4X7FC

Crystal structure of norovirus gii.10 p domain in complex with nano-25
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
DVQLVESGGGLVQPGGSLRLSCAASESILSFNHMAWYRQGPGEQRELVAVITREGSTDYADSVKGRFTISRDNAKNMVYLLMSNLRPEDTAVYYCNRGISNPWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 27
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7fC00
1G9EA 3BESR 3PIQB 1P4IH 3PV6A 1ZLSL 3VXMD 3E0GA 4WI3A 5HVWA 3D0LB 4J3WA 4AQ1B 3QH3A 5TPWL 5I1LA 15C8H 5T3ZE 3BEVA 3IVKB 2P8MB 4WW2A 2FECI 2GSIB 3QFDA 3CIQA 4Y8AA 4P5MA 3O2WH 1DZBA 5I6XB 4Q9QL 2CIKB 1DBJH 2NX5A 2HJKB 4OCMC 1U8KB 3OHXA 5I73C 4P46B 1HZHH 3MO1B 3IDMA 1DQQB 3NCJH 1NBZB 3C5SA 3FHAA 1QFHA 1Z9OA 2AJXH 3GK8H 4HC1A 3C9NA 1IL1B 2X7LB 2CJUL 2X89D 4ORZC 4WFGE 3MRKB 1UH2A 4YBLB 5DEFA 2Q6WB 1UM4H 3SDYH 1NC2D 4LKCB 3MRHA 2XV6B 4BH8A 4DGIH 2B8OT 1DBBH 5TQ0L 1U8NA 4MAYA 4OZFB 1KB5A 1OGAA 4MXQD 4L8BA 2ZCLL 3KLAA 2X89A 1C5BL 1Q38A 1CLCA 4M6NH 4S1QH 5I30H 1LO5A 5LAXB 4EJ1C 5FCUL 1T3FA 3SN6N 4GT7A 1AGBA 3CFJB 3R06A 3QUMB 3PWVB 3GSOB 4MAYD 4WRLA 1OAYL 2VKXA 3WFZA 1P1ZB 1H3WM 3UTTA 2WBWB 2Y72A 5FEBA 4FQIL 4UT6H 4FFVC 1MFDH 3MBXH 4UZGA 5HGBA 1YN6A 3NIDE 4N1CA 1S78D 3VGGA 2WUBL 3MLRL 3OF6D 5KZCD 4OD1L 5IHLB 3RGHA 1TTGA 3QFJB 2AXGB 1SVZA 3U4EB 4LL9A 3OF6A 4PRNA 3WV0A 1UH4A 2DTML 1G7MA 3CMOL 2VITB 4J2XA 1B0RB 3HZVA 4P2OC 1OB1A 3PUCA 3UZVB 5FO7A 1ZVYA 1XGTA 1MAJA 2DLHA 4L3EA 1NMCC 5I1EH 5JW4Q 1CICC 3UPRA 1FP5A 2GKIA 3QQ9C 5ITBH 4AH2B 5F9JA 1K5NB 4PV9B 2P7TB 3P11H 2CLZB 3QEUA 1I3RB 4K2UH 1G0XA 4C56E 2BJMH 5SWSE 4MS8D 2NTFA 3GHBL 2XY1A 5IFHL 4I18C 4X80H 3TNMB 1NDMB 2AJ3B 1N4XH 1T7VA 2QHRL 5AD0A 2FNBA 4KQ3L 4TUJB 4KKBC 3MBEB 1UXSA 4PRHE 4X4XB 5D71L 2ZCHL 1R3HB 5SX5K 5C6WH 3LKRA 4A6YH 4B0MM 4Y2DA 3B9KA 2YPLD 4MHHI 5HHPA 1RIHH 4TPRH 2MCPH 4K7PL 1K8IA 4UTBH 