJ9H 3EYOB 4UOJA 5A2IH 4FP8L 5ILTL 3QFJD 4XWOD 5DD6B 1EZVX 5E6ZA 3GM8A 3FT4B 4TNWF 4DTGL 5J1TC 2FZ3B 3KPQA 4QOKE 2VLME 4NZUH 4ONGH 5E2VL 3KDMA 5D72L 5IB1B 4PJAF 4NBXB 4YUEL 4JN1L 3FO1B 2VLKA 4Z7UE 3ULVD 1MHHA 2IALB 2QQNH 3CPLB 3KLSA 1YEHH 5SV3A 4WI5A 3WLBB 1UH3A 4M8VA 2M8XA 4HPOL 1I3RB 3EJYC 2XA8L 1M7IB 1EBPA 5EO1A 4O02L 4OIIL 3STLB 1AD9A 1OQXA 5FK9B 2XWJB 4YWGH 2ATPB 4CADA 1AGBA 1GHFL 1AKJB 3J8F7 4LSQH 2ADFL 3GRWL 4M7JL 1RUAH 1HKLL 3QUZD 2DICA 5ERWB 1KJ2B 5DD3L 1RK1B 3GMNB 1GPOL 5CGYC 3AC0A 4ZDHA 5D7KE 3O6LL 5HGDB 1VA9A 1V3JA 2VITB 4MJ6A 4Y89A 3UPCA 5CJOL 2X1OA 3EO0B 4YHOL 2J8UE 1Q8MA 5FK9A 5L8KB 1A4JA 4DW2L 1JNHA 1NFDE 2HT4D 3AREA 5J89A 5KVGH 4KI5C 1QSVA 4GRMB 3MPCA 3F7YB 2DF3A 3WXWH 1T6WA 4BH7B 3P0YL 2DMCA 5EN2A 4NO5A 3WIIL 1I8IA 4RSVA 4XCEB 3O4OB 1JGUL 4M62H 4H5SA 3GSVA 3VH8G 1EMTH 5KVFL 3CFIC 5EU5B 1JNLL 4JZOA 1I8LC 2IBZY 1FO0L 1WBZB 4LGSB 1MJUH 2DKMA 3MJ8A 4WTXA 4PJAA 3VXUE 3BRFA 5T5FL 2DIBA 5EOCJ 4QF1B 3T2NL 1IAIM 2IPTH 1E6OL 3AB0C 2GK2A 4XNZB 1CD8A 1BM3L 3M17B 3MR9A 4QRRB 1LO5B 3D9AH 1UGNA 3UDWC 3BIAX 3VD4A 3OAZK 3LQAC 1KV3A 3EZ8A 3NCCB 1AE6H 3MLYL 4MB3A 1J8HB 1I7TA 4LLUA 3T2QA 1Q72H 5HDQL 2H1PL 4MX7A 4HKBA 2HKHL 3CH1A 4PJHA 4RFNC 5IVNA 1IFHH 1VGEL 3EYUH 1KJ3H 4RNRB 5E2WH 5HHPA 5AAMA 3MRLB 3KPRB 1MI5D 4UTBH 1MQKH 3MQIA 1OAUH 4GXVH 1EO5A 3H9SD 3QQ4B 1P5UA 4WY7H 5FHBL 1B0RB 2AXHA 4IEFB 2FCBA 2EC8A 1JNNL 2DKSA 2AKRA 1QR1A 1KIQA 4U6VH 3VRIA 5SWSE 4CMMB 1T21B 4LASH 5HJ3A 5KTEH 4PJEF 4OAWB 5TE6L 3O6MH 5GS1A 1WF5A 1FORH 2OS7A 1IT9H 4F33A 4DZ8B 1MCJA 2H3NB 4HKZA 5I1KL 4HH9A 5FUZL 2ZZUT 3PGCA 2BOCA 3TPUA 4QXWA 3SDCD 2GI7A 1DQMH 2I5YL 1RIVL 1AO7A 3VI3F 4OCXH 1A6WL 5T3XD 2CIIA 1A1NB 2NY1C 4Q0XH 1A9EB 3ZE2E 4FFYL 4ZUUA 3MRNB 4WVRA 1U95A 4DN4L 3QDMA 1DLFL 3ORJA 4G5ZH 1KEML 2JE8A 2WQ8A 3EYFA 5DZLA 4C57C 3TZVD 4FA8A 4ZFZA 5E00B 2FJFB 2R23A 1IM9A 1AIFB 5SWSA 1I7UB 3BQUB 1YEJH 5HHOD 2VZ3A 4JKLA 6FABL 3B43A 1FPTL 1DANU 1MIML 3GFUA 3BSZL 1IL1B 4O9HH 3SCMB 4AEHL 3C5JA 3O3AB 4L8DA 3S34L 4P2OA 1LP9E 1X5HA 4PRID 4HC1L 3V4PH 5EU7C 3S4SB 4TUOB 3SE3A 1W0WA 5BVPH 1MQKL 3T65A 3G5ZA 3MRBB 2FD6L 4KV5F 1D5MA 3UTSE 2EDJA 3LAFA 3PL6A 3NPSC 5KOMC 3FL7A 1A5FL 5CD5C 1J9CT 3TO4A 3UPAA 4RGNC 3HUJF 3LKOA 3W0WE 3UJTH 3QEUB 5AG8A 3BGMA 3QDME 2W07A 2APWA 4Q9RH 4X6DE 4S1RL 4WHCA 4I48A 4Q6YA 5BS0A 4QHNB 2XRAL 2VLJD 2I24N 4N68A 3R8BB 3DBXB 2MQ3A 2A9NH 3GSNL 2IGFH 3U4EA 4HGKC 2AJZA 2FEDD 5MHSD 5DJXB 3FQXB 3SGEH 3KPNA 2HTKD 2ENSA 5C2BL 3CFEB 1HEZB 3VFPB 3C9NA 4UDTA 4LHUA 5CBAB 3VRJB 1N0XL 5INCA 3FB6A 4FG6D 1OW0C 2C7UA 4APQD 3GMPA 4NHUB 2XQBL 4DZBB 1MELA 2IMNA 4G7VH 3EDJA 5JXAL 2YA1A 1FSKC 4PJIB 4TVPL 3IXTB 1G7QB 1U8HB 2C5DC 3IDIA 3QRGH 3MRDA 2ZJSH 1JZ2A 1WAAF 4Z95H 1OWRM 5B8CC 2AJYH 4E41E 4XMPL 4P3CH 1F42A 2EDDA 3PL6C 3NFPA 1EGJA 1IEAA 1MLBA 5JW4Q 4ZS6D 2HFTA 3Q1SL 1FGNL 5F9OL 4DW2H 4Z7VA 2FLBT 1YYMH 2AVGA 5KAQG 3O8XA 2DQJH 2YPLD 2G9HA 2PO6A 1XGTB 4XP4H 4OZFH 4KJPD 1OAZH 4JO4L 5E6IC 2BSSA 2YWZA 3EJZC 3OJ2C 1JK8B 3GB7B 3FT4A 5KG9B 1CZ8L 2P8PB 2R1XB 3U83A 2MQ0A 2MCG1 2AJ3B 5TDNB 1FYTB 1VADA 2YD3A 3S3JA 3NN8A 3EHBC 4OCSH 2YR3A 2XA8H 3TH2T 1CLCA 1CICD 1FNSH 1BQHG 4BFBD 1QFPA 1MY5A 2YD8A 3W2DH 2A83B 1SEBB 1JPTL 3SJVE 4PJFF 3PWVB 4FFZH 1RUMH 1NLDL 1SVZA 2Y5EA 4UU9A 1NGQH 3WUWB 4GRWE 3JWDH 4RX4D 4M00A 5D72H 2R56L 4JHAL 2W0PA 5IK3B 4DKAA 4CU6A 4GKNA 2V7NA 5ICZA 5HHME 5I1EL 4TSAL 1HYSC 2GJZA 3LB6D 2UUDK 3BT2L 1FG2B 4LCCA 5I1DA 5I8EA 3GMQA 5FA3B 4JCLA 4X7DC 1RZGB 2X1XR 1DN2A 4JRYD 4MDIB 4XNZC 1FDLL 2XZAL 3DVNA 4N8PA 5IBTH 4HJGA 4RFEB 4NQVA 4XH2A 3BP7A 4ZSOB 1I9RH 2CRZA 1I9IL 4YAQA 2X4PA 3RQ3A 4X7EC 4R4FH 3WBDA 2F54E 3E8UL 4J3VA 2OL3H 2VSCA 3OR6B 2WUBL 1DANT 1TTGA 4R2GC 2FRGP 1RMFH 1RFDH 2W60A 1Q9KA 1OGAE 1CK0H 5T3XL 1DN0A 5TPWH 5F1NA 2ZOLA 5C0DA 3SCMD 1Y0LB 1JBJA 2F54B 3DI2B 5C08B 5MI0B 1QRNB 1FIGL 3ARZA 4J3SA 5C07A 3SDDA 4GKZA 4PV9B 3KXFA 5EH1A 5HHMB 5IROA 2CUHA 4S1RH 3VCLB 1U41A 1J0JA 4MAUH 3HPJA 3GO1L 1JI1A 3ARGA 3KYKL 4MNQB 4HPYH 3E1F1 3L95B 1AC6A 3LDBC 3O6KH 5DFWH 4DKFL 4ZAKD 4YBLB 3WS3A 1RVFH 1WFNA 4TSBL 3PXJA 4PRPB 2CIIB 3WKML 1U3YA 4I9WE 1OPGH 3MROB 2E7BA 4IMKC 5IQ9B 3RDTB 4L9LA 1UC6A 4R9HA 3H3BC 5BMFL 4QCIA 4Z7WB 3GJEA 5T3ZE 3DMMD 2KQMA 2FO1A 4OCLC 1VERA 2BSRB 3CAFA 4HK3N 5C08A 3CZJA 3TC9A 2QQLH 1MJJB 4F8TA 4R6UA 2C4XA 5CUSH 5AZ2H 4KJQD 3K8LA 2XWBA 3HE6D 1E28A 4WCYL 3P30H 5GRYA 3VI3E 4X5WA 3PGDB 