4X6DF

Cd1a ternary complex with endogenous lipids and bk6 tcr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
b'GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRYFLPTQGMGAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1a
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 241
sequence length 241
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dF02
4LOUD 3CFDA 3GHBL 4EI5D 1EFXA 3NPSB 3T3PF 3QZWG 3MLUH 5FYLE 5K9JL 2J6EL 1A3LH 2AJSH 4JM2A 4ZOAA 4ZMAT 2PR4L 1BQLH 3QCUH 1NANI 4LSQL 3ETBF 5DGRA 2QSCH 3T2NL 1MY5A 1E27A 3TBSA 5A2KH 2IJ0C 4PRBB 4TPRH 4P23C 5DURD 2GSGA 1YMME 1NGYA 1YYMH 4I5BB 2QL1A 4NKIH 4BZ1H 2AS5M 5F1KC 5HGHB 4PPTA 2FZ3B 2UWEA 3TWCH 2H6PB 1JRHI 2JJTA 3ZDYE 5KVGL 2E9IA 3KNBA 4OFIA 4R26L 4XMPH 5AD0A 4PRHE 1E4WH 2WBJB 4GO6B 3RNKB 1AQDB 2MMXA 2R29H 3BGMA 4KK9D 5I6XB 3O8XA 2QHRH 4QCIB 4X9BA 3R0NA 3CMOL 3QEUA 3DETD 1I8KB 3UROR 2X4UA 2X1PA 4R7DA 2VAAA 5FYKL 1BOYA 3CX5J 1F45A 3NCMA 1OB1A 2QSVA 1MWAL 3AU1B 1OPGH 5EWIL 3ARFA 5ENWB 3FFCB 1UB5A 1I1CA 5DRZA 4Y5VA 4G43A 4PR5A 2Y9RT 3P4LA 4Y1AD 2XWTB 4L3ED 4XB8A 5E6IB 2AK4E 3BZDA 3G5ZA 4EVNB 3MNVA 1JGDB 5AAWA 4TOYH 5TDOA 1CF8H 3DMMA 3IDMB 1BJ8A 1KPVA 1ZVHA 2CJUH 4M7LT 2HN7A 2Y36L 5JNYB 3ULVD 3MYJB 4L5FH 2J88H 5E1AB 5L9DL 1UQSB 3L3IB 5ICZA 3V6OA 4XI5C 4JVUA 1UEYA 5DJCA 2GI7A 1TETH 4OQTA 5MERA 2N1KA 2DLEA 3B2VH 5FYKE 5HHME 5EG6C 2D31B 5LXGH 2G9HB 2H2PC 3TV3H 4PRPE 1GOHA 3VXRE 4LCYA 5EZOH 4JFQA 4ETQB 5L2JA 2ZJSH 1EEYA 3UBXB 2V2WB 3UP1A 3RVWD 1KB5A 1QYGL 1AHWB 4K71C 3QXDA 2EYRB 3RUGF 2MOVA 4JFDB 3JV5A 1KJ2L 4JN1H 4Z7OE 5DD5L 1MF2H 2DM7A 4Y4KD 1CR9L 2GUOB 4PJ5D 5D7JB 5IHLB 4KMQA 3QDJD 2BJML 4JO2L 3N0PB 3KJ6H 1YEIH 4PP1C 5DJZA 3VG0L 1E28B 3VFVB 5TF0A 4HGMA 1C12A 12E8H 3WKML 4I18C 1QRNB 1IC4H 3AY4A 3BRFA 4OSUL 1E6JL 3FQTB 3ZZ1A 1NUGA 5DQJA 1I8IB 2A6JB 5AYQA 2X40A 1NCCH 1I8LA 4BQ9A 1TJHH 5F1IA 3W39B 2MFNA 3SE3A 2R23B 1CTOA 1AGEA 1FFRA 3LPFA 4HZLB 4WHTA 3P73A 5HYSB 1DEEA 4LSRH 5D5ME 3INUL 3ALPA 4PTUA 5GS0H 3GNML 4JY5L 3N85H 4KKCD 2VWEE 5JHDB 2DKSA 3EOTL 1UVQB 3W0WA 3L9RB 5HHNB 4ZPTA 1HYSC 4NN7B 4N0UE 2E6JA 5FO8A 3B43A 1KPUA 3I6LD 5JMOC 1U8MB 5KVEH 4PJDE 3VXTB 2Q8AH 4GQ9H 4OD1H 5I9QC 2HWZH 5E7FA 4IMLB 4U1LB 1UH4A 5A2LH 4GRWE 3K8MA 5HD8C 1NCWH 2H26B 1Q94A 4CW1B 3TPUB 1PW3A 4JFZL 4MD5A 1OM3H 3QUXB 3PABB 1PG7L 5KOVC 3WFDL 1LE9B 2IALA 1BJ1J 5BZDB 4GMTL 4OZHF 3HN3A 5M94B 1GYAA 5C0CE 2YEZA 4HQQH 1KCUH 2ZCLL 3LEYL 4TSCL 3HA0A 3IU4H 3VRJA 5MEOB 3QJHB 2VR9A 3IDIA 4F9PC 4ETYA 1XGTB 5F88B 3VXSE 1GOFA 5C3TA 3UC0H 4M5ZL 2EH7L 4U1NA 3MRPA 4FNLH 4PJAE 4CU7A 2GTZB 4JR9L 4KVNH 5HY9A 1OD7A 3SDDC 3SJVE 2F8XC 3RUGA 1J1XH 1JF1A 3N50A 1N5AB 1DUYB 4GS7C 3K8KA 3LSOA 5CP7A 2VUYA 3CLFL 1A47A 1DQLH 5E8DH 2ADJB 4MXQD 1VEPA 5IFHL 5DHVB 2YD1A 1ZA3A 2V7HA 3MLYH 4PG2C 2YRZA 3CX5K 5IHUH 2BK8A 1A7NL 3ET9F 4MJ6A 2UVFA 1M7IB 1GZQB 3O4LE 5H94B 2JTDA 5FK9B 4YHKH 2WV3A 3ZTNH 5FO9B 5HHPB 5HHQB 2BVQA 1ED3B 1QQDA 5JQHC 4FABL 5IGXL 1KG0B 2FJHB 1Z2KA 5GXBB 1OF2B 4JY6B 3SE4C 3PP4L 5D1QD 3L3JB 4P57B 4M4PA 4RMVA 4NCC2 3W9DB 2FGWL 2XN9D 4R4BA 2X1OA 1T7YA 4PYHA 4YDKH 4M1GH 3O4OB 2BVEA 1CDGA 3N1MC 4P5KB 2EE9A 1HINL 1RSFA 3OAZK 3O9WC 4WJ5B 1S7RA 1GH7A 4K8RH 4DAGL 1JZ4A 3H7BA 4RFOL 3MGTA 4OB5H 4PJXE 4LPTA 2X4QB 4PYGA 4LQFL 4MX7B 1FFNB 1HILB 5E2TL 1QFWI 1T4KA 5ICXA 3WLWC 1QSFB 1G7PB 4OFKA 2HT3C 5I30L 4CMHB 4O5LH 1L4IA 3T4AA 5DD6B 2I5YH 5AG9A 3S3JA 4L8SA 1F90H 5EBLB 5F9AC 5TE4H 4ZNEE 3K7UA 2DQCH 5GRYA 4G80A 1BVLB 2OK0H 4OZHA 3W9EB 1KLGB 4LKXA 5KN5A 3JWOH 5DHYB 1CFTA 1DSFL 1WCBA 5IR1A 1EA9C 1SJHA 1WWBX 4L9LC 1JGLL 2CMRL 3AC0A 2XRAH 4HULB 1CL7H 5E8NB 3SDAB 1T04B 2QADC 5DUMH 4YWGH 2UUDH 4ODTL 1F3JA 3QXAB 3MV8E 4OQTL 2RGSA 5I2IB 1A7PL 1EBPA 3PJSA 1XGPB 3IDYC 3H3PL 4KI1A 3BX7C 1FNLA 5MENE 1KACB 2MQ0A 1VFAB 1VKXB 5FGRA 2EDEA 3LCYA 5A43C 1RIVL 4HV8A 3S3PA 2DQIH 3V5KB 2FBOJ 3OL2A 3PWUB 3BPCB 3DGCR 3HC4L 1RV6X 1KJVB 4M7LL 4OLZH 1I4FA 1A14L 3KPRA 2C26A 3G5XA 4M00A 4Y4HD 1MLBA 3CGTA 3PDOA 3RNQB 1R5IB 2P48B 2ZG2A 5E99L 4OJFH 1XGYL 1BBJB 5GGTL 4HXAL 1AXIB 2Q6WA 1ORSB 2MHAB 4H88H 1PAMA 2VXTH 3D25B 3TJEL 3FQRB 3RWJA 4Y16D 4C56A 4PRDA 3RWEB 1T6VN 3VGBA 4ELKB 1TDQA 3ARBA 3GGWA 2G75A 4Z0XA 4HF5L 1JV5B 4G6ML 4N5EC 5J6GA 5JPMA 5SWQB 1OGTA 2QQLH 4JFFA 1QEWA 5DJYA 1C5BH 4D0BB 3IKCA 3TBVB 4QTIL 5BOPA 2GEEA 3HC3L 3FT3A 5HGBA 3NH7L 1UZ8B 3HZKA 1NDGA 1A6UH 2MWCA 1Z9OA 2IGFL 2RBLA 2VLLA 4HD9A 4F9LA 3GZKA 1IKFL 4J2XA 5JW5A 4FN0A 1K8IA 2PN5A 4CNIB 4YZFF 5IVXF 4ESKA 1NCTA 1CFSB 3QQ3A 5T3ZH 2PYEE 4MDIA 2C1OA 4MNQA 4UIMB 1H9VA 5T1MB 1FYTA 4ZSOE 3OAYH 1I1FB 3ZE1E 5ID1B 2P5WA 5KSBF 5C09E 3QWQB 5E5MA 1EXUA 2JKXA 1QVOB 1NUDA 1RZ8B 4ZPVB 2H1PL 3CDYA 4GXVL 4TNWK 3TZVC 3QSKB 2YK1L 3RWCA 1IGMH 5DJXB 1U8JB 4M6NL 3TA3D 3P11L 1KPRA 3SDYH 4ENED 4ZO6A 4YHOH 1BHGA 1T20B 4NRYA 3FQWB 4F8QA 1G1CA 4UQ2A 2EZ0C 3FFCD 4J4PC 2VLRB 3K2UH 1Z0NA 2L0DA 4W4NA 3LV3A 3T8XB 4NKMB 1S7XB 2EC9U 3MV7A 4MLIA 1X5IA 1MRDL 2KQNA 3TYGH 5CEZL 4K9EH 3P4OB 5DF0A 1YPZF 2RQ8A 4XNQB 4CN4A 4ZFGH 5EZLB 3VGEA 2OJZH 3X17A 5BW7A 4LARH 2CDGB 3C5ZB 3HPLA 4G6FB 3S6CA 3P0YL 5T3XH 