1DLFH 4DUVA 1S7VA 2ZKHH 4Y16C 3ELAT 4NO3A 3QQ4A 4KHXL 2VLKA 3QQ3B 4N5ED 2F53E 1A3RL 1FSKB 4U49A 3FO0H 4ODUB 2CRYA 3HC3L 3LZFL 4PJXF 2VDKL 2AABL 2F53B 3CXDH 4UBDC 5DJXA 4FTVD 5KVDL 5J11C 4YDIH 5HHMD 1HHHB 3R0NA 3RWJB 5FYKE 1EH9A 3E2HB 1G6RB 2JK5B 3NA9H 2YD8A 1J0ZA 3VXTB 2P5EB 3BWAA 3GFUA 4L4VD 4AT6A 4LVNB 2W9EH 5SX4H 4J1UA 4E41A 1KXTB 1U8IA 3RGVB 5LCVL 1FL6B 4PTTB 5TE4L 3SCMB 4KHXH 1IILE 4LCWB 3VFRB 1SY6L 4APQA 2Y36L 5HGHB 2VLLB 4JM2C 1T1WA 4PRDA 3K4DA 2ZOLB 1I1AB 4HUNB 2AJVL 1T89A 2XZQH 3FQTA 1MHHA 3UJIL 3DTXA 4TPRL 1Y0LB 4PJDF 5IMOA 4O9HH 2NX5D 4Y4FB 2ED8A 3P0GB 1H0DA 3QWRD 2DDQH 3BQUA 3MJ7A 2D4DA 2D7PA 3P30H 5CWSA 3O6KL 2HMIC 5EPMA 2JIXB 5E2JA 4NNYA 1CXLA 5B39B 1NFIB 3BPOB 2OP4L 4N90D 1K4DB 3ZE0E 3DURA 1MVUA 1Q9OB 4I2XA 3MMEB 3P3YA 3ESUF 5E2UL 1OTTD 4N0UA 3VD7A 4F2MA 3T0EE 3FFDA 2MKLC 3QHZH 3SDCD 3RKPA 4XCFL 3C8KA 3VFOB 2ATPA 5F7HA 3D18A 2H2SC 4X6DB 3THMH 3VRJA 1E6OH 4BFIB 4YE4H 1N2RA 3QDGE 3ZKMD 1CFVL 1LK2A 4KZDH 5BRZE 1I9IL 3PNWA 1F00I 1PX4A 1TQBB 3OXRB 4QXUL 1OAUL 2ED9A 4RMRA 1U8OB 4XNZC 2WINB 3U2SA 1BJMA 4YBHA 1TCMA 3I9GL 2YPKA 2EE6A 4HAFA 5ID1B 5FGCB 4I3SH 3MTRA 1KCKA 4Q9CA 4UOW0 5IROA 5I1KH 1SJEB 3SCMD 1IC5L 2PTUA 1OPGH 4LARL 4MNGB 4XVJH 1NCAL 1FNHA 3KPLB 4PP2B 3SDCC 3H42L 2NY5L 4P23D 2H41A 1Q94B 2GJ6A 3S36H 1KIQA 5E99H 1QKZH 4LEXH 5FA3B 4NZUL 3DSFL 1MJUL 4NO2B 1CCZA 3V5KA 4OB5H 5TDOA 3SE8H 4NHUA 3M8OL 5D1ZC 3UTSD 1MCQA 3KYMB 5SWZB 4OGZA 2H26B 4G80A 1F4WL 3IJHB 5JXAH 2P48B 1IGYB 5JNYA 1JTPA 2X4PA 2E8ZA 4RGND 4K3JH 1FH5H 5IT2L 4X99B 1IQDB 1M7DA 4JZJB 5GZOD 1V7ML 3LKQA 1UA6H 1I8IA 3QEQD 1LP9B 4ZNCD 4XHJD 2P49B 4ZOBA 4NZDA 1VA9A 4O58H 1HN1A 4ETYA 1AHWA 5FDWB 5DJ0A 2WZPD 4D9RE 5ENWA 1FAIL 2RCSL 3NCJL 2P43B 4KJPC 5HPOA 4JRXB 4HH8A 2X4RB 1NL0H 3RVUC 2I9TB 1OAQH 3F7QA 4LCWD 2UV3A 3O4LB 