4MNQA 3SDAD 3GBMH 4YAQB 3HTLX 3UTPD 5MEQA 4X98B 2NY2C 4F15C 2H32B 3LPWA 3DXAB 1YNTB 2W65B 1WBXB 2K1MA 3ULVH 5I1KH 1A6ZA 1Q9WA 1I1RA 3SE3C 5EUKB 4YBQC 1OTSC 3UJIH 1G6RL 5IR1A 1F4XL 5DZNA 5HVHC 4QXGL 2NXYB 2E6JA 1A6AA 1J05A 2D7TL 1XF2B 3G6DL 2HKFL 2ARJA 5C0ND 4L3ED 1IQDB 2XTLA 5BO1H 5DC0A 3QXWA 3BAEH 5KOVC 2BK8A 2VC2H 3GRWA 4RAUA 1UM4H 4WFHD 4K3EL 3QIWD 5DT1L 2YPLB 3GM0A 5IB5A 3E8UH 3QUMA 5CD3B 4UTAL 3X13B 2VLJA 4JFEA 3PNWA 3VXQA 2IWGA 3UTQA 3RL2B 4LDOB 2VQTA 5E4IA 2AEQL 5T1LB 5EUOF 1LO3H 2ZG3A 1SVCP 5ALBH 2B1AH 1JGLL 2R8SH 2R2BA 3G6JB 2IFFH 4WO4C 4OI9A 4OZHA 5EA0L 1HSAA 1FFRA 5DS8A 4L3AA 1KG0B 4ZUWA 4HUMB 2VAAA 3BE1L 3QXAA 2VN7A 2EDYA 4NZRH 3QJFA 4I2XE 1A6AB 1J05B 3LIZH 5KN5A 5IB3A 2G75B 1BQHA 2Z92B 1LQSR 4KZEH 4NM8H 2XKNA 4L3EA 4UT7H 5KZCD 3OBAA 4FFZL 4M6AA 2GAZB 5MEPB 1D5ZA 1F58L 3MJ6A 3HNSH 3R1GL 3KJ6L 3C5ZA 1EAPB 1F13A 2VE6B 1TZIB 3TNMB 4JM4H 4PJFB 5B21A 1CLYH 4KAQH 4X98A 5I1HL 1T0MB 3BYYA 1KN4L 4OCSL 5KN5B 1HHJB 2X4UA 2D31B 4H88H 2ZWLT 3PV6A 4PGCA 4TNVK 3S37H 1KJ2L 4KPHL 1D6EB 5C0JB 3FB6B 4M7ZB 4QRUA 4YDKH 1K9TA 3ZSTA 5JQHC 3D69B 4KKCC 5FOBA 5F89A 2Z93B 5TF1H 2LVCA 1HEZA 4NNPL 1YA5A 4U3CA 1G7LA 2MMXA 4F7PB 3TBSA 5C6WH 1IC5H 4Y19A 1D7FA 5EBWA 3ZE1F 4GQ9L 3MRRB 3P77A 4UAOB 1LILA 3BWAA 3F7RA 1HIML 5ITFA 3DX9B 3ILPA 3H3KA 3IDIB 3RPKA 4P9MH 3C08H 2DQHL 1BD2A 5DD3H 1T1YB 3BO8A 1NCCL 5IB1A 5DJZB 1B6DA 2ADIB 3REVA 1HILB 2X4NA 4KQ4H 4XVJL 2APXA 1IQWL 4NHCH 4R97B 4AIXA 3B3IA 3CXDH 5BV7B 4W6XB 5F1SA 1FH5L 4PJGF 4LP5A 4PJ7F 4XPHL 1FAIH 2OXHA 4DOHB 5HSFA 3MNVA 4PV9A 3S8WA 5HYFA 3GSOA 1AQKH 4Y5VA 3RVWD 4FN0A 1OCWH 4L5FH 4Y4HC 4KK6C 1BBDL 5CS7A 1JI2A 5H94A 5AUMB 2PF6A 5I16B 1KULA 1CGXA 3MRQA 4WFHE 3F5WB 4S2SA 3SPVB 1LO3L 2GEEA 4EI5B 2F5BH 3QDGD 3MA7B 3S37L 1UFUA 3WN5A 1WJ3A 3GMLA 1JL8A 4HWEL 2A2QT 2OM5A 5DC4B 4GW1B 4LLMA 4OSUH 4ODVH 3IFLL 32C2A 1P7QD 4IOIB 1QFWM 1J1XL 5FHAL 4H8WH 4P99A 3GSRA 4ODUA 1RIHL 3VXOB 1FAKT 1HH6B 5DT1H 1TJGH 3MLSH 4JN2B 3BKJL 3LVEA 1DE4B 4M7ZC 2YEZB 1ZK9A 4Q6IC 1BX2B 4R4FL 2YD7A 3VRIB 1R24A 4HMEA 5BV7H 4ZTPH 1BJ8A 1QHPA 1FNAA 5MERA 3MRNA 1UVQA 3AM8C 2X4PB 1ACZA 2K3TA 3U30B 1E6JH 5B39G 3O4OC 3QIUB 3QEHA 3RHWF 4BA8A 3G04B 4KUCF 4G8EA 2NY7H 5CD5D 3GJFH 2JCCA 5FCUH 2YKLH 1DQML 5DD0L 1UZ6E 1QLFA 5D7LB 5I66A 3DX6A 1T7VA 5KSUA 5JO5A 3BN9C 3FCTA 4NQDE 4QGYA 4M1DH 4WO4B 5SWQB 1G6RB 1GVIA 5DJZA 1HHJA 2X4UB 1YNKH 4JM2D 3DGGB 4X80H 4XRCA 1MFNA 2HKFH 5C6TH 5I1CL 4X6DA 3AS3A 2YXMA 4N8VA 2EZ0D 3ARRA 1NEZG 1FNEB 2PW2A 4JFOA 1HNGA 3OGCA 4EOWH 3WNNA 1O7VA 4YR6B 2V17H 3KPSB 2DIAA 4PJAB 5I1DB 3GHBL 4YFLI 2V7HA 2J7LA 4XVUD 1OAZL 4AL8H 1G9ML 5I75B 1ROWA 2W0FB 4JFQA 4M6OL 1G7LB 5FYLL 4F7PA 5JDJA 3SQOL 4NSKB 4YXHH 4F7EB 3D69A 1K6QL 2YC1B 1DQQB 3L5WA 3WIFB 2W9LA 2YRLA 1BWWA 2SEBA 3V6OC 2VOTA 3DRQA 4RBPH 3C9NB 1LO2H 2EKSA 1IZKA 5DJAA 2KQNA 3QNXA 3PDGA 1I8MA 4HUUA 1YY8A 1Q9LB 4PRHB 3TNNB 1KFAL 4NKMB 1QFWI 1FQ9C 4L4VA 1QLRB 1YEKH 1JHLL 4I4WA 4MA3A 4Y2DA 3VGDA 3IAQA 4KZDL 1MCQA 4X4MA 3T2NH 3N1PC 1DQTA 4PJXF 5CP7A 3ZKND 4OUOA 5JZ7D 5C0AA 5D7JA 1EEZB 1H3UA 1RUPL 1I85A 3BHBA 3LEYL 1R3IL 4QY8B 3IDMB 2KKQA 3KR3H 1BREA 4NC0B 1AD9B 2CDGB 3LS5H 3PQYB 5CP3A 1I3GH 4U05A 5EDXA 5CEZE 2ZUYA 4NQCA 4PGZA 4WI6A 5LGJA 3QR2A 2A6DB 3WD5H 1IAOB 4YE4L 3SGJA 1EJ6A 4GAGL 4JCMA 4P5TA 4IHOA 1KLGB 4RZCB 4KJWC 2DM7A 1WCQA 5T33L 1RMFL 5FYLH 3MV8D 2IPKA 5DQ9A 4W81A 4G9DA 2EXYD 1UH2A 4MJ5A 4S0TD 5DMJB 5I8KH 1TZGH 3BMVA 3RIAK 3JUZA 1RZFH 4L1DA 3EYSL 4Y4FA 4KVNL 3R06A 4F9LA 5HI5C 4JEGB 1MIMH 3RDTC 5CMAA 1FPTH 2D9QB 1DL7H 4P48A 1BP3B 3WE6B 1X5YA 5FYLD 2B4CC 1QD0A 4D8PA 5GRJL 4MS8C 1X9QA 3CPLA 3J7HA 1C5CH 4NGHL 4HPOH 4Q2ZA 1FBIL 5EG6C 1KUMA 3DV6A 3WS3B 3BH9A 3HR5A 4MNGE 2PW1A 3BEWA 3OX8B 3IGAB 2YKLL 3BXNA 3EO1A 3EYQD 1MFBH 3KYNB 5I1IL 1U8LB 4R4BB 5DHYB 3TN0B 5D5MB 2D7QA 1CGSH 2F8OA 4C83A 3LMJH 1AO7B 1N5YL 1NCDL 3R4DA 1LMKA 2Q7YB 2R39A 1MWAH 3M07A 3GJEB 1IC7L 3CLFH 4M1CD 5D7SH 3OG6B 1ES0A 4NRYA 3V6ZA 5E2JA 3ARXA 3UBXI 1QRNA 4DOHE 4NP4H 5M95B 4PJEB 1OT2A 1RZJC 1XMWA 2F15A 4PJHB 4HJ0C 2B2XH 1CTNA 3MLVL 5EZJA 4X8XA 1IMHC 3EDEA 1PQZA 1EFQA 3Q48A 5EOQL 1RHHB 2P5EA 4RMVA 2V2WB 1JWSA 2EIEA 2GFBA 1RD6A 3MV9D 4KKBC 3SKMB 3QEQA 4IBLT 4TUOA 3ZHKA 4TVPD 1KTDA 1QFWL 4QTIH 4AT6A 2QADB 4Z77B 3LV3A 4P3CL 5D2NA 3IFLH 1GAFL 3OKDB 4JFHE 4XZUB 4HKJA 1QO3A 5EFIA 2H2PC 2ZJSL 1BBJA 4I13B 1WTLA 2V9RA 1EVUA 1NJ9A 4G6JH 1RIUH 1WVZA 