4X6DF

Cd1a ternary complex with endogenous lipids and bk6 tcr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRYFLPTQGMGAFFGQGTRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1a
publication title alpha beta T cell antigen receptor recognition of CD1a presenting self lipid ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 241
sequence length 241
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x6dF02
1P7KB 5T5FL 3MSPA 1GIGL 1OAQL 1EK3A 2EDLA 1LP9A 4Y19E 5GS0L 3F6IA 2DTML 1RUPL 4NPYA 3V4PH 4QTHA 2F5AL 3WJLA 5ERWB 5C0IA 3B43A 4X6BA 2W07A 4KK5D 5LGJB 4O2FA 4NO5B 1AKJA 3AFLA 4ZQKA 2VQ1A 3TIDB 1R5VB 1HXYA 1KPRB 1IAII 4NQXB 1VACB 3JTSB 5FV2A 1JHKH 2RR3A 3SDDA 4G8IB 3KPLB 2B7DT 3V6ZA 4YXLL 5FOBB 4O2EA 3BYTA 4FABH 3KLHC 3UDWC 3VFTB 1C7SA 4P9HC 3HN3A 4OF3A 4X8JA 1WFUA 4FQIH 5EOQL 5HI4D 1N5YL 3U6RA 3MRDA 3U2SB 1S9YB 3BP5B 2A1WH 2VABB 3QUKB 4ZS7L 3VCLB 4NM4H 1KYOJ 3C60C 4X5WA 5FK9B 3O6ML 2NXYC 1QFWI 3MC0A 2BK8A 1LD9A 3MJ9L 4L9LB 2LQRA 1RZ8B 2EC8A 1NGWB 4PJHE 4XWGL 3FOLA 5KVDH 3BPOC 4G8EB 2P7TA 1MPAL 4I48A 3ESUF 1KPVA 1NQBA 4MAYC 1FG9C 5CJXA 1BQHG 5EB9A 4UV7H 1ES0A 4Z18A 3BOVA 2EYSA 3MYJB 4LQFL 4MQ7B 1CFTA 3BVNB 4MA7L 1MCLA 4GJTB 4H5SB 5J3HC 2FH6A 1CDBA 4B7LA 1ZS8B 4PIRF 1ZGLA 3C2SA 3R8QA 4P0DA 5J89A 4S1SL 2YXMA 4FZ8H 3PP4L 4ELMF 3S88L 1WFOA 5ID0B 4K8RD 4PJ5B 2O61A 4WIQA 4F3FA 4TULL 1L6XA 5I1JL 2NY7H 1CFVL 5HHQA 2Q7YB 4Y4FB 5CEXB 3PGDB 2IAMB 1LE9A 5GGRY 3U30B 2XA8H 4KJQC 4KK8D 2FB4H 3GGWB 3MRQB 4IM8A 1YPZE 4QYOB 4G7YH 1VERA 2DYPB 4G8GE 5HYJD 4O02L 1SM3H 1U8IB 4N8PA 5SWQA 4M1CC 2R23B 4XPTL 2HT2C 1RU9H 1WIUA 1JL8A 1XH3B 3O8XD 4I4WA 3MCLL 1FFNB 1E27B 3SCMA 3DURB 4DKAA 1NDMB 3FT3A 2P47B 5HDLA 5I19L 1UM5H 2XTJD 2OK0H 5TDNB 3PQYB 1NAKH 3AS1A 4QXUL 2PF6A 3QG7L 1A3RL 5LVEA 3L3KA 4FTVD 4JFYB 2H6PB 2VQUA 2GUOB 2F19L 3O4LA 5IF0B 3ARVA 4JFFB 4KMTL 2IPKA 5E8OA 5DA0B 1YNLH 2C1PB 1HH9A 4JJHA 3KXFE 4X6DE 5I6XC 1IJ9A 1J1XH 2B1HH 5ENWA 3MNVA 1KJ3L 3NABH 1T1ZA 1BOGB 3BP4A 3GEWB 3GKWL 1FNSH 1MCRA 3QA3B 4PJ8C 4QXWA 3L3OA 1N5AA 2HYMA 3M17B 3BKJH 5C0RL 2HH0H 3ZT7A 3MJ8B 4J12A 2Z8RA 1P4LB 3IFLH 3BZ4B 4WU7B 2SEBA 4EI5C 4OTXL 1GGCH 2R29L 1CIDA 5IVNA 2H9GA 5IGXL 1CGYA 4Z7UF 2ATKA 4ZOCA 3C60B 2MKLC 2XY1A 3LHPL 4WO4A 4X99B 4GS7C 1WICA 3QDME 2B1AH 1M7XA 3GSRB 1MAML 3DMMD 1YYLH 5IT2L 4Z7QF 4MS8D 4MAYB 4JFOB 3ZE0F 3AU1B 3QQ3A 3LIZH 3UTPE 5EBLB 3IDYC 5HPOA 2EE6A 4JZOA 1RZIB 3AM8C 4DK3A 2GSGB 1ZTXL 4BUGA 1X4XA 1DBBH 4HX1A 1MJ8H 3B6SB 4JG1L 2NY2C 1BP3B 1X6LA 1G0DA 4JO1L 3LRGA 1JE6A 3X3FL 1JHTA 1KCVH 2NY3D 3FN0H 5ISZD 1MCBA 1ZHNB 4QRRB 2DN7A 3CFKB 3JTTA 1UH3A 3G9VA 4OFDA 3ARDC 4UQ3A 4XPAL 1AXTL 3C08H 4OM0H 5L9DH 4KRPD 1F13A 1MHCA 3KPQA 2E27L 3TCLA 2VXTH 3IAGC 3LS5H 4GRWB 1R3HA 3MBEA 3BPLC 1FFOA 2AK1H 3HMXL 3Q6GL 1EXUA 1E4XL 3MRFA 1NC4A 5I1DA 1DDHB 1NFDF 2VLKD 1T2QH 2H41A 1B0GB 2F74B 1UFUA 1AR1C 3LKNB 2YD9A 3UTOA 1E6JL 3QR2A 4HIIB 3BFOA 3ULVD 3FFCD 2QSVA 3HNTH 3VGBA 4XVSH 4P46C 4N0UE 1WUNT 3FO2A 2HTLD 3ARBC 4LBEA 2YPLB 2PR4L 1RUQH 3WIIL 1YEKH 4CMMA 1MHPL 2V5TA 1SJXA 4OD3L 5DDHB 5I6XB 1Q9LA 4I18A 1LHZA 1A4JB 2CDEB 2WQ8A 4JY5H 5DTFB 4U6YA 4NNYA 3MROA 4PJ8B 1YJDC 1L7TH 2B20A 5DRZB 1YYML 1GC1H 3G04A 3MZTA 3V6FB 2IALB 3LMJH 3UJIL 5J9PB 5HJ3A 2NY1C 3QNYB 2UWEA 5JOFB 1MRDH 3EYQC 2QQNL 2CUMA 2CSPA 1ED3B 5H37H 1T66D 1QBBA 4GS7B 3BGFC 4RISL 1ZVHA 1JGUL 3QWQB 5HVWA 2PYEA 4NDMB 5CWSB 3TVMA 4LCIH 4KHTH 3RA7L 3HG1A 3IJHB 1RZKH 1P1ZB 3FRUA 3BP6A 4M7LH 4GSDH 3UTSE 3C2AH 1RIHL 3IDYB 3MA7A 3VXSA 3F7VA 1YC8A 3B9KA 4WTXA 1CFNB 1MCQA 4YDKL 4LEOA 5GSRB 5BV7C 1OGAB 4OFYA 4PRID 3ROLA 2NY2B 4PB9L 2FJHA 2FGZA 5IB1B 5EUOA 1G9NH 1UA6H 3TBWA 3DVGA 2WIIA 1WLHA 1KB5B 2VDQH 2Z4QA 3ARDB 4K94C 2EDYA 5GGTH 4X4XA 1MCSA 1XF3A 5T33L 2DI9A 4C57C 3BPLB 1FVCA 2B4CC 4ODXB 2D7TL 1ZT7B 2E9WA 3GSVA 4UDTA 5JQ6H 4TUKL 4Z7NE 3CFEB 4M7JH 3AY4C 2Q87A 1MELA 1V7MH 3HMWH 3FO1A 3QUZC 5T3ZH 5E2VL 3QDMB 2Q8BH 3S7GA 2X9WA 3ZTJG 1UQSB 5HVHB 3MJ6A 3VGEA 4GG6F 4M03A 5D5ME 4P46B 3JWOC 4G9FA 5GGVH 1G7LA 1MI5E 3MRKA 3BP7B 2EKJA 4NFBA 3H7BA 4MNGA 5FECA 3C8KA 3ARBB 5GGSB 4GKSA 5FO9B 4XNQA 1AJ7L 1ETZB 3ES6B 3E1F1 1Q9OA 2ARJB 4R0LC 1MHHA 3MX0A 3C5ZA 3S8WA 5CJQL 2OI9C 1H3PH 3D0LA 1Q1JL 1FV1B 1YNKH 1DL7H 4XNMA 4H25A 3MLYL 3TYGH 3HE6A 1G9EA 4F57L 5IEKB 2W0KA 3QUXC 4L8DB 4OLXH 1OSPH 1FO0L 2PO6D 4PJBA 3TNNA 5E8PA 3H3PH 3QEUA 3QQ4A 4YK4B 4OV5A 4ODVL 3BGFB 3K80A 1HHKA 3CUPA 1ZGLP 3BWAA 4HC1H 3IDNA 4P23C 1IRAY 1KPUA 1YY9D 4L4TD 1R0AH 2XWTA 1WISA 5IMOB 5J11C 1SJHB 3WE6B 1AC6A 1GGBL 1LO4L 4JRXD 5EOCL 1YECL 4LKXA 3OKDB 4LHJB 3BHBB 4OZ4B 5JW5B 1KFAH 5BV7B 3HE7D 3TESA 2ZOLA 1CXLA 1FZMA 1EJ6A 2IPUK 4DTGL 1A6WL 3BH9B 3NPSC 5I30L 4LSVH 5SWSA 5L6YL 1QNZH 3S35L 3O9WA 4P2OA 3QUYD 1OQOA 3OKNB 4O51B 3EO1A 4YUEL 4G5ZH 1W72H 5MENB 2AJYH 4CGTA 1HXMA 4EZMA 3K1DA 4PJFE 4Q6IC 5GZOD 1JK8A 3CFBA 3V0AC 4N1CA 2HJKB 1Q9KA 4Y5YA 2EDTA 4KROC 2AJZB 3ZLQC 3QUZB 3RKDC 4OI9A 5BRZD 3AGVA 4LLQB 4WI2A 4KI5E 5J6HB 1CQYA 1C7TA 4MHHI 3CD4A 4D9RE 2PTTA 3OXRB 4QRPB 3L3HB 3VFGL 5IG7A 5DUPH 3NFNB 1UM4L 1HSAB 5DWUL 1DBKL 1D5BA 5D7SL 2M2DA 2OI9B 2FCBA 