4HWBH 1E0OB 3EOAB 4HKZB 4NGHH 4S10A 5CILL 2EH8L 4E41D 2FWOA 3BKCL 2AXGB 2Q86B 8FABA 3MJ7A 1EERB 5LBSL 5D6CA 3FRUA 4YJZL 3UTTB 5HYQA 2R1WA 3AMLA 3DIFB 2QR0A 3BPLB 5IBTH 3ARGA 4JFDD 1IM3A 2WINB 4LOUC 3N06B 5T5FH 2DBLH 4HLZG 3MRCB 4EI5C 3E1F1 4Z7UE 4G8FA 2H8PA 2GYSA 5FF6A 2A9NL 4JY4B 4X7DC 2R4SH 5D7JD 3F5WA 3I9GL 5CEZE 4NUGH 1G0YR 3HE7A 4AEHH 1NBVL 1UM4H 4RGOH 4KQ3H 3CFEB 1SEQH 4ODXA 4HCRL 3TBYB 2X9XA 1F6AA 1UZ6F 1B2WH 1ZHLB 3U46A 3PWVB 4L4JA 4Q0XH 3P4MB 1XFPA 2BVPB 3T3MF 5D93C 5IVXA 2XYCA 4AMKH 4NDMA 4KK9C 1VGKB 3ELAT 1OP9A 5JHDD 5D7SH 3DETC 3HS0B 5HYJA 1Q0XL 2VC2H 3IDJB 2NW3B 4N1EA 5KSBA 3OXSB 1S7WA 2J8UF 3WFEH 5DQDH 4MXWH 1MCJA 5E9DB 1F4WL 1CDBA 1A0QL 4F33B 4PP2B 5TE7H 3PG2A 4KKLD 5D1ZC 2IPUG 1RZJH 4Y1AE 4L3EE 4XPBH 3W5NA 2RCSH 4JCLA 1HHJB 5EPMA 4EKXA 1NDMB 1AGFB 4NNPH 1HI6B 4N8CH 5C07A 3ULVC 2YWYA 3HNSH 3M1BB 2XQBL 4KDTC 2HKHL 3QUXD 5IW6A 3CDCA 1G9NH 3BEVB 2QSTA 3VCLA 1JPGA 4X7TB 4HWZA 1YPZA 3OX8B 4HKJA 1EEQA 1EHLL 2APTA 5EIQA 1XGRB 5D2LB 1RJZB 4QRRE 5CD3A 1NAMH 4XNYH 4JVPA 4ZS7L 4Z0BL 2WUBH 3H9SB 3RVWC 3QNYB 3FO2A 4LBEA 4JJ5B 1VCAA 2F58L 4H0HB 3DRQA 5IV2B 4Y4KC 4PJ5E 4TNWF 3RL2B 4PGBA 4U05A 1CXLA 1ZA6A 3KLSA 3X12B 1C7SA 4PJGF 1D9KB 5IJKC 5GJSH 1K4CB 1Q9OB 2XOTA 3C87A 4HX1B 5E0QA 1U8QB 4XH2B 4BSVB 1HXYA 5FAAA 1LMKA 1EEUA 3T09A 1P1ZB 1RUAL 3FB5B 4LPYA 1INEH 4HLJA 2EDNA 2XY2A 4LVOB 1ITBB 2Z35A 1DLHA 4OD2A 2CKBB 3SE9L 3RWDB 3U4EB 2HFFB 4AIXA 4FZEH 3QUML 4D9LL 4X4MA 4EJ1C 5ALCH 1K4DB 2GSIA 1WFTA 4P9MH 3RGVB 2KPNA 3DGGA 4KKCC 2V5MA 3O3BA 2BZDA 3QG6B 2EDLA 2X9WA 2CO6B 5FGSA 1A1MB 5F7FA 3T0BA 2EIDA 3LKNB 2VXVL 1RUML 4UT6L 1YNLL 2VXQL 4DKEH 3K4AA 3T0DA 2A6DA 5DT1H 1JPTL 4P99A 3MGOB 3EYSL 4N8VG 2F54A 1F2QA 1UM6L 2J8UA 3HI1A 3ZDYF 1PEWA 1RUPL 1MFBH 4QKXB 4XXCA 5C70A 4MD0B 4I9WE 3MRFB 5AZEH 1A6AB 1CD1B 3REWB 2CRZA 3GI9L 1KFAL 3BH9B 1ZVSB 2HJKA 1GZPA 1HZHL 4NQCD 4ODVL 4LRNL 4ORGB 4BK4A 2ED7A 4LLVB 4I3RL 4LHQB 1OAZH 5FKPB 5B8CB 3B4NA 5LAXB 4U1HB 5GRWA 1QSFD 3WUWB 3CK0H 3T04D 1IVLA 2D03L 1L7TL 3BQUA 3CFJB 3RU8L 4K3DL 1FVDA 2XACC 1UJTA 1Q9KA 4WV1C 3G6DL 2OX5A 5A3ID 4XPTH 1J8KA 4KJYA 3FB8A 4PLKD 5C08A 1ZLSH 2Y5TA 3GK8H 2PTTA 2XWJA 4OAWB 3STZB 5J89A 1AKJB 4OLYH 4Y2DB 3QIBB 3HR6A 2OM5A 5F9WC 1ORQA 3GB7A 1WICA 1F3DH 2X1QA 3NA9H 1UEMA 3B8SA 5GSRA 4E0RA 3AAZA 4MXQC 1R0AH 4UTAH 5EULV 4PJGA 4XPFH 1LO5B 1P7KA 2QQNL 1X5ZA 5L7XH 4YDJB 2AP2A 1ETZA 3DWTA 3QWRA 1O7SA 3MROB 1AJ7H 1J87A 5DK3A 5IB4A 2YZ8A 1N2RB 4Q9CA 1TTGA 1MFCH 3QUKA 4EN3B 4PJFB 2OMNA 1BOGA 2FECI 3DECA 4YHIA 3BDYL 4KU1A 1WEJL 1WBXB 2GAZB 2B20A 3QHTC 4AK1A 3I6GB 2R9HD 5ANME 3OKOA 1C8PA 2P1YA 1MAKA 2R56H 1U92A 5D1QC 5DQ9B 3TBWA 2IANA 1ZE3C 3BPOC 3SDXE 1X6NA 5FYLH 4M1CD 5T1KD 1JF5A 2JJVA 2XN9E 2ZSWB 5EBWA 2P8PB 4K23L 2MCPL 1CLCA 5E1HB 4P23A 3VXUA 5D5MF 4PJIF 4WHCA 4Z6AT 1HH6A 4LDLB 2YBRA 5JOPD 2PKDA 3BMWA 1B0WA 2Y6SD 4N1HB 1CK0L 2ZOKA 4UBDD 3DYPA 5F8RC 1MHHA 4MHHI 1A9EA 4PRHA 3O3EA 3WNNA 3P30L 4OZFG 5GGUA 3QJFB 4P59L 2P7TA 5IJVA 5C71A 4CADA 1QG3A 2WLZA 1VB9A 4Y88A 3EYQD 5IMOB 1IEBA 4PJDF 3ARZA 4JGUA 3BZ4B 3BGFB 1SY6L 4GKZA 1CVRA 3IDGA 4NRXB 5K9JH 1I7TA 5HI3C 2CIKA 2ZSVA 4PJBE 4PV8A 5D7LE 5SWSE 3MV11 2V9QA 4TQEL 5K9QI 1VPOL 4LSQH 3T2NH 4U6TA 2F8VA 3ARDB 4NRZB 2ED9A 1BEYL 2XZQL 1IBGH 2AK4A 4F7CB 1PKQB 2NXZB 4JFOB 1F2XK 4JKPL 1FIGL 5DRWB 1BLNA 2V2XB 2ZUVA 3NACH 4NQXA 4K3GA 3CC5A 1KCKA 3NZ8B 4JHAH 5KVGH 2PW1A 3IDUA 5AUMB 3OG6B 2OJEA 3ARPA 4JAMB 4PJ7F 1DCLA 5CBAB 1FLTX 4OLUL 2BDNL 4YC2B 3U7WH 3HZMA 2WNGA 3CMOH 3TCXA 4PRPA 4AG4H 4KHXL 3VXRA 2MKLC 4U1KA 5I15L 4ERSH 3L1OH 5FYKH 5I66A 4GUPB 3RY5A 3MRQA 4OLWL 1XR8B 2VLRD 3ZMRA 4QHMB 4L9DA 1X9QA 5DMYA 4Y4HC 1Z0MA 3K0WA 3O3UN 1KXQE 2XZCL 2QHLA 1U8IA 4PFEA 5KVMC 5KANG 3L3GA 2B39A 4W68A 3WDHA 4IRSB 1T7VA 4I18A 4JPWL 2HTLD 2X09A 3KDMB 1CXFA 3M17B 5D8JL 3KYKH 4G6FD 5L9DH 3RDTB 2F9BT 3E6HA 3IFNL 2V9RA 1NUFA 3L7FB 4JKKA 1NFIA 2SEBA 5GSVB 3LMJL 5D2NE 3SY0A 5D2NC 2DWDB 4EUPA 5D9SA 2ICEB 4PJIA 5D5MA 5BJTA 3DX7A 5IOPB 3NPSC 3ZE2F 2B8OT 1DBBL 4EUPH 4QWWD 4PG9A 1KJ2H 1T22B 3OB8A 5DD5H 3X11A 4J3XA 4AL8L 1EPFA 3EFDL 4QHKJ 1UCBH 5I1IL 2ITCB 4P4KB 1EMTH 1U8HA 3HNVL 3VG0H 1NQBA 1BM3H 2EDTA 2EYTB 3AMKA 3EFFB 4TNVK 4N1CA 5JZ7D 4PJDA 3WXVH 4A6YB 3WKMH 1IQWL 3QUYB 1CVSC 1MVUB 5DMJB 1P6FA 2YPVH 3BISA 1DVFB 1B0GB 4OSUH 4DGIL 3SHSA 4FXLA 4HDIA 2O93L 4AM0B 4X8XA 4X98B 1FPTL 3DVNA 4GRWH 4H25B 5I6XC 3H9HA 3JTSA 3IF1A 3CLEL 2FBJL 4MD4B 4OT1L 3EO1B 2FH8A 3EDKA 2JELH 3BUTA 4WY7L 3PHOB 4LLUA 3P9LA 3QRGH 1AD0A 4ENEC 5C0CA 5E9DD 4KPHH 4O2CB 4WO4B 3ZE0E 1RIHL 1NCBL 2DQUH 3OF6A 3PF2A 2NX5A 2VABA 4F9PA 4L3AA 4OCXH 2LVCA 4PJ7A 4ZD3L 1KV3A 3SOBL 4Z7WF 2KQMA 4U7MA 5E6IC 3KLAA 5JMRA 1R3KA 3IS0X 4CVXA 1OGAB 5JORB 3SDDA 1A21A 1YDPA 2XV6B 2JK5A 1RJYB 4KKNA 4D3CL 5CIPH 3WCYA 3SJVA 4MNHB 3ZT6A 3LQMA 4Y8AA 1H3VA 3D48R 1QP1A 4E41E 5KAQG 5MHSD 1OCWL 3MJ9A 1V7ML 4XRCA 3WFDH 1VFBB 4HUXB 4PG2A 4ZUTB 2XKSA 2ARWA 4JVWA 4NQDA 5TDNA 7FABH 3OR6B 3MJ9H 4R9HA 4WU5A 5BV7B 4GMTH 1QSEE 4JFDE 4FFVC 4LIQE 5IVZA 5LGHL 1CBVL 4AH2B 3RP1A 4Z78B 3VXME 2R0LH 2W9DL 4RISH 1YEHL 3ARYA 4IIQB 1UWEL 