1KIQB 1RJZB 5GSRB 5HYQA 3CSBA 1GGBL 4P4KA 3BZDA 5GRUH 3RKDC 3W0WB 3M17A 1VEPA 3E6FA 4FQQA 4JM2F 5D2NB 2EH8L 2CRIA 4PRNB 3HZVA 1UM6L 4HJGB 4AEHH 3K80A 2CKBA 3HE6C 2NY3D 4F8QA 1FH5H 3HFML 1RZIB 4JFPB 1MAJA 2NPLX 4OF8A 1SYVB 3GMLB 3FO2B 4HWBL 1BIIA 2BNUB 3EJJX 2ADGA 4OD2B 4P2OD 3WS6C 3LCYA 3V95A 2XFXB 4H1LA 4NKDB 5LVEA 3V4VL 1QLEH 4ZS6C 1MJ8H 1YPZF 1UB6A 5IJVB 3PWVA 1CXIA 1LK3L 2R1YB 2Z31A 2VZ1A 4OLUH 1K8DA 2AV1B 3NPZB 3VXRA 4KI5E 1KPVA 2UZXB 3U4AA 3MNVB 4LF3B 1DTUA 4LPWA 3ES6B 3ABZA 3RVVD 1DFBH 4J8RB 3WCYA 4Y4FB 3FQTB 1CE1H 1VENA 1X5JA 5EBLB 5TE6H 1IGYB 3U36B 1MHHB 1XR9B 4O4YL 3LN4A 5D7JC 4JFDD 3MRGA 5EO0A 3E0GA 2F58L 3I3BA 1PLGL 2O26U 2VIRA 1KJ2H 3AFLA 4U6HB 2BSSB 4P5MB 3TGXA 3BDYL 3OL2A 3MOAH 5SWZE 5BW7C 2ADFH 3HE7B 2DQFB 2XXCB 3QUYB 4HHAB 5GGVY 3UTSB 1T03L 4KAQL 2VR9A 4QYOB 1LGVA 4YHPB 2ATPA 1AR1D 1N64H 3ARBC 4Y8AA 4OM1H 2LABA 3UJJH 5I1HH 2E5EA 4RMRA 3G5YA 1TFHA 4GS7C 4OF7A 4U0RB 2VSDA 1P7QA 3QQ9D 4XCFH 1WZKA 1WISA 3L3DB 2J8OA 3QUXD 1BOGB 2A77L 4EXKA 5I9QB 1B2WL 2ZNXA 5D1ZC 4QRPB 4CL7A 2XPGB 3ROOB 1D5BB 1I85C 1FFQA 3HC4H 2Z31C 3NZ8A 5TH2A 4YLQT 4L8BB 3BIBX 1JGLH 2DN7A 5FUCC 2ARJB 2MHAB 4OGZA 4NP4L 4R3SA 1K2DA 1IGJB 1TVBB 1INEH 1MNUH 3G5ZB 4IRZH 4JO1L 2WWKO 2R8SL 2ARWA 1CXKA 3EFFB 1WAAA 1X5XA 2WWMC 5DHVH 4MQXC 5DEFB 4O2CA 4PJCF 1OM3H 2R0KH 5EC1A 3UCRA 4G8IA 2R4SL 1CL7I 4ONFL 5E2WL 1YN7B 2Q76A 4WW2F 4XVTH 4V2CB 5CWSB 1JV5A 4FQHB 2AK4E 2OLDA 4M62L 1FBIH 4PJHE 4NGHH 1GSMA 1BBJB 1GL4B 1ZT1B 4EBQH 5FYJU 5BRZA 3LN4B 1BD2D 2Y36L 1VFAA 3RGVC 5I1GH 1JJUA 4AEFA 1GOHA 4DEPB 4IRSC 3ULVL 1UENA 4M1GH 1KCUL 4QHUA 3WV0A 1BQUA 3IDXL 3T0WA 3UEZA 4X7TB 5BVJA 2R2CA 1XF1A 2Z8RA 1DBAH 2XZQL 5F7KC 5FO8B 3RVWC 3BGAA 3LY6A 4MNGB 4OZFG 5CLTA 1J18A 1FL6A 4IMKA 4JRYE 2FGWH 3LKSB 3ZT7A 4POZD 3W11C 1MCPL 4S10A 3WL9B 1OVZA 3O9WD 3KDMB 1HKLH 3V6OA 1I1AC 2BNRD 3RWIA 4F7EA 1XF2A 3DUUB 4IJ3B 5TQ2L 1KTKE 5CUSL 4HIIA 4BK5A 4JRXA 4UIKL 1XZ0A 5T5NG 2AJUL 2EDKA 5FUOL 2RFXB 1X5AA 1Y18B 4PJ5E 4O51B 4ZXBA 3RUGF 5IHUL 2E6PA 3BZEA 4PJDF 2V2WA 4DKFH 2Y5TA 3C6SA 3F6LA 3UC0H 2E9BA 2W60B 1RVFL 2ZG1A 1JWUB 3K46A 4NZUL 3U2SA 3MGTB 3UTOA 2FEDC 4PJDE 3WFHA 3RTQA 4HPYL 4NNXB 3P4OB 1U42A 4MQXD 4NKIH 5E94A 1GCFA 3OKKA 5HHOE 1XGUB 5JMRA 4JM2B 1MOEA 2LVEA 3VXMD 1XCQA 5J06A 3KYMA 4ZD3H 5HY9A 4MB5A 1A4KB 4LCWB 1SJVA 1WTGT 2DBLH 1ZANL 1KB5A 1NMCC 3GRWH 4M7JH 3BH8A 2BFVL 3QCVH 2WUCH 3MRKA 4JJHA 4XC1H 5ANMB 2P49B 1U58A 1N7ML 2A6IB 2N56A 1YEEL 1KCVH 3TBTB 3ZE2F 3OKLA 4BQBA 4GQPH 3ZE1E 2VZTA 4JRXB 3P9MA 3W0WD 4GKNB 1XCQB 5ADOH 3GGWA 1YPZB 4JFFE 4JPIA 5GGQH 5HGAA 1H8SA 2ITDA 3DIFB 3HLAA 4I3RH 5F3BA 3KWWB 4BSWB 1G7HA 1ORSA 1RAMA 1QYGH 4HFUL 1I9JL 3IFPA 1SBBA 1YUHB 3MUJA 4JFFB 4Y16A 5E99L 3OMZA 3O6FA 3WE6A 2ITCA 2X7LA 3MNZB 4NM4H 3I6LE 1Y0LA 1JGVH 5FB8A 3CMOL 4K7PY 4JHAH 5I2IA 4CJ0A 4E9LA 4NQDA 4HLZH 4GUPA 2R0WH 4JDTL 2R29L 1KPRB 5I1AB 5HYSB 3VFGL 4JQIH 4QT5B 3BEWB 3OX8A 3I9GL 1Q38A 2CDFA 4F57H 1DQJB 1KACB 3SDCB 4D9RD 2DQCL 2N7AA 3GMOA 4I5BA 2BHUA 4ORZC 2MFNA 1A7QL 1XGRA 3G6JF 3U4BL 3BD3A 4JZJC 2C1PB 3SN6N 1VDGA 1IKNC 3V6ZB 3RX8A 4CRPA 4Y5XB 1E6JL 3OKEA 2CK0H 2WSKA 3V0WH 4ETQB 5E8DH 3BRGC 1R3LB 4JPWH 1P84J 3ZKMD 1AFVL 5T5NF 1CGTA 4WW1A 4DUVA 3CX5J 1PGRB 1Y6KR 2SEBB 4X7FC 1OP3H 4YFEA 4XP6H 1N0LA 3KPMA 1D9KB 3FN0L 1C1EL 1MI5B 3LQAL 4K7PX 4Q9CA 4K8RH 5JXED 4M93B 1GYAA 1Q94A 5D8JH 3DROB 1R3LA 4PJCB 3BP5A 3STLA 2NX5E 3SKNA 3PWPE 1Q0YH 5JIPA 1S7VB 2VDMH 4RA0C 4OM0H 3LN5A 3STBA 4NUJA 3OF6A 2CLRB 2NY5L 3REWA 2AJYL 3D85D 1T04B 4WW2B 1BFOA 2HLAB 1MH5B 2VDKL 1IGJA 1J8HD 3FMGL 4JZNB 3ARSA 4HHAA 4F58H 2YC1A 3MRCB 4KKCD 5BV7L 2NY0C 1U2HA 2B1HH 1ZLSL 3UYPA 4HIXH 4J12A 5EO0B 4G3YL 5GGQL 2BVEA 5BQ7B 3P3YA 4X4ZA 2ZCHH 5IJKA 1J87A 2DD8L 3C09C 1HI6B 1A2YB 4WNQA 4L4TA 5ID1B 1S9XB 1CDJA 3O6FB 4JPVH 1KPUA 2GSGB 3GSNH 4WU5B 3THML 5JQ6L 1MF2H 4DVBA 4KQ4L 1LEGB 2XN9A 4PJGB 3DTXB 4PBVC 5H37H 3SEPA 4QXTB 4RGNE 4OQTA 3MLTA 3FTGB 2QV2A 5D7JB 4GRLB 3T0AA 4FQXD 5D7LA 3GGWB 3C2AH 4K94H 3VXPB 4NBZB 1T20B 4PRIB 2ESVB 3ZYOA 1RQ5A 3V4PL 1XFPA 3FQXA 3P9MB 1Q1JH 4I8DA 3FB5A 4WHTB 4XT1C 5KSAC 5EBMB 2VISB 3OGCB 4I77H 2XG4A 4FQ2L 4ZFFA 2C4FU 3EZJB 3MXVH 4QHMA 2BNRB 3TCLA 3FT2B 4NDMB 2OK0L 3RWDB 5FUOH 2JJTA 2COQA 1YJDH 5JHDB 5HYQB 5DMIL 4HIEB 4GH7B 1MFAL 1FNGB 2AJXL 2PN5A 4JGJA 3OR7B 1NJ9B 2XIDA 3BFOA 1TETL 3G5XA 4FTVA 4CVZB 2JIXD 3L5IA 4WW2C 3L3KA 1A7OH 3PUCA 