5C0JB 4JLRA 4K7PL 4G6MH 4JFPA 2YXFA 3BH8B 4KK9C 3HZVB 1ZLWK 3VDCA 1QFUH 3U79A 5FGBC 4ZXBC 5IHUL 1Z9LA 4QF1B 4ZYKB 3MRJB 5J12C 3O4OC 1MCKA 1QPXA 2EEAA 4YJZL 3WFZA 5C0DA 35C8L 2HLAB 4R26H 1DLHA 2DWDA 4WI6A 1FSKC 4I77L 4NQEA 2FR4B 1I9JL 3DOSA 4N0RA 4I9WD 3HUJE 4OCXL 2HWZH 4DCQB 3HB3D 4MLSA 5HHPB 1EZVY 4P23B 4MCYB 2XYCA 2ZNWA 4FQ2H 4DKEH 5F21B 1JZ3A 2DJ4A 3A6OA 1J0HA 1JNHB 1S7SA 3TJEL 4XCCH 2Z8SA 1OT2A 4JRYA 4X7CC 1ACZA 1UYWH 1QKZL 5EA0L 2P5WD 5E08L 1PQZB 1U58A 3VXRA 1J7VR 1FYHB 4JDTH 3UAJC 4HJJL 5JDJA 1SJVA 3TN0D 3TGXA 1OM3L 3DJ9A 3LKOB 4PRDA 5E6ZA 1MCPH 5I1CH 4H0HB 2IANE 4OZGE 1FNEA 4MDIB 5J57B 4J3UA 1UXSA 4NHCH 5FUCC 2LVEA 2YBRA 4KJWD 1ZAGA 1A6AA 3WYRA 2R0WL 3NPSB 1WBZA 3DO7B 4Y16C 5I1IH 3RWFB 3QHZL 5AD0B 3ARGC 1NEZB 2O5XL 3TT3L 3DRTB 2HN7B 2ITCB 1FZKA 5TE4L 4PS4L 5C2BL 3STLA 2Q6WB 3B5TA 2NTSP 2W65A 4ZDHA 1IT9H 5C7XH 5KSUA 5JIPA 4Q6IB 3NACL 4OT1L 2XFXA 1CFQA 3TZVD 3D6GA 5BXFB 5FDWB 2WBJD 2F5BL 5HY9B 3W11C 4YHYC 2RQ8A 4KROB 4IOSD 4LGPB 5AAWA 5BVJA 1DUYB 5EZJA 5D1ZC 4K8RL 3AS3A 3ZSSA 2D03H 3MLZL 3MMEB 1AQDA 2IWGA 2FECI 3VWJA 5IM7A 3FOMB 4MD4B 2ZUWA 4J3XA 1EFQA 3CSGA 1KT2A 1FFPB 2IC2A 1ERNA 4YHOL 3O6LL 5L7XL 4KTDH 3SDXE 3QWRD 3BJLA 5A16B 1W0VB 3QIWC 4X7FC 4TTGA 1T7WA 3T4YA 4HUKB 3ILQC 5F89B 4YDIH 3L1OH 3KPRA 4OAWA 4KJYA 5AYQA 5EUKB 3UTZB 3JWDC 4JM2F 1IAIH 1FL5B 3PABB 5B21A 4HWBH 2EYTA 3ZDZE 1VADA 4WJ5B 3UYPA 3MRNB 4GUPA 4ZXBB 4Z78B 4OGAD 3HPJA 5J12B 3HLAA 1A7QH 3O4OB 5KS9B 2FYYA 5FHBH 1XCQB 3QCTL 4KJPC 1FSKB 4DFIA 4Z76B 4G6JH 5DD1H 5TF1H 1MQ8A 5KSBA 1J0KA 1GSMA 1X6NA 4AH2A 4LRNL 1CL7I 4XC1H 1DVFA 2VE6B 5KG9A 3I2CL 1M71B 1CGUA 1IKNA 1FORL 2HMIC 2P5ED 2UWEF 2V5YA 1JGEA 3FB5B 5F96H 1NEZG 2CRZA 3U9UA 1CXFA 4CW1B 2NNAB 1INDL 5D72H 3A67L 1BFOB 5HHOA 4OQ1A 3W39B 5AYUH 1I7UA 4BQCA 1DFBH 3LH2L 4DGYL 4KQ4H 4O58H 4XPGL 4KK5C 1ORQB 3DRQB 3OKEA 1A5FL 4CVXB 2B8OT 5F3HB 1FO0B 2R69L 3L7FA 3ALXA 4OFKA 4Y16B 1MCOH 4QT5B 5EDXA 2CLVA 3RPIA 4PGBB 4TSAL 3NPZB 1QRND 3MO1A 2ZCHH 5J06A 2ADJB 4JM4H 3CX2A 1INQA 1FL6B 2GJZA 4CNIB 5IMMA 1YA5A 5JXEA 1YN7A 3PHOA 1XGTB 4C4KO 2YPVH 4F9PC 4KY1L 4YHYB 4RNRA 4JKPH 1K3IA 5EBWA 1S7RA 1QEWA 1DE4A 2B5IC 3PNWA 5D1ZB 2NMSA 1U8OA 5J6GB 1HK6A 3ULUD 3O3DB 3FB7B 5DJZB 3NTCH 4K07A 1T5WA 1M7DA 1X5YA 3WO4B 4J2XA 3NGBC 2NYYC 2VN7A 4HFWA 4HIEB 3T4AB 4PG2A 1RJZA 3RDTA 1QSVA 3FQXB 4M4RA 1ZWIA 3GHBH 4PBXA 2GT9A 3WN5A 3QIWB 3VA2C 5J1TC 5EZIH 3T09A 3GJEA 3BW9B 1S7WB 4YWGL 4HXBH 3MUJA 5I1HL 4OD2A 3ULVL 4MB5A 3QH3B 4ZUUA 5MEQA 4NRZA 3IDJA 4JAMA 3MV8E 5DD3H 5DC9B 3EYUL 4HQQL 4JY4B 1SVCP 1FYTD 4K8RC 4ZPVA 1IMHC 1NDGA 4DZ8A 1TXKA 2C9AA 4L4VD 2C4FT 5D1XD 3MODL 3GMLA 1A1NA 3PWJA 5C09E 3S36H 4PGDA 4TUJB 5C0AD 3VXMD 4LPVA 3VFOB 1WEJH 4KK8C 3SKNB 1B4RA 1UB6B 1U8QB 3EFDL 3MA9L 2MNUA 1RQ5A 3O6KH 4K7PY 4YNYB 1U36A 2A9NL 2E3VA 3U1SL 1II4E 5H35B 3DXAB 2OCFD 12E8L 1MCWW 1RJLB 4Z6AT 5JPNA 5JA8B 4MWFA 3GRWA 1RSFA 2H45A 5FA4B 1OAXH 1T03L 3EZJB 3FFDB 2XTJC 5FGCB 1T0NA 2NR6D 1AXSA 1FAIH 2BZDA 3R4DA 2IPTH 3NIDE 1FPTH 5AG8A 3ULSA 1UXWA 2QSCH 1NC2D 2W91A 3C8HA 4R3SA 3CVHH 4HLZH 4HWEH 3E8UH 3WJJA 3P4OA 4XMPH 4PLNC 5JZ7D 4IS6A 2K9UA 5DLML 5DQJA 5D70H 5ESAA 1V7NH 4LARH 4OJFH 2BY3A 5CLWA 3GZKA 5D6CA 5FYJD 3KPSD 4R4FL 1WWWX 4KV5F 4XT1C 3JV4B 1LO2H 4HIJB 3QBTB 4LCWE 5DD5H 1X5JA 5ADPL 4M5YH 2B5IB 4JGUA 4UIMA 4Z7WE 5I1AA 1IGTB 2KPNA 4RMRA 4P5KA 2QLVB 5CBEA 4XCEA 3VRIB 3NGBB 3VD7A 1FC2D 4ZO6A 1ZSDB 3NIFE 3O6FA 5F1NA 3FB6A 4H88L 5JR1L 4KDVA 3GHEH 3WLWD 1K5NA 4MS8C 5IOPA 1J0JA 2JELH 4GBXC 5ANME 2QQQA 2CRIA 4O00A 3PHQB 1N4XH 4I0KA 5CZXD 4FG6D 2VRAA 5IW6A 4ZNEA 2YRPA 5FUOL 3RTQA 1IQWH 3SO5A 5HHVH 3VGAC 3TBSA 2NY3C 3RU8H 5C0BA 4QNPF 4S1QH 2BMKB 4YDJA 1AIFA 3SE3C 4E42A 3MLUL 4YHPB 3RVTC 5AWNL 4OGXH 3SN6N 3T1WA 4LL9A 2F53D 5HGGS 4EOWH 5HYJB 3WFDL 3GSWA 1NGYB 2HFEB 4LDOB 4YQXH 3VWKD 2XKNA 1IEBB 4LCCC 4O9HL 3WDJA 3KPNA 3ARRA 2KKQA 1D9KA 1SYVB 3ETBF 3MRCA 3I3EA 4WWKA 3TCXA 2H32B 1RJYA 2XTJB 5I8KH 4HGWB 3S3PA 1FC1A 2WIMA 4GOSA 2NX5D 2HTLC 1EDQA 1MRCL 1K2DB 4HPOH 4FQLH 4XXDA 2BNRD 1F45A 3OKLA 5DQDH 4NQDD 1MJUL 5HGHA 1EX0A 1Z9OA 4ERSL 3N1GC 1IAKA 4X5XA 4FQXD 4PY7B 1I1YB 2DJUA 4Y88A 1OAZH 4KUZL 5EBMB 1TETL 1JTPA 2IFGA 3J8F7 2OTPA 5DHVB 5JIKA 2CGRH 4RFEA 8FABB 4CJ1A 2Y4SA 4HUWB 2DKUA 4CJ0A 4OZIA 4I3SH 1N59A 1XGPA 3GIVB 2XZAH 3EO9H 5LWYL 4ODWA 1TJGL 3BRGC 2GQHA 2XWJA 5GGUA 43CAA 4JFHD 4P59H 2HVJA 1VB9A 2OZ4L 2NY5C 1YMMD 2QTEA 4PTTB 3GSOB 2R2BB 3W2DL 1RUKL 3GSUA 4OZHE 1CGWA 2DLGA 3H9SE 3DMMB 5DJDB 5EO9A 2XZCL 5IVZA 1BHGA 4GBXB 1G7MA 3GSQA 3U7YL 1IBGL 1VPOH 4LIQL 4APQA 5IVXE 2Y25A 2DQUL 4ELKB 1PKOA 5T1MB 2DQTL 5IW1B 4WFGE 4P48A 3VGAB 3DV4B 1IGJA 3QXAA 4DOHB 5K9KB 4WHYG 4KHXL 1FRGL 4N8VA 2NY3B 3O11B 2I5YL 5ISZB 2BCKB 5KZCD 1HHJB 4EDXA 4JHAH 1BBDL 3F58L 3ZE2F 2DWEA 4F7EB 4RFNC 4GQ9L 4KRPB 2DQJL 4WI3A 3REVA 1EMTH 3T1FB 3UYRH 5CZKA 1KLUB 1OY3B 3QEHA 5B38B 1U91B 4JO2L 5BS0E 4RMWA 2BJMH 3VXUD 4EXPX 4FA8A 1ZANH 2VR9A 2VLKB 1HIMH 2PXYA 1MFEL 4LCCB 3NA9H 4JDZA 4TQEL 4TTDD 1JHLH 4PV9A 4OLYH 3V4VH 1ROWA 1A64A 4BKLB 3WIHH 3FFCB 3AROA 4M3JA 3VD4A 4PPTA 4XVJH 3ZKXC 2BXZA 1T1YB 