1J8HA 5D7JC 1D9KD 4M5ZH 5TJWK 4PBXA 1NC2B 4R3SA 4O51A 1H8NA 2PCPB 1ZLVH 5IF0A 3KNBB 4ISVA 4QXGL 3SE4A 3CH8A 5AD0B 3CSPA 1W0VB 1CT8B 5I16B 4QHLA 3C6SA 1XIWB 2J3SA 1JWMA 3MRHA 3T77A 3T4YB 3SKJL 5FUCC 4GW1B 5E4IA 3CLFH 4PY8J 4XT1C 1BWMA 3MLZL 4R7DB 5IFHH 5ADOL 2JJWA 2NR6D 3MRMA 1IEHA 1OB1B 5ISZA 3RX8A 3O9WA 1DQQA 5C6TL 3HRZA 1HSBB 4NN5B 2CKNA 5GRJL 2NY3B 4ODWB 3RGVD 2B4CH 4K2UL 3RVVD 5HI4D 1TVHB 5DRZB 5EOCJ 4Y5VB 5BS0A 4PUBL 1IL1B 1NMBL 3ZHKA 1S7UB 1M7DA 1JN6B 3L3DB 2CK2A 5J12B 3EKCA 4JCMA 3DUUB 2DOCA 4NN7C 3QH3B 3DMMB 4WFFE 3Q3GB 2HN7B 2FR4A 2DLFL 5IGXH 5C3LD 4KKLC 3KLHD 5I1JL 4F15B 3PWPB 4ZFFA 5EIIB 3GJFH 3QUZD 4WU7A 4LP5A 4L9LA 1FRGL 1DFBH 4M7ZB 4ZYKA 2FGWH 3BAEH 5EC2A 3WNKA 1FVCA 3ULUD 2OS7A 1G9ML 3V4PL 2VL4A 3FOLA 4Z7WA 3VXPB 3QUXC 3QXDB 1HINH 3GMRA 3NAAL 2IEPA 1I7RB 2AGJH 4DAGH 4G6AD 4YE4L 2VZ3A 3LEVL 4RFOH 4PTTB 5MENA 1P7QB 5DEFB 5DYOB 1FNHA 1N0LA 3GEWB 4LQFH 2JF1A 4OCRL 4KXZH 4P2RA 5CZXD 2B1HL 1C12B 4LLWA 3FOMA 1RZ7L 2G2RA 2XKNB 5LCVH 3WFCL 5DQJB 4L1DA 3C9NB 3QCTH 4KDWA 4S2SB 3MOAH 3BP4B 4QTHA 4EDWL 1AKJD 1CCZA 3O41A 3OPZL 4M9OA 1DSFH 4XZUB 2W60B 2ORBH 1DEEB 4YPGB 1FJ1A 1KENL 3MV9A 4ELMF 1QUNA 4JRWA 4XAWL 1H5BB 4LKCB 1QNZL 3DTXA 2BMKA 5IWLC 1FFPB 3ARTA 1ES0B 4IEFB 3SQOL 3FB6A 4MWFB 1K9TA 3RBSA 5FHAL 5FO7A 3GBML 4TSAL 1CE6A 1RIVH 2NY6B 4WI8A 2ZOLA 1EHNA 5CUSL 5ESVA 1K6QL 4WTWA 5ESAA 4DN3L 5C6PB 4EN3D 5HVGB 4NOFA 1MH5B 3LEXA 2E9JA 4NQUA 3OKMA 3MRGA 3EOBB 1NLBL 2Z93A 3HC4H 4GKSA 1A14H 3QNZB 1KJ3L 2VZOA 4RNRB 3MBXL 5FHBL 5GGTH 1QFOA 2BVOA 2HH0H 1HEZB 3JUYA 3WFHA 4HHAB 2JIXA 3O4OC 3ZDZF 4XBGB 4G6JH 5C0IB 1G6RH 1Y6KR 3TJEH 1MCBA 3CFBB 3IAGC 4NQCE 3WNMA 4ZSOA 4TSBL 1DUZB 3LKRA 3WHXA 5C09A 5SWZA 4G42A 2AABH 1L9NA 1QSFE 5IEKB 5E8OB 1XF5B 3TZVA 4CMHC 1QHPA 3FRPA 4HWUA 1OP3K 2O26U 5HY9B 4P4RB 1VADB 4KFZC 3REVA 3P9MA 4G7YH 4ODUA 5DLML 5F9DC 4K3JL 5A3IC 2X4NB 4IHOA 4ZUSA 2IBBA 4PLKC 5LJYH 1T0MA 3NH7H 1JHKL 3ULVF 2IGFH 3QEQA 4TUKH 4YAQB 3BE1L 5DUBB 1K85A 3VFTB 1INQB 1UWXK 3SDAC 5DDHB 5JUEL 1LP9F 2AXJA 1INDL 4NHUA 15C8H 2QSQA 4GAYA 5DRNA 1V8HA 4FQ1H 1CFQA 2A74A 2YUZA 3C6LB 3BSZH 1H0DB 4PIRF 1AIFB 4LEXL 1RU9H 3SGEI 1KXTB 1Q72H 1FNGA 1YEDA 1IGJB 5HTSA 5AEAA 1PZ5A 4HKBA 3IDXH 3CVIL 4ELMA 2NY5C 3O45B 4K07A 1CXKA 2YK1H 2Q7YA 5CLWA 2OL3B 5IEHA 5H37H 3TVMB 2YA0A 3LOWA 3P11H 2ZKHL 4OIIL 5B39B 5EU3B 2R0KH 4HK3J 5BVJA 4U6XB 1CLOH 5HDOA 5EU6B 1JHTA 4M62H 4MGXA 2R9HC 3HKFA 2P8MB 5KS9F 1JPFA 2D7OA 1FNSL 2D7PA 3ARED 2IADB 3BH8A 3CZFA 3HR5A 3TT1L 1TNMA 1RMFL 3SKMA 4M1CC 4PB0H 1UACL 4IRSD 1MRDH 3UDWC 5CEZH 2OYPA 3AB0B 5KVDL 3NABL 3UBXI 5ICXB 1AXSA 4ONOA 2Z0BA 3S5LG 1A9BA 5JOPE 1JIBA 3EOYG 3BT2H 4FRWA 5CILH 2Y6SC 2EXYD 1CGSH 1MHEB 1WJ3A 4U31A 3BKML 4NKQB 2A77L 5I1HL 2ATKA 3F62A 3Q48A 1NBYB 3SDCB 4JPIA 4HG4J 5LBSH 4FZ8H 4Z8FL 4UMGA 3JWDC 1KJMB 5C0AE 1HHIB 5F8QC 5IROC 1BX2A 3EYQC 5H35B 3DURB 4XP1H 5IHBA 1XF2B 4KVCL 1F3JB 1W8NA 1DBJH 4E9LA 3DV4A 2OTUA 3PJSB 3C2AH 2FDBP 3S4SA 3LAFA 4JRXA 4P4KD 3ILPA 3L5JA 4MA7L 5D1ZA 5IIEA 4OFPA 4HXBL 3B6SA 4M61A 3RZWA 2MSPA 3T2OA 1R3LA 4O2EA 4Z7NE 4L3EA 1OSZB 3QUYD 4NWUL 1DVFD 5HDQL 4YIQA 4KRMB 4HCRH 1MCKA 5F6HI 2XXMB 5KSVB 4RIRA 2BP3A 4RCAA 1PQZB 3ZSSA 1QOKA 4S1RL 4X6CF 5KG9A 1I3VA 2E8YA 1T3FA 4KDTA 4R90L 4LRIC 5IQ9B 3VFUA 3SN6N 1LP9A 3TNMA 4GRMA 3RWIA 5B38A 3G5XB 1NSNH 1QZ1A 3SCMB 3TO2A 4I4WA 2ERJC 2V17L 4J8RB 3VFRA 5EZJA 3PP3K 1BGXL 4K94C 4WO4D 2ZUSA 3I2CH 3KPOB 3VFSA 2VLRE 2IQAB 5GGRY 1FN4B 3QA3B 4UT9H 5IBLD 1HWHB 4TUOA 4MJ4A 1W72L 2X4OA 3OJMB 1A0QH 3D39B 4Y4KA 3U82B 3OB0K 1FAKT 3UJJH 4DVBA 2H9GA 4PJ5A 3QDJA 5IJKA 1FDLL 2CK0L 4U6HA 1B0RA 2FD6L 4JFYA 2ADGB 4JEGB 5FOJA 3W5MA 1OGTB 5CAYB 1QLRA 2PO6B 2WBWB 3UTSB 1CD8A 2HTLC 4UZGA 1FGNL 5TE6H 5KS9A 1TJIL 35C8L 2XQBH 2RHEA 1FVEB 4HH9B 5F7DB 4DW2L 4FXGB 4KDVA 3C5JA 5FDWB 2R69H 5TF1H 1S7TA 3BPLC 4LHUB 4Z0BH 3OHXA 2FL5B 1ZHNA 2F5BL 1AO7B 3OKNA 4QWWC 3P77B 1RQ5A 4XNXL 2E7CA 4DZBA 2NW2A 1NC2D 3ILQD 3QRFM 3NN8A 5IKCB 3ZTJH 4O9HL 5J6HB 3FKUS 1IFHL 1HQRA 4GW5B 3NFPB 4JDVA 1XIWD 1FHGA 1PDKA 4BH7A 5JZ7C 1OARH 1B4JL 2GT9B 4MJ5B 2VDKL 4G9FB 5FGCE 4DEPB 1XH3B 2R39A 4M1DL 3RWCB 25C8H 4KTEL 1T1ZA 3GSNL 2Z91A 5FV2A 1I8MA 4M7KL 5DUPL 4ODHH 2Q87A 3LKQA 2NCMA 4RFNB 1JFQL 3WE6A 1YY8A 3IFPA 4D9LH 2NY3D 4EIZC 2XWBA 2VRAA 4JLRA 2DDQH 1FZMB 3IFOA 3VI3E 2I07B 3HRPA 4P9HC 4QO1A 3B5HA 1M4KA 3MV7B 3MSPA 4S0TD 2EDHA 5E9DE 3CDGB 5DVOA 1DE4B 4X6CA 1JHLL 4HFWA 1H8OA 5EUKB 3D0LB 4K7PY 5EA0H 4MAYB 1DN0A 1FSKB 3BKYL 4WV1A 2V2TB 2Y7QB 1CQKA 3PIQB 5INCA 4JE4B 5I8KL 1HOCA 5FUZH 3PWPD 1JPTH 4F2MB 1EZVX 1A7QL 2FECL 5TGBA 2HRPH 1IGFL 4YEEA 5HHXL 1RUPH 1CYGA 3OKLB 5GJTL 2BRRL 3D9AL 5HYQB 3OKDA 5JDSB 1U3HA 4HG4K 3D3VD 3QDAA 3RAJL 1AD9B 2UYLB 4RX4D 3GI9H 2HLAA 5MHSE 4U2ZA 4KQ4L 1HZHH 2DICA 3WFBH 1VACA 4ODVH 3CFKA 3U36A 1T83C 3HG1B 2VISA 1SHMA 4M02A 2N7BA 1XGUB 5EU5A 3BEWB 4X0KA 4OCWL 4XMLL 1MNUL 2CPCA 2DKMA 1N3NB 4XGZB 5KSAA 4U3XA 2X4PA 1KTKE 4RAVA 4K3DH 1ODAA 5CWSB 3WEXA 2QEJA 5I71C 2IPUK 2VXSL 4Y2OA 1D9KC 1ZWIB 1FYHB 1WBYB 3VFOB 4B50A 3IU3B 4RGNE 4PGCA 4QRSA 4NQTA 5DR5L 5ANMA 5D1QA 3KPPA 