4PJAE 1MCIA 2YWZA 1CE1H 3AU1B 3UAJC 1VCAA 3B5HA 1UC6A 2ZCHH 2BVOA 2BSED 4JG1L 1QRNB 4KQ3H 3NOIA 2V2XA 2DQIL 2EDJA 4OFIA 4PJCA 4UILH 1MHEA 2BSTB 5DJYA 3HR6A 1OTUD 5I71C 2IPUG 2XTJC 4QXTB 2W9LA 3QIUC 1ZLUK 4OJFH 3JTTB 3MOQA 1UJ3C 3DV6A 4XMLL 1BVLA 1NFDF 1LK3L 1RJCA 5ERWB 5EH1A 2I07A 1JV5B 4HF5L 2HT2C 4DKEH 2X09A 5FOJA 5K9JH 3WNMA 4G6FD 1MFNA 1A7BA 1G7QB 2IPUK 1N7ML 5DJDB 1KIRA 5FYJH 3KPQB 4OIBA 4AIOA 4N0YL 2BFVL 2Y07H 4IS6A 4Z77B 1ZGLM 1GHFL 1CXIA 4S1QL 1HI6B 1K3ZA 4TVSa 5BRZB 2GK0A 3WN5C 1Q72L 3QNXA 5DHXB 3MLSH 4P59H 1MCNA 3BD5A 4ONFL 2ARWA 1UXWA 4M00A 4YXLH 5A3IC 1WAAF 3T3PF 2X10A 3CSGA 1MCPL 4LPCA 4FQXC 4PRIB 3RWFA 1HHJB 2AABH 3SDDD 2IADA 4Y4KB 4B7LA 3PWPE 4ERSL 3M45A 4Y4KD 2VISA 2HLFC 3BZDA 4HZLA 4FQQB 1QP1A 3KR3H 4LHQB 3KPOB 1KCSL 3V0WH 4PJ7A 2YA1A 3P2TA 3WNNA 4M6NL 3PL6D 4DCQB 5IJKC 3G04B 1T04B 2HKHH 4N0FB 1HH9B 3MNZA 7FABL 5A2JH 1J8HA 1JWUB 1L7TH 4F9PA 2GY5A 4XBEH 4Y5VA 4H25A 3LIZH 35C8H 2AXFA 2MSPA 3LQAL 3BDYH 5E1HB 2NLJA 5J9PA 2YMXL 3LEXB 4JO2L 1CD9B 1WK0A 2DQFA 3E8UL 3Q6GH 4FFVD 4HV8B 4ZFGH 4OFPA 3LEVH 1MUJA 3V5HB 4DKDC 4EIGB 3CK0L 2DIJA 4YHNA 4GXVH 2GUOA 1XGRA 1JCKA 5BXFB 4HK3N 3FB7A 3MGTA 5FYJD 4NBYB 4Q9QH 1PBYA 1L7TL 4XCNA 4L4TB 4P2YA 3FFCA 4NKIH 3K46A 2PXYD 2DQGL 1JGLH 4LGRB 5FYLH 2IAMB 3ULVL 1R24A 2KDGA 4P4KD 1QLRA 3O3UN 1KCSH 4I3GA 1YEKL 4NYLB 1N3NB 1B2WL 5HYQA 1WFNA 5IQ9B 2FD6L 4S1SH 5E5UB 1YYLH 1BREA 2H9GA 1F90H 5CILL 2W59A 3VA2C 4HKZA 3DPBA 3BZEB 1NFDB 1FNAA 4L8DA 1ZGLP 1E27B 4BZYA 1QTYT 2NY1D 4XHQA 3DSNA 1MHCA 4ZS6C 3SDAD 3BN9D 4IOIA 4PIRF 1BF2A 4AQOA 4LLDB 4TUOB 3TPKA 3LAFA 4JZNB 2NXYC 4J12A 1BEYL 2WAHA 3D9AL 1C5BH 3BMWA 1P4BL 3CZFB 3KPSB 1AY1H 3IGAA 5E8NB 1NGXA 3U0TA 3O45B 4GRLA 5KN5B 4PS4L 2YPLA 3L95B 4OCXL 4DKEL 4HWUA 3DMMD 4HIXL 4LIQL 1KNOB 4HSQA 4Z7UA 4CMHC 2GTZB 