1BGXL 4Z0XA 1G84A 5AUMB 4Z9KB 1K8IB 1INEL 4OIIH 3EUUA 4TYUA 4R4ND 2XOTA 1XZ0A 3AAZB 1P4IL 4QHMB 1NCDL 4Y5XC 5IR1A 4E41A 3MRLB 1J05A 3FMGH 2AK4B 1OP5H 3BDYL 2HFTA 4H8WH 1U6AL 4I8DA 3RKPA 4FZEH 3WFEL 2HRPL 4JR9H 4OQTH 5MI0C 3T77A 2AXFB 3TO4A 4LSSH 1Q72H 1B0WA 4OCNC 3EOTH 4NKOB 5DVKA 4CDGC 5KAQF 1YDPB 4UBDD 1F6AB 3CK0H 4IOIA 5IBTL 1R3JB 1ZLUH 1OGTB 4L8CB 1AGEB 2GI7A 3O81A 1GOGA 3ZE1F 4N68A 5C86A 1YY9C 2ADGA 4EUPB 3EJZC 2V2TA 2ATPB 1MIMH 5D2NB 6FABL 1NBVL 3D18A 5D2LB 1RZFH 3VGGA 3PWVA 4NOFA 5A2FA 1A02N 1JIBA 1D5IH 4QGTA 1JV5B 2CMRL 4AEIH 3HE7C 3FQWA 4PRIB 5B38G 1U2HA 4NSKA 1WVZA 2ZKHL 4HS8H 1NUNB 4YZFF 1UJ3C 5B8CC 1JNLL 3QXDB 2R9HD 3MBXH 4DWHA 5BMFH 3MLTA 1YNTA 1OW0A 1ITCA 3L5XH 5D7LE 2YA2A 4G3YL 5BCAA 3CGTA 2E6QA 4OSUL 5ACLA 4RFNB 3G6DL 1MVUB 4ONHA 3QUYC 2WBWB 1DCLA 5F7HA 1A2YA 1JNNL 2FZ3A 1QD0A 1MREH 2XNAB 4FXGA 8CGTA 5DZLA 1QYGH 4P9HH 3SKOB 1A1MA 4OKVA 2D0FA 4OIBA 3UBXI 4GFTB 5JO5A 5EIVA 4RBPH 4M9PA 1P5VA 3LZFL 3LEVL 2ORBL 1L0YA 5EG6C 1I8KA 4XP1H 3OR6A 3ZKXB 4CU8A 5DRXB 3NCYP 3ORJA 1AXIB 4JG0H 3LRHA 5J1AB 4XMKL 3S96B 1PYWB 3P9WB 3DETD 3ALPA 4PUBH 3S34H 1FIGL 2ED7A 5E5MB 2PN5A 1E4WL 1O5DT 3PXJA 2ADIA 1Q0YH 3M8OL 3MR9B 5TQ2L 4G80B 4J4PA 3QO1A 4NZTL 4EUPG 3BN3B 5IB5A 4LLYA 5TGBB 4N5UA 2DF3A 1DUZB 2YEZA 2XPGA 3LY6A 4EQ2A 3PJSA 2EDQA 1XEDA 4GMSH 3IDGA 2HG5B 3G5YA 4P4RA 3T0VA 1GZQA 1EO7A 2MQ3A 3KPOA 4S1RH 3V0VA 4YHML 3KAAA 4Z0BL 3RVVD 4ELME 3HB3C 3MV9B 1TNNA 5C2UB 2V2XA 5JPMA 4L4TB 3VXUA 3LKRA 1BFSA 1RZ7L 1T5XB 3IETA 1UZ6F 3TA3C 3FQNA 4JRXB 4JZNB 5D1QA 2NXZD 5HGDB 1KGCD 2FJFB 4PJDA 1SEQL 2ENSA 5A2IH 5T1LD 4U2ZA 2EC9U 3CCHA 4MX7A 2J3SA 5HI3C 3ZYIA 3FRPG 5TPWH 5IMLA 1KELL 3HE7B 1WK0A 4HDIB 3SQBA 4Q9CA 4U2YA 3TN0C 2GSIA 2A6JB 3ULUL 4NBZB 3TJHD 1G7IB 4HK0B 4BH7A 1B0RB 5I1LA 5IWLA 1BJ8A 4W4OC 1UJ3B 5B8CB 3V95A 1S7VB 5FEBA 4TOYL 4KJWC 5GSVA 2VYRE 1EGJA 2CJUH 3KLDA 5F1IB 1VFBA 4LP5A 3PWLB 3QDGD 1O7VA 3TBTB 3QUYB 2E9JA 3P11L 5T5NG 4NRYB 3X11B 3OWEA 1QO3B 1CL7H 4WTZA 2LV4A 4X4YA 3P4LA 2X05A 3GBML 3MRBB 4YHZH 1URLA 3B2VH 3TZVC 1S3KL 1UZ8A 1YEFH 1A3LH 5E2WH 5ICZB 2E9BA 5SWZD 4Y2DC 2E8YA 3F7YA 2OM5A 4WV1C 3W9DA 1I9EA 5BRZB 3IGAB 4U0QB 3CAFA 5E9DD 1G9ML 4HIXL 4I2XE 4XC3L 4LPTA 5ESQA 4YGVB 3CC5B 4OIAA 3W0WD 2AABL 3NZHL 5IESH 43C9A 2X7LA 3DSFL 4QHUA 1DEDA 1JYXA 5ESVB 1S5HA 3OKOA 2ZOKB 3S37L 3H3BC 2R8SL 1S7QB 1QTYT 4NQSB 4JPKL 3WBDA 4U1KB 1HKLL 1PG7X 1A7RL 3M1BA 4Z7QE 3U4BH 1YEDB 5D4QA 4OGAC 2AJVH 3VD3A 3MRMB 5E8EA 4U1MB 2YD7A 4EDWH 4OUOA 1CGVA 2IH3A 4X6CA 3GIZL 3RZCD 3W9EA 2P49B 2I9LB 4QTIL 5DMIL 1AO7A 1JGVL 1FFRA 1NGPH 4XMLH 3VW3L 1I1RA 4P5TD 2I07A 4PJIA 5DO2D 3CDGA 1MQKH 4NQTA 3VFMB 1KB9J 3B5HA 3LEYH 4U6VH 2CDFA 4KRLB 4QY8B 3C6LA 5CHNA 2JCCA 4M6NL 3GMNB 4HEPG 5CJ5A 1G7PB 1UT9A 3CDFA 4PYGA 1S7TA 5DI8B 3U7WL 2FATH 1NMCC 4BZ2H 2MSPA 3DUSB 3S97C 1FP5A 2EECA 1OTSD 5FYJL 4RZCA 2BY0A 1VSCA 5JHDD 3TA3B 1QSEE 4XP6L 1G6RL 2FO4B 1HH6B 2X4NA 3EFFA 1U3HC 1Q0XL 1XCTA 1L0XA 2GITB 4K55A 2HA1A 5T3ZD 1NFIA 4P3DB 2VDPH 1U92B 1DBJH 1MNUH 4LNVA 3BRDA 3BXNA 4HZLB 4MA8H 4MDJA 3TN0B 5HHXH 1G6VK 1MFBL 1IC4H 1NFDE 4XHQA 4H1LH 3DVFA 5D96C 4OCYH 5EU4A 4RCAA 3EOBA 2AJXH 1F3RB 2HTKD 1N3NA 2GCYB 4ORGB 4JPWL 3BD5A 1NANI 1YEIH 2IFFL 2AKRA 3TNMA 3C8DA 3G6AA 4IIQA 2IH1B 3H9ZA 1GHFL 4G8GA 5LCVL 5INCB 2Z91A 1XF2B 4NM8L 5H8DA 2GJ6D 1AP2A 3HTLX 5JW4R 2P8MA 4HWZB 2MHAB 1MLCB 5H2BB 3TIEA 1NGXB 5ILTL 1PDKA 5AZ2H 4FNLL 3TZVB 1B4JL 2Y06L 1OAUL 4UV4H 2QV2A 4Y2DB 5DYOA 1I8MA 4UQ2B 4WV1B 4DW2L 2V17L 2WLZA 2FL5A 2VSDA 1WTGT 2EH8L 3HAEB 4U1NB 4ZSOB 4OCWL 4X6DA 3V8OA 5HDQL 2Y6SD 4NYLA 5E00A 5CSGA 3NFPA 5E24E 2QR0A 3E6FA 3KVQA 2YSSB 1I85A 5E2JA 2ZSVB 3NA4A 5TH2B 3PXHA 3BQUC 4K3JH 2Q86B 5JLZB 1KN4H 5BV7H 2A6DA 4PRHA 3QFJA 4Q9QL 3R0NA 1C1EL 4OLEA 5EIIA 4MQSB 4NT6B 3ZKMD 5DJCB 4OLUL 3SKJH 3IS0X 1CQKA 5HYSA 3JXAA 2ZUQC 3V6OA 4Z5RB 3VXQA 1FDLH 4XAWL 3LKPB 3LEXA 1KCSH 2J8UF 1F3JB 4K94H 1IM3A 4QHNA 3U83A 1I8IB 3BPCA 3LAFA 3DHJA 1B3JA 2G2RB 3QEGH 3C9NA 2YN3A 3JV5A 4V1DD 3MLRH 4C56A 4LCUA 4PB0L 4PRBB 1NMCB 5IHLB 3RUGE 2OL3A 2P5EB 2F58L 1H5BA 3D3VE 5F97E 5CEYB 1CLZH 3DX6A 1EEZB 2MCPH 2GAZA 3GM0A 1K6QH 1OF2B 5JORA 5GGQH 2E5EA 1ONQA 1FHGA 1ZA6A 3JV6B 4WEMB 1F4YL 4Z7UB 4XVTH 5DR5L 3U0TB 3I9GH 3Q5OA 2BY1A 1EO5A 3KG5A 1EEYA 2GK0A 5DJYA 3MRPA 3RI5F 4IOFC 5TF0A 5JNYA 1KCRH 2J7LA 3AREC 4GG6E 4PJGE 3HAEG 4FQJL 1JWSA 1QRNB 4I5BA 3FONA 1J5OH 5IMKB 1Z9SA 5CINH 5HGBA 5EU6A 1KJ2A 2FD6H 5DJ8B 3WS3A 3OAYK 2J2ZA 4NQCA 5I8CA 4OGYL 4J1UB 2L7UA 3EYVA 1LP9E 3NCMA 1XIWC 3Q3GA 4OKDA 3W5NA 5CJOH 1VGEH 1U3YA 2VDLL 1HEZA 1KUMA 5E2TH 3KNBA 5F7UA 4XPBH 1BPVA 4WW1B 2UZYB 3ILPA 1CG9A 1F58L 2A83A 2FEEL 2ICEB 2Q76A 3L5WA 3P9MA 1C5DA 4G8FA 5DK3A 4LPCA 4WUKH 1MEXL 5T1DL 4I3GA 2WSKA 4FP8H 5C9JA 4PGJA 4OUUB 1Q9WA 1E28A 3BQUB 4FQIL 3SDCA 3RNKA 2O26U 3T8XB 3OKKB 4NM4L 4BELD 4NO2B 4ODHL 1KIQB 3QUMB 4GRMA 2MCG1 3MRHB 2Z31A 3SJVA 2ZUQB 1NAMH 1KEGH 3CH1A 1FH5H 1T2JA 1FYTB 2YD6A 4XTRD 3LN4A 1FE8H 4KZDH 3T0DA 3P9LB 5KVMC 1Y0LA 5F88A 4L4VB 1MH5A 5L2KD 5IK3A 4OZFA 1HDMA 1RHHB 3SOBH 3WL9B 4L1DA 1F2XK 1OP9A 3E6HA 5E2UH 5C0AB 3VXMB 