1JI1A 5CZKA 5GS3A 3UPCA 1OOAA 3S36L 1N6QL 3DBXB 4LVOC 3ZYIA 3LDBB 1NLDL 2XN9A 4XCNA 2I25N 3KYMA 4OI9A 1S7WB 4E42B 4X6EB 2VITA 3CUPA 4HT1L 1DQJA 2NR6C 3MODL 1KIRA 1IAII 5EU4B 4TTGA 2H3NA 5AZ2L 2NY6D 5DFTA 1WAAA 4XMKH 3RGVC 3RVVC 5HI4C 4R4FL 5GGSB 3AROA 3MR9A 3OKYA 5JA8B 1DQDH 3MRRA 4PJHB 1WEJH 2X9YA 3KLHC 3UTPD 1TJGL 4P2OB 1R3HB 5EC1B 4GXUM 2FCBA 2ZG1A 5CKGA 1UM5H 5HVWA 1NAMB 3QUZC 4HIHB 5CEYA 1A7OH 3OKEA 5L88H 2HG5B 4YH6A 5JLZA 2MCPH 3ULUC 1MUJA 5ACMA 4D0CA 4LBEB 1BFOA 5FGBC 1T6WA 3DRQB 4G6AC 5DJDA 2C1PA 5TQ2L 5B8CC 3CXDL 2Y07H 4XCYB 3CSYA 5HI5C 2ICWB 1PKOA 1FNEA 4TULL 5CZXC 3C08H 5BRZE 1UA6H 2ZCHL 4G5ZH 1T1WA 4WUKL 3QAZB 4NQEE 1T1YA 2GCYA 3A0OA 5LGKA 1N8ZA 3ZO0A 3CDFA 4JHWL 1U91B 1FE8L 5IB1A 4OV5A 2DD8L 1JBJA 4X6BA 4Y4HA 2BSRA 1UKTA 3QIBC 2GY5A 5C0GA 5GS1B 3QNXA 2PTVA 4YHML 1VPOH 3BP6B 3IB4A 4PY7B 1ZTXH 3X13B 3FAWA 4LLYB 3HZVB 4HIXL 3C6LD 3DX8B 1BEYH 2XZQH 3EYOB 5I8OH 5EBGA 3QQ4A 3BIBX 1CTNA 4MQTB 4WUUD 1BZ7B 4JKPH 3ZHLA 4YDLB 5C9JB 3LKSB 2PXYB 2OTPA 4ACPA 4PGDB 3LQAL 3VXNB 2OTWA 1SBBA 4PB9L 4OLUH 1D5XA 1EGJA 2BDNH 2F54B 5MEQB 3HAEB 5C9KA 2J8UB 4EN3C 3TVMD 5D1XB 1GAFL 1LVEA 4N0YH 3C8KB 5J9PA 2YD8A 2HT4D 4Y7MA 5EU6D 3K3QA 1FFOB 4YNYB 4N90D 3BN3B 4OLWH 1RZFH 3QFJD 1YMHB 4POYA 2XZCH 1WIUA 2F53B 2W0LA 4M93B 1HYRC 4OUOA 2NY4B 1DANT 4HS8L 3VH8B 3EYFB 4PRBA 3PHSA 1KBGH 2NTSP 1MIMH 4I5BA 3IXAA 1XAUA 2X4RB 4B53A 4JREB 1KCSL 5HGHA 2FZ3A 3P4NB 5D8JH 1LO3L 2H6PA 1G7IB 1MCOH 5BVPH 3IFNH 5I19L 1NFDB 3SDCD 2WBJA 3RNKA 5EO9B 4ZAKB 4ZTPH 3WIIL 3I50H 1U42A 2PTTB 5AYUH 3VDAA 4ODSH 1I8KA 1BJ1H 3BGFC 3QO0B 2QKIB 4LVNB 1I7ZB 5GSRB 4JO3H 5CINL 1DBAH 3CVHA 3AU1A 4FP8L 5ENWA 3FFCA 4AL8H 4X7SL 1WBZB 4CU8A 1CD0A 1CGWA 2E5EA 5AAMA 1NAKL 1S7SB 5I1IH 3CVHH 1ETZB 3LH2L 2VN4A 2XNAB 2XWTA 5T1DL 5E6IA 4HUKB 3QI9D 3MA9L 3TNNB 2JJUA 1PG7W 1Y0LB 4EVNA 1JGDA 1PKQE 4K7PL 3HMWL 1A02N 2IFGA 3TESA 3IDMA 3WHE0 5JNYA 1F42A 2ZPKL 4EI6A 3MYJA 5E1AA 1UQSA 1JP5A 1PSKL 3L3IA 4Y4FB 2ITDB 1FPTH 4I2XE 4M6MH 4XVTL 4E41A 3SCMD 2D31A 2G9HA 4YC2C 1U92B 3CLEH 3BWAB 4YHLH 4OT1H 4ETQA 4TVSa 1FORH 3UBXA 1A6VL 2V2WA 1AHWA 4JANB 3TJHD 2EYRA 2WP3T 3GJEB 4XWGL 4JFDA 1NUNB 1RIHH 2W38A 1NCBH 4GKOA 5J7CC 3D39D 1YMMB 4KK8D 3T0VA 2GUOA 5D7JA 3LHPH 2FB4L 4LIQH 4N0RA 3HFMH 3MCLL 1CU4H 2BSTB 1YNTB 1E28A 1CDUA 4LLDB 4IRSC 3VFVA 2X4SB 3UTSD 1QKZH 2H45A 4ZOEA 8CGTA 4DVRL 5F96L 3RRQA 1FAIL 3FQTA 4GSDH 2J4WH 1BPVA 1I8IA 2A6JA 4G7VL 4WFHE 3T2QA 3W39A 4NHCL 2XG5A 2R23A 2EXYC 4J3VA 1KCRL 1M05B 4GKZB 3DYMA 5A2FA 4HZLA 1BECA 2BOBA 2PTUA 4HFUL 5HYSA 2X05A 4D0DB 5T3ZD 3RZCB 4JFXA 2FX8L 4LHUD 2CR3A 2YUVA 3ES6B 5JHDA 1WUNT 1GXEA 1AO7D 1F4HA 4P3WA 1UVQA 5EU7C 4BKLB 2A0LD 1X5XA 1CBVH 1S3KH 4M7JL 3L9RA 5HHNA 2YOCA 5CSGA 2NZ9C 3NGBB 3THML 3TO4B 2DQJH 4Y89A 1WISA 4P4KC 1U8MA 1MHPH 4QXGH 3VXTA 3NIDE 1LO2L 2C5DC 4KI5D 1GPOH 3QO1A 4IMLA 4U1LA 3QUYC 4G9FD 4X5XB 1CICB 1DVFC 3AXLB 2I9TB 2D7TH 2I27N 3GRWL 5HHMB 2H26A 4GBXB 4DJMA 2AJVH 4CW1A 3TPUA 4NC1E 1MWAB 4QRPB 4NC1C 3DV6B 3I6KB 1I7UA 5C0JB 3QUXA 1NC4B 3PABA 4PREB 1QPXA 1M71B 2GJ6D 5BZDA 1N26A 3LN5B 2N7AA 4WO4C 3LY6A 2APXA 2R4RL 5MEOA 3QJHA 4XP4L 1R3JA 4MAYD 4WFGD 1XGTA 5IBLC 4H5SB 5CCKL 4EBQH 3WSQL 5M95B 2O5YL 4JQIL 4HUWB 4YFDB 4Q9RH 2GTZA 4XPAL 4MAUL 2SEBB 4NFBA 1RURH 1FRGH 1N5AA 1DUYA 3WKNA 5JO5A 4EUPB 1HCVA 1J0ZA 3X3GL 1TPXB 2ADJA 1KJ2B 3VD3A 3V4PH 3LPWA 5DHVA 5T5NF 1D5ZB 3V4UH 4UV4L 3L7EB 3BZFB 3HG1D 5IWLA 5DHVH 3WD5L 4OLVL 2J5LB 5BV7C 5KJRL 1ZS8B 1JK8B 4N0UB 4PRIE 1WTLA 1XF1A 3D69B 4OCRH 4XP6H 2ZUUA 5H94A 5FK9A 2A6IA 4IIQC 5FO9A 4HPYH 5HHPA 5HHQA 4L4TE 2XIDA 1ED3A 3WFCH 1KG0A 2AEIT 4GRWB 1WZMA 3ILQC 2FJHA 4X99B 1OF2A 4JY6A 3ZYZA 5FB8B 3L3JA 4P57A 4LGSB 5C6WH 1XIWC 3W9DA 1S5IH 4PLOB 1KENH 1QBLL 4KZEL 2CLVB 1BF2A 4LLUB 4WJ5A 5D7IB 2C4XA 5DZLA 1UB6B 2VABB 1CQYA 3DYOA 4NQCA 2NY3C 4OI7A 3SQOH 5D72H 1ADQA 5E6ZA 1PZUB 1UXSB 2X4QA 5FHAH 3VXSB 3GBMH 4JKLA 4MX7A 3FCTB 3GSRA 1FFNA 3F58L 1HILA 4TSAH 5CUSH 3NIGF 4ZUUB 1QSFA 5CIPB 1ADQH 1G7PA 4DN3H 4PJAB 4QOKE 5F1NB 1YUHA 1J0IA 3SDDB 5DD6A 4KJPD 1GGCL 5EBLA 1EHAA 4Q58C 3S97C 1CI5A 4Z7NF 4NNXB 1NLBH 1BVLA 5JW4N 1GOGA 3PWPE 2ADIB 1KLGA 3W9EA 4F15C 2IPTH 5DHYA 5CHNB 1KJ3H 1MAMH 4X7CC 4XRCB 4H1LB 1MAJA 3MBXH 4M7ZC 5FHBH 4HUMB 3MJ8A 5E8NA 3SDAA 1T04A 1HXMA 3Q5TA 1J1OH 3D3VE 2Q8BH 4D94A 4EDXB 3TCLB 1X5FA 3KHQA 3QXAA 5I2IA 1G6VK 2YD6A 2XZAL 1XGPA 3O4LB 1A3RH 2O5ZL 4OGYH 1KIUA 3PNWB 1KN4L 3PGFL 2ZCKH 4UNVA 3E0GA 1JCKA 1TLKA 3MYZA 1VKXA 4OLXL 1MI5E 4YX2L 4WEUD 4IMKC 4ISVB 4OGAD 1DP0A 4CDHA 4GMSL 3V5KA 1A6WL 2DMBA 3BPCA 3PWUA 1P69B 1IEAA 2BVTA 2IBGA 2NY5H 3IRPX 1KJVA 5J11B 1WIOA 2VO5A 1ZANH 1V3JA 2COQA 3RNQA 3MRMB 1JHKH 1MCRA 1R5IA 2XXCB 1IAIH 5A2IH 5GS0C 1D6VH 1BBJA 1LK2A 3HRZB 4YFLI 1OAXH 5T1KA 3N1PC 1ORSA 5F72S 5FIEA 5F9JB 4PJXB 3UDWA 1H5BC 3W81A 3C60B 2MHAA 5SX4I 3D25A 1I85C 1HSAB 4X83A 3FQRA 3LS4H 2HFGH 5T33L 1A1OB 1P5VA 2PXYD 4ELKA 5HHVL 4UQ3B 4LCUB 2NY6C 1JV5A 2NY7L 5SWQA 3MUHL 3MTRA 5JW4R 3GJFB 3GDBA 1JPST 1V3LA 4PJCE 5L8JB 4H26B 5D1XD 5DD3L 4D0BA 1ZEAL 2EDDA 1YEFH 4ZFFB 5SV3A 4LMQI 3TBVA 4ZYKB 3FT2B 