4X6DF

Cd1a ternary complex with endogenous lipids and bk6 tcr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRYFLPTQGMGAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1a
total genus 60
structure length 241
sequence length 241
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dF02
3QEQA 4JM4L 4O51A 4HMCA 5JUEL 5CBAB 5DZLA 2FJGA 5HHMD 4LCCA 1G6RA 1YPZB 4KRMB 5FYKL 1ZV5A 3HAEG 4OZHA 4Q2ZB 4JPVH 5HI3C 1I7ZB 15C8L 3CX5K 4JDZB 5CSZA 3WIFA 3MRKA 2DQJL 2CK0H 5C07B 1CXIA 5F9AC 2VDLL 3TN0A 4YQXL 4YBLC 5EBMA 4M3KB 3MLVL 4X9GA 4OCLC 5A40E 5T1DH 1WWBX 3OF6D 1IVLA 4LLDB 3VXUE 3QIUD 1CZ8L 2YUWA 2A0LC 1A64A 4WCYH 3D39E 3ZYZA 2DDQL 4LGPB 2XZAL 2XXCB 5I8CA 4XBPA 1MEXL 4JEGB 1NSNL 5DVKA 1HQ4B 1JP5A 2AXFA 2X4QB 3MA7A 3MJ9A 5HHOB 2A2QT 2DF3A 4H8WH 1CGSL 4U3HA 4U6VH 3S3JA 3IDGB 3TYFB 3LV3A 1QSFA 4H1LH 1P1ZB 4Z7UF 2JCCA 1I8MB 3NCJL 5H94A 5ILTH 5HD8D 1PDKA 3U48A 4XMPL 3AM8C 4G6FD 3TT1H 1KEML 2DB8A 2G9HB 4PJDA 5F1OB 2J8OA 4WENB 1ACYL 3F12A 5F97E 1IFHL 1QRNE 3R1GL 3BDXA 3BPLB 3QIBC 1NKRA 1YEFL 2W65B 1R3JB 2C4XA 4NO2A 1LNUA 5ADOH 5E99H 4Z7UB 2DYPB 4L4VB 1V3JA 4NWUH 1NAMA 4YHOH 5EBLA 5BV7B 3GMOB 5JHLH 4IDLA 2HLFD 2BRRH 4LRIC 2WINA 4FZ8L 1FFPA 4YBQD 4XPAH 1MI5E 4AZ8A 3EKCA 2J12B 3E6FB 2NZIA 1WCBB 3L3KB 1QFOA 2R39A 3D39B 5E8NB 1RUKL 4K3DL 4YC2C 5HHPB 1UZ6F 3FOLA 4PJAE 4Z78B 5EPMA 3L3OA 3BYYA 3FT3B 3DJ9A 2IBZY 5HY9B 4ENEC 1E6OL 4KTDH 5SWSB 4RCAA 1BZ7A 1CLOH 2FWOB 4ZUUB 3U4BH 4DCQB 4YBLB 4NWUL 3E6HB 4L3CA 5CEZL 1Q9OB 5L9DH 4QRRB 2P5WA 4KY1L 4U3XA 1D6VL 3RTQC 4F7TA 1HDMB 4HX1A 1FG2A 4OD2A 2K9UA 5J56B 4J8RB 2YUVA 4P2QE 3MV9B 1ZVYA 1NANH 5D7KE 3KYMA 2W1NA 3KXFE 1GGTA 1S5HB 4K8RH 4OLZH 2AKRA 3T4AB 2M2DA 2R0WH 3MGAA 4X6EB 1EUUA 3G6JE 4WEMB 1CD9B 1DE4A 3QWQB 3QSKB 1T20A 4Z9KB 3PL6A 4N5EC 2LTQC 1EFXA 2X1XR 3SGKC 5L0QB 4KZEH 5IHBA 1KT2A 3MXVL 4MNQE 3FQUA 2BC4B 4WEBL 5CEZH 5GHWH 1IQWL 2VDML 1S5IL 3O4OC 5IKCA 5KANG 2Z35B 2MSPA 2PW2A 3V4PH 3IDXH 5IEHA 2P45B 3EO1B 1I3UA 2NY2C 1E4JA 4HPYL 2A6JB 4LBEA 1I9JH 4PD4J 3VG9B 3V0AC 1ZGLM 1RK0B 4ZOEA 5SWSE 2IJ0C 1PD6A 1FC2D 3T09A 1HE7A 1OLZA 1T0MA 3OX8B 5FA3A 1CD8A 5JNYB 1T2QH 5FCUL 3DURB 3NACH 4HUXB 1ADQA 4K2UL 4QRTA 4I0PC 3EO0A 3VFPA 1Q8MA 2GY7B 2W59A 4WTZG 4P59L 2W9EL 5HJ3B 1VFBB 3E2HC 3WKNA 5JZ7C 4OAWB 4NZRH 3H42L 2CDEB 1O5DT 1C5CL 5E6ID 1H3VA 3DUHA 2ADJA 3SDAD 1ZA6B 3D39A 2NY4B 4WIQA 5ALCL 1NDGB 5JLZA 5A16A 2ADIB 4YUEL 5J57B 4JKKA 4Z7VF 5DT1H 1NSNH 4PYHA 3O6LH 5FHAL 3SQOL 1CS6A 2D0FA 4BSWA 3EOYG 3MV9D 2PETA 3N9GH 3BHBA 3C6SB 2O61B 1JYWA 1ZT1B 5EIVA 2P8MA 3G6JF 1NAMB 2WWKT 2XTLA 4WGVB 3AUVA 2KBGA 4QHUA 5BXFA 3SE9H 2E6PA 1BX2A 1OF2B 2BY1A 1FHGA 1I7TA 5GGSB 4G80B 3MRNB 5E5UB 1MLBB 1TJHH 2Z92B 3BP5B 2NPLX 4PLJC 2P7TA 1KB5L 1QYGH 4HIHB 3RA7L 5IVXE 4OTXH 5IEHB 1VGKA 4KRLB 5BRZD 4FQXC 4AT6B 5T5NF 5DMGC 5C71A 3RZCC 2Y36L 4V1DB 4NNPL 1BREA 4OZFH 2BVPB 5L2KB 1QLFB 4KVNL 4KUZL 1WK0A 4HQQH 1F4XH 3RQ3A 4NZUH 1P4LA 4TTDC 3QO1A 1RJLB 2HT2D 2OZ4L 5B39B 2X70B 2Y5EA 2Y25A 4L3EB 2WUCH 2X4NB 4ZO9A 3HPLB 1IAOA 1IEHA 2XRAL 4NJAH 2HAZA 4WWKB 2FH8A 1CDGA 3MROA 2DMKA 4HXBH 4NQDD 1SJHB 3BMVA 1WZ1L 4H1LG 4LHUG 3PGFH 2F8OA 5IESH 5ENWB 2VLJA 4PJIA 2PW2B 1KELL 4OLXH 5J1TC 1CE1H 4ODSL 5D7LA 1AXSB 1JGUL 2H6PA 3LY6A 5C0AE 5CSZB 2DDQH 4N8VA 3U0PA 2YD7A 3NIFF 1KT2B 4F57H 1FYTA 3L3JB 2Y07H 5FYLL 4YXHL 5BMFH 2VC2L 1JGLL 4ZPTB 3T08A 2AJUL 1BJ1H 4MQXC 3BW9B 3MSPA 3T4AA 4U2ZA 1UYWL 4TUKL 1HH6B 3G6DL 3GKZA 3OKKA 4TSBH 4PB9L 2FB4L 4IRSD 4PP1D 4HH9A 2Z91A 4TVPD 1GGYA 3TBWA 2EIZB 5FYLE 1EBPA 4JFYA 1YQVH 5HVWA 2VABA 5EO0A 4L4TD 4LF3A 4MMXC 5KAQF 3F7PC 4H0IA 4NT6A 4XPTL 5FIEA 1BP3B 3V5DB 2H1PH 1T21A 4JREC 1LEIA 2AJZA 4D3CH 2HH0L 1HNFA 1FSKB 3P0VH 4WHYG 3D48R 3P4NB 5ISZE 3W9DA 3B9VA 3D18B 2L4OA 3G5VB 4K94C 4WY7L 1KPVA 4MDJB 5EPMB 2AJUH 4L8CB 1ES0B 5C0EB 2DKUA 3HUJB 2VXSL 4BQ8A 2NY0C 3H3PL 3X13B 3HZYA 5EO1A 2R1XB 3UYRH 1E28A 1JGEA 5CWSA 4K94L 3EO9H 3ARGB 5FK9A 4WNQA 1YY8B 2H41A 3OB8A 1MCDA 4U31A 5D2LF 3OXSB 4GO6B 5C0BE 3KPNA 1J0HA 4NCC1 4QRPA 1H3PL 1MWAA 3Q6FA 4L1DA 5IHUL 5K9JL 5EWIH 4K7PX 4XP1L 2DYPA 5DXWA 3O9WA 4O00A 1WFUA 5IFJA 5L8KB 1JI2A 1R24B 2V9TA 5DJAA 3Q0HA 4HIXL 4FABH 1NBYB 5D1XD 1QQDA 1VSCA 1YUHB 4FXGB 4NM8L 5HVHB 4FFYH 5C0RL 4JKMA 4GBXD 5TE7L 1RZFH 2EYTA 2WBJD 4U1JA 4QHMA 4GKNB 2AJSH 2J6EH 4OSUH 5ISZB 1QBBA 3I02A 1MFCL 2G2RA 2AJVH 1VFOA 3DI2B 5IT2L 1JGEB 1I1YA 1Q72H 5CGTA 1AIFA 5T5NG 4XBPB 4WO4C 1YEHH 2V7NB 4ORGB 3CFBA 1IAIH 1EEQA 1CIUA 5KVGL 2G60H 4ZPVB 1RZ7H 1JFQH 2YN3A 4F7EB 1JF1A 1QACA 5B39G 3V8OA 3OGCA 4ODTL 3QEQB 5HYQA 1MCPL 4FS0A 3L1OL 4JJ5B 1UADC 3VWJB 2YHGA 3NCMA 5CKAA 3UC0L 5D1ZD 1IEBB 2AJSL 3DX8A 2FX8L 4WV1B 4Q58C 5BW7A 2FEEL 3ARYA 1JNNH 4KC3B 5I8KH 1DN0B 4NJAL 5DK3A 5E56A 2Y72A 3KLAB 3ZTNL 1VERA 1EPFA 3HNVH 4G6KL 5GS0D 1S9WB 3OMZA 4FTVA 4WW1A 3VRLF 4XPBL 5D7JC 1OWWA 2YWYA 2HVKA 3BX7C 4QO1A 3S8WA 4NKQB 5CJXC 5ICYB 3W0WA 5ISZD 2EZ0C 3HMXA 2WMPA 4M5ZL 4NSKA 1TTFA 2MTPA 4Y19D 9CGTA 5HGBA 3F58L 3WNKA 1HH9B 4OF0A 2AABL 5GS2D 5B38A 5DZOA 1EHXA 3ELAT 1OQXA 1OQOA 1KTDA 4WCYL 1YEEL 2PYEB 1I9IH 5J1AB 4P23C 