4PLNC 3GGWA 4UAOC 1IC1A 1DQDL 1MWAH 5DRZB 4M7JH 1AD0A 4FABL 4A6YB 1LP9F 4KUZL 2YKLL 1J7VR 4B7IA 5DJZA 5DK3A 2B5IB 4Y5XC 4OF7A 5TF1L 5ISZE 3GSNA 2IAMD 4RX4A 4X7DC 2DQGH 3HLAB 5FYLL 5KSUA 4PJ9C 3N1FC 3ARGA 5C0IA 3ILQD 4MA8H 4MD5A 2H1PH 1NDGA 1EVTC 4ZTPL 3E2HC 5DMIL 1S5IH 1KSRA 2DQHL 4GBXB 2PKDA 3NACH 4NKOB 4DGYL 1BBJB 1SBSL 5JOPE 4EDXA 1NL0L 2BVPA 2QADC 4RX4D 4FZEL 4KRPC 1F2XK 4OLVH 1NCWL 5B3JE 4OZIF 1HOCA 3O9WD 1XF2A 4HPOL 4YIQB 3OKDB 5IB4A 1J5OL 4JO2H 1AO7E 4M7ZB 5CGTA 1HYSD 2WWMD 1V7MH 5F96L 1FV1B 3WUWA 3ROOB 1FC2D 1OF2B 3FO9B 3TESA 2MHAB 3ZL4L 1Z0NA 5DS8A 4HUXB 1NUGA 2DMKA 3IDIA 3P40A 4PTUA 1FNSL 4BK4A 3MLWH 5T1LB 2HKHL 1TZGL 2RFXA 1DLHA 4WDIB 4EDWH 4DOHE 4JEGB 2VDQH 1T83C 3E6FB 3S35L 3SGEH 4L8CA 4RNRB 1BJ8A 2G5RA 3TJEL 4G8FA 4OBRA 4J8RA 4UDTB 3TYGH 1M71B 3OJDA 4IJ3C 5GHWH 3VW3H 1RAMA 2FR4A 4NBXB 2FH8A 1CICB 1QKZL 1R5VA 2DKUA 4R4FH 3MX0A 4U2ZA 5ILTL 1WT5A 3S97C 1JRHH 3VGDA 2WWMC 5TE7H 3JV5A 5DJ2B 4NFDA 5FAAA 3DRTA 4Y5YA 5K9OB 3C5JB 1FCGA 2LU4A 3B8SA 3P77A 1JHKL 5IVZA 2X40A 1A9EA 3FMGH 3U36B 4LRNL 1BHGA 4O5LH 2YRLA 4Y4HB 3N85H 3VFTB 2EICA 3VCLA 3QA3B 4UIMA 5K9JL 3TFKC 4G6ML 3GBNH 2CLVB 4G5ZH 4GKNB 5T5FL 3D25B 1A0QL 3VXRB 4ACPA 5GS0L 2B1HH 4HUUB 1A1OB 4TUKH 4CMMB 3TN0B 1RZGA 4PJ9A 4OJFL 3KXFE 2LU3A 2NZIA 5CFHA 5GS2D 1P5VA 1SEQL 1MCWM 5J6GB 2VE6A 4ISVA 3D85A 3UYPA 4EN3A 2J5LB 3BE1H 1XGUB 3ILPA 4LBEB 3TO4D 4JY6B 32C2B 3SBWC 4XNUL 3EDFA 4KJYA 1R3IH 1K6QL 4GH7B 5DYOA 1FNLA 5C08B 4JB9H 1U93B 2A9NL 4QRTA 1RZJH 5H37G 3GSRB 4MNHB 4GO6B 4DUXA 4WVRA 4JRYB 2R2BB 3MRDB 1YN7B 4N1HB 5CSGA 3QCTH 1A6WH 2VJXA 5CCKL 4PRBB 4PP1C 5GRJL 1KEMH 2V17H 3DIFA 1NGZB 1KTLA 3IDXH 3FB6A 2C4FT 3RBGA 1VGEL 5DEZA 1OP5H 4N8VB 4MMZC 2EH7H 1MCCA 1KUMA 1FN4B 5I15H 1A7OL 3EDDA 3HR5A 4NHCL 3NFNB 3JV6B 4ZOAA 4PBXA 5E8OA 3O4OC 