2ZKHH 4JG1L 4Y5YC 5IROA 5EC2B 4JKWA 3JWDH 3SE8H 4WWID 2QADB 4R2GB 1FNFA 2HA1A 3Q6FA 4RZCB 5IFAL 1YEJL 3UTPE 1UZ8A 2YD2A 4BZ2L 3MV8B 5C92A 1FNSH 2F53D 3JUZA 1Q1JL 2YWZA 4RMSA 2VDLH 3SBWC 1YC8A 4CNIA 4H8WL 3LIZH 2WZPD 1CFSA 1UACH 4HWNA 5MENB 3V6ZA 4UIMA 3NABH 2VR5A 2IF7A 4X4XB 5ID1A 5CGMA 1W0WB 9CGTA 1B6UA 1ZGLB 1AFVL 3FOMB 3EW3B 1GVIA 3KAAA 1HH9B 3U1SH 4ZAKD 1PGRB 1QVOA 1D5BB 1RZ8A 4LRIA 3BKMH 4KMTL 4ZPVA 1DBKL 4QXUL 4C83B 1A3QA 4Z7VE 2FHCA 1RJCA 5ID0B 2Q76A 5DJXA 1U8JA 4BFEA 1IGIL 3JWNC 3QHFL 1T20A 3QIUB 4GKNB 5CZVL 1BMGA 1U0QA 1QR1B 1LDPL 3FQWA 1AE6L 5KTEL 2YSSB 4OCSL 2VLRA 4B0MM 4Y0GA 1MJ7H 2DQGL 4NM4L 4NKMA 1S7XA 1WZ1L 2D4FA 3B9KD 3FB6B 2W65B 1F8TL 3P4OA 5DD1H 3AGVA 4XNQA 3C6LC 5EZLA 4NWUH 3WXWH 4WUUE 1F6FB 1OSPL 5K93A 5F70A 5CEXB 1J18A 2CDGA 4HC1A 3C5ZA 4Y4FD 1CLZH 3ZDXF 4S1RH 3EOAA 4HKZA 4C57C 4LASL 1DDHB 3U9PH 4S0SD 5FDYA 2AXGA 2Q86A 3QQNA 5FYLD 1AR1D 5F7WC 3H0TA 1T2QL 2LU7A 5FA4B 2V17H 3QISA 3TVMC 3DIFA 1BGXH 1FCCA 1G6RB 1P7HL 3BIKB 4WHYH 2PW2A 2WINA 5EU6E 2HT4C 3WFHB 3MRCA 3TFKD 5F7NC 4N90E 5E5RB 3OXRB 1YMMD 4HMCA 2PYEB 3QFJE 4JY4A 2DQEL 1Q0YL 1W72H 4I13B 1JTTA 3UZQA 2XICA 2OXHA 4POUB 4WNQB 4EXPX 2BHUA 2CK0H 3CFEA 1B4RA 3AB0C 1RPQA 1UWGH 1NEZB 5JDJA 4NT6B 3TBYA 4WW2B 4ZO7A 1JI2A 2IFFL 1FGNH 1ZHLA 3CPLA 3PWVA 3DX9B 3P4MA 4NN6B 3REVB 1TJIH 5FV1L 35C8H 3N1QC 1RK0A 5GGQH 2BVPA 1CD9B 1WWAX 3SGKC 3SDCC 4LFHG 3RZCD 4NO3B 2YD4A 4P3CL 4JFED 5D70L 1XMWA 4WI4A 5IB3B 5F89B 2B0SL 1HHKB 3ME0A 4BM7A 4HUUB 1A22B 3B2UD 2RFXB 4UIKH 3IDJA 2NW3A 2Y4SA 1I1AB 2VSDA 2X7LB 2F5BH 5E9DA 1MEXL 3X3FH 2A74B 2OZ4L 1K8DA 3TO4D 4PLNC 2NTFB 3AFLA 4F33A 4PP2A 3ULUF 3MOQA 1PBYA 4NO2B 1NCDL 1GHFL 1WV7T 3QXVA 4LSUL 1IFHH 1HHJA 1G0DA 1CICD 1RFDH 3BUYB 1NDMA 1U2CA 3CAFA 1AGFA 5FYKD 2VDKH 3WMSA 2Z8SA 4GBXD 1HI6A 2PUQT 4QRPD 3M1BA 4S1SH 1NC4D 1YA5A 4M48L 5HHOE 4AEIL 3BEVA 4OM1L 4EI5B 3FMGH 1J5OL 1CIDA 1SEBB 1JFQH 2N4IA 4G3YL 4X7TA 1H3GA 3SCMC 3OX8A 4Z7UB 4JDZB 1T83A 1XGRA 3ORJA 1RJZA 3HMXA 1VGEL 4HAGA 5I8EB 5GISL 2J2ZA 3H9SA 4CKVX 3FN0L 3BJ91 3QNYA 4JJ5A 5DURB 5DVNA 5IV2A 3FQXA 4KK8C 2R1YB 5BOZG 1OQXA 2Q1EA 3X12A 1TVBA 4OGZA 1D9KA 1MCQA 1PLGH 1Q9OA 1SJEB 1EO5A 1DN2A 2D7MA 4I77H 4JO4H 4Z95H 4HX1A 1U8QA 4XH2A 3UTSE 4BSVA 2ATKB 2PO6C 1A7QH 2X89D 4OV6F 3MXVL 4Z76B 1P1ZA 4JZJB 3ARVA 2YMXL 3FB5A 3V7AG 2BRRH 2DWEB 4ZODA 4YHNA 1UCTA 2CKBA 3VFWB 4M43H 3RWDA 3LKPB 3U4EA 4BQ8A 2FEEI 4PJFF 2AK1H 4KQ4H 4WI9A 2HFFA 1QFWM 3P0VL 2CKBH 3QG7L 5F9OL 1K4DA 2R0WL 3GIZL 3VA6A 4V2BA 32C2B 4LSSL 3RGVA 4OCWH 3QEGL 3P40A 4XMLH 4YHZH 3KYAA 3V8OA 4EUPG 4X4YB 1MNUH 3G6JB 3QG6A 2YD3A 4Y1AB 2Z8WC 3T0EE 2WAHA 1A1MA 4RQQB 3O2WH 3LKNA 4WVRA 4NUJB 3AS3A 3MNZA 4G8EA 4TRPL 4L4VD 2HKFL 3H9YA 1KEGL 2CGRH 3VRLF 4KI5E 5DR5H 1JZ7A 1FC1A 4G9FE 4KI5C 3TNMB 5J3HD 4LPUA 3NTCL 3ARRA 4NZTH 1NGQL 5F3BB 3QUZA 4MD0A 1XZ0A 3RJQB 1N6QH 3MRFA 1JPSL 1A6AA 1P4BH 1CD1A 4M5YL 3REWA 4N0FB 3BH9A 1ZVSA 4QRRB 2AQ3A 2FH6A 2RR3A 1LK3L 3U79A 3RTQD 4RFNC 4HT1H 4EIGB 3Q6GH 4ORGA 1YQ2A 3DVIA 4LNVA 5FGBA 4DGVL 4LLVA 4NQSA 2GJ6E 3ZKXB 3TM6A 3VXSD 5CGTA 5FKPA 2P4AB 3RWHB 5B8CA 5LAXA 3RIAK 3ALWA 2YC1B 4PJ5B 4U1HA 2E7HA 3UJTL 3AS2A 4R4FH 4OF3A 3WUWA 5H2BB 2UVEA 1B0RB 1CFVL 4K55A 4MAYC 1FSKC 3O11B 1D6EB 3MCKB 5EBMB 1BFVL 1IC5L 3WN5B 1C5DB 1MQKL 1FG9C 4FHBD 3MLVH 3V5DB 5JHLL 1A1NB 4CDGC 4GAGL 1TJGH 4OAWA 4WGWB 3QWOB 3OBAA 3STZA 3B8YA 1AKJA 2R0ZL 5DEZA 1UG9A 3QIBA 3MGAA 4APQB 5T1LB 5JIIA 1X5KA 4QNPF 1LNUB 2GJZB 4JO1H 4YFLF 1TXKA 3BD3A 4ALAL 1QA9B 3O4LD 1CDCA 4V2CB 4Z9KB 3FN3A 5INDB 3TIDB 4O58H 4BFGA 1CGVA 3OQ3B 1H3XA 4YDJA 4FG6D 2DQHL 1JNJA 4DZBB 4OZGB 1VENA 5TQ2H 3MROA 1WWCA 3CXDH 3BD5A 1A4JB 3WNPA 3HZYB 1P53A 4UUJB 1N2RA 2GK2A 4JDVB 3BI9X 4OFDA 1DTUA 3EAKA 4WUKH 4EN3A 5HVHB 4PJFA 2VLKB 2ZZUT 1YC7A 3QULB 4JHWH 1WBXA 2GAZA 3HB3D 3I6GA 3QUMB 4U1SB 2H2SD 4XP9L 3GSVB 1C08B 5DQ9A 2A83B 3ESUF 4M8VA 2AJYL 1MRFL 3KPQB 2ZSWA 5FYJL 3LDBC 4HJGB 2P8PA 4JM2D 3HLAB 3C60D 3P3YA 2W59A 4YGAB 3MZGB 1PFCA 1ACZA 1DQML 2VZVA 3WUZA 1RZJC 1U3YA 2DQTL 3RGHA 2UZIL 1OTTC 3BXNB 4LSDA 1DLFH 1ZVYA 3D18A 4S1DD 4JB9H 3QJFA 5ACZB 3FO9B 5I8CB 4ZFOL 3UTQB 3WIHL 1NGXB 5EH1A 1GAFH 4OF8A 4KJPC 5IMOA 3RHWF 4IRJB 1G9NC 2FEDD 3QCVL 4R2GD 5CSZB 1X5HA 3TT3L 3BZ4A 2NY0B 4NRXA 1NGPH 5KVFL 1KNOB 4PGEB 3MV8D 1RZKC 1DANU 1AGDB 3SGJC 5D7KE 1EVTC 2MPAL 3WIFB 4DK6A 2VISB 4FQXB 1CL7I 5BZWB 2BFVH 1P2CB 4F7CA 1KCSH 1PKQA 2W9EL 4JFOA 5DRWA 2V2XA 3OKKB 1LO3H 3TP4A 4HKXB 3NZ8A 1NL0H 4UNUA 4XPGL 5AUMA 5TDPA 4JAMA 1WT5C 5CBAA 3V52H 4OGAC 2HJLB 3QAZC 4JZNB 5TPWL 3BPOB 2AJUL 3SDXB 3KLDA 3TYFB 2JJSC 1F58H 4GUPA 2XN9B 3PHQB 5CINH 4M6OL 4QHMA 3RIAF 1KELL 1GJIA 2X44D 1DQJB 2EIEA 5GS1C 4X7SH 4MCYA 2DAVA 4XHJD 1FP5A 1H15B 2H3NB 2VKWA 4IDJH 5IBUB 2VH5H 1HN1A 1IC7L 4BK5A 2WQ8A 2FO4A 4IRSA 4K7PH 1H3PL 3WO4B 2BY2A 4LLMB 3KDMA 3QXTA 3M17A 1FO0L 1TITA 2ZPKH 3MRRB 3OTTA 4AIZB 3RDTA 4YDLC 2HJFB 1PSKH 3NIFF 2PXYC 4WI2A 2IG2L 3CH1B 3L7FA 5GSVA 1YEEL 5ITBL 4XCFL 1I3RB 4NM8H 4LAQL 4HBCH 2DWDA 5D1XC 5D7LB 2ICEA 4PJBB 5SWSB 5IOPA 3T1WA 2IPKB 2NYYD 1AXTL 5JLZB 5EOCH 1T22A 4IS6B 4YXLH 