3VFRA 1LGVA 4IDJH 4PREB 5IVZA 5FYLD 3F8UB 2AV1A 3GI8L 4TVPE 3ES6A 1RJLA 1AD0A 1P2CA 4LFHG 3I6LD 2YRLA 5DA0B 1UQSB 5L6YH 1REIA 3CCHA 4PJ8D 3WFEH 1D6EA 3DRQB 5BOPA 4JM2F 2O5XH 2ZZUT 2BVEA 2PXYD 5KG9A 4HGWA 5DC9B 1Q9WA 3GIZL 5DUBA 1RZJC 3RUGE 3H9ZA 1UA6H 3O41B 4FQ2L 3EBAA 5IOPB 2EZ0D 2EDWA 4W4NA 4BUHA 1I9EA 1IC1A 1MIEH 3WXWL 1NCDL 4NQVB 1YEEH 2JTDA 1P69B 4NQDE 4CUCA 4R3SB 5D7LD 3T2NL 3RNQA 2Y1VA 1FE8L 5I1KL 4C57C 1CFVL 2YBRA 3QCUL 5DVNA 5TGBA 1KB5A 1NGYB 3P9MB 4DZ8B 3PNWA 4QHUB 5BXFB 1GGUA 3MUGA 5IP4A 1RK1B 4WW2A 2NY4D 3CX2A 4G6FB 1MCSA 3U6RA 1IT9L 2ZCLH 4CN1A 2QKIB 1H3PH 5DTFA 2BFVH 5LWYL 1UVQB 2H32A 1HQRB 3PGDA 4P4RB 1HSBA 4ACPA 5BRZE 3QZWB 1G7JB 1JRHL 3OV6A 1IC4H 3NAAL 5FKAA 3TBYA 3QEUA 1HYSD 1IQDA 1A02N 1YZZA 2VIRA 4WU5B 2OI9C 5ITFB 1AP2A 1F02I 1ZSDB 5DVMA 4JFEB 5GS3A 4JKLA 3P77B 1J0IA 4QWWD 1J7VR 2GI7A 3L3DA 2ITDA 4IHOB 5B4MD 1YPZF 3RAJL 1UG9A 2B2XH 1EO7A 4J6RH 8FABB 3QPXL 1PZ5B 3B5GA 4HG4J 4ZAKC 1T6VN 3NA4A 2LFGA 2ZCHH 1MJ7H 3MV9E 4FFWC 4KV5F 5I1HL 1DLFH 4HUMB 4P4KC 2A77H 3P30H 5E6YA 2MPAL 3GSXA 4X99A 3DBXB 3P11L 3MROB 4M48H 3ARPA 4XRCA 4JKPH 3TIDA 5I71C 4UQ3A 5K9KB 2VITB 1NGPH 3ARGC 4PJBB 2VXTL 1JHTA 4JHAL 4ELKB 4G6MH 3QDGB 5ALBH 3WEXB 1A6UH 3BGMB 3LRGA 3QO1B 4MJ5B 1CLZL 3IJYA 4HV8A 3B9KB 4OM1H 4X6CB 4PGEA 5JW4M 3HNTH 5DEGA 2VDQH 4L8BA 1Q38A 4RFEB 5F70A 3VG0L 3LOWA 1YNKH 5HHVL 4NKOB 3MX0A 5F44A 1DSFL 2HKFL 1FYHB 1ZANL 1FVDB 3PDDA 1S5IH 1ROWA 1G9NH 3QG7H 5SX5H 2ICWI 2C5DC 5SWSD 3ULUH 3ZMRA 3GMLB 1F5WA 3BI9X 2IEPA 1YECH 3RY5A 2OJZH 3IKCA 1DBBH 4JHAH 3W2DH 3IGAA 3FB7B 3KGRA 3DSFL 4M7LH 5IK3B 3BSZH 4OV6F 4PUBL 1FG9C 1EXUA 4F33A 4QT5B 1T2QL 5FCUH 5JW5A 4MNQD 1JZ3A 3JWOH 4Q9BA 5HY9A 3CU1A 5CGYC 1PFCA 3GIVA 3R8QA 2F53E 3DHMA 4KDTA 3BN3B 3UPAA 4MNQA 1S7XA 3GI9H 1SQ2N 1OTSD 3VXQA 3MODH 2LV4A 4RAUA 1DQQA 5IF0B 2HKFH 5I76B 1U8LA 4X6FA 5C0FB 5T33H 5IB4B 2E9BA 4OLUL 2V5TA 5GS1C 4M6NH 5D7KD 2BVOA 4LPUA 3QUZC 1F8TH 4P2QD 1WWWX 3V6BR 1QFHA 4XP4L 1BFOB 2Y23A 1CDJA 4Z7UE 2DQDH 2ZPKL 2AERT 1UT9A 1URLA 2NNAB 4KK8D 4PJ7F 5FOBA 2IH3A 3IVKA 2IAMB 1F97A 3QULA 1DVFD 3HI1B 1B2WL 3HC3L 4S10A 2F15A 3IGAB 4MNGA 5IK3A 4RMWA 2BSED 4U0QB 3AS0A 2OTWB 3OX8A 5FA3B 1BJ1J 2GCYA 3AS1A 2FZ3B 1EJ6A 2ED8A 4M4RA 4FFZL 5EU6B 2FHBA 1XF5A 5FO7A 1CYGA 4G6JH 4HJGB 2NY7L 3KPSB 4JPWH 3VFOA 4HKXB 1U8HA 4I0PB 4PBWD 1KJMA 1FVDA 4DJMA 2W9LA 1IM3B 4BSVA 1JHKL 4HKZA 5TH2A 3RWFA 2KZ1B 3HE6B 3QG6A 5DO2C 2YD2A 1CDYA 3O6KL 4O5LL 1UM5L 4Y0GA 4AK1A 4XBEH 3LKQA 1A2YB 5K9OB 4HKBB 5C70A 4YNYA 4LCUB 5E6ZA 1MQ8A 2Q6WA 3U7AA 4EZMA 4WRLA 1U8IA 1LHZA 2V5YA 4KK9C 1DFBH 5AUMB 2XXMB 3TM6A 5IG7B 2WUBL 1K3IA 2MNUA 3O6ML 4NZJA 1QFUL 1QRND 4UDUA 1U6AL 4PJIF 5DGRA 3SKJL 3BZEA 2Y36H 3UYPA 1NAMH 4F7PA 5F1SA 3PIQA 3BUYA 2DIAA 3QDGD 3WIFB 2IANA 3CFJB 5I30H 1A14L 1JHKH 4KRPD 2B8OT 2R1YB 4M7ZB 1QTYT 3U2SA 1RIVL 4O4YH 1D9KA 4WUUB 3MJ6A 2YD3A 5DFTA 4NKDA 3MLVH 2XPGB 4Q6YA 1ZHKA 4J3UA 4X4XA 3MLUL 2Y5TB 5EZLA 4H1LA 3MLRL 1U3HA 3MOQA 1I7UB 1R3HB 1IQDB 5DJ8B 2HH0H 2GHWB 4KQ3H 4B0MM 4ZAKA 4JPIA 1XF4B 4YEFA 4PJCA 2JCCF 1JHLL 1ULVA 4P4RA 1V3KA 5KW9L 3WLWC 3VFWB 1YQVL 5FF6A 3IDYC 2ZUSA 3JV4B 3C6LC 2V7HA 2BNQA 1AC6A 3OGCB 3OKDA 5DK0B 1EAPB 3SDXB 5ILTL 3W9EA 43C9A 5JIHA 4TVPH 1J9CT 2A73B 3PJSA 1VGEL 3E8UH 2ITCA 4LDEB 1N0XH 5D71L 3RBSA 2GUOA 2CLRB 4AG4L 2FD6H 4LSTL 3SCMA 5T1KB 1WT5C 3IETA 3WNMA 4U0RC 4Z7WA 5J89A 5A43C 5KOMC 3IT8D 4YBHA 1QPPA 3F12B 2JJTC 1INDL 2J8UE 3UTPD 2G2RB 4K3HA 1NFIA 1OT2A 2EE3A 5TDPA 4PJDB 1NCNA 2VJXA 3QUYA 1IBGH 1LILA 1OT1A 3BE1H 6FABL 2NY3D 3L3HA 4X6CE 5KJRH 1EGJA 4OZIA 1A5FH 4JHWL 5EBGA 4YHZH 4HFUL 1CD1B 3H3PH 4FZEH 1VPOH 5GS0C 3BH8A 2EEDA 2HT3D 4UI2A 4P5TA 4NHUB 5TDOA 2NX5B 5DD3L 4X8JB 1CD1A 4Z7VE 4AEIH 1MFBL 1L6XA 2MHAB 1KG0B 4ZFZB 1FBIL 3D69B 4PTTA 4PP2B 3F65A 3IJSA 3BEVA 4TPRH 5HYSA 5JQ6L 3DROA 4M7KH 2VXTH 5C2BL 3LHPL 1LE9A 4P2RE 4P2CG 4MA8L 4DGVH 3SOBH 4JVWA 2OS7A 4Y4FB 4LSQH 5EB9A 1ZT4A 4PRHD 4B7LA 3O2DH 4GAGL 1WZMA 2OSLB 2W0FB 1G7IA 4R2GC 3J7HA 2GUOB 3LIZH 5I74B 5L2KE 3PQYB 4RAVA 1W0YT 2JF1A 4ENED 1Q9KA 1YY9D 4P23B 3M07A 4RMTA 43C9B 4R7DB 3JV6A 1N4XH 2CKNA 1CE6A 4U1IA 1MRCL 4NQSB 2FX7L 4FQCH 4NCC2 5CMAB 3VFWA 2C4FU 2CLVA 1FL6A 5AAWA 2XFXA 3V5DA 2FLRT 4OFYA 1CFQB 1FC1A 1AR2A 4GS7B 4MZ3A 1F4WL 1YEHL 4LF3B 3GHBH 4R4NC 4KZEL 5ANMA 1ED3B 2I27N 4PG2C 3PWPD 5IMMB 3IAGC 2QSCH 3TBWB 4ODXB 3S4SB 4L8SC 1IGYB 4JRXB 4PRIB 4ZYKA 1KEGL 4PJXB 5F96H 2Y9RT 3GSUB 3T8XB 4Y16C 4GJTB 1T1WA 3OG6B 2VUYA 4MB4A 4PJCF 5DVOA 3PXJA 1C16A 2GW5A 3ULUF 2NY1C 4ISVB 2FL5B 5C0JA 3IU4H 5BV7C 4ESKA 1SEQH 1CDIA 3OKEB 1YY9C 3MBXH 3F7VA 1IGIH 2OK0L 4NM4L 1HWGB 3LKSB 3RY6A 4AENA 1S7QB 4HKZB 5TH2B 3MQIA 4UDUB 3BPNC 2VZSA 4XXCC 4D8PB 2BX5A 1HHGA 2XZQH 5J9PB 1TPXB 3CDFA 3EHBC 3LKNA 1IARB 3S88L 5HVFB 5T3ZD 3KPRA 4ZFZA 3RVWD 1W8NA 2FJHA 4Z7OE 2EKSB 4D9QD 4MYWB 4EI5C 5HYJB 1RJCA 3GFUA 2BK8A 5LVEA 1EEZA 3IFOA 3QEGH 5F6HJ 4IBLT 4OQTH 5KW9H 1CBVL 2GJJA 3STLB 3WE6B 4GLRH 2UZXB 3CK0H 3MZTA 4PRIE 5I66A 3UTTD 3V2AR 2PO6D 2BVOB 5E6IC 2AK1H 4KGLA 5FO7B 2BCKA 3V52H 1GGIH 1T83C 4NKIH 3FRUA 4R8WL 4WVRA 