1L0XA 3BZFB 4OCXL 3TJHC 5LGHH 1I4FB 1WBYA 5IR1B 4QRRE 1YNLH 1NKRA 1CR9L 2X89D 2H32H 2UV3A 3VXTA 5B38G 2JCCF 3GJFB 5DSCB 3BKCL 3Q5OA 4M1GL 4HUKB 3EJZD 4LGPB 1T1XB 3EJYD 4GQ9H 3FFDB 4XWOC 2ZUVA 3ETBF 1R5WB 3MA7A 4JHBA 1FZOB 5DJYA 5HHVH 4F7MA 5ISZE 3W11D 1IT9L 1GC1H 4LCYA 2Y36H 1MFAH 5TF1L 3KG5A 1KBGL 3V6FA 4JKPL 3QDJE 4ZUUB 2VLLA 4W6WB 3AY4C 4HGMA 3TBWA 3CU7A 4PREB 4LSVH 4KGJA 4K7PL 1A6VL 2ED9A 3QZWB 3BWAB 3RVUC 1F3RB 2AI0H 1G0XA 1SHMA 1UCBL 4FZEL 2AAVA 1MCNA 1CD9B 1I4FA 5DR5H 2NLJB 5IWLC 5FGCB 5D1ZA 2VC2L 3S9DB 3I6KB 1DN0B 1HH9B 4GBXD 3E2HB 2GUOB 3RVTD 5GS0C 4LSTL 2M26A 4WI7A 3AUVA 1WZ1H 3REVB 1S3KH 5BOZG 3LZFH 2HJFA 5F7HA 1U9KA 3G6AB 1T5XB 2Z91A 2E7LC 1FZOA 3QPQD 1W0VB 3ZSSA 1OTUD 1UADC 3HZKA 4JPVL 1OD7A 1MWAA 3M1BA 5I6XC 1NGYB 3V52H 1CFNB 3GBLA 4MXQC 5T1MA 2FHBA 4V1DE 1RZGA 3NAAL 3GKWL 3QIWA 3H9ZA 4CVXB 3B2UC 5IMKA 5F88B 2Q3ZA 3H7BA 4U1NA 1H0DA 1E4XI 1Z6JT 2JELL 3BYTA 2EDNA 1DQLH 4MX7B 2DLIA 3NIDE 3CCHA 2CSPA 4RGND 1JNJA 1TITA 5AZ2L 4OFIA 3OR6A 4QOKA 3QUXC 4OFYA 4U7MA 2BSTB 2GITB 4KK5C 1LO5A 3RWGA 1ZV5A 4ZOCA 5JPMA 5TDPA 1BLNA 3DWTA 1WFOA 3O9WA 4YIQA 5KVGL 1CFQA 2UZYB 3DXAE 3DARA 4OBSA 3WKMH 2HH0H 4OQTL 1RI8A 4XWGL 1V3MA 3HPLB 5DQJA 4F3FB 3FB5B 4WHTA 1HHKA 4Q6IA 4I77L 5LQBH 1T2XA 3UO1H 3FN0H 4UV7H 4KDVA 3LQZA 1IEBB 4ALAL 3OKMB 4BK4A 1J8HE 3RWCB 3V7AE 3KYKH 2EYRA 2KL6A 2DQFA 3OAUH 2WZPD 2D3VA 4ODWB 1DVFD 4Y5YB 4JPWL 3F62A 4NO5B 5E9DB 2DTML 5I15H 4O02H 4OIIH 4J3OC 5J13C 3OJMB 1HHKB 4Q6IB 3V0AC 3HG1A 3QULA 5DD1H 3DYPA 4ZNEA 1YDPB 4JVWA 1NFDA 1JRHL 2V2XA 5IEKB 2RR3A 2P5WD 3ZHLA 2N4IA 5CBEB 1QTYT 1F6FB 4YUEH 1YEHL 1MUJA 2DS4A 4H20L 1FHGA 2OL3L 3P73B 5D1QB 3BJ91 5FKPB 5F89B 4YPGB 5F9DC 1ITBB 4P49A 5TE7H 3QWQB 5DS8B 5D2LE 1EHLL 4LLAA 2EIBA 5E08H 3LQZB 3W9EB 1IM3A 3MJ9L 4POZC 1XR8B 5K9JL 1JTPA 5IMKB 2VDQL 4FP8H 1NGPL 1WGOA 2IPUG 5J3HC 2NX5B 1GC1C 1NFDB 5F7WC 3ARDC 1IGTA 3O6FC 3H9SB 1MRFL 4TSAH 3SKNB 3O4LA 4N8VG 2FSEA 4AIZA 2OZ4L 4ZPTA 1QPPA 2R56H 5JPMB 4HUUB 4U6TA 4S1DC 4EUPA 2Z92A 5D5MF 1A7NH 5IW1A 4G9FE 1CK0L 1JGEA 1TCMA 2YBRA 5F93C 1LK2B 5GGTL 1S7UA 3D5OF 1SEQL 1Z0NA 3C60B 5JHLL 1E4XL 2B4CH 5T3ZL 2JCCB 2BHYA 4KROC 1T2QL 4XC1L 2DB8A 1XF3A 4Z5RA 1YQ2A 4JAMB 1IKNA 5GIRA 4U49A 5DYOA 3QEGL 2KUTA 3O9WB 2CUIA 3A6BH 1NGYA 1IC7H 3CLFL 5D7SL 1G7MB 4H0IA 5DHXB 1YY9D 2BVTA 5F1NB 4ETYA 2Q1EA 1AHWC 1YN6B 2F54D 3UPRB 4XCCL 2BRRL 4LL9A 3DGGA 1NL0H 3MRHA 4WUUD 1V5JA 4MA7L 5E00A 3Q3GA 5FM4A 2ITDB 3KLAB 5FO7A 1R5VB 4AEIH 4HXAH 5HHXL 5KJRH 5FGRA 1U95B 5C7XH 3IETB 3CCHB 3QP3A 4BH8A 4JFZH 4UI2A 2EIDA 1PX4A 4GW4A 1QSED 1FAIL 4PJ5A 3GDBA 2IANA 4DEPC 3BUYA 3F7VA 5EC2B 1A4KA 4GG8B 1GGCH 2WBJD 4V1DB 5INDA 3VFUB 4XP1H 1BVLB 4HDIB 1TQBC 4OV5B 4BH8B 2P24B 1N2RA 5DRNA 4QHKI 3ILQC 1KXQE 4PJ9B 3C60C 4NYLA 2ICWA 1R5VA 3T0EC 5EU3B 4Q7DA 3SY0A 2P8LB 3UPRA 5HHQB 4NC1E 4KK8D 1TJHL 2QTEA 4M6NH 4IJ3C 3O4LB 1CE6A 1S8DB 4U1JA 3KPLA 4YDVB 5FV1L 1FYTA 3ZTNH 5D1QD 4U1LA 4HH9B 1X7QA 2NYYD 4YDKL 1J5OH 3OXRA 3VGHA 4P46C 2WLZA 5KVEL 3CH1B 4MVBC 4KROB 3C2SA 1ZANH 2MWCA 3FJTA 43C9A 1BZ7A 3HRPA 5H37G 5LJYH 3FO9B 3T0BA 4G7VL 4X83A 3RY6C 1NGWA 2V9TA 1OM3L 4ZUTA 3VFNB 5DJYB 2NY2D 2UY6A 3HNSL 3R1GH 4IIQB 5ISZB 4OCMC 2R9HC 4LKXB 4RRPG 1FFOB 4N8CL 5LG1A 1PZUB 3SBWC 4JO2H 1FIEA 3CGTA 1M7DB 3WDJA 3ARBB 5EOTB 3RA7L 4YHML 1YEJL 1CXFA 2FHCA 4ODXA 3NAAH 4HGWA 3IVKB 4J6RL 3TH4T 1J7VR 3O45B 2OR8A 3HMXA 1KBGH 1V05A 5JOPD 4LNRA 5CJXA 5F8RC 2VRAA 1CTOA 5D96C 4XPAL 3OKOB 8CGTA 1IAKB 2P5WB 3K4AA 3LRSB 3DURB 3HRZB 1IGML 3KPSD 4HIEA 4EIZC 4OZHB 2AEQH 1KGCE 1WFUA 1MFCL 5IW3A 4Q58C 1LP9B 2E7CA 1ERNA 2XTJD 4KRPB 1U8IA 2C26A 4JDZB 1ZWIB 2BNRE 4Q9BA 2Q7NA 1PJ9A 2EDFA 1UCBH 4B0MM 5MP6L 2AJ3A 4RMUA 4HJJH 5I8OL 1S9YA 5IIEA 2R0ZL 3BPNC 1I75A 1N6VA 3CDCA 5IP4A 5HGDA 3VFMA 3CVIH 3TWCH 4DAGH 1AGCA 1PAMA 1AQDB 3SGDH 5EU6B 3ALWA 3EDDA 5C0FA 3RGVA 5L88H 2P46B 3DX8B 4GT7A 1N3NB 3H6JA 2AK4B 1HQRA 3DRQB 2AJSL 2P5WA 1M71B 1F90L 1NCBL 2FWOB 3ISWA 4GAYB 4XI5C 4NT6B 3AMLA 2AS5M 4PRAB 5EN2B 3MXVL 3P0VH 1JPGA 3ARDB 3HE6A 1XT5A 5EO1B 1G7JA 4HV8B 2LU7A 1JIBA 2M2DA 5IVOA 1YMMD 1A0QH 4HLJA 4JO3H 1KJ3L 5IESH 4RAVB 2VXTL 3VWJA 4PTTB 4M1CC 5DJ8B 1MIEH 4YH6A 4OV6F 1D5XA 2B39A 4GG6A 2P8PA 1MJ8L 2YPLA 3BIKB 1QUNA 1BFTA 1AE6L 3BN9D 4U1GB 1BECA 3FFCD 2A6KA 2HYMA 3VRLF 5DK0A 4BZ2L 5EU6E 4HLZG 5IHZB 1T1WB 2Y7QB 3CDFA 4XXCC 1HSAB 4LHUB 1LEIA 4OTXL 3O45A 2VDPL 5EBLA 3IDJA 