2MTPA 3C5SB 4O4YL 2F53E 1MRCL 3GBLA 2ITCA 4M93C 4RMUA 4J23A 1AI1H 2F5AL 4P4KA 5JQ6H 2NY4C 4PJEE 3I84A 4IRZL 4X7EC 1HKLH 3MOBL 1YY9C 3EFFA 2LTQC 4LSVL 4JREC 4A6YA 5J1TC 3G5YB 4Y5XB 3DX6B 3QUYA 1MVUA 1U8NB 1DVFA 4DVRH 5F96H 5AWNH 1T1WB 4A6YH 4DZ8B 1TENA 4AM0A 1WSST 5E6YA 1NFDE 1OWRM 3V9FA 5I18L 5F93C 3CU1A 3L5WB 4PS4H 3U0WL 4ZAKC 1TFHA 5IB1B 1KCRH 4MMZC 3WV0A 4H25A 2UZYB 4HFUH 4OV5B 4MD4A 2EDJA 3EO1A 4HJ0D 4F7MB 4F7PB 1I1AD 1YJDL 3PHOA 3FRPG 5IESH 3EYUL 4LVNC 4O2CA 4WO4A 5F7EL 2NLJB 2HVJB 2WUCH 4A2LA 2O61B 1BF8A 2AAVA 1LILA 3WS6C 3FB7B 3O81A 4Y16B 4GAJL 4YDVB 3B9KC 3L95B 4XC1L 3U9UB 4D9QD 4C4KO 2VB5A 1C16B 2DTSA 3AS0A 1LO2H 3B3IA 3QEHB 3JXAA 5JORA 1CE1L 3MREB 1RJYA 3B5GA 1KIPB 1G1YA 4MNHA 1CGXA 5D2NB 4ZDHB 4BSWA 5BO1H 3GRWH 2L7JA 1U36A 4Y4FC 4O02H 2I60L 1ZLUH 3V4VH 2Z31B 1ZKAA 3NPZB 3N1GC 1FL6B 1BVKB 1VFBA 4HUXA 4ZUTA 1AR1C 1R6VA 3S96A 3UTZB 5CEZD 5L6YH 1ZXQA 3OR6A 4WEBH 3RVUD 5H37G 2MQCA 1RUQL 1P4IH 5I1DB 3DXAB 5BV7H 3TFKC 4AH2A 4Z78A 4MNGE 3EBAA 3NCCB 3IXAB 5JOFB 4IIQA 1A5FL 2OSLB 5CCKH 3WSQH 1IGCL 2O5YH 1NC2A 1HWGB 1N6UA 2PCPA 2UUDK 5B3JE 2DLTA 4MHHG 1MFDL 2XPGB 4MB3A 1W0VA 2VUOA 4XPAH 4K3HA 1CT8A 5I16A 4OGXL 4W6XB 1XIWA 4NZUH 2E7MA 3T4YA 4O00A 4GW1A 4ZS6D 3BVNB 4MS8D 1SM3L 3KWWB 3TA3B 2D9QB 3NFNB 4U1MB 3DVFA 4UV4H 2IBZX 3IJSA 3CVHB 4JFEE 3RZCC 3O0RL 2EKSB 1UJ3B 1HSBA 3WD5H 4OLVH 2A9ML 5K9QG 4GT7A 4ODWA 5KJRH 5HGAB 4F57L 1ZT1B 1TVHA 3B2UC 5KOMC 3HI6L 3PE9A 3BO8B 1IL1A 1S7UA 4Y19E 1JN6A 3L3DA 3V0WH 3RKPA 3UPRB 4JG0L 1F00I 3DUUA 1UT9A 3NGBC 3HCVB 3QH3A 3TO4C 3Q3GA 1N5YL 5LG1A 4EI6B 3H3BC 1BQHB 2WWMD 1KGCE 2JB6A 3CFCL 2B7DT 3S4SG 3PWPA 2GFBB 4E41B 5DSCB 5EIIA 1CICC 2YPLE 1MJUL 2Y06L 3Q5OA 4PRNB 1T7WA 4GBXC 4QRPE 3MFFB 4K3EL 4QRRD 4KZEH 3U48A 2K9UA 3D3VA 2R8SL 3VXPA 4D8PB 1L6ZA 1QSEB 4QHNB 4RX4A 2VZUA 1VFUA 4KTYA 1PJ9A 5DMGD 4Z5RB 1I7RA 3VW3L 4BQ6A 2A1WL 3VXMB 2ICCA 4HGWB 4JQVC 4PTTA 3QDGB 3O6ML 3QBTB 5B38G 3DI3B 1P7QA 5DEFA 5DYOA 4HIJB 3F58H 1MJ8L 4PLJD 3D5OF 2A2QT 4IMKA 3MXWL 3DROB 5HYIA 3LS5H 1UH2A 2XKNA 2DJUA 5F21B 4QRUA 3C9NA 5E00B 4S2SA 3BP4A 3VRIA 3O2DA 5TQ0L 3R0MA 3OAYK 4XZUA 3MRBB 4APQD 5T1LD 2BOBB 2ICWI 1OHQA 2W60A 4N9OB 3F7VB 1PY4A 4YPGA 3O2DH 4JFXB 4JM4L 4HLZH 1TPXC 4V1DE 6FABL 1LD9B 4HWEL 1R3IL 1HQ4B 3WNOA 4KHTL 4DGYL 1H5BA 1LWRA 5IB2B 2VWEC 4LKCA 1I85A 4RWYL 4NP4H 1GGBL 1SVZA 2XZAH 4NO5B 2J5LC 1FFPA 1ES0A 4UU9B 4MWFA 1IAMA 3PGFH 4TVPL 2IMMA 2VDPL 4OF7A 4MJIE 3ECBB 4OLXH 4YX2H 1HIMH 3MLWL 1GC1L 2BOCB 1AP2B 3KPNB 4FXKB 3QO1B 3NVQA 3MRJB 1MH5A 5GHWL 2VLKD 4NQVA 4LSPH 1YECH 2AJ3B 4I9WD 3EOBA 4BA8A 1ZT7B 3A6BH 4L4VE 3PDDA 3QNZA 1N64L 1U93B 3DSNA 2VDOH 1I7UB 3R4DA 4ONGH 4RNRA 1VDGA 4NJ9L 3V0VB 5J3HC 1TVDA 5C7XL 3SBWA 2CRYA 1HEZA 3MRLB 4HHAA 5DK0B 2AI0L 1MCPH 4CJ1A 1MVFA 4XBGA 5C0IA 3ISWA 4YK4B 1EAPA 1P84K 4TVPE 3QDMB 5D7IE 4B41A 3GSWB 3CFBA 1HCFX 3RTQC 3GHEH 4XVUD 1DUZA 1R3JB 4M3JA 2HFEB 4W81A 3VDCA 1Z5LB 1FYTD 4XVJL 1OLZA 1RULL 4X6DB 3GKWH 4Z77A 2NY7H 1RZGB 5IEKA 1C1EL 4Z7QF 5E8OA 1RK1B 1XF5A 3ARUA 3HPJB 4XVSL 4KTDH 1I9EA 5DMKB 2PYFB 4C55A 5DD3H 1ZEAH 4IRJD 1XF4B 4P4RA 1VADA 2KKQA 5JR1L 1YN7B 2NY0D 5I1LB 5JO5B 4JG1H 4OFYA 1U3JA 4HMDA 1R5VB 2X4NA 3BW9A 3GUTB 5BMFH 1AQKL 1CFNB 4DOHB 2VDRL 3E6FB 5DUBA 3LVEA 4YAQA 3VFTA 2Z4QB 4NCC1 1INQA 4FQXD 1T5XB 3MLUL 5DDHA 4JPVH 5KBNC 4WI6A 1WZLA 1A3LL 1L0QA 1G7HB 4EXKA 3GM0A 4YBLB 4OF6A 1FCGA 3C6LA 4ZO9A 5TFSH 1H0DA 5F44A 3UJIH 1EVUA 2A6IB 1AIFA 1T80A 4FG6C 1O5DT 2D3VA 4TPRL 3FT4B 1YYML 2AXFB 1IGJA 4NKIL 3KPSD 4BZ1L 4G8IA 4LVEA 3G9VA 4KMTH 3ZL4L 3O45A 2DLIA 2P8LB 2WWKT 3FAXA 5HSFA 1QLEH 2OL3A 4XMPL 3TVMA 5B39A 5EU3A 5J11C 4U6XA 5CZVH 5I1CH 2OL3H 2R29L 4J3SA 5EU6A 1OVZA 2EE3A 3HB3C 1OAYH 1T21B 2P8MA 5KTEH 2H2SC 4OCSH 3HUJE 2B4CC 2IADA 2DQGH 1P5UA 2ENSA 3ARGD 1NFKA 3CZJA 1QO3A 1WZ1H 4FTVB 4NQCB 3UCRA 1F8TH 5GRVK 3MO1B 2W92A 4JM2C 5BXFB 3C60C 1OPGL 3GSRB 2E7BA 4HJJL 4NFDA 3IDNA 5FYJU 3VFMB 2QLVB 2Q3AA 1YUHB 4XCEB 3FHQA 4TOYL 5J0BA 1CF8L 1MHEA 1T0NB 2UWEE 4NZDA 3SGKA 4OTXH 1NBYA 3SDCA 1DBML 4X5WB 5D7LD 1EO7A 5SWSD 4S1DC 1KJMA 3UTOA 1HHIA 1AGCB 3A6OA 3MJ8B 1TETL 3MRNB 5H35A 1HXMB 2FEDC 3DURA 4KI5F 3H42H 4R2GC 3B2VL 1XF2A 3D6GA 2YS4A 5LXGL 3TV3L 3K4DA 5EZOL 4FQLH 1ZHKB 1OL0A 3M07A 3S98A 4QGYA 5LWYH 4HK3N 1TQBB 1KULA 1Y6NR 3MNWB 4JN1L 3LN4B 2VSCA 1OSZA 1KB5L 3NZHL 5DO2D 5IG7B 5KSVA 1HDMB 4LF3B 3KJ6L 1PQZA 1U8KB 2VXUH 2WLYA 1IEAB 5C8JB 1PYWB 5IQ9A 1F4XL 1FL5B 1IC4L 3DNKA 4B7IA 3SCMA 3V6OE 2B0SH 3VXOB 4J8RA 1JE6A 1LK2B 1ONQB 5EO0A 3QIUC 4GG8A 5T1KB 5A1AA 2L4OA 3KPOA 3ROOB 4LSRL 1MEXH 2IQAA 1FN4A 3QA3A 2OZ4H 5GS0L 3N85L 2FJGB 2KDGA 3D39A 2F15A 2YKLH 4OQ1A 4XHJC 4NWTL 1NCDH 1GHFH 4AEFA 2ADGA 1CXHA 2X42A 3AM8C 3F7YA 4LSUH 2PO6A 3UTSA 3DJ9A 1FBIL 5JXAH 1SYSB 2JLLA 2Q8AL 2Z31D 4GQ9L 5C0AB 2HWZL 1FVEA 4HH9A 5F7DA 2IQ9H 4M48H 4FXGA 4KZDH 2K7PA 4OM1H 1J5OH 2D2OA 3Q6FB 5ALBL 5FDWA 3TGXA 3B9DA 1S78D 3EHBC 1NCWL 4G3YH 5DI8B 4OZ4B 3MRKB 2B5IC 3DXAD 4LHUA 1VGEH 1OM3L 3U30B 2NYYC 5LQBH 5GISH 3FN0H 5DC9B 2FL5A 1AO7A 3P77A 3V6ZB 1I9JL 5C2UB 3OGOE 4HQQL 4YBQD 1KCUL 2DKUA 3OR7B 4I3SL 