4M93C 1X5YA 2FX9H 4DOHE 3RUGA 1A1NB 3RWCA 5K59E 2IAMA 3QULB 4F3FB 1MIEL 3WXWH 2Z31A 1F90H 2DM7A 4MQSB 1EEUA 5AYQA 1HEZB 2X10A 5DRZB 1CFVH 3QCUH 4I2XB 4JQVA 4OZIE 4X9HA 4WFHD 4LPCA 3QIWD 1DUYB 4WFFE 1ZKAA 3T0ED 1F00I 2OP4L 1FIGH 1XF4A 3QJHB 4Y5XC 1JPFB 1PG7W 1QSED 3HE7B 4XNQB 5FECB 5CJQH 1JPTL 4JVPA 1JRHH 3UJTL 5FB8A 3HN3A 3EDKA 1U8NA 3H9SA 4GRLB 3GMPA 4M6AA 4JFEE 1INEL 4ZNCD 5IHUH 5K9JH 2OL3A 4J23A 1BBDL 5DMGD 2D7MA 4I18A 3O6FB 3QIBD 4Q6IA 3PGCB 4B5EA 3NH7L 3U2SB 3CH1A 3HPJB 2FGZA 4FFWD 5HHNA 5GJTH 1C5DA 4XNYH 2HT4C 3OG4B 4RDQG 4BH8B 4NC2B 4GSDL 4JY4A 4DOHB 1ZGLA 3MRIA 4OFKA 5IQ9A 3U46A 5A2KH 5IVNA 3HZMA 1BMGA 4LPWA 1F4HA 1UXWB 3MUY1 5I1HH 5DWUL 5DJXA 2GEEA 1R3IH 3PQYD 4ZSOE 5JPNA 3PHQB 5JXAL 5E08H 4PY7A 2B2XL 4GOSA 1UGNA 5B39A 2WIIB 1JCKA 3VFMB 1MJ8H 3WLBB 3QUXA 2EICA 2ZOLB 4CU7A 1GGCL 1HXMA 3CFKA 4HSQA 2XIDA 3S96B 3MCLL 1KXQE 32C2A 1F3DJ 3TBTA 5HXMA 3OZ9H 2QSCL 1FP5A 5IMOA 3P9LA 5DJYA 1CCZA 3NH7H 5BQ7A 1UZ8B 2WAHA 1A9BA 4UOJA 1TCMA 2SEBA 2QSQA 1LO4H 3E3QC 3O3DB 4GAYB 3SGDH 3VDCA 3VRJB 1IAMA 3G6DH 5JOFA 3BSZL 1MHHA 3MV9A 1OP5H 1JPFA 5KVFL 2VLJD 3CSBA 4FXKB 1SBSL 1E4XH 2XZCH 2WBWB 1D5XB 3GUTA 1S8DB 4UINH 1Q9OA 2ESVD 4XB7A 5E08L 4KXZH 3HI1A 4FP8L 3RPKA 3R06B 5C3LD 4OB5L 4N90E 4NKMA 4OCXH 4JG0L 4WDIB 2OJZL 5DJ2A 4YHNB 4JFEA 5CJOH 1V7ML 2FNBA 4TPRL 4IEFB 3Q6GH 2I9LB 3FZUC 4WO4A 1IRAY 3GMMB 1NGWA 1RUPH 1A6AA 4QHLA 2E6QA 1Z0NA 1I85A 1ZHBA 5DF0A 5AZEL 4XI5C 1NLBH 2XICA 4NQDA 4ZSOB 5AD0A 4HIXH 4RGND 2VLMD 4LLMB 3QUZD 1X5FA 5C0BA 4F9LA 3WL9B 1MF2H 4MNQB 4CDHA 5I66B 4WUKH 3FJTA 4L3ED 1I9JL 1CICB 2DICA 2FHFA 1J87A 4HHAB 5DD5L 4RFNC 2J8UF 1WQVT 1TJGH 1MFEL 3O0RH 3NIGE 4MB5A 4AMKH 1OCWH 5GGTL 5D7IE 2QQKL 3H2WA 5I16B 3P9MA 1N0LA 2VDMH 2XQYG 2Z0BA 3EO0B 1FZKB 4XCCH 4ZUVB 4KMTL 4HWUA 4YR6A 3BO8B 3VXUA 1MHHB 4HPYH 2PTVA 3MV8E 3BGFC 4Y1AD 1GGBH 2XN9E 1OTUC 3VXNB 3QDMA 1S7VA 2H9GB 2EDNA 3G9VA 3GDBA 1A9BB 3KYKH 1QSFB 1MCPH 4K55A 4PRPE 1KN4H 3S35H 3SE3A 4S1RL 3HG1D 4E41B 3BP6B 5KSBB 1YQ2A 4HCRL 3DIFB 3ZDZE 3OJDB 4OLYL 4W4OA 5GRVL 3DO7B 2J2ZA 1QFWH 5D72H 5K59F 3SQOH 2OTUB 4KUCD 1DE4B 3E0GA 5C2UB 6CGTA 5F7EL 1CDCA 3HZMB 3KPSD 3EYFA 4JN1L 4YPGA 1CVSC 1QKZL 3DBXA 1AO7D 1IGYA 2Y06L 1RUAH 3QCTL 4AEHH 3QXWA 5HDLA 1QUNA 2VDKL 1NLDH 2VQ1A 3DGGB 1SYVA 3NCEB 5ADPH 4OZGE 1A9EA 2AV7A 4A6YH 4HPOH 4DGIH 4OI7A 5D2LE 4HMDA 1R5VA 1RZJH 4LLYA 1ITCA 3VMOA 1TJHL 3FO2A 2P5WB 4PS4H 3BZFA 2LU4A 4OLWL 4ZUUA 2NY2D 3FT2A 1GOGA 1P53A 4Z7NE 1RJYB 5MHSE 5F3BB 5F71A 2X7LB 1HI6A 1RZKL 5CJBA 2W60B 1FGNH 5GGQH 4TTDD 1YJDC 4WFGD 1UM4L 3IFNL 3ZKQD 1CK0H 4M3JA 2BMKB 3U4EB 4NO3B 4YDIL 4IMLA 1TZIB 3NOIA 4GUPB 1Q9LB 2Q87A 3LS4H 3TESA 1B88A 1DEEA 3UPRB 1M7XA 1T1XA 5LGKA 2GTWA 2EH7L 2J88L 4I8DA 3ULUE 1YJDL 3M1BA 1FYTE 1M7DB 1PZUB 3BEVB 4R2GD 4PPTA 1WGOA 3QNYB 4PRBA 1OLLA 1L7IH 5T5FH 3N85L 3B83A 5CD3B 4ZTPH 5IQ7H 2JIXD 3PE9A 3QIWC 3KS0H 3EYQD 4RMSA 4ERSH 2XA3A 3FFDA 1ZVSA 4R3SA 2PYED 3C5JB 4M6OH 1JHLH 5IFJB 4OM1L 4UINL 3OB0H 3ILQC 4ZO8A 2IAMC 2GJZA 4QRPB 2EYSA 3S7GA 4WTXA 3RVVD 4H26A 4ZO6A 4PGZA 3I75A 5EU7C 4M1GH 4NNYA 5LKNA 1FFOB 4W6XB 1WCQA 1JGLH 4C58B 2P5EE 4JPVL 1U91A 1VHPA 1INDH 4M5YL 3UTTB 3VW3H 3O9WB 4XNYL 3ZTJH 3BIAX 3W5MA 2EKSA 3UO1L 4OCNC 3FCTB 4PJFF 5JQ6H 2AJYL 2EC8A 4MDJA 2RHEA 4PRBB 3KDMA 4XVSH 3BE1L 5FO9B 1EAPA 1YN6B 4Y16B 5BO1L 2JELL 1JGDB 3UTQB 1MFBH 4XP6L 3EJJX 3MREB 1OP5K 5E00B 2K7PA 4GMTL 3EYQC 3RVUC 2W0KA 1PW3A 4L9LA 1MUJB 1GHFH 5EO1B 1UENA 2FL5A 3FQWA 4TQEH 3VFTA 2G75A 5DJ8A 3HUJE 5I1DB 2BMKA 1IL1B 2YA1A 3MRFA 1ES0A 5C0EA 4U6YA 1TVBA 1QBML 1RIUH 1JK8B 3ZKND 3RWGA 5CJXA 5TE4L 2VXUH 4HS3A 3FQTB 5CSBA 1OW0A 3QRFM 2EE9A 4HWEL 5C07D 3ZSSA 3IU3A 4FQXD 3GHBL 4JO2H 1N7ML 2YPVL 3RGVB 4PGBA 5JHLL 4JFHE 4R0LB 3KPMA 4K94H 2D31B 4WHCA 5I19H 2R4SL 4GKOA 3AU1A 5C09D 3VWJD 4OLVH 5F89A 4LKCB 5E8DH 4GW4A 2JJVA 2BSTB 3N1MC 4BZ2L 3WDJA 3OR6A 4F7PB 5DMYA 1NEUA 3DETC 3AMLA 3VWJA 3QDJA 2F8XC 5DJDA 1NGXA 3D2UB 1DUZB 3IS1X 4M43H 4EI5B 1DSFH 1OPGH 3RX8A 2O93L 3MV8B 5T1KD 4XMLH 1RUML 4ZPTA 4S11A 1KIQB 2PYFA 3EYVB 2CXKA 4IOIB 2AEIT 1AGCA 4M93B 3MRFB 3P0YH 4OD3L 3RFZC 5IVXB 1N5YH 3KJ6H 4LSPH 1HSAA 3N1GC 1QR1A 2NXYD 3O3AA 5D6DC 4Y2DD 4HFWA 3D9AL 3VRIB 4GBXB 3DMMA 4F9PA 1LK2B 2BNQE 3S5LG 5DYOB 3VA2C 4F7CB 1F3RB 4GRWB 3IJSB 1E6JL 2BOBB 3RVXD 4PTTB 3IFLL 5FO9A 1FNHA 4I13B 4XTRC 3EFFB 5D8JH 2G5BB 5HGAA 1P4LB 5I30L 1T7ZA 3T0WA 1OVZA 5IB2B 4HAGA 1J88A 1OGAE 1TZGL 3ME0A 3KWWA 2HTLC 3SGJA 5JW4Q 1JNHA 3HFMH 3L5XH 1LWRA 5EC2A 4M1DL 1KJ2A 3ZDYE 1RVFL 5FCSH 4KVCL 3MRCB 1T5XA 2L7UA 4R97B 5D1QB 4Y19B 4R4BA 5DD1H 1AJ7L 3F58H 5EOTB 1MCQA 4K8RL 2Z92A 4GRLD 1T2XA 2HTKC 4PRHA 4LLUA 4PV8A 1LP9B 7CGTA 4N0FB 4Z6AT 1T66C 4OUOA 3OXRB 2BNRB 3IAQA 1FH5H 4L8DA 2ZUXA 4P4KA 2V9QA 1TMCB 1FFRA 1ZLUK 5SV4A 3BZ4A 3MRRB 1ETZB 3RUGF 5KZCD 3GSRA 4XPFH 3G5VA 3QQ3B 4GMSH 3ZT6A 2BNQB 3OKDB 3CVIL 4L8SB 5F7YC 1NEZG 3MA9H 4EI6B 3FOMA 2V6HA 3TJEH 1ACYH 3LKPA 3MNVB 2CKBL 3UPCA 2Y6SC 4NT6B 1ZLWK 1AJ7H 4ZAKB 4DGIL 2RB8A 5F7UA 5CEZE 3VXME 4ZAKD 5FDWB 4HIIB 4LKXA 1WAAA 2ADJB 5FKPA 4HUUB 4XNZC 5M95B 2BVQB 1RY7B 