2QADC 3DECA 1WIUA 3QUZC 3QUZB 4IRJD 5ESVB 4WY7L 4TTGA 3DRTA 5D7LD 2WBJB 1ZS8A 1MRCH 4HIXL 2KDGA 4FQJL 4PIRF 2B1HL 2Z35A 5D7IB 1ZLSH 2IAMB 1Q94B 5GRVK 1TZHA 3UJJL 1I7UA 4OSUL 2NCMA 1JF1B 2NW3B 2XRAH 4BFIA 1AJ7H 4CMMA 5D71L 3NCJL 2XFXA 5EWIL 4CNIA 4GMSH 1IC1A 3L95A 3TIDA 5HPMB 2EYSB 1HN1A 3W9DB 1HHHA 2VERN 4OLXL 1X5ZA 2AXFA 2VZSA 4FMKA 3DETD 3OKLB 4PJBB 3ELAT 5E8EB 1MJ7L 1HK6A 5B8CA 2V5RA 4WTWA 3DBXA 3VG0L 4WTZA 5T1KB 1KB5B 4Z7VE 4HK0B 3BGFC 4L4VE 4GW1A 1UXSB 3DSNA 4MJIB 4KRPD 2GCYB 4WJ5A 3VXSD 1SYSA 5F21B 4J1UB 4IRSD 3UROR 2X10A 4F37F 3MLXL 1E27B 3TPKA 1K8IB 3FMGH 5F7MC 4B41A 4CMHC 1YEDA 2D9CA 4DGYL 4ONHA 4YQXH 1ZLVH 3SE8H 5IGXL 5IOPA 3RAJH 3ZKNC 4EVNA 2XY2A 5JZ7C 5E24E 3QQ4A 4WI4A 2DQHH 5DMKB 4HF5L 5GIRB 4PJEE 3L3OA 5DVOA 4K07A 4L8DB 2O5YL 3QSKB 2HJKA 2VDML 1FRGH 3CVHA 3JWDL 4P4KB 3MGAA 2L0DA 4NN5B 1CDCA 4U1SB 5D8JL 1ZXQA 4JZOB 1AXSB 3LPGA 3QDJA 3B2UD 2G60L 1KT2B 4R0LC 5EZJB 3GHEL 4JQVC 4P2QE 1NUDA 4YBHA 2WLYA 5I30L 3ZL4L 5JW4R 1RUAL 3VJ6B 1WFTA 5JDSB 3CNKA 4OGXH 5ACMA 3TM6A 4YHLL 5ID1A 5IB2A 5JHLH 3MRKB 5ANMA 4P2RE 3VMPA 5BQ7A 4GXVL 4JFDE 5IBUB 3S37X 3DMMA 3KNBB 4KY1H 4HXBL 3VGAB 3O2DH 5SWZA 5HD8C 2PXYC 4Y2OA 5GS0H 4N0RA 1CD1A 4NQDD 3QG6B 3ULUL 3GMNA 1BZQK 2PW1B 3ARUA 1IC4L 4KTDL 5CWSA 4UUJA 4Y7MA 5MEND 3WD5L 2IAMD 4JN1H 2NW2A 1LO4L 3I6LD 3L7FB 4MNHA 1UWEH 5IMLA 3DHJA 4HIHA 1AR1C 1NKOA 1QSFA 2VUYA 4MJ4A 4WV1A 5A16B 4GAJL 4BUGA 5GZOD 4P4RB 1F00I 5F7NC 5ACLA 3ARGD 3MLUH 1XF5A 4XNUH 4LQFL 3GMQB 5FA3A 1N6UA 3SGDI 4PJCA 4TNVF 1OGAB 5IB4B 1O7SA 2V5YA 5DJ6A 3GIZH 4NKIL 4RGMB 2X4QB 4W4NA 1QRNE 1CGSL 2DLFL 1CWVA 2EDQA 1ZT7A 4FRWA 2HLFD 3T2PA 4Z7VF 5C2BH 1F3DH 1F2XK 4LIQH 1IEBA 1NANH 5KVFH 1IAIH 2EDHA 3I84A 1A1OA 5HHNB 1DP0A 1X5LA 3IFNL 1JGUH 5F70A 2AK1L 4ZUVB 4HZAA 5KVEH 3T3PF 1T7ZA 4D0DB 1AGDA 2IG2L 5F9AC 3QIBC 1KSRA 3WXWL 4OZIE 3WFCH 4F9LC 4JFEB 4I3SH 3FAXA 5DD5L 5CILL 5CFHA 4QWWC 2Z4QB 4YXLL 1SMAA 1SJEA 3VWKC 3UJTL 43CAA 3N85H 4IDLA 1Q9OB 1SY6A 4D0BA 4LCWD 3SDXE 5K9OB 4CVWA 4LOUD 3QA3A 3PGFL 4FHBD 1AR2A 4DQOH 1B3JA 1OAXL 3FN9A 3TVMC 1G9MH 1QFUH 4XNMA 1F2QA 5C0RH 3T2OA 4HC1H 3ARED 1IBGH 3WHE0 3REWB 4FOMA 4YWGL 4KK6D 1FP5A 4Y4HD 4JKKA 1X4XA 1CL7H 4LFHG 1CICA 4E5XB 4DK3A 1AO7D 1K4CB 5A16A 1RZKL 3D39D 3C8DA 3GSWB 4PJ8C 4PLNC 1OPGL 3D85A 2M1KA 3PF2A 5I76B 2BSTA 1DQJA 5HVWA 3IKCB 4G8GD 4ZO7A 3VG9C 3QEUA 4PUBL 3BQUC 2VAJA 2X4OB 1AQDA 1NMBL 5C0FB 4QKXB 3O6KL 3BP4A 1A1NA 1YECH 3O2VL 3KPSA 3PDOA 5ICYB 1DDHA 3QH3A 4NQCD 4I1NB 4Y5XA 4HQQH 4CVXA 4IRZL 1P4LA 3QWOA 2X4RA 3RI5K 2H9GA 5L2KB 3O41B 3M1BB 4PTUB 1A3RH 2MKWA 2VWEC 1CI5A 1ORSB 1FIGH 1IAKA 3BDBA 4I0PD 3QWRD 4KRLB 2X1QA 1B2WH 2CDFB 4RFOH 1KB5L 2Y6SC 1LO4H 5J8OA 1E4JA 3AREC 3L3GA 4NO2B 1S7SB 2FJGB 2FZ3A 4C59B 1MPAL 5F7EH 2HG5A 3ARGB 3HS0A 5C0GA 4ONFH 2DI9A 2XKUA 3MRBA 1A7NL 3FT3A 3VXSB 3RBSA 2PNDA 3BQUD 4LPVA 1XGPA 5C86A 3Q0HA 3SCMC 2OZ4H 4G6AD 4JLRA 4P4RA 2CJUL 3QFDA 4Y5YC 4QWWD 4U3HA 4U6XA 2MTPA 5DTFA 2AV1A 3VXRB 3RPIA 3TA3B 4NO2A 4E0RA 2AABH 4O2EA 3T3PE 4WWKD 4XX1E 3H9YA 4WO4A 3D9AL 3FO9A 1YNKL 3DX6B 4FQLH 4Z8FL 1OLLA 1EEUA 3U9PL 4B5EA 1OGTB 4EDXB 4P59L 1R3JB 3WFEH 1LDPH 4HCRA 1G0YR 4EI6A 5C9KA 5F6HJ 1VFUA 3B5GA 3T1WA 3OF6D 1QQDB 2X4SB 3W0WA 3EO1B 1P1ZB 1OAKL 1TVHB 5DD1L 1KEGH 1T20A 4PRIA 2GQHA 1A3LL 2UUDH 2RIKA 3ARGC 1HHIA 1HWGB 3OKKB 3FTGA 1T03H 4XVSH 1F11B 2N7BA 2L4OA 1T21A 5I76A 1KYOK 2YEZA 1H9VA 5F96L 2E7MA 4O2EB 3T09A 4H0GA 4FQ2H 4JDVB 5BVJB 2FBOJ 4O4YH 5DXWA 3F65A 3L3OB 2C3XA 2HLFC 3BRDA 4GOSA 2GHWB 3QH3B 4ZQKA 5J7CC 2DQIH 5HYJA 5FGSA 5IFAL 3QXDB 1QBML 4IDJL 1U2CA 3VH8A 2Q8BL 3OSKA 2P4AB 3VG9B 3NFNB 4OF3A 4RMSA 3TBYA 2AXJA 2XN9B 4FQIL 3ZTNL 3LKQB 4G6ML 3DX9A 3ILPB 3ZYIA 3BP6A 5GGVL 5E8NA 3N9GL 2RGSA 4WEUD 1YY9C 4O2CB 5GHWH 5J4MA 3HZYB 5EPMA 4UT7L 3MRIA 4J3UA 1D5IH 5L9DH 2HTLC 3BD4A 1H5BA 5TE4H 2EH8H 1OAYL 3HNVL 2HP4A 4K23H 4XPHH 5F7YC 1AD0B 1T1WA 1WBZA 1MI5A 3UZQA 3NCYS 1KCKA 3DNKA 2VDKH 3JTSB 4D0BB 5C0AE 4UAOC 5ALBL 1D5BA 2P5WE 1MCOL 3TFKC 1U3HB 1T89C 2HLAA 1S7RA 4RBPK 5FDWA 1ZS8B 3ULUE 1MFEH 5FM8A 2X4RB 3X14B 3SKUD 3I75B 1X44A 2IADA 3TA3D 3PP4H 4LF3A 1D9KD 1S78D 3U4EB 3P77B 5H8DA 4XP5H 3VDAA 2PR4L 4L8SA 4MAYB 1HIMH 4U0RC 5C7XL 3UTTE 3D39E 4K3DL 1C5DA 4ERSL 4M43H 1CF8L 1OARL 1GXEA 3GBNH 2YPLE 4GMTH 5L2KD 3QJHB 2VJXA 5CP7B 3VXMA 1XIWB 5GJTL 1AD0A 3MOBH 5FYJE 2AJSH 3ZDXE 3F6IA 3S36H 5DRXB 1E4KC 3TNMA 3P11L 3EYOA 