2I27N 2PXYC 3UBXA 1A1MA 12E8L 5DFTA 4PJEE 1B0WA 2NY6C 2XTJB 1NC4B 4GKSA 4UV7L 1AQKH 5E2WL 3T08A 1AR2A 1IGCH 4QO1A 3SY0B 5DZLA 3X17A 3MNWB 1YNTB 3FB8B 4UTBL 1GXEA 2IQ9L 5EZLA 4XVSL 3OKNB 4HGWA 2XOTA 1EFXB 5D1QD 3VWJB 5L2KA 4PPTA 5BJTA 5JORA 4YGVB 2R1WB 1J10A 1RIHL 4Y16A 1G9NH 1RUML 4DVRH 2C1OA 4EXPX 4QRQA 2PO6A 1IGFL 1EBAA 1RSFA 1D6EB 4KGJA 3QIBB 2VL5B 2ICWB 1JF1A 1CT8A 2FWOB 3BGAA 2Z92A 2BDNH 4YDLC 1OGTB 4K55A 5CGMA 3C2AL 3GUTB 4NKMB 3FQXB 4BQCA 5JPMB 1I8KA 2OCFD 4RWYH 4V2BA 5CZXC 1JNJA 3FO1B 1CTNA 1Q0YH 4HQQL 4EOWH 2RR3A 4FQXD 1YEJL 1KIUA 4APQC 5IVOA 2R56H 5A3ID 3QO1B 1GGCL 1JK8A 3RAJL 2EYTB 3H3BC 5L88H 1IFHH 5I16B 4HWBL 3NCEB 4DK3A 3RKDC 2WBJB 4D8PA 2ICWJ 1UCBL 2ADFH 1I1FB 4OF8A 3ULSB 2XQYK 5J3HC 1TZHA 3LRSA 1YJDH 1IAIM 3S8WA 5F6IC 2V2TA 2H8PA 1P9MA 4WW2F 5GIRA 3X14A 1YUHB 1NGYB 2GY7B 3SKOB 3WFBH 1IC7L 4NQVA 1DQLL 1MRCL 3BRGC 3BKMH 3QG6A 3C6LB 1U8QA 4U1MB 1L0YA 3S34L 4ZUVB 4NHCH 4Z7UF 5CUSL 2G5BB 5K9KA 1ORQA 4WFGD 4HIJB 4LFHD 1T2QL 4JO3L 4TOYL 4XAWH 5T1DL 4M1GH 1OARH 4XBPB 3HC3H 1IGML 4NSKB 4XVUC 4XI5C 4NIKB 5T3ZH 1C08A 1AJ7L 4YHIA 3UAJD 1FVCA 5BRZD 4MA7H 4JFED 1OAZH 4PRPD 3ARFA 4HJ0D 2OR7A 1F8TH 2MCPL 1X5GA 3B6SB 1NANH 4MJ5A 4PRPB 5B22A 1R3IL 3HMWH 4M6ML 4Y1AA 4KGLA 5CP7B 3TYFA 3V4PH 3VGBA 5F6IB 1MCKA 2CO6B 4XHJC 5E1AB 4FMFA 3O2WL 3B9AA 3MZGB 3MV9B 3L3GA 2BSSB 3UTZB 3VH8A 4Z0XB 3EJYC 1K4CB 4L3AA 3ZDYE 2VRAA 2EIZA 1U95B 1JPTL 1A47A 4MDJB 1TMCB 4KUZH 1KEGL 2FO1A 3EO0B 1S7WB 3GMMA 1ZWIB 2EH8L 4KV5F 5DK2B 1QRND 3L3JB 1HKFA 2H6PA 4KKNA 4NGHL 2X4OA 2VXTL 4YUEH 5I1EL 5INDA 2A38A 1QBBA 4FXKA 4G6MH 2C5DC 4OIAA 5JMRA 4NPYB 2DIAA 2IH3B 3RWEA 1IEBA 3QNZA 1P5UA 4XRCB 1OL0A 3FT4B 2FHBA 5ECJE 1ORSA 5TGBA 1U58B 3O6FB 4ZO8A 4LCIL 4WU5B 5E8EB 2VH5L 3PXJA 5HGGS 3MRPB 1WWBX 5FHAL 5C08E 1HHKB 1J8KA 2BRQA 