4LEXL 5SWQA 3WDIA 4H88H 1BBDH 4HH9B 4PG2A 2XN9A 3H0TA 5F93C 3KPQB 1CGXA 1EDQA 3WV0A 3NIGF 4L8BB 2KH2B 3CDYA 1X5AA 3FFCA 4PGEB 1T2JA 1X4XA 3M17A 2F5AL 2X4UB 3DURA 2PXYA 3VFMA 3C9NA 5J12C 4AY0A 1H8OA 3VRLE 4OZFA 3L5HA 4Y5VA 5CGMA 1P6AB 5DWUH 3PWVB 1ZA3A 1IC4L 3QPQC 5DHVA 4JQXC 5TDNB 2RFXB 3NBNA 2CUHA 3EO1A 4ZDHA 4LL9A 5IG7A 1H0DA 4JRXE 4Q74A 1SMAA 1KENL 2IPTL 4P2QA 3A6OA 3OAYK 3VI4E 2O5YL 5KSAD 2IGFL 1H3XA 1WFTA 3NFPB 3QUML 1BIIB 1OHQA 3L95A 3ZDYF 5JXAH 4AIZA 2DLHA 3DGCR 4WGWB 5H2BB 3BIBX 5C7XL 3RAJH 4XXDB 4FQIL 4KJQC 3HE7C 2ENSA 4RGNB 3ZTJG 4O4YL 4PBVC 4HGMA 1OP3H 1DLFL 5D7SH 1S78C 1W0WB 3BKML 3B6SB 4PJ9A 1VFAA 3UAJD 1MJ8L 4FP8H 3VG9C 4F8QA 4HWBL 3O2WL 2QQLL 4YIQA 5GGRA 2H45A 4OD1H 4QOKB 4PJEB 2OCFD 1JZ7A 4LOUC 4KK5D 5I16A 1OARL 3HI6L 1B9ZA 1CFSB 3OJVC 3JVGC 4RGMC 1IGTA 1X5XA 1ZT1A 3IFLH 4BQ9A 1GSMA 3BZ4B 3HR5A 4OB5H 3BN9C 4CKVX 4EBQH 4DW2H 4POZD 4OCMC 1MJ7L 5EA0L 2H2PD 1E4KC 4JVUA 3TFKD 4UT9H 1DQDL 1K6QL 5FYKE 3QFJA 1RUPL 1HHJA 2WIMA 3U9PH 4M61A 1TIUA 1KIRB 3TVMB 3SPVB 3C6LA 1FO0B 3MV7A 1T3FA 3GJFH 5AZEH 5JIPA 1UJ3C 4KRNA 2BHYA 1A7OH 4CMHB 1NGPL 5D9SA 2A83A 3BKYH 4GLRI 4LCIH 3QCVL 5JHDB 5E7BA 1I8MA 2HMIC 5BOZG 3ZE1F 3CXHK 4L4VE 3CU7A 4KFZC 5I8EA 4I77L 4FQLL 2AXFB 1JPGA 3MA7B 4UTAL 1RURH 1MCRA 2B5IC 4UV4L 4XHJD 2IC2A 4N9GB 5GGTH 3ES6B 3EGSA 1CN4A 3TWCH 1JWMA 5DQ9B 3C2AH 3KYKL 2HA1A 4WI4A 4MNHB 3KHQA 2BOBA 1KTDB 4LSSH 1OW0C 3O8XD 3JWDL 1FLTX 4OLUH 5KSAA 4M6NL 5KTEL 3CMGA 2NW3A 3G5YA 4FQCL 1WEJL 4R9HA 2E7CA 2ATPA 5FYJH 4UTBL 5C07A 5CZKA 2BOCB 3TBTB 3W39A 3ZL4L 2V2TA 5IVXA 4HLZH 3QXDB 1KNOB 3VXSD 3X17A 4QRRE 5BS0A 4IRJB 1QOKA 4JZJC 4UTAH 4WTZA 3OB0K 3O4LD 1JRHI 4ORZC 3PHQA 2IADA 3MZGB 3GSUA 3F5WB 1AGFA 1H8SA 2LU3A 4X6DB 1U8KB 1P5VA 1V3MA 3CAFA 4U1KB 5ICZB 5IQ9B 3UZEA 2EDEA 2X44D 5INDB 3DV6A 3NCBB 1TITA 1BAFL 4XHJC 4Y5VB 3PWUB 3VXRD 5EU4B 4LSDA 5DJ0A 4XVTL 4OD2B 3EYOA 5FYJL 3GK8L 2C3HA 4G6JL 3MOAL 1CD0A 5DC4B 3E6HA 2P5WE 4L3CB 3QPQD 1HHIA 4LCWA 3WFHB 2X4OB 3WO3B 1P4IH 1OGTB 3MLTA 4UT7L 4HZAA 1S9VB 3TNMA 3GSOA 1U8NB 3VGFA 1NLDL 4ZPVA 2A6IB 2WBJC 3NPSB 5EOQL 2O5YH 4PTUA 1PQZA 4KJWD 5KSUB 2Y07L 4OZHF 1MWAH 3P2TA 4MAYA 3N06B 1HKLL 1HQRA 4RX4D 4MCYA 4DUXA 3UTQA 1LO5B 1MAKA 4QHMB 4PP1C 5SWZB 1B0WA 4WU7B 3CLEH 1KFAH 3FQXA 1QHOA 1KIPA 4XBEL 1A6WH 2IH1A 4DUVA 2F54E 3NA9L 1Q0YH 3HLAB 3FCTA 4LEOB 4MMZC 5IMLA 4HK3J 3KPLA 4TNVK 4ZUTB 4EI5D 3OPZH 4HWBH 5EBWB 3SDYL 1AD9A 3FFCD 3BEWA 5DRWA 3HR6A 3J8F7 5ANME 3MYJB 4CL7A 1RUQH 2IAMD 3VXSB 3HI6H 1QLRA 1YDPB 5LJYH 2Q8AH 5GZOC 1HHKB 1Q1JL 1XGRA 3P4MB 1FJ1A 1KJ2L 4X8XA 1EERB 1VACB 1OTUD 4PRNA 3MMEA 3GRWA 3TZVB 4Z0BL 1IAII 3UTOA 4DW2L 2P46B 5EC2B 4MS8C 1G6VK 2J1KA 3CCHB 1KOAA 3SKOA 2AK1L 3LN5A 1K4DA 2B0SH 4ALAL 1ZAGA 3V79C 4EXPX 3FTGB 1A7OL 1U36A 2AABH 3PJSB 1FNSL 4PJFA 4LLDA 2R2CA 4UOW1 4WHDA 1F13A 2ZP0T 1C5BH 4PJEE 1DBMH 3L5WA 1MJUL 3QRGH 2CSPA 2R29L 2DKMA 4U1SA 4RGNC 3RVUD 4EEEA 4B50A 3QAZB 1KJ2H 4P9MH 3T3PE 4UIMA 3W0WB 3G5ZA 3U30C 1N26A 2H2SD 2YK1L 1P5UA 1EO8L 1DANT 4CW1A 1JNJA 5F9DC 3VFVA 3HHRB 4I3RL 2EH8L 4KROB 4NPYB 4LHUA 3DWTA 5I75B 1HYRC 5D6CA 5DD5H 3KLAA 3NCCB 1NMCC 5FGBC 3QEQE 1VKXA 4M02A 3QB7C 4FQHA 4MDIB 4PJ9C 3B3IB 1G6RL 1CLOL 3RWIB 4UIKL 3B2VH 3KNBB 1NCDH 4LVOC 4BFGA 4RIRA 1TTUA 4Z7WE 3LHPH 4JGMA 1WBXA 3RGVA 2ICWA 3IFPB 1ITBB 3GBNL 3RBGA 1OSZA 3ARVA 4KAQL 1ZLVK 2X2YA 4JZJA 5CGYD 5GS2H 1OAYH 3WUWG 3TT1L 3CDCA 5AG9A 5MI0B 3UEZA 3A6BH 4JFXA 1BM3L 3HNSH 5K9OA 2AK4D 3DLQR 2JCCE 4U05A 2PTUA 4U1SB 1T04A 1GC1L 4XNUH 3FAXA 1KCSH 2JK5B 1WVZA 1DL7L 3AC0A 3FO1B 3ZTNH 3MMEB 3ULVL 2VAAB 4XP5L 4UT7H 3MRHA 1MY7A 4GQ9L 4L5FL 5ESVB 1IC5H 4X5WB 3X11A 4PJCE 4X6BB 1XF5B 1FNGB 1A3RL 5FYJD 2J5LC 5CP3H 1X5LA 4X6DE 2OTWA 4KTEL 4PJ8C 2ID5A 4I3SH 5EUOF 1XMWA 4R0LC 1F2QA 5ETUB 3MRJB 1AGEA 3HZVB 4J3WA 1CI5A 1NCCL 4Z0XB 3TWCL 3ARDD 3KPPA 4XX1G 5BVPL 3S5LA 5T3XL 4PJ8A 4Q9CA 1KIPB 4Y5XA 3ZKNC 4GRLC 2YC1A 5KSVB 4Z76A 2VLLA 3QJFB 1E6OH 4JGUA 5D1XB 5FGRA 3O0RL 3O9WC 5D8JL 2HG5B 4FFVC 4K9EL 4QTIH 1GCFA 3CVHA 3PWPA 3C5ZB 5CWSB 4G6ML 1WIUA 4YK4B 4JDVA 1UC6A 1HINL 4NQDB 1T0NA 1A3RH 4MD4B 5FM4A 4NM4H 1I7RB 3O6FD 3MYZA 4WO4B 2I9LA 2W38A 3GSOB 4NJ9H 2WK2A 2HJKB 3SDXA 3W9EB 3X14A 1CZ8H 1JWSA 5LCVH 1PGRB 4BZYA 5TQ2L 2J5LB 4JANB 4DEPC 5F7NC 1JWUA 2YEZB 1FH5L 3G04B 5TF0A 1QFWL 5D72L 3TV3L 2X5PA 3JWNC 4QRQA 4LBEB 5EOCJ 1W72A 2EXWD 4LIQH 3ARQA 4ODWA 4MAUH 1AO7A 5CLWA 32C2B 3BQUC 5FUOL 1F6FB 1JI1A 4ELME 4P9ML 1MJJA 4MNGE 3BZDA 2DQEL 4OZGF 2BHUA 1T20B 5CINL 1SYVB 1JHTB 2FLBT 3DV6B 4MXWL 1FIGL 4QGTA 4AH2B 4QHNB 5ENWA 1X4YA 4G8GB 4ZDHB 5KSAB 4G5ZL 4AQOA 1T1ZB 4KPHL 4U1KA 5ICZA 4EIGB 1U92A 3HPLA 3LH2L 5F7EH 2HN7B 1AR1C 4OGAD 4G9FA 2A6KA 3AM8A 4KXZI 2E7HA 1U8MA 4KTYA 4XB8A 5BS0B 4YNYB 4NBZB 1R3LB 2EEBA 3I85A 4IS6A 4XNMB 3WIIL 4UUJB 4IHOA 4JDTL 1RIUL 3UTZB 4C59B 4S1SH 4JPWL 3GMPB 4KI5E 1Q1JH 2CKBA 4NNXB 4OZHE 2EO9A 4FHBD 3OAZK 4UNUA 2FJFB 3VXNA 5BZWA 3QNZB 4R96A 12E8H 1QSEA 4HKXA 3EOTL 1BF2A 2VR4A 4G80A 5E8NA 3A6BL 43CAA 3G04A 3RJDA 4Y4KD 2JIXA 4Z8FH 1BX2B 3EUUA 5JW3L 4PJHB 4J3OC 3W11D 3OJMB 4OI9A 2IH3B 