4TUKL 4D0DA 1U8IB 1VSCA 5A1AA 5DK3A 1MWAL 3IJYA 4HZLB 3HB3D 5HDOA 1IL1A 5HHNA 4PGDA 4OFVA 1OW0A 5D6CB 3DX7A 4RQQA 5IT2H 4F57L 5IJVA 3PJSB 1X6NA 2AK4D 3D39A 3VFGH 4MCZB 2J4WL 4NFDA 2NQCA 1J0YA 3RU8H 1CD1B 3BE1H 2DYPB 2ZSVB 3OXRB 2FJHA 4GS7B 5DHVB 3W81A 3TVMB 2ID5A 4BSJA 3ZMRA 3MREB 3WNLA 2FATL 2CIKB 5DDHB 4LLYB 5GRJH 1QLRA 3L5XL 1FNEA 2PW2B 3HN3A 4JFOB 4XAKE 4YHIB 4FQXB 3TPUB 3RHWK 4FQXC 2R1WB 4KXZH 5HYIA 1QG3A 3CVHL 1A47A 4NFCA 1MHEA 4XRCB 5HVHB 3VGBA 2YS4A 4XCYA 4LARH 1E28B 3UBXB 4WEBH 7FABL 1RZJL 1FE8L 9CGTA 2P24A 4HBQA 3QXTA 4XTRC 2Y5TB 3C6SB 4R26L 2AERT 3U48A 4KJPC 3S35H 1CDBA 2EEAA 1YEKL 5FECB 3VFVA 4MNQE 1E4WH 4LLQB 3WNOA 5EUKA 4PJBA 4ZFOB 4C83B 3QAZB 4L1HA 1ETZA 5E2TH 4HAFA 3LS5L 3BMWA 4FQQB 1N59B 3IXAB 2R0LL 1RZJH 2DAVA 4I0PC 2DOCA 3TT1L 1OTTD 3T1FA 4DCQA 4LARL 4KQ3H 2P5EB 1SBSH 4TSCL 2V2TA 3NABH 3HKFA 4G3YH 3F7QA 4M5YL 1T5WB 1XCTB 4PV8B 3LEYH 1NC2D 3P0GB 1I9RL 5KBNC 1VFOA 3V5DA 3R8QA 4EQ2A 1JHKL 5D1ZB 4HKJB 4V1DA 4LRNH 2FL5B 4Z0XA 5EO9B 4ODUB 3VXOA 1EX0A 4JFYA 4XBPA 1JTOA 1QSFD 1I1AA 2CMRH 1DR9A 3VFOB 5E2UH 2NY5H 4XNYH 4YC2B 5HHOB 1P2CA 1KFAH 1HHHB 3U0TA 1ZA6B 3FZUD 3X12A 1LK2A 4JFFD 3BXNB 4ZODA 1BJMA 4YHZH 2VLRB 5CJQL 2V2TB 5DK0B 2OBGA 2X70A 4GFTB 2YK1L 4NYLB 4LCYB 4P5TB 2DQDH 2FB4H 4M5YH 3IDXH 4X4XB 5H2BB 2EDRA 1D5XB 4G8IB 4LU5L 2B5IC 3IF1B 4OZIB 1G7MA 2JIXA 2VABA 4XCCH 1K4DA 3GSOB 1QSEB 3P11H 4JAMA 1EAJA 4IRJA 4Y4FC 5IFJA 1P4LB 2JJVA 4Z7QE 4JFDA 5CILH 2UWEA 4I3SL 5DMKA 4ZFGL 3U6RA 1DDHB 5GJTH 5CZKA 2J3SA 1MFDH 3NZHH 1IILE 1P69B 4CUCA 1WZ1L 1XAUA 1LP9F 3VXMB 2IPUK 5CEYA 2P5EE 5GQBA 1BGXH 4P2QB 5C0AB 1YYLH 1EZVY 2FH8A 3SO3B 4DN3H 3NMEA 4JFHD 4N0UA 2BVPB 1N5AA 2AV7B 1WIOA 1AY1L 4UV4H 3PWNA 4ONGL 5FHAH 4FMFA 4PBXA 3TZVC 1F3JB 2PXYA 4HWZB 5JPNA 4GRWH 4MD0B 4ODVL 4ZG1A 4PJIF 4BELD 4U2YA 1NAML 4PRHE 4JG0L 5AEAA 2Y07H 2CDGA 3PQYA 4LSSL 4TQEH 2OQJB 1KCLA 2FATH 4YDJB 1NCUA 1NGPH 4GBXB 3SGEI 5A3ID 4FXGB 1S7QA 3C87A 4MQ7A 2ERJC 2X4NB 5HHVL 3AU1B 4K23L 3U7YH 1OAYH 3HNVH 3AS2A 4OD3H 4M48L 4U6HA 3AXLA 3FQNA 4JVUA 3O11B 4NN5C 4P4KC 4P2RB 4K7FA 5LCVH 2DM4A 3MBEB 5IEKA 1HYRC 1BIHA 2I9LA 3ZKXB 2FX8L 5JIHA 1B90A 2HFGH 5DUML 4PLOB 2BNQD 2Q86B 3MRRA 1Q9LA 4PRHA 4PY8I 3JUYA 1ZHLA 1X5KA 2F53B 1XIWA 3FO0H 4NQED 4TNWK 1DJSA 3BD5A 3JV4B 3O0RL 4LCIL 4PRAA 2R1YA 2EDXA 3MOAL 3OZ9H 3JV6B 2NTSP 5CZXD 5E6IA 1PLGH 4QRUB 3MV9A 4PS4L 3BHBB 2Q6WB 4JPKL 4A6YL 1ND0A 2OK0H 3PV7A 2BVQA 1MCWW 4F7CA 4KGLA 4M9PA 4YO0B 1U92B 4JY5L 4J4PC 35C8L 5T1LA 2IQAA 1GRWA 2Z8WC 5DC9B 5IB2B 2VXUH 3X14A 1A21A 3HZVB 1RULH 3MLRL 1LK3H 4OLUL 1U3HA 2XQYK 3IXTA 4KFZC 2ZSWA 4HWBA 1UVQB 2AQ3A 4N0CC 1X5GA 2VWEE 3K4DA 4NIKB 4PP1D 3QRGL 4R90L 3ARFB 1KEMH 4YK4C 2CLVA 4WDIB 2ZOKB 4JHWH 1MY7A 3THMH 2ZCKH 5CEZD 5F7LB 2YUWA 5KVMC 1FGVL 4F7TA 5L2JA 1T1ZA 2FX8H 3VFMB 3FO2A 1PEZA 5FF6B 5J6GA 3UYRL 2JELH 5BJTB 2XZQH 3QDAA 3GZKA 1D5IL 4KKAC 2C1PA 2WAHA 3LHPL 3K3QA 4EI6B 4NN6B 4LLMB 3Q5YA 3IT8D 5B39A 2JIXB 4JGUA 5ETUA 5CEZH 4I18A 5FYJL 1T80A 2B0SL 1F45A 1JYXA 5H2BA 2BOBA 1P4IH 5KANG 5KS9B 1V7ML 4NO0B 5DJ2B 4LEXL 2HJFB 5SWQA 1V7NL 1NDGA 4MD5B 3RNKA 5B38B 1BX2A 3TO4C 3LB6C 3SKOB 1IGIL 4IS6A 1EJOL 5DVMA 5GXBB 1A9EA 5E95B 1U91A 1B0WA 4LHUD 1M1SA 1QO3B 4O5LL 5EFIB 4I2XA 4MQSB 3MO1A 1ZMYA 3Q5TA 4R4ND 4Y1AA 5EC2A 1G1CA 5T1KA 3KXFB 4FQCH 3N1FC 4WU7B 4PBWD 1ZLUH 3QEHB 1W2KT 2QSCL 2HJLA 3V5HA 1LO0L 4PRPA 1AO7E 4Y8DC 4QRQB 4P9HL 3G9AB 4HS3B 4PJXE 1F4HA 3ZDYE 1HHGA 2VN4A 2OTPA 4K7PH 2AP2A 1EHAA 1QNZL 1R6VA 1MNUL 4NJAL 3EHBD 4ZS7H 4HEME 4OTXH 4NZRL 3RJQB 3GKZA 4WFED 1EUTA 4RGNB 3FT2A 2GSIB 4IRJC 4NDMA 4OFKA 4OBRA 4AIZB 4LSPL 4PRDA 1GC1L 5DRZA 3BPNB 5E6ID 3TBTA 1MVUB 2GIYA 2UZIH 3F7VB 3DRTB 3FZUC 2NY6B 4XMKH 1NBYA 4LU5H 2GKIA 1UZ8B 3QNZB 1WIPA 4EIGB 3C6LB 1JPFB 3MO1B 1I3UA 2I5YH 5HD8D 3MLWL 4P59H 1WWCA 3V0VB 4PRPE 2VQUA 4LNVA 4CN1A 1A7OL 3DTXA 4MA1B 1NH6A 2BHZA 3QDGE 3TZVA 2ZUQB 3TT3H 4NOFA 1FYTD 1DQDH 3O3DA 3VWKA 3JWOC 2BNRA 2P45B 4D9QD 4PTTA 1LEKB 3VCLA 2LAAA 2AJVL 3U1SL 1DVFB 1YDPA 4Z0BL 2VISA 5BJTA 3SHSA 3MUY1 1QYGL 3MJ8B 1ZGLB 4MB4A 3NA4A 4ZXBC 1IM3B 4LAJH 4I2XB 3OXSA 4F7CB 1JHTA 4NQXA 4ZAKB 4NQCE 2Z93A 2EC9T 4XX1G 3RNQA 3SKOA 2Z0BA 4E42A 5DRWB 5DQ9B 4ZPVA 1MI5E 3IAGC 3IAPA 4GLRH 4L9DA 5C09D 2H1PH 5E7BA 4OGAD 2BJML 1UA6H 3O41A 4HCRH 3PE9A 4KUZL 5DI8A 4UB0H 3RL2A 4HUNB 5CHNA 3H9SA 4BJLA 2ICEA 4AQOA 4N90D 3IDNB 4XBGA 1N6QL 2BXZA 