3IU4L 1ZT4B 5IKCA 3IFLL 4R8WH 4OIBA 4KWUA 2X1XR 5J6HA 4GW5A 3NFPA 2F8OA 2GT9A 1CDHA 3UC0L 4MJ5A 4WW2C 4G9FA 1XH3A 4LK4A 4FFYL 1S9KC 2YMXH 2Q76B 4M03A 2NY1B 2ERJB 3EGSB 1S7VB 1S9WA 4FNLL 4NN6C 2GHWB 3C8DA 2VYRE 43CAB 1Z3GH 4DKDC 3I75A 4PBVC 3I3DA 4KVNL 43C9B 2GTWA 3RIFF 2W91A 4PJHF 1J1XL 1IZJA 2LFGA 3MACH 3UMTA 1FLRH 5E8DL 1FZMA 3IYLW 2DIJA 3L5XL 2I07A 2GJ6A 4HJ0C 5D6DC 1I1AC 4WENB 3CDGA 3MLYL 1DE4A 2YA2A 5EUKA 5IHUL 5HPMB 1NCAH 5GRXG 3D0LA 3K80A 4HWBA 4U6VL 4MAYA 3I02B 2V2TA 3OZ9L 2Y7QA 4XXDA 3PIQA 2BNQB 1BQUA 1CS6A 2XA8H 4D9QE 4AY0A 4YHKL 3RA7H 1KEGH 1OLLA 1I3GL 3T08A 3ZTNL 4F2MA 3GI8L 3TN0D 2WQRA 2I9LB 3H0TB 1MREH 4AEEA 3OKLA 5CBEB 2FHBA 4NZRH 5JDSA 3MZTA 3FL7A 1AD9A 2UYLA 1QSED 2PW2B 4OBSA 3RUGE 1K3IA 1W72B 5ILTL 4CL7A 1EX0A 3VXMD 4D9RD 4OZIB 3QDGD 5CGYD 5K33A 2F19H 3HG1A 3EYVB 1XGUA 4YDKL 2VDQL 4M1GL 3RVUC 1T89A 3BEWA 4FQIH 3UJTH 3QPQD 2IH1B 1N3NA 5DEGB 4XGZA 1EK3A 4K8RL 3QWRD 3AS1A 3UBXG 1CFVH 5L2KD 1L6XA 4C4KT 2EC8A 4OB5L 3EO9L 4G6KL 1Y18B 3DUHA 5CWSA 3O3DB 1GCFA 1T7XA 5CJBA 5E2UL 5FGCB 1ZWIA 1IC5H 1WK0A 3CPLB 1WBYA 3MUY1 4UT7H 1MQKH 3IU3A 3VFOA 4DN4H 1N4XH 3D85B 1IAKB 1RK0B 4O5LL 5GPRA 3FO0H 2BCKB 4GAGH 4PV9B 5DFVD 2I5YL 1V3KA 1KXVC 4JZJC 5GGSY 3HNTH 1YYLL 3V6FB 3IJHB 2DQCL 1TCRB 4ODBD 3DBXA 2OK0L 5ICYA 2ATPB 2BHYA 5J8OA 3RL1B 4ZS6C 3JWOL 1WLHA 4MS8C 4ALAH 4Q2ZB 1DL7H 4YXKH 4E42A 4X6EA 1K2DB 2XRAL 2VOTA 3LQZB 1CL7L 4C58B 1K8DB 2DQFB 4X80H 2XFXB 5EU4A 2DQHH 4WFFD 5DUML 3S88H 4YWGL 2VL5B 4X9HA 5HYSG 1JF6A 3G6JE 1E4XH 5GGSA 2V7NB 5F1OB 4I0PB 4KROB 2VR4A 3GSNB 3IJYB 4PJEF 2I26N 4PJHA 1ZLWH 1GSMA 2DTML 2DQIL 4P2OA 4XP9H 1R3HA 2GW5A 5EC1A 3KJ4B 1NAMA 3G6AB 3BHBB 4HIHA 1NFDF 4OZHE 4JFHD 1RZKH 2WBKA 4OLZL 2HG5A 3R06B 3U4BH 3QDMD 4MXVF 1URLA 4XHQA 4OJFL 1RHHB 2M8XA 3PXJA 4DUWA 2N56A 3WFZA 2M2DA 3RX5A 1V3MA 4W70A 3H2WA 2WIMA 1MPAH 1QR4A 3ZKXC 1JJUA 4RGMC 2UZIH 1IGYB 2WIIB 3FQXB 4DFHA 5LGJB 2YD5A 5A16A 4XCYA 5I71B 3EO0B 1TVBB 4H88L 2ICWA 3UXFA 2VXTL 1LO0H 4GW4B 5DVMA 4KXZI 1RUKH 1WT5A 4PLJC 3QZWB 4RGNB 2NY2B 1G7MA 3WIHH 2X5PA 4OCYH 2BRQA 1WFOA 3MLSH 4J6RL 1FQ9C 3WN5C 2QQLL 1U91A 3TT3H 2JJSA 4LCIH 4YHNB 3KVQA 5MEPB 1C5BL 3B9VA 3BGAA 1XGQB 1J1PH 4PGJA 5JOEA 4OM0H 5GS1A 3OGCB 4APQC 2Y72A 3BP6A 4PY7A 4NSKB 3X13A 2CXGA 3KPRE 5IQ7L 4QY8B 4LLYA 3HZVA 2MNUA 3IKKA 3PQYB 3DX8A 3EYOA 4LAJH 1A6UL 3BN9D 2W9EH 1BZ7A 1S7QA 3WS3B 1RJLA 4OZGE 4YHYB 2UY7A 4WFED 3KYNB 4U33A 3VMNA 1QLFB 5C9JA 3LKSA 2PXYA 4LLAA 5C2BL 3A67L 3MNZB 2CQVA 4G8EB 4PGDA 4C56E 3I3EA 4XPGH 3VXNA 3Q1SL 1H3UA 4JRYB 3L6FB 5MEQA 3HAEA 2YD7A 4WWKB 5D1XA 5HVHC 3CD4A 5TPWH 5DJ6B 2VLKE 4KRPB 3C8KA 3JV4B 4JFFE 3QUZB 1JGVH 1XZ0B 3HAEH 5K9KB 3IVKB 2KZ1B 4TTDD 1FFOA 4YNYA 1T1XB 2ADFH 4M6OH 1IGML 2VAJA 4NO0B 1YMHA 4FTVD 2W0FB 3SDYL 4LGPB 2F53A 4HIIB 4NQSB 4BSJA 3VH8A 3EYFA 4PJEA 3K2UL 4UI2A 3ULSB 2X4RA 1C5CH 2YXMA 1EJOL 2UY6A 1FO0H 3P4NA 5CJ5A 5BRZB 4XVUC 1G7IA 4MNQE 3TYGL 5I73B 4K9EL 1FYTE 4NQEB 4ZFGL 4F37K 2OJZL 1NFDA 3S37L 5EO9A 4ZAKA 1X4YA 2X4TB 5A40E 4ZUWB 2XA3A 3QHZL 4XCFH 5KZCB 4UNTA 3PXHA 2ZNWA 5T3XL 4HWBL 4IRJC 3CMGA 4KUCD 2C3VB 5ADPL 2FX7H 1J88A 1AXTH 1ZLVK 3QO0A 1JTOA 2NY0C 2QKIA 1I7ZA 2OR9H 2CDFB 5E2WH 2CRIA 3UAJD 5CJOL 1WBZA 2EICA 1MRCH 3WS6A 1S7SA 1VFOA 4X7FC 5F97E 4U1IB 1B90A 2DBLL 5CJQH 5T5FL 4FQXC 2XNAA 1XR9B 5K9OB 4IRZH 3B9KA 1WVZA 3MOBH 3TNNA 3VJ6B 1Y0LA 2R4SL 4Z7OF 5FM5M 2VDMH 2BSSB 4NUGL 3X14B 5C0RL 4JN2B 4IOIA 3RI5F 1JRHL 4U7SA 4AEHL 4DWHA 1UM4L 4RGOL 1BD2B 2P47B 1J11A 3IS1X 4KQ3L 4XCCH 4Y4FA 1YEGL 2ITDA 4H0IA 4EOWL 5IW1B 3PWLB 3KPSE 4TN9A 1IGTB 3BKJL 1B2WL 4YQXH 3VD5A 2DS4A 3BWAA 4MA8H 4W6YB 2XQYG 4I48B 5GGRB 2DJ4A 5EZIH 2IWGA 5L8LB 4OD3H 5T5NG 4JANA 3EYUH 2ZUYA 3GJEA 5KW9H 4POZD 1D3CA 2C3HA 3CX2A 4JZOB 2YPKA 2H32A 1YMMA 4MDJB 4YDIH 3UYPA 3BDBA 5D7SL 1HE7A 2VC2L 3O6LH 4EQ2A 4LEOB 3WFEL 4YGVB 2H32H 4GAJH 5DQDL 4MXWL 2BSTA 1YNTA 4LLDA 3U7AA 2OQJB 2X4SA 3RPKA 3WO4C 1JVKA 1QFUL 2NXYB 1RZIB 4O2FB 5EORL 5IMLB 4OIAA 4Y8DC 3D18B 4FQQB 1A8JH 4MZ3A 4XPBL 5C0AD 3PGCB 4NKDB 2IAMB 2WANA 2RCSL 2J6EA 3CCHB 1L7IH 2C7UB 3GHBH 4PJ9B 1T7ZA 3DARA 1M05A 4NNPL 4N9GB 5SX5H 2J6EH 3QR2A 4D0DA 4MB5A 2YD9A 4XTRD 4GRWF 3RZCA 4DTGL 2PR4H 5GRVL 1RUQH 5IVXE 2A6KB 3ES6A 5E94B 2AJZB 4YBHA 4BKLA 3QB7C 5B21A 4UOJA 1TZIB 4CJ0A 5HYJE 3M45A 3TO4A 1HHHB 5BS0D 5E2JA 4XNYL 3NMEA 1K5NB 2J8OA 2NNAA 3QT2A 2EO9A 2AEQL 5D7IF 4R26H 5TDPB 4P3DB 4Y5XC 4I2XB 4X5XA 4OGXH 1CICA 3CJJA 5DO2C 2NY1D 1N6VA 3AXLA 2I9TA 1BP3B 5E24E 4GBXA 5ELIA 3SO3B 2EDKA 1MFEL 3T65B 4PJAF 1MWAA 4QRPA 5E7BA 3DV6A 2VZSA 3I6KA 5ABDE 5C0JA 3B9EA 1NC4A 4ZQKB 1EH9A 3STLB 3QIWB 2AW2A 1MWAH 1T03L 5EWIH 4PREA 1M71A 2A9MH 4NKOB 4JQVA 4MCYB 4UB0L 4R6UA 3AREB 4HIEB 2X10A 3HI6H 3TBTB 3LN5A 5EOTB 2C3WA 3F7QA 1YPZE 2AEWA 4HBQA 1QBBA 1M6OA 2FO4B 5ALCL 4F37F 4CVWA 4F7EB 3GMOB 4FQPA 2BNQD 4ZFZB 4GG6B 4H5SA 1N5YH 1R5WB 2Y36H 4P2RD 4Y16C 3F7PC 1LEKB 4LNRB 3VFNB 4HUWA 3BZEB 1NEUA 3U6RA 3CFCH 4HGKC 5E08L 3OJ2C 4JFPB 3F7RA 1MJUH 4YLQT 2X89A 3V6BR 3EZJB 1IAIM 5DT1L 1JTPA 5J56B 2E9WA 4K3EH 1KJ2A 1QACA 2Z31C 2R8SH 1D5ZA 1QYGH 2D7NA 2LABA 