1II4E 3BISA 5T3ZH 4UQ2B 4JFQA 3RX7A 1DFBL 2AVGA 4GKZA 3U6RB 4PR5B 5IB3A 2YMXH 1OD9A 2ADFH 1MLCB 3L9RB 1KB5B 1NGYA 5C9JB 2W65A 2ZOKB 1L7IL 3H9HB 2EDBA 3MXVH 2CMRH 4ODHL 4U49A 4NQVA 4XC1H 1ZGLP 2OJEB 1XGPB 3ZKMD 3H9SD 1EV2E 4H0HB 5GGRY 2XZZA 1N6QL 4CN4A 4Z76B 4I3RH 5GISL 5B8CC 1R5WB 2E27L 3ZYIA 1NGQL 5DURB 5HJ3A 1WZ1H 1AH1A 5FHBH 2D7NA 1L9NA 2GJ6A 4JO1H 5C1MB 5KBNC 2VR9A 4HUVA 1D5XA 4UDTA 4M1GL 3JUYA 3B4NA 3N50A 4ONOA 3S6CA 1AD0B 1P2CB 1TLKA 4NN6B 1D5IL 3GSNH 1AHWA 5MEND 3KPRE 5EUKA 2A6KB 1CVRA 4YXHH 5IW6B 2WNGA 3HZKB 1BOYA 5K93A 4OCXL 2HWZL 2I9TA 4RRPG 2DJUA 1C08A 1YYMH 4XGZB 3CFCL 4PJAA 1JTTA 4MVBC 5BQ7B 4HDIA 3L3IB 2JK5A 3ZLQC 2XZCL 3MLSH 5E4EB 3UDWC 1I1AB 1MCKA 4P46D 4RMUA 5ALCH 2HFFA 3CFKB 1J0YA 1MFCH 2FIKB 4ETYA 3ARSA 2PXYB 3ABZA 3GBMH 2GSIB 1T1WB 2QQKH 4BH7A 4AEFA 5FGBA 4PJBA 1KC5H 1W72B 4K7FB 1EBAA 5ITBL 3Q5YA 1V8HA 2VISA 1ZGLB 2R23B 4HUUA 3PUCA 2BSTA 4HIIA 3MCKA 4LKXB 5FM5M 3RZCA 2DM4A 2EDJA 4PJBE 4J8RA 3B9DA 1PZ5A 1A7NL 4LCWD 4O2FB 4BK5A 5DHYB 4LPVA 3FFCB 4WHTA 1A7RL 3HE6D 3IU3B 2AQ2A 2OXGA 2Z8SA 4YXLH 2RCSL 4M4PA 4KHXL 3BT2H 3VXOB 2XN9B 1JNNL 3TC9A 2XWJB 5A3ID 4U0RB 3DX7B 3EJYC 5J6HA 1IAKB 4NC1E 4BYHA 3CFBB 3UJIL 4D9LL 4S2SA 1OPGL 1QKZH 1BHGA 4JN2A 1UKQA 1UM6L 2KUTA 4XAKE 4L9LB 3WJJA 3MC0A 4P46B 3CZFA 1DUYA 1PSKL 3RU8H 4CU6A 2VDNL 3QHZL 1UVQA 4ONHB 2YXMA 3RWDA 2FRGP 3TZVC 5MEQB 5JXEC 1RZFL 3BDYH 1HN1A 5E8EA 3REWA 4HCRH 4P3CL 2Z8WC 1UCBL 1GPOL 1A0QH 4OT1L 3BP7A 4L4VA 4QNPE 3K2UL 4FQQA 2LAAA 3JBG7 5LGHL 4PRAB 1FVCA 3TNNA 4GG6F 4OCSH 4CVZB 5TFSH 3FRUB 5JORA 3NA9H 4OF5A 1AXIB 1XT5A 4HS8L 1JJUA 1FFOA 4LVEA 3ALWA 4QKXB 2VZ3A 4TNVF 1UKSA 2R2EB 1IKNC 3RPIA 4GXUM 4ZUWA 3EJYD 5L2JA 1G7LA 1KELH 1AGBA 1I1FA 1G9MH 3LRSA 4RISH 1KYOJ 1FGNL 5GGQL 2NXZD 3UROR 3D6GA 5D5MB 3DVNB 3SBWC 5D7SL 2DQIL 3LV3B 4DK3A 4KVCH 3ZDXE 2CUMA 4YHLL 3QDJD 4TUJA 4JFFD 1QR1B 2XYCA 1JNHB 1ZHLA 2A38A 3SJVE 1HCVA 4MZ2A 3ZHKA 1AD9B 2HRPL 5DRXB 2FDBP 2DJSA 1OAZL 4EUPG 1H3GA 3SDAB 3ULSA 4DN4L 5TFSL 3EFFA 2XA8H 3MV8A 4H88L 1G1CA 5T1MB 5SWZA 4EDXA 5DK0A 5BJTB 2UZIL 4GAJL 5IQ7L 1FPTL 1WBXB 5GGVY 3VMPA 5DSCA 1IT9H 3T65A 1N2RB 2JJUA 4NSKB 1I7ZA 3U9PL 2AEPH 4S2SB 1UH4A 1FORL 4K3JH 2YPKB 4PLKC 1YEJH 3U7YH 4YHMH 3D3VA 4Y5VC 2BSSA 3VFNB 1WAAE 3NGBC 1W72L 2W07A 5GRUH 3GSWB 4F15B 1UH3A 2DI8A 3OKKB 3BPNB 4YE4H 4YDKH 5EN2B 1OGTA 3MLTB 1F45A 5E99L 4M7LT 2VL4A 3HRPA 1MEXH 5I1GH 3QDJE 4RGOH 3KLHC 4QXTA 2XA8L 1WZKA 4MD5B 2B20A 1AGDB 4G8EA 3RKDC 4GW4B 5CP7A 5LBSH 1IFHH 4M5YH 3QIUA 2VQ1B 3DGGA 3PL6D 4XCYB 4P5KA 4APQA 3KPMB 2FIRT 3BUYB 1KEMH 2D7QA 4KKCC 1FL6B 3IKKA 4JJ5A 3WFDH 5L0QC 4Q9QH 4LNVA 2EYRA 2GFBB 4QCIA 5ACZA 3V6OC 1OAQL 1CL7I 1XGUB 1WEJH 1U42A 4P99A 4FQJL 5FUZH 5SX5K 1G0XA 3CUPA 5I18H 2R0LL 1CR9L 4EN3B 4JKPL 4Y5YB 1WIOA 3OKLB 3W39B 2V2TB 3MR9A 3IRZA 2PUQT 4KK6C 4ZXBC 4XC3H 4BK4A 1J18A 3C5SB 5ISZA 5D5MA 2ZJSL 5GJTL 4GMTH 3MLWH 2W9DL 2EXYD 1EEYB 4BZ2H 4OZIF 1RZ8B 2V5SA 1G7LB 2XOTA 5J12B 2GJZB 4ZUWB 5HHVH 5DQ9A 1BFSA 2ZNWA 3ILPB 2FZ3A 1KPUB 3SDXE 4X4ZA 1BM3H 4AEIL 3VXPB 5HYJE 4NYLA 4YFDB 1NBYA 2DWDB 2VRAA 2MQCA 4FQJH 5FUZL 3STZA 1I9RH 5SWZD 1BBJA 3RU8L 1M7IA 5DQJB 5GS1A 2JB5H 2DQCL 2CO7B 3MJGX 2AXGB 2YOCA 1NC4B 1IQWH 4KUCF 4WW2F 3RWHA 2PO6C 4I0CC 2FSEA 1IGJB 3OQ3B 4PJDE 2K7QA 1YY8A 4ONHA 3WL9A 5FK9B 1NFIB 5IHLB 3INUL 5C0FA 4MVBD 2GQHA 4YDJB 4JR9H 3P4OA 4BUGA 4QY8A 1JYVA 4DAGH 4MHHG 2IALB 5CBEA 3T4YA 4JY6A 3KPTA 1ZHBB 4WEBH 1MLCA 4KMLB 4LVOB 2FX7H 3C08L 3ZHDA 2ITCB 3GIVB 2XWJA 2A9NL 3VGGA 2AGJH 5F3BA 3QAZC 1HOCB 1TZGH 5HGHB 3SKUD 2NY0B 1N3NB 1SJEB 1NBZB 1B6DA 1HHIB 1U3HD 2NR6D 1X7QB 3JV4A 2W0PA 1IZKA 5JTWA 5I75C 3K0WA 4J1UB 4K71B 2Q3AA 1GZPA 4F2MA 3B2UC 4OGXL 3AY4C 2GIYA 4CMMA 4EOWH 4PJGB 1U3ZA 4OBSA 4LNRA 1CG9A 4ZQKA 3SHSA 4NJ9L 3BD5A 5MENE 2X7LA 3BD4A 3BVNB 5DD1L 2PO6B 5CJ8A 1WF5A 4M9PA 3F5WA 5L6YL 2E6JA 1Q0XH 1MAML 4AIZB 2I07B 3HMWL 5JZ7D 5D70H 4ZOCA 3UJIH 1GIGL 3ARUA 4N1EA 2LTQB 3WFCL 1DDHA 1INQB 3ARWA 1QSZA 2P48B 3MTRA 1I1AA 3H9SE 5IGXH 1MRFH 3TH2T 3C60A 4LOUD 4NN5C 4RBPH 2MQ3A 4TUOB 3SJVB 2DQEH 2ZCKL 1WBYA 1YMMB 5FV1L 4NBYB 3QDME 1E4XI 5AUMA 3PWVA 1Y6NR 4OKVA 5DQDL 4H20L 1C1EL 4G5ZH 2QHLA 4CMMB 2Q6WB 3IXAB 4OCSL 2HFEB 5GRYA 1MJJB 2F9BT 1A2YA 5LGJA 3LCYA 2MKWA 1MPAL 3PV6B 5EIQA 4KJPD 2DKSA 1DLHB 1N64H 4KPHH 1NFDA 4Y89A 2CKBH 1JZ5A 4J2XA 1FNEB 5MEPB 3I84A 5D9SB 1MLBA 3A6CH 5DI8A 1JUFA 1J1OL 2OQJB 3DX9B 3LVEA 1M4KA 5CLTA 3HC3H 4NNPH 1CTOA 2YEZA 1QNZL 1CGWA 3LDBC 4OLXL 4ZMAT 3MNVA 3VWKA 1PG7H 3RA7H 4PJHE 2CDFA 4YO0A 2R69H 4XPAL 1C12B 3NMEA 3B9AA 4PGJA 5DJ6A 1J12A 5J8OA 4PR5A 2VN7A 4YZFE 3AMKA 1F4XL 3SDCC 1CFSA 4OQ1A 5IESL 3I3BA 1I7RA 3DSNA 4LGSB 3O6KH 4OIIH 4GG6E 4A6YB 1VGEH 3E8UL 1P7QD 3WS3B 1G9NC 1AQDB 1F3JB 3DVGB 4QYOB 3DOSA 1NUNB 5D71H 3D1MC 1V5JA 4KKBD 2VWEC 3VRJA 2G9HA 3SQBA 3H7LA 1QSEB 4QHLB 3RY6C 1W72H 2DOCA 5D93B 1OP9A 5D1QA 1AE6L 2CDEA 1ZANH 5E9DA 3KHOA 4NNXA 4O58H 2EH7H 1TETH 5JUEH 4GXVH 5H2BA 4APQC 5KJRL 3ZT7A 3V5HB 1Z9LA 4MJ4A 5T5FL 2VDRL 2X41A 4OGYL 2UUDH 2E8ZA 2HT3C 1N8ZA 1NCCH 1DQLH 1LMKA 1U58B 5ESAA 3PXHA 3KPRB 2VZOA 1ZLWH 