1BAFL 3TVMA 4KKLD 1NCWL 1JK8A 1TQCC 4ZDHB 3V2AR 2EE2A 5GRXG 2VXSH 2Z8VC 2J5LB 4NT6A 1D9KA 3DURA 1MCEA 1C12A 3FQUA 4MA8H 1PX3A 4Z7UB 1QACA 3WNKA 3L3IA 3HC3H 1I7ZB 4R4NC 2RBLA 3CFEA 1H0DB 3QAZC 2A1WH 1R5IB 1EA9C 3BT2H 5ALCL 1UQSA 4YIQB 1MREL 4OJFL 1ZTXL 4EDWH 3WEXA 2HVJB 4AQ1B 4EXPX 1F6AA 1FYTE 1U8HA 1ED3A 4U2ZA 3NFSH 1XR8A 4JG1H 4XHQA 1QSFB 4CVUA 2WP3T 3ARYA 5FDYA 2BY3A 1TJHH 4BZYA 3NTCL 1H3WM 4QRSA 1EUUA 2W92A 3LQAH 1MCWM 4OZGF 5D93C 5I18L 1EH9A 1JVKA 1EDQA 3JTTA 2QSTA 1NSNH 5EOQH 4GO6B 4JY4A 3MRPB 5IFHL 3T0EA 1RUKL 4UQ2B 3HI1B 4PY8J 4F9PA 4G9FB 4HGWB 4U1NB 4M4RA 3IVKA 1U93A 5EPMB 3PHOA 5L7XL 4I18C 4LVOB 2HT3C 4PJ7B 4KUCD 5ACZA 1F4WL 5DRZB 1A1OB 1JTTA 1MWAB 3BDXA 3Q6GL 4K7FB 4AMKL 2E27L 1OAQL 3LN9A 5HHMD 2ZKHH 1UXWA 3MOQA 4F15B 2PTTB 3KYOA 3MLWH 4PB0H 4YXKL 5AYUL 4E42B 3W5MA 1AGEA 1QFOA 2J6EL 1BZ9B 1NGQL 1MCSA 1NLDH 3WLWD 2B20A 4P0DA 1JMXA 1NL0L 3B9KB 3GIVB 3RDTD 3KHOA 1HZHH 3C6LA 1XF4A 2EO9A 3OG4B 4S0SD 4YQXL 2BC4B 4MD4A 3HI6L 2EIZA 2W38A 2EXWC 3CLEH 4PJ5B 1LEKA 1VKXA 1ZE3C 2Z31B 4I48B 3WIHH 1YEDB 3P9WB 4OAWA 3IS1X 5HGBA 4R8WL 1JZ5A 1K8IA 5DMYA 3G5XB 4FTVB 5I0ZA 3WJLC 3L7EB 1LHZA 4JB9L 1UJTA 4P57A 4P9HH 4AY0A 1WEJH 1F02I 15C8L 2GUOA 2XNAA 5JXEC 4HDIA 3ULUH 2VLJE 2J88H 4WHYG 1MJJA 3DO7B 4O51A 2A38A 5DJCA 4C4KO 3GJFA 1T7XA 4OGYL 2X7LB 2BC4A 4MD4B 5GS3A 1XF3B 1WT5A 2NY2B 1I7RB 4FQIH 2EC9U 4PJ8D 5BCAA 5T1MB 1ZOXA 4X6CE 4Z0XB 5L2JB 2FJHB 3BPLC 2BRQA 1YMMB 3LH2H 1H8NA 1IAMA 1A22B 4QEGA 1HXYA 3RTQB 5SX4H 3QEQD 1UJ3A 3HAEB 1ONQA 4XCYB 2C1OB 3EUUA 3HC3L 3RUGA 4NQEB 4OCRL 5BVPL 3ZYZA 5I71B 3OKNA 4NRXA 1AQKL 1A7RL 1MCKA 3S5LA 2E9IA 2C3VA 5KSAA 4HBCH 1U58B 1KTDB 4G6FD 3N1GC 3ZKQD 4HG4J 3MV7D 3PGCB 3SDYL 4HT1L 5A3IC 4PRBB 4YC2C 3GB7A 5KG9A 2FJGA 2MOVA 3VGEA 3RWIB 3O2WL 1BQSA 2ICWJ 4N9GA 4HWNA 4LLUB 1FZKA 3D1MC 3QUXB 5HXMA 2DQEH 4UBDD 2BDNH 2QLVB 3RP1A 4F37K 3BO8B 4V2BA 3HFMH 3G08B 5D6CA 1YZZA 4OZFA 1EFXA 2GSGA 4WU5A 3WHE1 3KXFE 2R4RL 1G0DA 2HVJA 4N1EA 4M6MH 3FOMA 4ISVB 3P4LA 3RZCA 3VXTB 1FV1A 3KPRA 4Z8FH 5CEXA 4JRXD 3U7WL 4YEFA 2VKWA 3UXFA 5KVDL 2E3VA 4OKVB 2XQYG 4X9HA 1CLOL 2AEPL 4OZHE 4U1MA 1C12B 3FQUB 1G9NH 1UM5L 4X7SL 4Y4FD 1A6TA 4YPGA 1KELH 2AK4A 4M5ZL 4MA1C 4G5ZL 4ACPA 1QFWH 1X3DA 1PD6A 2IAMC 3RY6A 5E8NB 4B7LA 4KZEL 4M03A 5AWNL 1NAMB 4DGVH 2NY4C 1Z3GL 2QR0A 4G8FB 5LGKA 2P43B 3VU2A 1TQCB 5BS0B 3QCUL 2PO6D 1HDMA 2R69H 3QUKB 4QO1A 2A6JA 4OZGB 4JO1H 2VNCA 2P8MB 5EA0H 1CU4H 5INCB 1YN7A 2Q76B 1TPXB 3HI6H 5B22A 4ZAKA 3ZDZE 5JHDE 2GTWA 4H8WC 4LSTH 3IU4L 4Y19E 1B4RA 5L2KE 1NBZA 3U0PA 3LN5B 1BMGA 3EBAA 4MZ3A 2FEEL 5IWLA 1NLBL 1NCAL 1T66D 5AWNH 1RIHH 3Q2CA 3MA9H 1MCHA 1G7QA 5IB5B 2IQ9H 3WO4C 3ROLA 5FYKH 2ESVE 4AMKH 1KELL 4QT5A 1M6OA 1IGIH 2IC2A 5FCSH 3DX8A 4RMWA 5M94B 3VI4E 2ADGB 1V8HA 4QXGH 3QUKA 2YWYA 1F4XH 4QRPA 4XB8A 3X12B 3PL6B 2RB8A 5JORB 2YA2A 4N5ED 4PJGE 2IJ0C 3MBED 3QHTC 2A9ML 4Y2DB 3CK0H 5MENA 3TWCL 3BOVA 2QEJA 3ALXA 5IQ7L 3GSUA 2BOCB 5KSBF 2WP3O 5C0RL 5DURB 4HKZB 3F12A 1B4JL 1K4DB 3VFTB 3SKJL 4L8CA 1NGXB 4JREB 4PJDA 2HMID 3WO3B 2XYCA 2OMBA 5D1XA 1HXMB 1FGVH 3UDWA 4X5WB 1FO0H 4X9IA 2AEIT 1LE9A 1JNLH 2CLZB 3CH8A 3TBVA 3V4VH 1DBMH 2VLKE 2V7HB 2NZ9D 3K81A 4QHLB 3EO9L 4XPBL 4C56E 4P2YA 5J1SC 4JLRB 3DYOA 4I0PA 5KW9H 3IFNH 4L3CA 1RUQH 4R96B 2APVA 4HWBH 4YZFF 2R2EB 1RULL 3EDKA 4PRNA 2QQNL 3BH8B 2X5PA 3NGBC 5FYLE 1AXTH 4QNPF 3TO4D 3MROA 4RWYH 2GFBB 4S1SL 4F33B 2OJZH 3I02B 2WV3A 3HC0A 1SBSL 5CJOH 5I73C 4G6FB 2DLFH 4OCWH 3RWJA 2NY0B 3P4OA 1GGBH 3OR7A 1JYVA 2EICA 2QBWA 4JM2C 2MKLC 4JPIB 4U1SA 1ZHNB 5HGAB 1F8TH 1QQDA 1DBBH 4LLVA 1J1PL 3LV3B 2EYTA 2VDOH 4LSQL 3D3VA 5F72S 4WV1C 1M05A 1PVHA 2HVKB 1CLYL 1HSBB 3VXSA 1LE5A 2HFGL 3GK8H 5DUMH 1OT1A 3BVNB 4WI9A 3DO3A 4NCDA 2ZSVA 4XMLL 4AENA 4Y2DC 4OZIF 1YEIH 3A6CH 1FSKB 4DKDC 4P57B 3SQOH 5SV4A 4KY1L 3QZWG 1WC7B 4YHYB 2ATKB 2WMPA 1XGQB 4NZJA 5FV2A 5MEOB 1S7TB 4HULB 3EOTL 4PY7A 2AKRB 5EOCL 3VDCA 5E2VH 1NCTA 1U8JA 2D7OA 2DQGH 3MCKA 5DTFB 3FFCB 2DJ4A 1DEEB 4WUUE 3BVNA 1TQBB 1AGFB 1DCLA 3GI8H 5DA4A 5EZOL 5CJBA 5JUEH 4QHMB 1FNHA 3PWPB 2C9AA 4XP1L 2B1AL 2HVKA 2A74A 3VI4F 5MENB 1FN4A 2NX5A 3VDBA 2VL4A 1DZBA 1FG2A 1FL5B 4OM0L 4K2UL 1JN6A 3P4NB 2XTJE 4MSWA 5L6YH 4R3SB 3L9RA 1S7SA 3TIDB 5HPMA 1FLRL 2ESVD 4ZNCD 4UTAH 4AYFA 4UV4L 3KS0H 4P46B 1M4KA 2CD0A 3Q3GB 2J6EH 1I7TB 5BS0D 1HXMA 4D3CH 4ORGA 5DQDL 4YX2L 5TDOA 1NC2B 4R7NA 4AG4L 1LDSA 4KTEL 3MACL 