1QLFB 1LEKB 4MD5A 4FQ1L 4EVNB 1OP3H 1FCGA 3WJLC 1AR2A 2VN4A 1OARH 3N50A 5HHMD 5LXGH 1CZ8H 4KPHL 3VWKC 3AXLA 4GKNA 3UZEA 3VFVA 4XCYB 1YZZA 1MCDA 5GRJH 1N2RB 1ZMYA 2NY7L 2Y72A 3D2UA 3G6JA 4LAQH 3CZJA 5C07D 4HUVB 1X5LA 2XN9A 3HRPA 1PY9A 2QEJA 3S98A 5FYKU 2XA8L 4L8SC 3S4SA 3RL2A 2FB4L 4PJDF 1NLDH 1NC2B 4G7YL 3ROOB 3T04D 4G9DB 1SM3L 5F3BA 1MWAB 3QXTA 5IFAH 1WF5A 3CH8A 1RU9L 5DMGD 4FQXC 2CDGB 4MNQA 3MREB 2LU3A 3FQUA 4F7MB 5DXWA 5BVPH 2HJFB 2VXQH 2OJEB 1AHWC 3KPSB 3ZL4H 4ETQB 3MTRA 2OK0L 1G6RB 3D39A 3GSNB 3KLAA 1VEMA 1QHPA 1CE6A 4MVBD 4LLMA 1VA9A 4S2SA 1AY1H 3I85A 5C0FB 3GMRB 3LKSB 1CVRA 4PJAF 1YNLL 3H6JA 3O4LE 1J1XL 2B1HL 1MUJA 5F7FA 4LHUA 2XWBB 5GRXG 3O41B 4IRJD 3DROA 2YRZA 3HI6H 1U8KB 4P9MH 3WHXB 1KLGA 2F54B 4GAJL 2UY7A 1MSPA 3U46B 3PIQA 1U8PA 1G7JB 3IFLL 4MMXC 2Q3AA 4QOKA 4M7LT 4YFEA 2X10A 1GGCL 5JQHC 5E8NA 2MQCA 3BZDA 3ZYJA 1DQJB 1QLEL 2EDFA 2QJDA 1I75A 2R1YA 1I3VA 2X1OA 3CPLA 1A4KB 1LNUA 1QR1B 5I1KL 3VFPB 4YXKL 1BJ1J 3MV7A 3O3BA 4IRSD 2R4RL 1KSRA 3NCCB 3LIZL 3MOQA 4OFIA 3E3QC 2ZUVA 1H0DA 1KBGL 3X14A 4JKLA 4FFYH 4XZUA 1F4WH 3LSOA 4N0YL 4TN9A 3IVKA 2F53B 1DBBL 4LK4A 1MJ8L 4WY7H 3WD5H 4JY6A 2F8OA 4D9QE 1IGCL 5F9JB 4H0GA 2VERN 3ARZA 4CVZA 3FT2B 3PWNB 4MAUH 3VWKB 3EDJA 1AKJB 3FN0L 4YBLC 1F3DJ 4U33A 3RVWC 1F90H 2ICCA 4D0DB 3HC0B 4XH2A 4ZFZB 2WV3A 2JJSC 3C08L 4LSTH 4OM0L 5L9DL 1GVIA 3RIAF 1HI6B 4L8SB 4EXKA 3MGTA 2NX5B 4JO4H 2AK1L 1HSBA 4TNVK 1KF9B 4UT6L 3OBAA 1T2QL 4X8JB 2VL5A 4MA3A 4FQXB 5GS3A 5HI5C 3JWDH 2EDWA 5H94A 3MGOA 3V6BR 1AHWB 5C0GB 4X5WB 4WO4C 3HNTL 5DJAB 1DTUA 2QBWA 3U4EB 4XVSL 1LD9B 1JJUA 2WP3O 3UP1A 1R3KB 1YPZF 4LRIA 4QRQA 4GRLC 1A7OH 3NAAH 1RUQL 1Z2KA 4P3CH 4KC3B 5FKPA 4P2QD 4UBDC 1MIEH 4PJEA 4M93C 2AXHA 4R4BA 4FXKA 3BZEA 1YMMB 3CZFA 3MCKB 1CGTA 3L95B 3VXTA 2QHLA 3EDDA 1RY7B 3DWTA 1ZV5A 1L7TL 3K4AA 1WSST 4M6MH 1CU4L 4U3CA 4WUUA 3OKMA 1GC1L 5C0CD 3PWPA 4XX1E 3IKCB 4WRLA 4XVUD 5IQ7H 5DD0H 5C0EA 4X6DF 2P24A 5BQ7B 2UWEE 3C09B 2EYRB 1LE9B 2IMNA 2P43B 1M7IA 3MBEC 5E1HB 2PYEE 1RZKL 2J88H 5CD3A 5KZCB 5M95B 1KIPB 1NGQH 4M7LL 2OQJB 2R15A 1T1WA 4X9HA 4KTEH 1MY7A 2BHYA 3REWB 1RZJC 5F7DA 1NCWL 4PJXB 4I4WB 1J8HA 2EE3A 3VDAA 3VMPA 4LHQB 4K7FA 3PDOA 2D4DA 4WI4A 3M07A 4JM2C 2BSED 1UA6L 2GIYA 3L3KB 3MNZB 3FO9A 4YBLB 3CFIC 5EUOE 1MFCH 1YY8B 2VDQL 5DZNA 4FTVE 2VDNH 4TPRH 4HKBB 4XAKE 5GGTL 2ESVD 3UMTA 3HR5A 4HPYL 4R7NA 3N1QC 4JJ5A 4YPGB 3QJFA 5HTSA 4JO3H 2GTWA 1N5AB 1QFPA 1GOFA 2HVKB 5GRUH 5JQ6L 2A6KB 1MFAH 3BEWB 5TDPA 3WXVL 4M7JL 4HKJA 4NO0B 3V5KB 5I76B 3GJFH 4M5ZH 4JFQA 3HMWL 1J0ZA 2ATKB 1W0YT 5T3ZL 2Q8BL 5KSVB 3VXNB 4PG9B 4Y4HD 5ICXA 1Z3GH 1ZLVH 1A6ZA 5M94B 3BZFB 3VMNA 3TVMC 5GGVL 3RWJA 4MCZA 2X1XR 4HBCL 4GG8B 4DVRL 4GRLB 4G9FE 4MNGE 3QDJD 5LGKA 1XR8B 3STZA 4PGZA 4M93B 3GKZA 1EAPA 5HDOA 1T6WA 3EJJX 3RVVC 1H3PL 2N7AA 3H2WA 2YC1A 3ZHLA 4GXVH 4YH6A 4YHLH 3SGDI 1YNKL 4YO0A 5KVEH 1EFXD 4WHYH 3OJMB 3WIFA 1IGFH 2C3VA 2AV7A 2VUOA 2WWMD 4NHUB 3UTTD 1OSPL 3T2NL 3U4AA 3C5JA 5D93C 1T0MA 4R8WH 1MHEB 3QIBD 1MHCB 4HG4J 1U8NA 1CXIA 4PJBE 1K8DA 3RL1A 4WCYH 4TRPH 3L3DA 3MBEB 4G6KH 3DECA 4HC1L 2E7MA 4PP2A 5JHLH 3UPAA 2BNQA 1R0AL 5A1AA 5I1DB 5EFIB 1L9NA 2HJLB 4H0IA 3LN5B 1IC7H 5JOPE 4EI6A 2ZPKH 3SDAC 4XBPA 2CKBA 3WEXA 4WEUD 3D69B 4PRPB 5GPRA 3VXPA 1K85A 1WT5C 4M1GH 3SY0A 3ULVE 1LO5A 2VTFA 2YK1L 4JM2B 5K9QI 5CCKL 3AVEA 4N90E 3CFJA 2AJSH 1BX2A 3P2TA 1AGDB 4G43A 3QYCA 5F6HI 4LSVL 4P2QA 2BXYA 1QNZL 4F33A 2FDBP 3QHFH 1TPXC 4KUCD 2G60H 3C5ZC 5D7JA 5IEHA 1ULVA 2AJYL 2P48B 4UUJA 2P44B 3QRGH 3I6LE 4R97C 4K7PX 3HZMB 2WP3T 4M61B 3PV6A 1FL3B 4L3EA 1T83C 3L6FB 2NZ9D 1IL1A 2X2YA 5I75C 4KKCD 2CXKA 3OXSB 1E4XI 5F9AC 2GFBA 3PL6A 4X83A 1G9NC 2A2QT 1AH1A 4H26A 3HG1B 4J23A 4KK6C 3RWGB 4RGND 3RZCC 2E7LA 1T21A 4Z7NF 1C5BH 5IFJA 1BD2A 1LEGB 1AE6H 3VXSB 4P5TC 5DO2C 1KTLA 3VH8A 1T4KB 3MJ7B 4KAQH 3U0PA 1JZ7A 2R0LL 3HZYB 1VGKA 2BC4B 2OTUA 4O5LL 1B6DA 4G6ML 4POZC 5D5MF 3RWIA 5FB8B 3EJYC 1FLRH 1B6UA 2APFA 2PW1B 5DMKA 3WSQL 4URTB 4F7PB 3TBWB 4NKDA 1XGUA 2NXZB 2OTWA 3OHXA 1B90A 3N85L 5T1LB 2PYFA 2C7UA 4J8RA 4ODTH 4R26L 3QPXH 1QSFD 3LQZA 3VGFA 4P2OC 4ISVB 2XZQL 4JFEB 4NQEE 5EU3B 2HWZL 4U31A 2NY0C 5JTWA 2HTKC 4FQ2L 4DKEL 7FABL 4GAYA 5T3XH 5MERB 4XCCL 3QZWA 4Y5YC 2NLJA 5ICYA 4UOW0 4YBHA 3BT2H 3SDAB 4HGKC 1EVTC 1OQXA 5INDA 4JRYE 1XGQA 1AQKH 4JDTL 4N0CD 5IJKA 4FFVC 3QWOA 3T0BA 3KYKH 3MV01 1MCPL 1RUMH 3VXRE 2XQBH 1SBSH 4UILH 4XBGA 4PJ5D 3BD4A 5GHWH 2DMBA 1C16B 3QEQD 1I7TB 2IQ9H 1IEAA 2DMCA 1XGRA 4MJID 3CXDH 4Y4FD 4Y1AD 5C08A 5E9DB 2VDKH 1TPXB 3C5ZB 3VD9A 4DKFH 2ADFL 3D0LB 4XCNA 3W0WB 2DYPD 4PP1C 2B2XH 4XP9H 3HI5L 3KHQA 1IT9L 5C7XL 5I16B 2DIBA 4KKLC 4AT6B 4H25B 1D6EA 2KQNA 3QNXA 4N1EA 3C5SA 2EDNA 3FQRA 2DL9A 4TSBH 1BVLA 1WFTA 1CE1H 2D03L 3QEUB 3QQ4B 5I75B 4JFDD 1R3IH 4WW2A 3PQYD 4Z7WA 5BJTB 3VFSA 4P4KD 2RGSA 3BWAB 4PJFF 3RZCB 3P0YL 3F6LA 3T0EC 4KTDL 5HYFA 2Y5TA 1W8OA 4P5TB 1M6OB 2EE9A 5C6WH 1IQDA 5CBAB 4YDIL 5IB2B 4KI5F 4PRNA 4U3HA 3KLHD 3ARWA 5GISH 3S9DB 2A6IA 3KPRE 4DN3H 2ZOLB 5JHDB 4BK5A 3IJYA 2FWOA 2LAGB 4PJEF 5E03A 2VLJD 1A7QL 5GJTH 2DLFH 1CICD 3P73A 3C60D 2R0ZH 5SWSB 