3X11B 2HJLA 1RK0A 2R0WL 2P8PA 3MRHB 4UT6H 5IBUB 3ARFD 3U46B 2SEBB 3FO1A 2HJFA 1WT5A 4FQXA 3STBA 4IRJD 4ZTPL 4QTIL 2XWBB 5L8LB 1FV1B 2R2BA 4X6CA 4F80A 4E41E 1MJUH 1EZVY 3QRGL 5CZXC 2NY0D 1EFXB 3PGCA 1R0AH 1MI5A 4FTVE 4LIQE 2XG5A 4B53A 5C92A 1ZLSH 5AEAA 3VH8A 3TIDB 3F7YA 4O9HL 4KH2A 5EN2A 4K3EH 4DGYH 2EDRA 3MRQA 4XCEA 3B9KC 2R56L 3MCG1 4N0CC 5F9WB 5T33L 2FYYA 4WFED 3FB5A 5DEFA 3HNSL 4MCZA 3L7EB 4M6ML 4HX1B 3TV3H 1XGQB 3C2AL 4KRPB 5E1AA 3HC0B 4PGBB 2LE9A 3KYAA 1TFHA 3VA6A 2CLVB 2DQDL 2ZPKH 4LVHB 4JGJA 4YWGL 3CDGB 4ZFOA 5I17B 1XFPA 3BKJL 3NCFB 5MERA 1IKNA 1PKQE 4XCFH 5IVOA 4EVNA 5FYJE 2R0ZH 5HHPA 3TLRA 4Y4HC 3RWCB 4YBQC 5HHQA 2N4IA 4Z18A 4R7NA 1BQHB 1K8DA 1PKQA 1BFVL 1M71B 2AXJA 1LE9B 4YHYB 5AWNL 1A7RH 2H3NA 5DURD 4LRNH 4EQ2A 4PJ7E 3OR7A 2CDGB 4JREB 4MQ7B 4N9OB 3U7WH 1UM5H 1PEZA 1QBLL 4CVXB 1RFDH 3WIHH 5DQJA 5GS1B 3WJJC 3LKRA 4QOKD 5H8DA 3KPPB 4CU8A 1TTGA 3Q5OA 1IC5L 5F72S 2W91A 1X3DA 1LO3L 3ZYJA 1JZ4A 3IJHA 4N0YH 2X4PB 5JQHC 5H94B 4AIXA 5GSRA 2AAVA 4Z5RA 4XVTH 4P57B 5T1LB 1BQLH 2NY3B 1M71A 1U3YA 1AFVL 3UXFA 3OKLA 3EDEA 3C6LD 5B3NA 4QF1A 2CLRA 4BKLA 1F4YH 4HKJA 3EYSL 5CHNB 1VFMA 2VZTA 2X4RA 3PHSA 5E4EC 4KI1A 4ZFOB 4WU7A 3ARDA 3SN6N 4RZCA 1CE1L 3OHXA 4KQ4L 1TDQA 1Q0YL 5E24E 1E6JH 4D9RD 3MGTA 4IOFD 1HCFX 2PN5A 5DUMH 2AJZB 3CZFB 1J1XH 4XWOC 2NY5C 3SO5A 4Z7QF 3OKEA 4ZS6C 4XVUC 4JN2B 1TQBB 4NO3A 3SE8H 1Z9OA 3CXHJ 4KU1A 1FQ9C 5TF1L 3RWIA 3B3IA 4WW2C 1U3HB 2X4TB 2AEQL 2AI0H 2EIZA 2R23A 4P59H 5BZDB 3T2QA 3WHXA 2XT1B 2ZUUA 3TNMB 3CFDB 4KROC 3BW9A 2UWEF 3KG5A 4FQ2H 4JRXA 1U2CA 4PB0H 1FNSH 3AAZB 4DKEH 4U6XB 2C7UB 4JFPB 5J4MA 2J3SA 4S0SD 2OXHA 5EG6C 3ISWA 4OZGB 5FDYA 3WHE1 5E8PB 4MJIA 1NCUA 5HYSB 4TTGA 1L0YA 3FFCE 1KPRA 4Y2OA 1QSFD 4LEXH 3ZE0F 3CVIH 1BFTA 5IROA 4E42B 1JPST 2ADGA 2F54D 2VAJA 4JO4L 2XKNB 1R5IB 1N8ZB 2CO6B 3N1PC 1G7IB 1KNOA 3LQAH 4UDTB 4Y1AB 4NRYB 4ETQA 1AIFB 2COQA 2BOCA 3H3KA 3BXNA 3IYLW 4BZ1H 2QQQA 2ZUVA 1WV7T 4YXKH 2P43B 4G42A 7FABH 4PRNB 1BPVA 1IM3A 4BSVB 1CFTA 2FEEI 3WIIH 3LRSB 2OZ4A 3NAAH 1S9XA 5E6IA 4X7EC 3TH3T 4M8VA 5E2TH 1I9RL 1RHHA 1L9MA 1Z5LA 4QYOA 3P0YL 4N9GA 2E9IA 3BIKA 3LQMA 2C1PB 5TDOB 2YKLL 3LN4B 4E0RB 1R24A 5DJAB 1MCCA 3QT2A 5EOCH 1JYNA 4NP4H 4ZNEA 4NZDA 4HIEA 1NUGA 4DN3H 4KHXH 5DC0A 2FECL 2O61A 4ELMF 4GG8B 3C6SA 1C12A 4X0KA 2CIKA 2J6EA 5TDPB 3W0WD 2EIBA 3FHAA 3MRGB 1T1XB 4LAQH 3UPRA 4XBGB 3GJFB 1LP9E 4KJYA 2ZOKA 3U4EA 3MBXL 4PTUB 1JUFB 5KSAC 1I7UA 1QG3A 4L29A 1Q94B 1A6AB 2HKHH 2JJSA 3D0VB 3TBSA 3L1OH 3O2WH 5IB5A 2WWKO 5J06A 4GQ9H 1NFDB 2GK0B 3U0WH 1VFBA 4WI2A 1XIWA 1RI8A 1EXUB 1XGYL 3GHEL 5JO5A 1UWEL 1KUMA 3AFLA 5DHYA 4ZS6D 4QRTB 5E95B 5LGHH 5D1ZC 1FLRH 3MRLA 1A9EB 5EU7E 5F21B 1JTOA 2IPUG 4PJ9B 1CBVH 3MCLH 4F58L 1D6VH 2A9NH 5IWLA 2R1WB 1E0OB 1OTTD 2IMNA 3UTSE 4X4XB 4NKOA 3OAUL 2NY6D 1UCTA 3FO9B 3QI9C 4P46C 1B90A 3VH8B 3BAEL 3PDOB 3WUZA 2IADB 2F74B 4AEEA 1XCQB 4LASL 4EBQL 3GMQB 3QNXA 1IGCL 3VFGL 3QUXC 3HMXL 1E27B 4GW1A 4Q6IC 5KVFH 3WDHA 4OF3A 2GJ6D 4X80H 5J13C 3GMQA 5KSBA 2IANB 2R2BB 5AWNH 1NBVL 3L3IA 4HDIB 3NFSL 3TO4C 2DBJA 3P73B 4WWKA 1BLNA 1MELA 2NX5E 1ND0A 4XPBH 1KIUA 4EKXA 4FQLH 2UWEA 4JQIL 1C5DB 3OAUH 2VKXA 2WP3O 4PJGF 1P4BL 2UUDK 3SDCA 1WISA 4O2EB 1CXHA 1WIPA 3L3DB 1X5ZA 5CUSH 4XVJH 4K7PL 3Q3GA 5F1IA 4PS4L 1ZSDA 1NFDF 1MHPH 4Y4KB 5DQDH 3ALPA 2HLFC 2W9EH 4Y8AA 3UTSB 1C1EH 1BVKB 3MXWL 1A7BA 2AJVL 1T3FB 1X44A 3EFDL 1XGPA 3IAPA 3TVMC 4C83A 1I7TB 2NY6B 4B7IA 3DRTB 3L3KA 1TZHB 4M61B 4HT1L 3UJTH 3BPOB 1NCTA 5FXCH 3TT3L 1YMMD 1SMOA 4Z7VA 1RZ7L 3G5XB 1S7XB 5CILH 4QXUH 1SVCP 1MFDH 2HT4D 1OAKL 5D7IA 7FABL 3X14B 4KK9D 5GRWA 2X05A 5IB3B 3RI5K 2VMFA 5FHAH 4WW2B 3DVFA 3IDUA 4G8FA 4JHZA 3TP4A 5D7IB 2X1OA 3BHBB 3V4UL 2Z31B 2LAGB 3S36X 2CDFB 4LPYA 4NN6C 4YO0B 4YHLH 3STZB 5KS9B 4JRXD 1S8DA 1CDHA 3DTXA 3NZHL 4JKWA 2AJXH 3AB0C 4R26H 5DS8A 4N0FA 3K2UH 1QYGL 3SKJH 2OZ4H 2F5BL 1PY9A 2H32H 5IOPA 1NAML 4LU5H 2BY2A 5EOTA 1EA9C 3W81A 5BZWB 4Y4KA 3JV0A 3OL2A 4HD9A 2E3VA 1AI1L 2GTZA 2DJ4A 5HDBF 5JR1L 2XTJD 4CAGA 3ESUF 3JV5A 1KB5H 3MRJA 1MCWW 3IFOB 4X98A 1Z6JT 4O02H 3OJ2C 4E42A 3HAEB 4PY7B 3PGFL 4TSAL 3VCLB 5DJXB 1TNMA 4ODHH 4Y5YC 1KENH 3VW3L 5TPWH 4F7CA 3UO1H 2RFXA 3FRPG 3T0EB 3QHFH 3VI3F 3WLWD 2XNAB 2ICWB 4QLRA 5A2IH 4AH2A 4ONFL 2D4FA 5C6TL 1G7HB 5FYLH 3T2PA 5IMKB 4RIRB 4YHIB 3HCVA 5F7DA 1DANU 1A5FL 4JHWH 4HBQA 5JR1H 2X4UA 3BGMA 5H37H 5LAXA 3FO0H 2FJGB 4WI8A 4FTVB 1MRDH 1TCRA 2CLZA 4D3CL 1Z2KA 2FEDD 1F2XK 3H9SB 4GRLA 1FL5A 4KTDL 3KPQA 4W4OC 1I8KB 3RI5F 3VU2A 1YECL 2X4TA 5E2TL 2YA0A 1CG9B 2YPKA 4X6DF 4KY1H 3I9GH 2DMCA 4HFUH 2FB4H 2RR3A 1QFPA 3MRLB 5IEKA 4D0BB 1PBYA 1A7QH 2CXGA 4KHTL 5I8OL 6FABH 4JANA 1J05A 1CGUA 4GRWH 3JWDC 1OB1A 2H32B 3BPOC 1IZJA 1Y0LA 2YA2A 1LK3L 3FOMB 3C60D 3MBED 3O2DL 3V8CA 1J5OL 4F9PC 1A4JA 3MACL 5HGHA 2H1PL 4OIAA 4PG9A 3ZE0E 3FTGA 1Q9KB 1NC2A 1R3KA 4FFVD 4ZFGL 1IL1A 4DZ8A 2FH6A 4C54A 2D7TH 4U1GC 1QRNA 1WCBA 1IM9A 4XCFL 4N0UA 5GQBA 2HWZH 2BNQD 2DQFA 2A6DA 5GHWL 5E7FA 1P7KB 3QWRD 4JFDA 3I02B 4EXKA 4ELMB 4URTB 2ICWJ 3MLZL 1CU4H 3LKOA 3P4LA 5KSVA 1T5XB 4FZ8H 3CC5B 5DUBB 3DI3B 