4OLYL 5FO9B 5GRVL 4HK0A 4M7KH 4YGAB 3CFDB 1FZMB 3SDDC 1DBKH 4LLYA 3A6BL 4WNQB 3MOBL 4L3CB 4E41B 3T77B 3EO0A 2AXFB 4J2XA 1DL7L 3BP4B 2DJSA 4POYA 3U4BH 3C8KA 3CXHJ 4U6YA 4PJ9C 4ELMF 4XP9L 2ICWI 4PRHD 3KPMB 4ALAH 5C0BA 5IVXF 3TIEB 2OJEB 3RY4A 3CSYB 3UO1L 5HVFB 1ZLVK 3PWJB 4G8GE 4ODHH 1TJGL 4LRIC 4YK4B 5E4EC 4GG6B 3P30L 2A6DA 1RJYA 1DBJL 5BXFB 2Z4QA 5IVXE 1U8QA 4RDQG 5ACZB 4X7TA 1ZGLM 4Z95L 3I3EA 1FJ1A 3KPPA 4G42B 4NUJB 4L4VB 2JCCE 1QP1A 5IBLC 3RBGA 2BSED 4EI5C 1MRFH 5GJSL 2H2PD 2NXYD 1JP5A 4HIHB 5JW5A 5FOBB 3NCJH 5EWIH 4GXUM 3TP4A 5DUPH 3SDCA 4LRNL 1OD9A 1A7BA 1N0XH 4U1MB 5FKAA 5D7LE 1H8OA 1KCRH 3KR3L 2Y06L 1JMZA 4LLDA 1A1MB 5L9DL 4MXWL 1NQBA 1EK3A 4RWYL 3CDGA 1JN6B 1Q0XH 1XR9A 3X3FH 4OI7A 2OR9H 2VDNL 1MLCB 4JANB 2VXSL 4LSRH 5EC1B 2NTFB 4ETQA 3H7BB 5GISH 1NCWH 3GO1H 5JDSA 1ZVYA 5SX5K 1MCIA 2VZVA 3C5JB 5JW3H 1UWXH 1IQWH 3B9KC 1INQB 1L0QA 4RCAA 5DVNA 2Q8BH 1BF8A 1G84A 4ZTOH 1MAML 2DDQH 3UTSA 3D2UB 1KENH 4FXKB 1ZLWH 1QPXA 1L7IH 3OKOA 2P8MA 2RQ8A 1RFDL 2YXFA 2FR4B 3EYVB 3LKOB 1UB5B 1Q9OA 4KDTA 3HA0A 4P3DB 5E9DD 1RY7B 2IMMA 3JV5A 4LVEA 2JK5A 3BKMH 4PJBE 1WWWX 4Q74A 3D6GA 4RWHA 4M4PA 3T77A 5LQBL 1HCFX 3CK0L 4M7LH 5LXGL 3HZYA 4JDZA 4NC1C 1IC5L 2CUMA 1T6VN 4LHUG 3VWKB 1KPVB 2H3NA 5E9DE 2QKIB 4P23D 3RUGB 1HOCA 2YOCA 5ID0A 4OIBA 4PY7B 1G6RA 2P44B 1AIFA 4K3HA 1JFQH 4GRLC 4KU1A 4HJJL 2I60H 4NRZB 2YZ1A 3VA2C 1N59A 1S5IL 5CZXC 4ODXB 3U36A 1ODAA 4TULL 5B8CB 2XT1B 3PHSA 3TLRA 2D4FA 1A6ZB 1QR4A 1CE6B 1S8DA 1NPUA 5I71C 3NIGE 5EUOE 1R3JA 5D5MA 3HE7D 25C8H 4X8JB 2F19H 4NRZA 1F3DJ 2XV6B 4Y0GA 1I8LA 1CXLA 4P2RD 3ARFD 1CT8B 4NNXA 5E94B 3FHQA 2R15A 1SYSB 1QR1B 4TQEL 2O93L 5J6HA 5SWZB 1A64A 3U0WL 4AK1A 4M7LL 3BUYB 2UVEA 3MRJA 4LGRB 2D7PA 3JVGC 5IVZB 2R2EA 1BVZA 3QUZA 1NBVH 1XF4B 3LOWA 3PG2A 1G9EA 3B9EA 2BMKA 1J0IA 3S5LB 3VWJD 4HS6B 4PR5B 5IROC 1Z9MA 3ZLQC 5A2KH 4HSQA 5L0QC 2DYPA 1S7XB 2WM0A 4N5UA 4GRLA 5GPRA 4E41D 3QISA 4TVPH 1A3RL 4EN3D 2HTKC 4ZAKC 5JQ6H 2QQKL 1AXSA 3HB3C 4UOW0 4WJ5B 1VEMA 3T0ED 2GY7B 4N0YL 4B50A 1ZHBB 1UXSA 4MJIA 1P4IL 1LD9B 2H9GB 5LBSH 3QUYD 1NFIB 3LS4H 5E0QA 3C09B 3BW9B 1PKQA 5HGHA 1Z3GH 3U9UA 4PG9A 2X9XA 2NTFA 1UWGL 4EVNB 3I2CL 1NUFA 3MXWH 5KSVB 1WITA 4F58L 4G6MH 2CLZA 1X5IA 4PGCB 1HQRB 2JB6A 3O3UN 4HS8H 5D1XB 2EZ0C 3P0YH 3B8SA 4XC3L 4HT1H 3DV6B 3HG1E 2OTWB 1ACYH 4UQ3B 3O3EA 2Z35B 5D7IA 3GSQB 3ZE0F 1R3KA 5ITFB 3GNMH 5IG7B 3A67H 1DUZA 4MXQD 5EIIA 1L6XA 2FD6H 1NBZB 3U0PB 4IMLB 4PPTA 4RISH 5K59E 1OTUC 1W0YT 4TSBH 1C1EH 4X6EA 1S7UB 3LDBB 2L7UA 3IDMA 3QJFB 4ZO9A 1HYSD 1OSZA 4JY5H 3M8OL 12E8L 4C55A 3IGAA 5CCKL 3ZT5A 1T3FB 5D7JD 5E5UB 4TOYH 1FVCB 5DFVC 2VMFA 2EDOA 1G9NC 4OT1H 5TJWK 3RIFF 4AZ8A 3E6HA 1KTRL 3MRGB 3GSWA 1EHNA 3H9HA 2Q86A 5LGJB 1OTTC 3FONA 1E4WL 3GSNA 2BY0A 3D0VB 1KN4H 4CW1A 4W6YB 3G5YB 3DVGB 2RHEA 1OWWA 3X13A 5CMAB 1P4BH 1S7WA 3WXVL 4J7RA 2GK0A 2GTWB 1FL3B 15C8H 4PJ8A 5DMGC 5GISL 4HBCL 4X6FA 5DJAB 3UTZB 4YO0A 1K8DB 3TBYB 2BZDA 2DJUA 1KC5H 4D0CA 2AXGB 1EGJL 2MPAH 4NQTA 2GJ6A 3CSYA 2ILLA 4FNLL 2YRZA 3L6FA 3PWUB 1JGVL 2NY3C 4NN7B 4JQVA 2KH2B 5IHLB 5HYJB 3VWJB 1NDMB 1CFSA 1NGZA 2CJUH 1VESA 4GAJH 2PCPA 2I9LB 3K7UA 1TDQA 4GRLD 1OP9A 3QO1A 3RVXD 5D70L 3T3ME 3RU8L 1VACA 3T0VA 4N0UB 1KB9J 4W4OC 2I07A 3GEWB 3SDXB 4QHKJ 1EGJH 1G7HB 1RJZA 5GSRA 1S5HA 5GS0L 3DLQR 2C7UB 1J0KA 4LCUA 4I0CC 4Z7WF 5J1AB 3ARPA 3OAYK 4XPGL 1RZ8B 4UDUB 4BYHA 4R7DA 1SJHA 3QI9A 3MLYH 4HH8A 4U0QB 3G6DH 5JW4N 2X6MA 2B2XL 1A9BA 5L7XH 3K1DA 4MAYC 1RZIA 2WNGA 4NKOA 4QCIB 3UTQB 4FFWC 1KN2L 2VLJB 4H1LG 2RJMA 3DO7A 1BLNB 3SKMA 5C1MB 3O3DB 2DM3A 4OLVL 1EFXB 3HMXL 4ZUTB 2JJSC 5C0IA 2VH5L 5BOPA 3QQ9C 2X70B 1C5BL 3GBML 3KLHC 4G43B 4ZPVB 2XTJB 1EXUA 1TTFA 4YXKH 1I1CA 3P2TA 3CC5B 3HC0B 7CGTA 1DE4A 1UT9A 1JHTB 2QL1A 4NQXB 4C56D 3V5HB 2RCSL 3RKPA 2NY6C 5EZLB 4JDTH 4KI5D 1HH6A 1GZQB 1OAQH 1ZGLA 4K2UH 2V9QA 4YHYC 3SE8L 5IGXH 5E8EA 2XZZA 1Q9WB 3O3AA 2RFXA 3SDDB 1KIUA 1KYOJ 2NNAA 2FL5A 4XC3H 2K9UA 2C3VB 2O5ZH 1CGWA 1YNTA 1YUHA 1REIA 2XQBH 2KPNA 3TA3C 1KOAA 4XB7A 3IU3A 2YBRB 2QHRL 1IM9B 3KPOA 5DJDA 2FYYA 2VLRE 4LK4A 3RL1B 4CKVX 3ULUF 5DFTA 4NPYA 5I18H 1UWGH 2XTJC 2LAGB 5AUMA 1BZ7B 2PYFA 1T4KA 2J6EA 3SE9H 4BKLB 5CZVH 2KZ1B 3HMWL 4JG1L 2WBJA 1BJ1J 5CJXC 2HJKB 2W9DL 3GJFK 4PJ7A 2F53D 2XOTA 2CDEA 4LLQA 2HTLD 4LCCB 3EFDL 5GGRY 3VFVB 4HCRL 5EZLA 5GS2H 4GW4B 3LQMA 1SJHB 3B9KA 3QI9B 4RMQA 1FO0A 4YHNA 1U91B 4OD1L 4OZ4A 1Q9KB