2NTFB 2VLRA 3WNLA 2NXYD 1BQHA 4G6JL 5TF1L 3GK8H 4P2RD 4XC1L 1SJEB 1F11A 5KSBE 1HXMB 4QHKJ 2P8PB 1C08B 4W70A 4ZAKD 4UNTA 1OD9A 5H37G 1UVQA 3JVGA 5F96L 4Y19D 2IJ0C 3RY5A 3ARPA 1P7KA 3KDMB 3OMZA 3UC0H 3K2UL 4JDVB 2GJ6B 4MD0B 3PP3H 5J3HD 2KUTA 1DQDH 2VXUL 3DX7B 5ERWA 1I9RH 3HUJF 4O2CA 4LSPL 5HHOE 3QT2A 4NO5A 3VI3E 1VKXB 5ITBH 4LDLB 1CR9H 2AXJA 4HS3B 1R5VA 4AIZB 1A9EB 1MJJB 2JE8A 1KPRA 1BAFL 5GS1C 3RWDB 4NQXA 1VACA 3JTSA 3SGKA 4G8IA 3KPLA 4KJQD 1H3UA 2WM0A 5FOBA 4AENA 1HHIB 2ZCHL 4JM4L 3VFTA 4M1CD 5I8OH 4OZGF 5ADOL 1UWGH 2HT2D 5L8KB 1NBQA 1GGYA 3BEVB 1RIVH 2YPVL 3U2SA 1PG7H 3GFUA 4JKPL 1S9YA 3BP5A 4XXCC 3VCLA 3NCYS 5C0DB 3ET9F 2DWDB 1SY6H 5TJWK 5IROC 4JB9H 4Y7MA 3NTCL 2UUDH 3O2DH 3ELAT 4L9LA 1JPGB 1VCAA 1NGWA 4GW1A 1IKNC 3FO0H 1QFOA 4MJ4A 4G8EA 5IP4A 3IFOB 2VITB 1EPFA 4XTRC 2BVUA 1EUTA 4KXZI 3T0EB 4MQTB 3GHBL 1JGLH 5CKAA 5CZVH 2X5PA 2R4SH 4JRYB 4PLKC 5EZIL 3MYJA 4PJ8D 4MQ7A 1W72B 3OL2A 3BVNA 4H5SA 4YZFE 1OB1B 4FQQA 1ZS8A 2MPAH 2CKBL 3LN9A 4NFDA 3Q6FB 2AXGB 2P5WE 1TZHA 4C83B 1FNEB 3RJDA 4EI5D 4WEBL 5ID0A 4BQ9A 1UXSB 4PJ5A 4U6TA 2BSRA 1ACYH 5KANG 1A6AB 3SDXF 1BFTA 1WBZB 1N64H 1SVZA 2ARWA 1U41A 3X12B 2Q7YA 5CEXA 1JZ8A 3PGDA 2BOCB 2IAMA 4MA1C 3RAJH 3MRQA 3GGWA 3S36L 1ADQA 1BZQK 4QYOA 1T2XA 2DYPA 3SEPA 1S5IL 1F4HA 1WEJL 3ZDZF 2J6EA 3WNNA 1U8IA 4UOW1 3VG0H 5ABDE 5KSUB 4KVNH 2R23A 1PFCA 3O6KL 1PLGH 4NZUH 1XH3A 5LBSH 2IG2H 5BS0A 2VZVA 5DMGC 1FFNA 1E27A 1TZGH 2WZPD 5DFTA 1OGAD 1NDMA 1AFVH 2NY2D 4N8CH 1J11A 1AQDB 1YUHB 2Q7NA 4PJCB 4I0CC 3EYOB 5IB4B 5TDNA 3PQYA 4ZUVB 1J1PL 1FAIL 2GUOA 4IMKA 1UADC 4JFFA 2MFNA 4QHKI 5CIPH 3RDTC 1FPTL 4N0FB 1UC6A 2AS5M 3CVHL 2ZUTA 2C1PA 3WN5C 3E8UL 5GS1B 2PW2A 4XMPL 1BOGA 3DVNB 3LQAH 3QA3A 2HFGL 3ARFD 5JA9A 1FGNH 2Z35B 5BZWB 3M17A 1FZOB 1V7NL 4LARL 4IRJC 1JF5A 3UDWA 4QRUB 3P4MB 4U1SB 3MJ8A 1WZKA 1P4LA 3BZ4A 2AW2A 4WU7A 1FGVH 2VWEC 4LAJH 5DFVC 4FXLA 3QDMD 5D9SB 2YD8A 3RGVA 3RJQB 4X99A 4JHWH 4TNVF 2A73A 2YKLH 4P46D 5FYLD 2LE9A 5HVGB 4XNYH 3GSRA 1UZ6E 3UTPD 4F37K 3MZGB 2EIZB 5L8LB 1FAKT 5A43C 4MAYA 4JFOA 3AU1A 1S9WB 2JIXD 1T89A 4IRSC 4NJAH 5EBLA 5C70A 3GHEL 5T5FH 1RZIA 3F12B 2GSGA 4GW4B 1AGCB 3H0TB 1NCAH 3DNKA 4BA8A 2OXGA 4KKBC 1KCKA 2V7HB 3VFRB 2NY1D 2V7NB 1IQWL 4YEEA 3PGCB 4QCIB 5HHVL 4QRRA 3EYQD 4LLWB 3CFKA 3ZKND 5GIRB 3RU8L 2FJGB 4LMQE 2CKNA 3WJJC 4S1QL 1LK3H 3BRFA 4WI9A 4MA1B 5EOTA 5C07B 5C0BE 1PKQB 3R8BB 3MO1B 1INQB 4L3CB 2FEDC 1B0GA 1YN7B 2F74A 1UWXH 5EOQH 3LKNA 3ZSTA 4YQXL 4RNRB 5KSAD 3SE8L 2OS7A 4HIIA 4ZS7H 4YLQT 3SKUD 4U1JB 1U8OB 3O6MH 3WNOA 1NUGA 3G5XB 1UACH 5C0ND 3PDGA 5FIEA 4XWGH 5I8KL 4CL7A 3ULUE 2CR3A 1G1YA 2YPLA 4WNQB 5JUEH 4HFWB 4PGCB 3O6FC 4NO3A 5TFSH 2I60H 2GT9B 2ZNXA 1DN0A 5F7YC 1BJ1H 3RFZC 5DQDL 4PJ9A 1BF8A 1U8HB 4M3KB 2CDEA 1A4JA 5DTFA 4C54A 4LQFH 4KWUA 5KTEH 2VLLA 3IDUA 1RMFH 1OAZL 4IRJB 5DRZA 3V6FA 3KYMB 2CGRL 2IALA 2X4QA 3RTQC 5J9PA 3PP4H 3OAZK 5MEQB 3IDJB 3MPCA 3U9PL 4I3SL 1H3GA 4JCLA 5JOFA 2XZAL 1WZMA 4TULH 3EO9L 3QUZD 2R0KH 1ED3A 4L4JA 4OZIE 3FTGB 1CFVH 1KC5H 2VL4A 4QO1A 4XRCB 4DZ8B 2VISB 3CFDB 1F3DH 3NCFB 4NDMA 5CWSA 2ICWI 4P59L 1K4CA 3PWJB 5DUBB 4PGDB 3P40A 3IJHA 4QRPD 3UTSD 5I0ZA 3TPUB 1P1ZA 5EIQA 3PE9A 2F8XC 1DQQB 2VXSH 4IRSB 5B4MC 1EBAA 4POUB 2W0FA 2XQYK 3FAWA 3MCLH 1CDUA 3VJ6A 4WW2F 1CFNA 5KAQG 1IZJA 4ZUTB 5GSRA 4Z7WF 1D9KC 1OGAA 4PV8B 2BNUA 3GMQB 4IRZH 3UJJL 5IB1A 3QG7H 2BSTB 3WDIA 3NIFF 4RA3A 2F19H 3SGDH 3QUXD 3WNKA 3UYOD 1KB5A 3BIAX 3ARDA 4D0BB 3MJ9A 3WKML 3EYSL 1NSNL 1EMTL 3UYRL 3DX8A 1T04B 5DQJB 5ESAB 4ODXA 3CXHK 1ZT7A 5D6CB 4ALAH 2YA1A 3I75B 1NMAL 3CFEA 1S78C 4DN4H 3T3ME 5KVGH 4N9OB 1ZANL 4X98A 2R29H 1ZHBA 4CADB 3MRIB 5EWIH 3NA9L 3NCJH 4ZODA 1MI5D 3LHPH 2DJSA 4OLYL 2CH8A 3WIHL 4P46A 4P5KB 1BWMA 2BSSB 3IU4H 4XCEB 3ARBA 3VFUB 1P4BH 5GGSA 1E4KA 4PBVC 3O6FB 3BX7C 3FB6B 4OIIL 3FB8B 4I2XA 3X3GH 2OR9L 2ARJA 3HFML 3G08A 1IKFL 5JMOC 1A0QH 1N7MH 3BGMB 1NBYA 5EC1B 4WFHE 3TP4A 3FMGL 3FKUS 4APQC 4FQHB 5DA4A 3CMOH 1CFSA 5I8EA 4JR9L 4JO1H 4OQTL 3TH3T 5EZLB 3VI4E 3X3FH 4E41E 5F8RC 4LSSL 1Q72L 4NKIL 3KWWA 4XNZC 5DMYA 3RKDD 4L8DA 4F80A 1AXTH 4UDUA 4OLWH 3CK0L 5TQ0H 3QIBC 3SE4C 1NLBH 3HMXH 3Q6GH 1JTOA 2WWKT 5T1KD 3GI8H 5IMOA 1SJHA 1IM9D 3CVHB 3WE6A 3O3AB 2PXYC 1E6JH 1MIML 3OKDA 2L4OA 3RWEB 2VAJA 5D6DA 3KPNB 3BHBA 5JW5A 3L5IA 3PDDA 2VO5A 1RZFL 1MY5A 1D9KB 3W81A 3NN8A 2JJTA 4O4YL 3ZDYE 3OG4B 4OF6A 2GW5A 3UO1H 1RJYB 4KQ3H 4AMKH 1Y18B 5DJ2B 4HS8L 4X9FA 4OZHF 1OPGL 3BH9A 1P6AB 4HULB 3MBXL 5BMFL 2D31B 1TFHA 3L5XL 3IFPB 4EJ1C 3HA0A 5HGHB 4D8PB 1TZIB 2N1KA 3OKNA 2ESVB 4O51A 1GGTA 3KHOA 2FGWH 4WENB 5HDBF 4LSRH 2BNRE 5MENA 4NQDE 5HSFA 1QFHA 2ZCKL 1YYMH 3BUYB 1MREL 2HJKA 5HGAB 5CEZE 5FHAL 4KI5D 5I1EH 4P9HL 2AJZA 5TE7H 5FGSA 3UAJD 4LLQA 3HR6A 5FYKE 1JGUH 5GGUB 3HNVH 1JVKA 2G5BB 4U4BA 4Y4HB 2HVJB 3RA7H 3O3UN 5F7LB 4A6YH 2GJJA 4QRPA 3OXRA 3L3HA 1FNGA 2DQCH 4CN4A 4JG0L 1V3LA 9CGTA 4KZEH 4JFHE 2E6PA 4NN7C 5IB3B 3NFNA 5FM8A 2A0LD 3ARGD 1HSAA 1A7NH 4PUBL 3MNWA 2K7QA 5C0JA 4PB9H 4LGRB 3HZVA 2G5RA 3SQOH 5DRNB 4AL8L 1BQLL 4HLZG 4QF1A 3MRJA 4N1HB 4XNZB 1S7XB 1LE5B 3QXAB 1I7ZB 5D1ZD 4NZJA 2FR4A 