3L7EA 3BZFA 3VW3H 1S78C 4C54A 2A1WH 5J1AB 5AZEL 3UPAA 1CR9H 1OWWA 1ZS8A 2Q3ZA 3DXAE 1JK8A 2BJMH 4N0UA 4JO2H 3LRSB 4WHYG 3D69A 1MJ8H 4X4ME 1RD6A 2CIIB 1OAZL 5CSBA 1PG7X 1U6AL 1BZQK 4PJXF 4X4ZA 1E6JH 5EO1B 4YBQC 2VQTA 4AYFA 5F7HA 3D85D 4X99A 4F3FA 4X6FB 3DPBA 4L4VA 5FB8A 5HPOA 5EN2A 2ZUXA 4GH7B 3INUH 2DMKA 4XPTL 3SPVB 1ROWA 1ZLSL 3GNMH 4JY5H 3GK8L 4P46D 2CLVA 3AVEA 3TA3C 4DGYH 3TH2T 4OLYL 3W2DL 4OKVB 3EOTH 1U8LB 4RWYH 1GGBH 5D7IA 3RTQA 1TNNA 1UJ3C 2JIXD 1UB6A 2V5YA 4MLSA 3EDDA 4P2QB 1JYWA 1X4XA 4TVPH 1UXSA 3VXSA 1R0AL 3FCTA 5DS8B 4I0PD 2Y1VA 1GC1H 3CSBA 4KROD 4M9PA 4XPFL 5IK3B 2VQ1B 4ZUUA 5CIPA 5FM8A 5L7XL 2ENYA 5E2VL 4PJAA 5SWZD 1D7FA 3B3IB 5CMAB 5F1NA 2JE8A 2AV1B 1AJ7L 4NIKB 1LEIB 4BSWB 1OY3B 4NNXA 3GMLB 5GRZA 4RFEB 3L3KB 2ADIA 4JFZH 4DCQB 2J8HA 4LDOB 1MFCL 5CHNA 2EYSB 3TN0C 1PG7H 4H1LA 1VEOA 4RBPK 2CLRA 3S96B 2A73B 5C08E 4EDXA 4H1LH 3EDJA 3TCLA 2R56L 5I1EL 5JXED 2ZCLH 4PRIB 3LEYH 4TSCH 4D9RE 3O4LA 3QDGE 1BAFL 3PNWA 2YZ1A 5CGYC 1U3ZA 4S11A 1QFWL 5ERWB 4L4TB 3ROLB 1G7JB 1QBML 2EH7H 3C09B 4KRLB 4CGTA 3QPQC 3CU7A 2NY2D 4RGND 4XVSH 2P5EB 5L2KE 1TIUA 4TUJB 4JR9H 4AENB 1J05B 4QXWA 4UILL 3QQ9D 1OTUD 3BRDA 4X8JB 3MA7B 3FTGB 4R97B 2WM0A 5DFVC 1XCTB 1IARB 3QXUA 3IJSB 4YPJA 3PQYD 1A7NH 1MIEL 4LLQB 5F9JA 4PJXA 1WFUA 2IANE 3C60A 1KTDB 3MFGB 1UADC 1FZKB 1HSAA 5DA0B 1YQVL 1A1OA 4QOKB 4UQ3A 4LCUA 1FGVL 3VXUE 1IBGL 4FABH 4Q9QL 4N8PA 1V5JA 3DSFL 5IHZA 4ZNEA 4JRYD 2JB6B 3GJFA 1M1SA 3PP4H 4WWKD 3ZL4H 3ZE1F 4H26A 2ESVB 3NACL 4KRPD 1FZJB 4JHAL 3VGDA 5DVKA 3FT2A 1F11B 4WW2F 4NO0D 4RZCA 3D3VB 3FZUD 3U7WL 1U8PB 3SEPA 4AG4L 3MV8A 3WLBA 3HI5L 4ERSL 3L1OL 3VXQB 1S9VB 4JFHE 4HS6B 3QDME 4YK4C 1MI5B 5E2TH 4JRXD 4HJJH 4X4XA 5D1ZD 5BRZD 3GMPB 5FA3B 5I30H 1W0WA 4L1HA 1ZGLA 5J13B 4KK5D 2Y25A 4NQED 2W0PA 4NOBA 4X6DE 4QYOA 1O0VA 1HH9A 5KSUB 1ZSDB 1VESA 4QRUB 1D5BA 3NA4A 1AC0A 2WK2A 5I75B 5KZCD 5IVOA 1ACYL 3VRIB 4C83A 3KYKL 1DBMH 5ID0A 3EUUA 3WUWG 1G9MC 2BC4A 1JGLH 2CMRH 3QIUA 4GKNA 4MB4A 1QR1A 4LGRB 5CD5D 1R24B 4ODTH 2YSSA 4OQTH 1E4KC 4DOHE 3VGGA 1A7PH 4CBPA 3KS0J 1UGNA 1CGUA 1X7QB 2F74B 2NZIA 3H3PH 2ZG3A 1II4E 4D2NA 2W65A 2IMNA 2DYPB 4OF5A 4YBLC 4FOMA 1YN6B 4Z7UF 3MLRL 1KB5H 3AM8A 3NZHH 3BN9C 1CGYA 1UCBL 1BD2D 3O6KL 5I17B 5CEXA 4PJCB 4WFEE 3PGDB 1EMTL 3V7AE 1BM3L 4NQVB 1DDHA 3WXVL 4Y5YB 1ZAGA 2OBGA 3RJDA 4M7LH 1F4XH 2YPVL 5GGTA 2J1KA 1BZ9B 5FA4A 5E99H 1XGYH 2FLBT 2ILLA 4HXAH 1G6RA 3BIKA 5FUOL 5ACLA 3OXRA 3KPLB 3MV01 4TTDC 1LO4L 4XAKE 2PYEA 5CJXC 5J06A 4HK0B 4P49A 4PJIE 1EFQA 3VI4E 1EAPB 2JELL 2D9CA 1AGBB 2R2HA 4FTVE 3QRGL 3QFDB 1J12A 5F7YC 2WW8A 4KPHL 4WNQA 4NWTH 1MELA 4MQ7A 2ARJB 2DQUL 2JCCB 3KXFD 3O6FB 4HF5H 2EDFA 2NXYD 4G6MH 4Z77B 4ZTOL 1NEZA 4OCXL 4NZJA 4NT6A 4WW2A 1N59B 5B3NA 4Z7VB 2IAMD 1FBIH 3G6JF 3DX9A 4PJ9D 4M8QB 4BFIB 4QTIH 2XTJB 3HC3H 3QDHA 4LPWA 1NBZB 2R2EB 1Z9MA 5ALBH 3BW9B 4NO3A 4J4PA 5IB3A 5F89A 3K8LA 1HHKA 4HUUA 2RFXA 1IKFH 2BNRB 5D6DA 1OAUL 2WP3O 1I1AA 5IVNA 1B88A 1WF5A 2X7LA 2R1XB 5E5UB 2IH3B 1I9JH 7FABL 3MJ9L 3UAJC 2OP4L 2NTFA 3HE6B 4Q97A 3MMEB 2DF3A 4WUUB 1TQBC 5E56A 4NO2A 1Q9WB 1Q8MA 4I3SH 2NX5E 3U83A 1A6TB 3IFLH 2R0LL 4RISL 1MLCA 1KT2B 4PJ7E 3BUYA 4G8IB 2H1PH 3F6IA 4GXVH 4NPYB 4FFYH 4YR6B 4M6NH 1D5MB 3ARQA 2B1AL 5IB5B 3QIWD 4EI5A 1L0YA 5EIVA 1SEBA 4KKAD 1FFQA 1U3HD 4Z7UA 3SKOA 3QFJB 4JDZA 3VWKB 1RHFA 3L5XH 1NJ9B 1QO3B 5I8EA 1IMHC 2FHFA 4XPHL 1LEGB 4NQDE 4POZC 2FGZA 3IGAB 4KKBD 2DIBA 1CIUA 3A6CL 2B4CL 4N8VB 4U6VH 3IDNB 2ED8A 2R1YA 2HYMA 3OZ9H 4W4OC 5FM5O 2CUIA 5DK2B 5KSAD 5SV4A 4WFHD 1J10A 3P0YH 4I3GA 1SJEA 4GXUN 2DI8A 1SYVB 1J8HE 2EH8H 4UBDC 4OZGF 3BKCH 1I3GH 1N7ML 3GI8H 4Z76A 4JZJA 4AQOA 2DI9A 4P48A 2DWEA 3OJDB 3ZE2E 2E8ZA 3GIVB 3VFWA 5FKAB 1GIGL 3LKPA 5DJAB 5ILTH 1DFBL 2H41A 4WTXA 2A9NH 3BAEL 1JYVA 3B9AA 4XTRC 2QBWA 3I9GH 1Q38A 3VDBA 2V5TA 2VDQH 1VA9A 1CGTA 1U58A 32C2A 4Q6IB 3U30C 4RAHA 2GJJA 5ISZE 1NBVH 3VG9B 1JUFB 4HCRA 4X4YA 3G6JA 3KR3L 4ORZC 2AGJL 1MFAL 4Y1AA 4HUNB 3QI9B 4RQQA 4M4RA 3EO9H 4G6KH 5BS0E 4EZMA 4U0QB 1OP5H 5HYFA 4NUJA 5F6HJ 5E2UH 5IMKB 2HT2D 3LRGA 2VN7A 3MLTB 5HHOB 5LCVL 1CFBA 1YYLH 3ZHDA 5C0ND 5F3BA 2NY1C 3QCTL 3MOAL 5K59E 5HI3D 4G9DB 4UDUB 4HSQA 5EO0B 1Q0XH 2XY1A 3FFDB 4GG8B 4QHUB 4N0FA 4QRRA 1EEZB 2ORBL 2VE6B 5F7UA 1F4WH 4P2QD 3GFUA 3FHAA 3MRIB 4WI7A 2X70B 1RI8A 4Z7WE 4G8GD 4XP5L 5DJ0B 2J7LA 3RWHA 3BP5B 3RWFB 3PL6B 2YC1A 5E8PB 2GK0B 3QXWA 2VLME 5H2BA 3D0VB 2KBGA 1BFSA 3K81A 3F7YB 3ZT7A 2VDNL 2BNQE 4KK6D 3O11A 1D6EA 3MCKA 4MQXD 4P2RE 5EBMA 1NGZB 2CD0A 3FONB 3WN5A 1OTSD 1C5DA 4BFBD 2DL2A 5DC0A 3V5DA 1A1NA 2DTMH 2HKHH 1JWUB 5F1SA 4Q7DA 3QWOA 4KGJA 5IP4A 4LCWB 1JMZA 4APQA 5T1LA 5C0BD 1LNUA 2GJZA 1P4LB 1EHLH 2CUHA 4UAOC 5HDBE 3GSXB 3HTLX 4UDTB 4PRID 3RBGA 4ZS7H 1QA9A 3PV6B 4H20L 2OLDA 4OZIE 1F5WA 3BMVA 3GSQB 2BNUB 3M8OL 5INDA 3TIDA 3DO7A 3SDXF 2HH0L 1MCEA 3MV9E 3T0EB 4OZGA 2F58H 4L3CB 4OZFB 4L4TD 2YN3A 5DJ2B 4G6JL 1G6RL 1A4JA 1UKSA 2P5ED 3HZYA 3DVGA 4UUJA 2P24B 3LD8B 2AABL 1PX3A 4Q9BA 1RUAH 1IQDB 2VLKA 2AKRB 4J6RH 3QULA 1LE5B 1S9WB 3WJJC 1H3TA 3QUMA 4U1SA 3D2UB 1J86A 2GY7B 3I75B 4GLRH 3GSVA 3SE9H