5L2JB 3ZE1E 3V95A 4OCRH 5TE6H 2HFTA 5J7CC 1K2DA 1BBJB 4LHJB 3UTTA 4BSJA 3U0TA 1NGZA 4RNRA 4P5TC 3BEWB 1FVCB 1RFDL 1UQSA 1BQUA 5CEYB 5HGAB 4G6AC 2FJHB 4OLWH 3Q6FB 2B1AH 5JPMA 1J86A 3CC5A 3P4MA 3NVQA 5C09E 1RZKH 3IXTB 3T1WA 2V2XA 4EN3C 4JRWA 5FA4A 3CXDL 3WIHL 2ZSVA 4JFHD 3TYFA 5FOJA 4N0UB 3VFGH 2IFGA 5C07E 2EXWC 5IJVA 5KSUA 2AJXL 1RZGB 5BCAA 2YPLB 1NH6A 4EN3A 5SX4I 1IAKA 1PSKH 5CIPH 4PJAF 4EVNB 2R69L 1A6TA 2VQUA 1KIQA 3DXAD 2DRUA 4PREA 3QNYA 2NY5L 3GSNB 4JZJB 5HI4C 5DVLA 3ZDXF 2WQRA 3M1BB 5IFAL 4Z0BH 1OB1B 4ZOBA 3KPOA 1YEKL 3ARTA 5E1AB 5HGBB 3MLYL 1CXFA 1D5MA 1G9ML 1Q9LA 2ESVB 3RTQD 2NXZB 4QHKJ 1P4BH 4M8QB 4Q2ZA 3KNBA 4U1HB 5CP7B 1FNFA 2ICEA 1ZVHA 1MH5A 3HTLX 4OM0H 4WI5A 5CCKL 2CJUL 2WV3A 2P5ED 5D6CB 5TF1H 3WFHA 5DMKB 1AGFB 1H8NA 1CGTA 5C0CE 3WHXB 2ZWLT 1AKJD 4J4PD 5I8KL 4H20H 4S0TD 3R0MA 5A1AA 3L3JA 2FIKA 4JE4B 2V7NA 4ORGA 1T7YA 3QIWA 2MCG1 4J3SA 4R2GB 5FO8A 1G1YA 2WLYA 5JDSA 1PAMA 1F8TL 3TYGH 2BSRB 2PYEE 3GSQB 3EYFB 4XP6H 4PP2A 3ARDB 1L7TH 2X89D 2DQTH 3GO1L 3V0VA 5GJSL 1OP3K 1PJ9A 3V6ZB 4Z77A 2QSVA 4TOYH 3NABH 3S35X 3ALXA 5ID0B 1KLUA 1FYTD 2OR9L 4PBXA 3HE6A 3QG6B 1ZTXL 2NY1B 1KTKE 3ECBA 4YGVB 5T1LA 3N1FC 3I75B 5D1QC 1FJ1B 1U8JA 2VLKD 3WUWA 1CF8H 3DECA 3IDIB 4RGOL 4WNQB 4WFGE 25C8L 4NRXB 4ZS7H 1BVZA 5E8OB 3VFUA 1JVKA 3VXSA 4K71C 4G9FE 3VDAA 4KZDL 3H7BA 1QQDB 1YUHA 1I8LA 1OAXL 4FXGA 1UA6L 3TO2B 2NMSA 4XPTH 4HH8A 3A6CL 5EBWA 4D94A 4PRAA 1NGZB 4JG1H 4RNRB 5C8JA 3RNKA 5DRNB 3NPZB 3SGEI 3IDNB 5HYIA 3WFDL 2VE6A 2PR4L 5H37G 1IGFL 4JZNB 1KXVC 5I1KH 2VERN 5DJ6B 1DBKL 3LRHA 2VOTA 4NFCA 4U6VL 3QQ9D 4GAGH 5IFHL 3SPVA 3G6AA 3RL1A 1AO7E 2JIXB 2CGRL 3KPSE 5HGDA 1DQQB 5IF0A 1EHNA 1FN4B 4XXCA 5C3TA 3UYRL 3ORJA 4ZS7L 3VGAB 1MRCH 1MRDL 2FATH 4H1LB 5ABDE 3EZJB 4Z8FL 2Z91B 1G7QB 2EXYC 1P7QB 3QEHB 1Z3GH 3ZKXB 1IGTB 4HXBL 3JTSB 4QEGA 3CDGA 3P40A 3UTZA 4PJ5D 2BDNL 2IQAA 1KYOK 4YHOL 2DQCH 3MJ9L 4PRPD 3VD5A 4O2FA 5D96B 1ZEAL 2AP2A 3GHEH 4KHTH 3PWUA 5K9QI 2XN9D 1MNUH 4M1DH 4P9HL 2N1KA 3MV8D 2V5MA 3PIQB 1ZLSL 2Z31C 2B4CL 4XCEB 2A6JA 4XC1L 1YC7A 3FMGH 4JG0H 4YPGB 5KVDH 1NAKH 2ZCHL 1GYAA 4L3EA 4XX1E 1H3UA 1UJTA 3AXLA 1AY1L 2VLRD 4LSTH 1AFVH 2DQUL 3S9DB 2NY1D 2P1YA 5C09B 1RULL 1G0DA 2X4SB 3QUKB 1XH3A 4H5SA 3K7UA 4JRYB 4GRMB 3TCLB 3LKQB 4E5XB 2I07A 4NUGL 1NCAL 3MPCA 3EYSH 4IJ3C 5D7LB 5F8QC 1G9NL 4X6EA 3T0DA 3DSFH 2VLME 4KJPC 4OBRA 4RGNE 1WFNA 4RWHA 2P8LA 5IW1B 4PJAB 3RIAF 3VXMA 1S7TB 4M00A 3KYOA 1T5WA 1NBVH 4F37K 3SDCD 1LD9A 4DFIA 1ORSB 2DLGA 1JWMB 1U58A 1RD6A 1I3GH 1MCHA 4TRPH 4X80L 4Z95L 3OGOE 1NPUA 5EU3B 4WWKC 3V5HA 5H35A 4N90D 3VGBA 3VDBA 4V1DA 2OL3B 4J12A 4M62H 3P0GB 2ESVE 3OTTA 5FOBB 1SY6A 2E8YA 4YX2L 4LRNL 1IEAB 1GGIL 4OF6A 4JQXA 5IB5B 3WN5B 5HPMB 3OKNA 3PWNB 4FG6D 4NKIL 4X5XA 4JQIH 2PW1B 1KTLA 5CBEB 1U8LB 3QFJE 4S1RH 4X6FB 4UAOC 3T04D 3TBYB 1CL7L 3RVTD 3PG2A 1MHPL 1NDGA 2B4CC 2IPKB 5JLZB 5EORH 1LP9A 3G6AB 3RL1B 1KTLB 5C9JA 5D7IF 4IIQC 4L8SA 2I24N 1XEDA 1BFVH 4Y19A 4F37F 3PWLA 1Y18A 1X5HA 4NO0A 3CSYA 4G8FB 3TT3H 4K23H 4YK4C 5FYJU 4HIEB 1G7PB 3GJFK 5TQ0L 3GSRB 5ACMA 4UB0L 1J8HD 3PWLB 5IIEB 3ARED 4I9WD 3EFDH 4M1CC 4MA1C 3G5XA 3HZVA 3RWJB 2BNRA 3RNQB 1T0PB 5IB2A 1JN6B 3HS0A 4DQOL 5ADPL 2CD0A 1MAJA 4PV8B 4NQCB 2WP3T 5EC1A 1WICA 5D96C 1U93A 1BVKA 4NUJB 1M05B 1EGJL 1DJSA 3B5HA 3WN5A 5HPMA 2VKWA 5E5RB 1EHAA 5DHXB 4FFZH 3UBXA 1RAMA 3Q3GB 3F7RA 1KJ2B 5FUCC 4ZUSB 2J88H 1B0RB 2J4WH 1T4KB 1T04B 2AK4A 3ZSTA 5CINH 5J1SC 4Y5YA 5BVJA 4JFXB 2I25N 2XKNA 3MNZB 1RIVH 4PJFE 1IE5A 5D6DA 2GK2A 1KV3A 2Y7QA 4EI5A 4W68A 3P73A 1T1ZA 3MOBL 1MCWM 4HK0B 3T0EE 1BECA 4TUOA 4WFFD 5DMIH 5GRVK 3SJVA 4DKDC 1D5ZA 2ZKHL 5ICXA 4XHQA 3GMNB 3MJ9H 4WFHE 1OWRM 1PKOA 1G0YR 1S9YA 1T83A 3OZ9L 1NMBL 5TPWL 1BIHA 3AU1B 4GRMA 3TCLA 3NTCH 4E5XA 2DWEA 3TFKC 4GXVL 3AAZA 4R0LA 4NFDA 5CIPB 4QXTB 3QUYC 3LAFA 2ORBH 3PP3H 4H8WL 1AO7B 3PDOA 4DCQA 3D2UA 3NCJH 3IF1A 5C0AA 3MJ8A 3VFVB 2X1PA 2ARJQ 4PRIA 4BFIB 4IIQB 4PD4K 4U6YB 3JWOC 3V4VH 4OLEA 4NQEE 4WWID 4UBDD 3UTTE 4PRID 1FN4A 4AG4H 2JB6B 4HUKB 2QQNL 1DZBA 4R8WH 1OGAA 1FAKT 1VADB 4DKEL 4HEME 1F90L 4MGXA 2YMXL 2DTMH 3L5WB 1YEGH 1JGDA 3DYMA 1OM3L 1CDBA 3EOAA 5HSFA 3OBAA 4FABL 2P5EA 4D9QE 4LDOB 5DRNA 1BJMA 3V5KB 3V0WL 1H5BA 3UJJL 2EDYA 3TA3C 5KS9F 4NQTA 1K4DB 2I5YL 3VFTB 1RZGA 3JSSA 5TE7H 1JV5B 4U1NA 1MFAL 4HJ0D 4ZFFB 3G08A 2GSGA 4NP4L 4Z5RB 4YXLL 1TJGL 4OLVL 1YNKL 4G8GD 2RAMA 1ORQA 2EYSB 1U8JB 4U1JB 1NCWH 3QFDA 4XMKL 3WE6A 5I1IH 2X4PA 1QLRB 1YDPA 3ECBB 4YGVA 2R2EA 2YSSB 1BAFH 4NRZB 1HILA 1U3HC 4H8WC 1KLUB 3BKCL 4L9DA 3NCYS 3O3EA 2VXUL 5I2IB 4MA8H 4NQEB 4DGVL 1HILB 1K2DB 3VH8G 3CXDH 1SJVA 2AV1B 2YK1H 5KVEL 5GS0L 1TPXC 4OZIB 1WWCA 5F88A 3MLZH 3FQXB 4LSRL 2Z31D 2XQYK 4S1QL 2IQ9H 4X5WA 3KJ6L 4LSPL 5E6IB 4N1CA 2QADC 2WWMC 4TSCL 5FGSA 2YD8A 2NZ9C 3OXSA 2EEAA 4LSQL 4OLYH 3DMMB 1AXTL 4P46A 3I6GA 5EIIB 5B38B 5D2NE 2Q7YB 1Y6KR 1BQHA 1PKQB 3EJZC 1ZVSB 3O2DA 4N0UE 4C4KT 3EOBB 4U2YA 1PQZB 3SCMB 2NTFA 3ILQD 1H5BB 2D2OA 2C3XA 3DX7A 2DN7A 5L2KD 5DUPL 1HINH 2BVYA 5MERB 4WJ5A 3GMRA 1S9VA 3EOAB 2ERJB 1D7FA 4P3WA 1A4JB 3X12B 4PRHE 3L5XL 5J3HD 