4U49A 1RFDH 3UTTB 1RJCA 4LSUH 3QIBB 5I73C 4UTBH 4DCQA 1TTGA 4P23A 4MCYA 2D7TH 2FBJH 4X0KA 1R5WB 4L5FH 4TUKH 4RMSA 1JNHA 1QA9B 2YD4A 3QIWD 5HHNB 4WTWA 2CK0H 3PG2A 2P4AB 3MJGX 3VGDA 4UTAH 1EAJA 3BD3A 3PUCA 2N56A 2FX7L 5I2IB 3D3VA 1N0XH 4JDZB 3VXUE 1PQZA 2IAND 4H8WC 5FCUH 4OF0A 4XNXH 4JFZH 1DANT 1EUUA 3LKOA 3TV3H 2GYSA 4RFOH 4PJDE 4Q74A 4MDIA 1GPOL 4JREC 2C3GA 1BZ7B 4M43H 3TYFB 3DO7A 4KJPD 3M45A 3SGJC 3B9AA 5E5RB 5AD0A 1QR4A 1NEZA 2J12B 2I26N 2NCMA 2DQHH 4IDJL 3T0WA 3D85D 1FBIH 3DRTA 2HN7A 2ITCA 1IGIH 4J3OC 5CJQH 4PJ7E 1OCWH 2Q6WA 2J8UB 4OI7A 1MAJA 2QQKH 4J4PC 4Q6IA 4UNUA 3MLYH 1WBYB 2IF7A 5BXFA 2W9EL 3RBSA 5FDWA 5HY9A 4YHZL 2FLBT 1WWCA 4F57H 2VZ1A 4GKOA 2XRAL 2JKXA 1DUYA 1YEFL 1A3LL 4FFZL 4P2CG 3MMEA 4ODVH 3U36B 1RULL 3ECBB 3QCVH 4J3SA 4BSJA 3FOMA 3ZDXE 1KCUL 1JZ6A 1FFPA 4R7DB 4P4KC 3RWHA 4NN7B 4RGNB 2W9DH 2ADGB 3T3PE 5A16A 1LO4H 1HNGA 1UEYA 4GH7B 1YMHA 5B3JF 4YHNA 5IESL 2VZOA 3LV3B 5F89A 5EUKA 3G5ZB 4Z7VE 5EU7C 5E6ID 3MOAH 3O3EB 4WJ5A 4Z78A 3MRNA 5FGBA 4ZXBA 2DM2A 1HWGB 3KYAA 3QPQC 5K59E 3U4BL 1X4YA 5IWLC 5KS9A 2AJVL 5B39B 3ZT5A 1YNTB 1XCQA 5DVMA 5DGRA 1AGBB 1I1AA 1KB5L 4Z76A 1CICC 1JPSL 1X5GA 4X4ZA 5DHYB 4X6CE 3S5LA 3SBWA 2VE6A 1QSFB 4NNXA 1M71A 5MP6H 1MQKL 1AO7E 3GB7B 2NYYD 2DDQL 4R6UA 1A2YB 1MVFA 2FZ3B 4PJIE 1BBJB 4CKVX 1EJOH 1GAFL 4Z7OF 3FB5A 4RA0C 1QBLH 2FATL 4BZ2L 4FXGB 4ZAKC 2JCCE 3GMOB 3IXTB 4CW1A 5D7IE 1ZT1B 2NNAA 2X41A 5JO5B 1WCBB 1BFOA 3W39A 2VDPL 3B9DA 1FJ1B 4ZTOH 4X6EB 2FHFA 5HHXL 5FYLL 5ITFB 4JREB 1IC4L 1ORQA 3DRQA 3WUZA 1F8TL 3OGOE 5F3HA 1FO0A 4AEHL 4OCYL 4PD4K 4Y16A 2AJXL 4QT5A 4MXVE 2APBA 3QEQB 2EICA 1DBKH 1YEIL 1PX4A 4MJIB 4PGBA 4Y1AB 1X9QA 5EO0B 3H9HA 4K7PH 1YQVH 1JF1B 2AGJH 3EDKA 4AIOA 1RAMA 4LNRB 1YJDL 1FL6A 4CNIA 4LSQH 1E6OL 1XGTA 4EBQH 5IB5B 1N6QH 4Q0XL 1OD7A 4KKNA 4Y0GA 4RX4D 4UV4L 35C8H 4L3AA 2O5YH 5J6GA 3QG6B 3O3DA 1I3RA 3FB7A 5DJZA 1TVHB 3IDGB 4L1HA 2VLME 5F9WC 4JFDB 1BMGA 4RAUB 3W5MA 2AEPL 4M6OH 2JB6B 3QP3A 4HIEA 3T4AA 4P4KB 5B39G 3FQXA 2V2XB 3QIWA 4I0PD 1QKZH 3BW9A 1S7WA 1RZJH 2IBZX 4CN6A 2VDOH 4K3JL 3AS2A 1KN4L 1OM3H 2R1WB 5DFWH 5B3NA 5BV7L 3QH3A 5CP3A 2G9HA 2QSTA 1FN4B 2GSIB 1A9BB 4IHOB 3L3IB 4PRHE 3QFJE 4LPXA 3SKJL 4JY4A 2WAHA 1HHGB 2FBOJ 1MJ7H 5C09D 1RVFH 2VLJB 3MUY1 2O5XH 1CICB 1HYSC 1KCSL 1ZVYA 4K94L 1G0YR 3N1MC 3QFDB 4AQ1B 2NXYB 4ZOBA 1CFBA 3V6OE 4TUJA 4GXUM 1IGYB 5LKNA 3QEGL 4P2RB 4HSQA 3VFOA 3K74B 3SKNA 1X4ZA 3MLRL 4R96B 3DBXB 5JW4M 3BPOB 1U8QA 2B4CL 3NACH 1JWMB 4LMQI 4PJAB 4OT1H 1GXEA 3QDGE 4ZAKB 2F5BH 5H35A 3DXAA 4C56E 1CLZL 1RJLA 4GBXD 2LFGA 4Y19B 4AZ8A 1K6QL 4F37F 5GGQL 1H3TA 3WFHB 3T08A 3W9DB 4MHHG 5SWZE 4DJMA 3JWOL 4BFIB 1V3JA 1OWWA 2M8XA 5ESQB 2DQIL 5L7XH 4XVTL 4B0MM 1I1FA 1V3MA 1JZ2A 5EO1B 4FQPA 4X7TB 4IDLA 2X70A 1X5XA 5DJXB 2Z93B 1I85C 3RVTD 1KCRL 2DBJA 3H42H 3EGSB 2B0SH 3ARFC 2OMBA 1TQCC 1MF2H 2HLFD 5A2JH 3RVUD 1J5OL 4NN5C 5CINL 1VEOA 3JV4A 2DBLH 1B2WL 4AG4H 1K9TA 1XF1A 4HIJA 5EU6E 5SX5K 4JE4B 3V6OC 4NQCE 2HKHH 4NWUL 1IGTA 5CJOL 1VGEL 5F9WB 5E2TL 4PJHB 3EDFA 4FRWA 4NZDA 3VRIA 3CDGB 5F72S 4XPBL 3H7LA 4E5XB 5KW9H 1ZSDA 3TPKA 1S7TB 1CDHA 2E7BA 3TBVB 4M48H 5T3XD 3NBNA 3IXAB 4WUKL 2AK4D 3HNSH 3PHQA 1NFIB 1NJ9B 2RCSL 3PWUB 4WTZG 4MDJB 4JN2B 4XPGH 5T3ZE 4BSWA 5I18H 3B8YA 4D0CB 2CIIB 4EI5B 2R56H 3EOBB 1T7YA 4UI2A 1KEGL 3MXWH 3ZKNC 1FH5L 4JFXB 2JTDA 1FE8L 4KZDL 3KYNB 3SJVE 4D9LH 1YPZB 4YHPA 4G8GB 2JK5B 2CO7B 3SOBL 5I9QC 4J3WA 5HYJA 3P3YA 5E5UB 3TIEB 5C8JA 1NGYA 2GKIA 2HFEA 3S3SA 2HT4C 1IEBA 4OF8A 4Z95H 1OARL 5LXGL 1CWVA 1NUFA 1CZ8L 1RIUH 3O8XA 4RX4A 5KSAC 1SYVA 1QQDB 1OAKL 5DYOB 1WTLA 2WBKA 2H32A 3GO1H 5GRJL 1HILB 3J7HA 4XNUL 5C0NC 4LAQL 1QG3A 4KGLA 4FTVA 3KXFB 1YN6B 3G6JE 3IDIB 4X6DB 3RUGF 1K2DA 4U1IB 3VFNA 3V9FA 2XN9E 1NLDL 3NFPB 2QR0B 3E6FB 3PGFL 4PY7A 1UM6H 3V4UH 2DD8H 2Z92B 5I1HH 2XY2A 5EBMA 3SDCC 3ARFB 5DHVA 5F44A 1TQCB 4NRXB 1YEEL 4HUWA 1P7QD 5BVPL 2VXQL 4MNQE 3GIVA 3ZL4L 4PLJD 4HQQH 1NCBL 1U93B 5HYSB 1U8JA 3OR7B 1L6ZA 3P0GB 4I13B 3D39E 4R90H 1KJMB 1VEPA 1IM3B 3IRZA 4YFDB 3BI9X 4PJGF 5GGSY 1D5XB 3H9SD 1D6VH 3C9NB 3CNKA 4H1LB 3GSOA 2R2BA 2HAZA 3WS6A 2OR7A 2PETA 4HKZB 1BECA 3DMMA 1I8LC 4HUUB 5DJDA 5F9OL 2A9NH 1XFPA 3HI6L 3U1SH 3DI2B 4V1DE 4P9ML 2JIXB 1LP9F 3WCYA 3UTQB 1DZBA 3IF1B 1FNLA 3L5JA 2DKMA 5JORB 2ICWA 4ELKA 4GQPH 4PREB 2N4IA 4QOKE 3K81A 3THMH 5IW1A 4PTUB 3DV4A 2NY1B 1TVDA 5K9KA 5GRVL 4XBEL 3IJSB 3O11A 5ISZA 2BCKA 3ZYOA 1LVEA 3IDXH 5DJYB 3MRPB 2CIKA 3T1FA 3MLXH 4EN3D 4NKMA 3MV7E 1KLUA 1JWSB 5I9QB 3QQ9C 3MV9D 5B38A 3P4NB 1U91A 1PEWA 3EJZD 1KJ2B 1NCCL 2VLKA 4WY7L 3WD5L 4EIZC 2HKFH 5I8CB 1MOEA 2DRUA 3TT1L 3X13B 4MAUL 5KSAB 5AG9A 1BVZA 1P69B 4BKLA 3FFCA 4N0UB 4XGZB 4M1DH 3EYFA 4GT7A 1F90L 5DK0B 2HFFB 3GUTB 1W0WB 4F8QA 4JANB 3ZMRA 1GGIH 4MXQD 1NKOA 1T1YA 3OZ9H 4LSTL 1ZLSH 3STBA 5AUMA 4X7SH 1K8IA 1P53A 4MB3A 5HYSG 2Q76B 3L5WB 2AEIT 3AAZA 3DX9B 3F7RA 4LLUB 3TFKD 5CJBA 3P9MB 1C5DB 4G8FB 4QHMA 3GMPB 5E1AB 1HOCB 1RD6A 3MRLA 3LS4L 5FOJA 4K3EH 4HF5H 1XGYH 4H1LG 4HH9B 1BZ9A 3JWDL 2BVQB 5FUOH 4IMLB 1OLZA 3R06B 3NZ8B 4ZTPL 2BOBB 1NGZB 1MCCA 1IAMA 3L7EB 4GRMB 2X4PA 5D71H 1RURL 1P84K 3KPMB 2C26A 5E99L 4GW5B 2DAVA 4ODSL 1F6AA 4PY8I 1R3JA 4P3CL 3HZKB 3MLUH 4L8CA 1AGEA 3NIGE 5AWNH 3MXVL 1MIEL 4ONGH 2ZUXA 3QISA 2I25N 3E6HB 3UTSB 4MD5B 1NH6A 1SYSB 1IAOA 4EUPA 4PJEE 5L2KE 1OTTD 3DV6B 4M6ML 2ARJQ 1ND0A 5D2NA 4R0LB 5D2LA 3LRSA 1IGML 4NWTH 1H15A 3Q1SH 5CP7B 4X9BA 3DTXA 4WUUE 5DD0L 1JV5A 4BQ8A 5BOZG 2X4SA 3PWPE 5HHME 4PRIA 1HINL 2FEEI 1NCTA 2BVEA 2QHRH 2CXGA 2XN9B 2QADD 32C2A 2Z8WC 1MRCH 1C5CL 4GAFB 2YZ8A 3QUXB 4LU5H 2J88L 4WU5B 5C1MB 1CS6A 1NGQL 4KTEL 1MVUA 1TETH 4X80L 4B7IA 4MNQB 1T20B 3FRPA 1EHAA 3HC4H 2XNAA 1CT8B 5J11B 1J8HE 3SKOA 3K4DA 3TA3D 1IEHA 4DZBA 1TJGH 4KI5C 4XCFH 1F02I 5IFHH 4LRIC 5D5MB 5HI3D 1CE6B 2ZCLL 1MI5B 1MFCL 4GAGH 5DRXA 2GY7B 4ZO9A 2VDNL 3WFBH 1NMBH 1X5FA 2QKIA 5J1AA 4UNVA 1HHHB 1X5ZA 1NAMB 3IFNH 3S96A 3RRQA 1CYGA 4JO3L 2FNBA 3LCYA 3BO8B 2A0LC 5E5MA 3OB8A 5GRUL 2BVPA 2GTZB 3U7YH 3PIQB 1L7IH 1IBGH 1U8PB 1LK2B 4OFPA 2A74B 3MR9A 4OZFG 4G80A 2HT3C 4JVPA 4M5ZL 4BH8A 4V2CB 4MXWH 2J4WH 3ARTA 1Z3GL 1DUZA 1DP0A 3BESR 5CFHA 4KKAD 1KTDB 3HRZB 2I5YH 5ETUB 4Y2DD 4CVUA 1QZ1A 4BZ1H 2PO6A 1G7HB 5FDYA 3BKMH 2DQJH 2V5MA 1AD9B 3BAEH 1ZHKB 1UCTA 3MV9A 5T1KB 4L4TA 4XZUB 1ORSB 1SEBB 4F58H 1T5XA 1IM9B 3ME0A 1YEGH 2H8PA 4TUOA 5DJ6B 4JRXA 4JZNA 5KVEL 5HGDA 2Z8VC 3FZUD 4PLOB 1TITA 3MFGB 1IGFL 4GXUN 2NW3A 2E7CA 3HE7A 4HDIA 4OM1H 2A6JA 1CTNA 1G7IA 1WV7T 4HK0A 4R8WL 1B0RA 3CSYB 4WI5A 5B8CA 1RI8A 1S7VA 3LPFA 1D5ZB 4HWUA 1OSZB 5FGRA 4G6KL 4PRAB 4XP4H 4X5LA 1HSBB 2W92A 5JHLL 4N9GA 4U6HB 5F1IA 2OZ4A 1F6FB 2Y36H 3QI9D 3ZZ1A 3PWLA 3TBTA 4U1HA 3QUYA 4PJFB 2BNQE 4NRYA 1IC7L 2HRPH 3I02B 1QO3A 4M00A 4BJLA 1QFWH 4LHUG 2ZPKL 4XPHL 1SBBA 3MRBA 4A2MA 3DGGB 1QLRB 2VH5H 1U3HD 1T22A 1WC7B 1D5MA 5BRZA 5CUSH 4TVPE 3IGAA 1MCFA 2K3TA 3Q0HA 4LF3A 5I17B 4HUXB 1J0IA 3RZWA 4YGVA 3CC5A 4FXKB 4NGHL 2G60L 4P2QE 3DUHA 1KTRL 2QQLH 3MQIA 3ARGB 4YHKL 5ESVA 1AI1H 4WFFD 2ZOKA 1Q94A 4AK1A 1UKSA 5DMJB 2EXWD 1AD0B 5KJRH 5EUOF 1S7QA 3CX5K 5C0EB 4NQSA 4MYWB 3SPVB 5C0CE 3GRWH 4JGJA 5E6IC 2CPCA 5E6YA 1YEDA 4L3EE 2NQCA 1R5IB 4U1MA 1JNLH 4F2MB 1JPFB 2I9LA 3K8KA 4HAGA 3HUJB 3QB7C 3T2QA 5DT1L 3G6DH 1C5BL 3MLPA 1T1WB 3VFMA 5C3LD 4EEEA 3UPRB 2A9MH 1AE6L 1J18A 4IJ3C 4QY8A 3H8NA 1JNNH 1JYWA 1G7PA 2X89D 1BD2E 4JHBA 1QSED 4KAQL 3DUSA 4AQOA 2FIKB 1HWHB 1I7RA 2FO4A 1FLRL 1HH6A 1JWUB 3BQUD 3LZFH 4OCSH 2ORBH 1BLNB 2Y23A 4P3DA 2P5WA 4Q2ZB 1U92A 2IANB 4OZGB 3V52H 4MJ5B 4KH2A 3TN0A 4ODTL 2D7PA 4FS0A 3IB4A 4YX2H 3QPXL 2J5LC 1LDPH 4XHJD 1ITBB 4W4OA 4WHTB 4XMKH 1KNOA 2APWA 1N0LA 2GCYA 4ORGA 1A22B 2GTWB 4U1LB 3UBXB 2IH1A 1MCNA 5T3XL 5INCA 3D85B 5TDPB 1XF2A 4ZFOL 5TQ2H 1S9XA 4HWZA 2MHAA 5KOMC 1MLCA 3I6GB 1NGXA 3BT2L 3AC0A 4LOUC 1NL0L 3GNMH 4PJBF 3TZVA 5KN5B 1A6ZB 4NBYB 4UU9B 2WBJA 4LCYB 2UZXB 1RUML 3FQTB 2R1XB 4LFHD 4POYA 1SBSL 4UILL 3ABZA 1NBZA 4UQ2A 4WV1A 3MOBH 5GHWL 5IHBA 5M7QA 1UEMA 2IQ9L 3CXDL 3HAEA 5CGTA 3STZB 1A7PH 1T1XB 3DIFA 1FQ9C 4U1NA 5CJ8A 4ZSOA 5EZOL 2VDKL 2NY5L 4K23H 3SDXB 4RRPA 4D2NA 5K9JH 1M05B 4DKFL 5C08E 4HMDA 2B2XL 2L0DA 4XP9L 3ULVF 3QWRA 4U6XB 2YSSA 3UCRA 4IOFD 3QO0B 4YO0B 3ARED 2ZSVA 5SV4A 5TH2A 2YWZA 4I0PC 1S9VB 2V2WB 5TDOA 1QHOA 5E6IB 3ZT6A 4ENED 3C5JB 4NT6A 1T0MB 2W0PA 2VZ3A 1R3IL 3TWCL 1XIWD 3DUUA 1K8DB 4F7TB 3I50L 2I27N 4Z5RA 3QIUC 3LKPA 1F3JA 5MEPB 1RPQA 1I8IA 3BSZH 1EVUA 2VIRB 5B22A 3B8SA 2BHUA 5DC0A 5F1SA 4RDQF 4NUGL 4PRBA 1DQLH 1Z5LB 2P5EA 2P46B 2F54D 3UBXG 5IJKC 4R9HA 1EEZA 3SY0B 4DN3L 4ODUA 4P57B 1OF2A 1TVBB 3GJFB 3K4ZA 1WAAA 4YC2C 5GJTL 2DLFL 5KANI 4G43B 4IEFB 4FMKA 3JV6A 4HIXH 4F33B 4XC3H 2J5LB 3WFCH 1IAIM 1W2KT 2VLRE 4RIRB 5IEHB 3TO2B 1P9MA 3U0TA 2YZ1A 4AM0A 1PEZA 2DQEH 1MLBB 3DSFH 2FSEA 4OB5H 3V2AR 2MOVA 1YEHL 2R8SH 3HC3L 3HCVA 1QRNA 5AZEH 5IMKA 3UJTH 1CGSH 4ONFH 1HKLH 3C6SB 4UIKH 1IL1B 2HLFC 5DJ8A 3RVUC 4D3CL 1WIPA 4WW2C 2GFBB 4ZPTB 4J1UA 4HT1H 2P8LB 1VFAB 3GIZH 4MJ6B 1QFWM 3OAUH 1A6TB 1AKJD 3QCUH 3DVIA 5DMIH 5SX4I 1GZPA 1CR9L 3VW3H 4JZJC 2X4OA 1YEJH 1BOYA 3L3GB 4WW1A 5DHXB 1KTLB 4LLDB 4M6NH 3LKQB 3CSPA 3U7WH 1ZEAH 1U95B 3CFCH 5DVLA 2LU4A 4XP6H 4U1GC 4OUUA 1UWGL 5DMKB 4I0PB 3BQUA 3VRJA 1RIVL 1K4DB 2OTWB 1PG7L 2WLYA 3BKCH 3B83A 3MV8B 3T8XA 4CVWA 2PYFB 2DI8A 3VFWB 3OKKA 1X7QA 1I4FB 1SY6L 4NO2A 4JB9L 1KIQA 3QUMA 3LQZB 4PR5A 1PZ5B 3MRHA 3WNMA 4JQIH 5HXMA 3QIUB 1AGFA 1FYTA 4JPWH 3FO0L 3K46A 5ELIA 5C09B 3P9LA 4GAYB 2VAAB 4L4VA 2H1PH 4NM8H 5D1XA 1JGLL 3QZWB 1RHHA 5D8JL 3WL9A 5CZVL 2R4SL 5C0AA 3VXMA 2AJ3B 2D7MA 1LEKA 1T3FB 2C3XA 5ILTH 4HUNB 4EVNA 3OPZH 4FNLH 5DRWB 1B4JH 2MPAL 3BMWA 3BKYH 4A2LA 3LD8C 1ZT4B 3O2WH 4HH8A 3MGAA 3F8UB 1ACYL 2V17H 5HDBE 1AC0A 3WUWB 1F2QA 1JGDB 1N2RA 3OJ2C 1N64L 3B3IA 1XGRB 4PJ5E 3D48R 1BIHA 1JMXA 4DGVH 1MRFH 4HUVA 4Q9RH 4HFUL 3SGKC 4OCWH 4Q7DA 1FZJB 2IEPA 2EEDA 3K2MC 4QWWC 1NC2A 3ROOA 2P42B 4G9DA 5DC4B 3VG0L 1MWAA 4KVNL 5I66B 1RUAL 4QRSA 3NOIA 3KYOB 1PLGL 2EDXA 2CDGA 3FL7A 5DS8B 5LBSL 2IG2L 1ZA3B 5HPMA 1S8DA 3SCMD 1TZGL 3CLEH 4LLAA 2HJFA 2XKUA 2OJEA 5HBBA 3KPSA 1AFVL 4LCWB 4HCRA 4XP5H 4ETQA 5FO8A 5HYQA 1G6RA 3GSNA 4HIHB 4Z7WB 4PLJC 5KSBF 4ZFFB 5DEFB 4XAWH 5GRZA 3O4LD 2X1PA 3RVWD 3PQYE 4M8VA 2Y7QB 