1MCFA 1NGXB 4JFZH 3EDDA 1FIEA 3FN0H 4MJIB 4IRJC 3BAEH 3FO2B 4NZTH 4U1MB 1FCGA 1XR9B 2MWCA 1B2WH 5I73B 5MP6H 4OZGA 1OGAB 3RP1A 2VLKA 4TSCH 2XY1A 1CXEA 1EVUA 4G8GE 4U6XA 4MDIA 5INDA 2E7LA 1BVLA 4LU5L 1FLRL 1VB9A 1MFNA 4PJXE 5C0DA 3FQRB 2QADB 5IBUG 3FT2B 3HA0A 1AI1H 1D5BB 4L5FH 1EVTC 4BH7B 1MH5B 4OFIA 4EUPA 4HWNA 4NHCL 5CCKH 1J8KA 4R90L 1NMBH 1Z0MA 2W0FA 4YZFF 3QXDA 4Y4FC 3ZKSD 3FL7A 3ARRA 3LD8C 3DIFA 2Z93A 5FM5O 2RGSA 4YHML 3SKMB 4NQXA 3JUZA 4XH2A 1ZT7B 1LO2H 1OAUH 3V9FA 3CX5J 5B3JE 4G7YL 4M7JL 3UTPE 3N9GL 3RJQB 4YGAB 3QUZA 4FOMA 1N5AA 2C9AA 3TBVB 3GSNA 4KDWA 4UB0H 3MRPA 2M26A 3ARBA 3D69A 3OAZH 4NQED 3U4AA 5BRZB 3TIEA 3WFBL 5C6TH 2X70A 4OQTL 1MVFA 3ULSB 5MI0C 5A2LH 1CGYA 4X83A 4X8JA 2VZUA 4HKBA 3D85B 4NHUA 4I5BB 5I9QB 2H8PB 1BEYH 1K3ZA 4RMVA 1MIMH 3S4SG 2Y6SD 4FQPA 2FHCA 1VGKB 1L0QA 3HC4H 4L4TB 4KMQA 3LKOB 3R1GH 2BY3A 1CGSH 4LLMA 5GGSA 3V6FB 5SX4H 4YR6B 4EDWH 3MYJA 3G08B 2UWEE 4I0PD 5C9KA 2Y4SA 3L6FB 3HZYB 4F7MA 4LLAA 1CTNA 3EAKA 4M6OL 1J10A 5KS9A 4ZUTA 5LQBH 5FEBA 3RHWK 1LK3H 1NC2B 1R3KB 1MRFL 5I71B 1A1OA 2HT2C 2Q1EA 4LMQE 1A1MB 2WWMD 3VGDA 1DVFB 3QP3A 1CQYA 3QPXH 5E2UL 1F11B 5L7XL 1F6LL 3QDGE 2ATKB 1GOHA 4YLQT 2A1WL 4ZFGH 1LEIB 3QQ4B 1J05B 1VADA 5B22A 4HUWA 4PJEF 4A6YL 1CDUA 1I75A 2WSKA 3B6SA 4HXAH 2NY2B 1UWXH 5J6HB 4JO2L 1OAYL 3RVWC 2Y5TA 1RZIA 5F1NB 4FQIH 1IEAA 2BVUA 1FE8H 2IMMA 5I17A 5CSGA 1A7PL 1RUKH 3AGVA 4AL8H 4JB9L 3UMTA 4I9WE 1BJ8A 1J8HE 4G43A 3GUTB 5LAXB 3NZ8B 1XGQA 3HKFA 4F15C 4TQEL 3MNWA 3GSVA 1BIIA 5D1ZB 4DK6A 1VA9A 2UWEB 5F9OH 2EDTA 1FVEB 4YFEA 2FYYB 5HI3D 1K4CB 2AW2A 4BQBA 5IW3A 4K8RC 3O3DA 1YJDH 4U1GB 4DUWA 1MSPA 3KXFB 3MO1B 4XZUA 3ULUL 4O02L 2LQRA 5BV7H 5IW1A 3VWKC 3QFJD 1ADQL 5DA4A 3WFZA 4K7FA 4QHNA 1DTUA 1IAOB 1TCRB 2CLZB 4U7SA 4LAQL 5LXGL 3W2DL 2VR5A 1JZ8A 4JRYA 4BQCA 4KJWC 4X9BA 2VXVH 3QXTA 2HLAA 2VQTA 4Y2DA 4I18B 3K80A 4KK6D 4DN3L 5JA8B 1XCQA 5D2NB 2AK4B 4HJJL 3H8NA 4AT6A 2VUOA 4YH6A 5DK2B 3RHWF 2VDOL 4L4JA 1N4XL 3QCVH 1MCLA 4POUB 3QDMB 1KCRL 1P84J 4PY8I 4DFHA 3PHOB 4PYGA 4KK8C 3HE7A 4XNQA 5EUKB 3HAEA 2F53D 5HHNB 1AHWC 4Y4FD 2E7BA 3AREB 5DEZA 4G3YH 1OF2A 1HKFA 4ZTOH 5LXGH 4LASH 2IQAB 3U0WL 3T0AA 3IVKB 2YUZA 1BZ7B 3C60C 1RURL 2WW8A 3O4LA 1P7QA 3QEHA 1HZHH 1FO0L 5JHDA 2VLRE 4JCMA 4GXUN 4D0DA 2E9WA 1MVUB 2P24A 4RDQF 5DD6B 4OJFL 3WYRA 1U2HA 2OJEA 5FYKH 1MF2L 1AQKH 3QFJB 4UOW0 3C08H 4XCCL 1OL0A 1T66D 3MRBA 3UTSA 3HC4L 1P7HL 1FFPB 4AJ0A 2CR6A 3MRCA 2NW2A 3QUYD 3MOAH 2LVEA 4ZTOL 4JFZL 1L7TL 2X1QA 4KMTH 3X3GL 4QRSB 3H6JA 4PJHF 4ZNEE 5HHXH 5C8JB 4PJ5E 3LS5H 2EDLA 3D0LB 3LN4A 3SDCB 3C8HA 1TJIL 1DEDA 5HYJA 3ZYOA 2PKDA 1B3JA 4MLSA 1BGXH 4ODVL 4Z7OF 3MODL 1ORSA 1S7RA 1CT8A 3BMWA 4TULH 1AQKL 2BERA 5ESVA 1MCJA 4JQVC 4D8PA 2FJFA 1CFTB 3LEXB 5F3HA 5F9JB 8CGTA 3C5ZD 4GRWF 4HGWB 4LLVA 3ULVF 4G42B 2QTEA 1XCTB 3F7VB 4POZC 3O3AB 3V7AG 5DEGB 4ETQB 2H8PA 1OAXH 4XNMA 1NKOA 3WO4B 3BFOA 4Q0XL 2V9RA 4MJ5A 5JW3H 4DKAA 4NIKB 2E5EA 4POYA 4P4KD 3NN8B 1DQMH 2Y06H 3QO0A 3W11C 4DZBB 1W0VA 4YAQB 3VD3A 1KEGH 4B41A 4PJXA 5DJDB 1RMFH 1T22B 2BSRA 3GSQA 1UB6B 3PP4H 3V4UH 3LZFL 4G9FD 4JY4B 3TN0B 2D03L 2F58L 3DX6A 4UU9B 4W81A 5ANMB 1ZWIB 2VLKE 2PTTB 1MFDL 3PABB 4JAMB 1OAKH 8FABA 1A22B 3WCYA 4C56A 1INQA 4L3AA 1UM6H 2XFXB 1RIHL 4G43B 3QNXB 3DUUB 4RRPA 3TJHD 1A6ZA 1MREL 3C09C 4Q0XH 2YD6A 1J1OH 5D7LE 4MQXD 3FQTA 1XAUA 3H0TB 3GSWA 1AP2B 4MS8D 4RX4A 3V6OA 3VJ6B 1G84A 3FOLB 4Z78A 3D3VB 2PCPB 3M8OH 4IOSD 1WTGT 5ALBL 5MENA 2BNUB 2Z4QB 1NFDE 1FZMB 3LZFH 1J1XL 1MUJA 1IEBA 1IILE 3CPLB 4FMFA 1T03L 4WY7H 3MRGA 5IB1A 2FR4B 1NMAL 3RDTA 5DTFB 3SE8L 1CICD 2NY4C 4JFFB 3V0WH 1J1PL 4KK5C 1K85A 4DGYL 4IOFC 4RZCB 4I2XA 2JE8A 4FN0A 3I6LE 2VXQL 3B9KD 1RK1A 3FN9A 1R3IL 3I3DA 2VZ1A 4GT7A 5C0CD 3OKYA 1XZ0A 4P5TB 1AC0A 1T0NB 3T0BA 3TO2A 1ZHLB 2H2PC 1SYSB 4MQTB 3HI5H 1NEZB 2X9XA 2VB5A 5GRJL 4MXVE 4PLOB 1G9MC 1MY5A 3BRGC 1KJVA 4Y19E 2XQBL 3QYCA 3IDXL 5KZCB 2WZPD 1HK6A 3HG1A 4YHYC 4PJ7B 3RPIB 4AL8L 2R8SL 2MHAA 3IDGA 2IF7A 1J5OH 4MJ6B 2OP4H 3CVHL 4GS7C 3T3MF 1EEZB 1E4XL 4ZD3L 5I8CB 5C0GA 2C1OA 5I1JH 2IBZX 3DXAE 1DBJH 2WM0A 2Q3ZA 2YSSA 4OSUL 2BXYA 2DLIA 2CUIA 2RCSH 5IVZB 3K81A 3MACH 4IMKC 2MPAH 3VD4A 3ARFC 1DR9A 4NZRL 5KN5B 1RV6X 5DYOA 2B7DT 2GTWB 1S7QA 2BDNH 4NN5B 4OI8A 4OF7A 1A7NH 3D85D 4MAYC 2D7TL 2JELH 3MR9B 1N59A 4XNXL 4OZHB 5MENB 3KS0J 4Y16D 2PCPA 2A6IA 2ADGB 1G6RB 1YPZA 1N7MH 2PYFB 1KJ3H 5GGVH 3QH3A 1CU4L 1KPVB 3VXOA 3PDGA 1GVIA 5DD3H 5F7HA 2XPGA 5TQ0H 3CFDA 3RL2B 3SGKA 1A6ZB 3QDJB 4WHTB 3HRZB 5DUPH 5B3JF 2E7LC 3BKMH 1BVLB 4IRSC 2D7OA 1IGIL 3CPLA 3ZL4H 1DL7H 2UYLB 4HZLB 4D0BA 3PABA 4JAMA 5HYFA 1IAIL 4CADB 3WNPA 4G3YL 4K9EC 3DX6B 4QGYA 4X6CF 2KQNA 3U30B 3N0PB 3B5TA 3X3FH 4IRZL 3BKJH 3BH9B 2VISB 2XI9A 3U1SL 1CE6B 4P0DA 4X6DA 1HZHL 4EIZC 3X12A 3KAAA 1JTPA 1LDPH 4HS3B 1NMCB 1JF1B 3BWAB 1FSKC 4TNWF 4F7EA 1ZXQA 5CHNA 4R6UA 3SKNA 4RQQB 4C56B 2ZSWB 5EA0H 1P6FA 3D9AH 3EOBA 3O11A 5IFAH 3RX5A 5INCA 5C0BD 4LCYA 5K9QG 4NO5B 4E41A 2H6PB 5D70L 1RQ5A 3T65B 1DCLA 1EFXD 4W70A 1JF6A 2NW3B 3BZEB 2HJFB 4LLVB 4Y4HB 4GRWE 2Z8VC 1UACL 1XF2B 3CIQA 4RWYL 4CVUA 3DYOA