4FOMA 5C0FA 2NY6D 3GMRA 3LKSA 4CN1A 4UZGA 4JZJB 4MMZC 5D7KD 4JFFE 5DURB 2VB5A 4JPVL 1JRHI 4B5EA 2XWBA 3O41A 5CEZH 1U8KA 1FGNL 2F58H 2C4FU 2Q20A 5ANMB 3WHXA 1KG0B 2F54A 2BVOA 2DB8A 1EHNA 3V5DB 3U46A 4U1GB 3VI3F 4ZFOB 1G7JA 3I6KB 5FYKH 4NO0D 1WFNA 1F4AA 3QZWG 1FGVL 5HI5D 1JFQH 1WIOA 5C9KA 5K9OB 5CMAB 1DQJA 4WO4D 1Y6KR 3GSXB 5BZDA 1KJVB 4JQXC 1HNFA 3LB6D 2IAMC 4W6XB 2G75B 1A4KA 1QR1A 4GRLD 4P5MA 3MLWL 2JJUA 3WUWG 3F5WB 3OJDA 4AYFA 5EPMB 4NJAL 2DLIA 4EN3C 2OJZL 4D9QD 1RZGB 5ACMA 3RY6A 3T0AA 2F53A 1KULA 5F7MC 5F9JA 1FVDB 4WGWB 4OGYH 1NCAL 4O2CB 3FT2A 3PWNA 3VWKA 3LD8B 3MUGB 4YHIB 3JWNC 2YMXH 5IQ9B 4IMKC 2VDLH 2DLHA 3NCEB 4D0DA 5LAXB 3HC0A 4ZFZA 3AMLA 4QRRE 1CXEA 2CLZA 1LK3L 5IKCB 1A7BA 2DLTA 4MXQC 1F58H 1HI6A 4L8SA 3MBED 2NX5A 4AENB 1MEXH 4L8BB 5T1DH 1XR9A 1NC4D 3TFKC 2BNRA 5DUMH 1MAKA 4NQDA 4GRWE 4M7KH 1BFVL 2XXCB 4FQXA 4DAGL 3MRGB 1UJTA 3L9RA 5DJ0B 5E70A 3ZHDA 1TCRB 4PRPD 1AHWA 5C0GA 3RGVC 1P7QB 5DJAA 5DD6A 4ODHH 3U4EA 1JN6B 4JM2D 1UACL 4F7CB 4HK3J 5B3JE 1R3KA 4GW1B 2PCPA 3MFFA 3P77B 4RMVA 1EGJH 5JUEL 2MJWA 2NPLX 3BYYA 1T89C 2OSLB 5TFSL 2I60L 4HJ0C 2YPLE 3QXWA 2YN5A 4OZHB 5J4MA 3QXUA 3H9SB 1OL0A 1YMMA 3WV0A 4FQ1H 3MCKA 3L95A 5KTEL 5ALBH 1HCFX 1RMFL 5BW7A 4LASH 4FQQB 1OTTC 1PGRB 4KPHH 5IVXB 3IKCA 4Y5XB 1TZHB 1KOAA 3QSKB 3FCTB 1TTFA 2BSRB 5DGQA 3L3JB 2R0KL 1KC5L 5MI0B 4NP4L 1RK0B 5BQ7A 4Z7OE 2ID5A 1ZVSB 4PGEB 2CO6B 2PYED 3DPBA 2EYRA 2X4UB 4YGAB 5E0QA 3CVIH 3ARSA 1XF4B 3TVMD 2ZSWA 1BVKB 4OF7A 3HG1D 2QADC 3CMGA 3I3DA 5GGRB 2IQAB 4NJ9H 1QUNA 1KIPA 2OQJA 2VXSL 2V6HA 2XTLA 4FFWC 4HS6A 3VXSD 25C8H 3REWA 2VXVL 3B9KD 1H8NA 4PJXA 5GXBB 5DF0A 5BS0B 4EN3B 3LQAC 4KMQA 1HQRA 4BQ6A 4OFYD 2AVGA 3O45B 5AEAA 1IE5A 4IRZL 1CBVH 1OGAE 1U2CA 2D7NA 2R2EB 5ID1B 3V0WH 3MNZA 4GKZA 1KENH 4M62H 4XAKD 1YY8A 3CIQA 2JJSA 4HKBA 2PW2B 4PJ9C 4JFED 5IJVB 4YPGA 4FMFA 1XF5B 1PD6A 1A6PA 1T6VN 4OV6F 4TSCL 4K9EH 4Z8FH 4GAJH 2HVKA 4PJ7A 4ALAL 1WAAF 2A6KA 3BEWA 3NH7H 3CDCA 1J10A 4DN4L 2EKSB 5KVGL 4NO0A 5GZNC 3V5KA 5I76A 2QL1A 2X4RA 3SDAD 5EWIL 5GS0C 4K3DH 5KSVA 3NCJL 3V5HB 1VENA 3VXNA 1QLEH 4LKCB 4PG9A 3RGVB 3VXOB 1CF8H 2AAVA 2A73B 4UB0H 3BZFA 4G9FD 1DJSA 2YR3A 5I1KH 3IU4L 3QUML 4YXKH 4GG8A 4KKAC 4L29A 3MLSL 4GRLA 2R4RH 1P4BL 5FYLE 3JZ7A 2BFVL 4UT7H 3BIKB 3EHBC 4Q58C 3X3GL 3UEZA 4YE4L 1XR8A 4Q6YA 1A0QL 1N7ML 3C5ZD 5IV2B 1KBGH 5TE6H 2DICA 4N0YH 3IAPA 4WWID 3ZYZA 1IGCH 3CMOL 4Z7VA 1HN1A 4RAVB 3ULUF 3HE6D 3IDMB 3FHQA 3FZUC 4NHUA 4OLVH 4LPUA 4OLWL 1MHEA 1KN2L 3RNQB 4JEGB 2O93L 4R2GD 5TQ0L 2W60B 5EOTB 5D7LB 3RWCA 2VC2H 4NZRH 4KK6D 2QADB 1NLBL 5CIPB 4UT6H 4CU6A 5I71C 3GI8L 5JOPD 5EFIA 1ZKAA 2HJLA 4ACPA 3LN5A 5CSBA 1MWAL 3QI9C 4OZIF 4TVSa 2RFXB 4ZUWA 1WWBX 3D69A 4MNHA 4ESKA 4PRPA 5D7IA 5HVHC 1ZXQA 4POZD 4N90D 2Y07L 1KEMH 3EJYD 3A6BL 1VFMA 4JM2A 4HCRL 3UO1L 2BRRH 1RK1B 4KQ3L 4AMKL 4MSWB 3GSNL 4G6FD 1AGDA 1E4KC 2ZJSH 1OAYL 5SWSD 4NO3B 2AQ3A 2R2HB 3O9WD 5GRWA 1DN0B 1BEYH 3IU3B 3P0VH 4PJ9B 3I6LD 4NQUA 4P2OD 4Y4KC 4ZUSB 2FGWL 2VLLB 2NY0D 4LSRL 4XPFL 2ITDB 2CLRB 3EO0B 1CU4H 2CUIA 2ZG1A 2OL3H 3HZMA 4QHLB 3QRFM 2X4QB 5MENE 4M61A 1ZHLB 4KI1A 3MLVH 1S7UB 4G42B 1FL3A 5I1EL 5TE7L 2EXWC 3L6FA 4EKXA 4Y5VC 5C3TA 1U8MA 1MCWM 1JF6A 4FFVD 4YK4C 1SQ2N 3D87B 3OXSA 1CXKA 4KRMB 1KIRB 4GMTH 1EA9C 2X6MA 3HNVL 1K4CB 3NFSL 5I0DA 3RWGA 4A6YL 1A1OB 1DBAH 2DQCL 5EN2A 4KZEL 4N5ED 3T3MF 5I15H 2AV1B 2YUZA 1LEGA 4QRPE 4ELMB 2W0FB 4HGMA 2XZZA 1NCWH 4E0RA 4XWOC 1A7NL 3VJ6B 5JDSB 1WBXB 1T4KA 3HS0A 3VRLE 3MJ7A 5D6DC 4E9LA 1LO3L 3BE1L 3HZYA 2BC4A 4PP1D 3W82A 3BPNC 2BNUB 2JJTC 3LPGA 2JB5H 3QULA 1KJ2H 4P3WA 3SQOL 5FB8A 4KKLD 3RVXC 2PW1A 4UT9H 4F7PA 4KDTC 2WUCH 3SGEI 2YS4A 1DBMH 5T1LA 5IUSA 2VSCA 2EH7H 4NQED 4G7VH 4HJGB 3WNPA 2BDNH 5FO7B 1RFDL 2WNGA 4HPYH 4JKMA 4ISVA 1LILA 4LSUL 2EDHA 4JFEA 2CRYA 4XHJC 4UTBL 1L9MA 5EU3A 3DX8B 2IGFH 3N9GH 3VI4F 2ILLA 2FBJL 4M4PA 3ZTNH 5I71B 1LEIB 4L5FL 3T0ED 2VOTA 4Z77A 3P30L 3WXVH 5MERA 4C55A 1SMAA 4I3RH 5CSZB 3WLBB 5J0BA 4X98B 4JRYD 2CK0L 1ZHBB 3QI9B 4UTAL 3QDGA 2KBGA 3ARUA 4JPIA 1I1CA 3O0RH 3SDAA 1N0XL 5JXAH 3VXRD 4Y89A 5FCUL 2AI0L 4MQXC 4XNXL 1WT5A 4JFZL 2OLDA 2DQFB 3TV3L 4RFOL 1LO0H 4JQVC 5DQ9B 4HBCH 4DVRH 1CD1B 1U3HB 3KR3L 5SWZA 1DEEB 4M43L 1CLOH 1C16A 1I7TA 2NW2B 3A0OA 4I2XB 3GI9H 4J7RA 4OD1H 3G08B 5E9DA 3VE0B 2DQHL 5FYJU 1FBIL 1NBYB 4Y4KB 4OZFH 1IGIL 3OGCB 5D96B 1OCWL 3W0WA 4RWYL 3ZDYF 3O2VL 2O5ZH 5I16A 1CFSB 2QQKL 5I8EB 3MCG1 1CK0H 2OBGA 3K7UA 4AT6A 3IKKA 2WK2A 4AIXA 4F9LC 1IFHL 3T65B 5IVOA 1N8ZA 3KWWB 3SE9L 3D0VB 3E2HC 5F1OB 1T83A 4UAOC 4WDIA 4X7DC 4Y5VB 3T2NH 3T2OA 5LGHH 4UDUB 1A6VH 5EC2B 1BIIB 3CU7A 2H3NB 4ENEC 4HMCA 3VWJD 3QCVL 4G6AD 5BJTA 3V4PL 2UYLA 2C1OB 1W8NA 3UZQA 5DSCB 1C12B 3RZCA 1X44A 5LG1A 2YD5A 4HK3N 1FG2B 2W9DL 5GGTA 3GMMB 4P5TA 1M6OA 4YR6B 5SX4H 5IIEB 4QRTB 5CBAA 2CRMA 3QNZB 3KPRD 5IB2A 1JHKL 1FLTX 1F5WA 1TJHH 4DVBB 3NN8B 3BPNB 1QSEB 3MOAL 4HW6A 2OP4H 4FABL 2YK1H 4JCMA 5CCKH 5EORH 5JHDA 2VQTA 4CBPA 4H20H 5MHSE 3FT4B 1NFDB 2NTFA 4HKXB 2A1WL 3HI1B 5KS9E 2J8OA 3KPPB 4RQQB 5FKAB 1DVFD 1SJEA 4ODBD 5MP6L 2RIKA 3MRRB 4JGMA 5MEOA 2P8PA 1C08A 2XKSA