4OF3A 4R4FL 4DAGH 5FYKH 1KTDB 5DWUH 2BRRL 2VXVH 3IDGB 2QJDA 1L9NA 2BP3A 2OTPA 4AENB 2AJZB 1WZMA 5CGYC 1E4KC 4JM4H 1NAML 1WIOA 2LV4A 1EBPA 4EN3C 3W81A 3BIKB 4PJHB 1OLZA 1YQVH 4Q97A 5KSAA 4RAVA 2XWTA 5ESQA 5C0FA 3MV8E 4IOFC 3CH1A 1G0DA 4IRSC 1T03L 3FB5B 4CVZB 2DM7A 2Z8RA 4R90H 5HHVL 4OLYL 1DBKL 2HH0H 2FJHA 2R4SL 1S3KL 3QCUL 5HHME 1I8MA 5FUZL 4LQ1A 4PJHE 3MCLL 5C0AD 1VFAB 3AXLB 4PGDB 3L3IA 3S88L 1JWSA 1OP9A 3WFDL 1J1OL 4K07A 5I19L 1XGYL 2E7LC 3MYJA 4ZQKB 3VWKA 2P24B 3MUZ1 5ANMA 5MENB 3PE9A 3GNML 4NO5B 3QJFA 3GO1H 1UZ6F 1JI1A 4AK1A 4PRHD 4XPAH 1GGTA 4AIXA 4HBCL 5MEOA 2X1PA 1IC4H 3DGCR 2YD3A 3HE7C 1HXMB 4P23B 1G6VK 4RBPK 4L9LB 4OKVB 2Q76A 3VFMA 1UB6B 1MHPL 4GMTH 4XX1G 4HUKB 3TPUA 4IOSD 4PJEB 4X6FA 5F9DC 5IIEA 3IFPB 1TVHA 2VAAA 3MLTB 4IRSB 4HWZB 4HKBA 4LSQL 4PLJC 1Q9KA 1UYWL 1MEXH 3TVMC 5C09D 5DXWA 1B88A 3IAQA 3VE0A 2YUVA 3WXWH 3QUXB 3HRPA 4O2EB 3EO9H 1HINL 1RK0B 4LVOC 3TA3A 4ZTOH 5CEZE 2H32A 5KVEH 3CU1A 1AGCA 4ZTOL 1BQHG 3BO8A 4OCWL 4L8SA 3TBSB 1S7QA 3ZYIA 4YDJB 2V5RA 4DQOH 1DCLA 1FZMA 4X5XB 2MPAH 4LPYA 2VXTH 2JIXD 2YK1L 5JOFB 1A1NB 5E8DH 5J1AA 2CKBH 4LAQH 3BGMA 4PV8A 4M5ZH 4MS8C 1L7IH 2L7JA 1D5BB 1F58H 2A6KA 2HJFB 4IBLT 4Z9KB 1W0VB 1S9WB 3CVHH 1MAMH 3QXAB 1UM5L 3MRJB 3FRPG 3MV7B 2QEJA 1CICD 1JNNL 2IEPA 4HIHB 4Q9RL 3G5XB 4MX7A 1OAXL 3QCVL 5C0AB 3BEWB 1TZIB 1AP2A 5EOQH 3SGEI 3JTSA 3U1SL 4IHOA 1UQSA 1ZS8A 5I73B 1MCBA 4ZUWA 4UNTA 4X6DF 5DRXB 1GGUA 4HT1H 3RGVD 4LLMB 1CFQB 1OQXA 2R23B 1PKOA 2DQTH 3NPZB 5D70L 1MLCA 2IBZX 4JJHA 5C07D 5C2UB 4QYOA 1IZJA 1L0QA 1IGMH 5HHXL 4YFEA 4ZAKD 1G6RL 5L6YH 1F3DH 1AQDA 4TSBL 3BDXA 3PGCB 4K3JL 1A6AA 5AZEL 2AJSL 1NSNH 4MAYC 5DK0A 2Y06L 3HPLB 4RMUA 3TWCL 2VSDA 4ODSH 3RVVC 1FFPB 1S7UA 4RCAA 2DWEB 2X05A 1YQVL 4EUPG 4GAYB 3QWRA 3DGGA 4U6XB 2AV1A 5IQ7L 3CFKA 3WUZA 4PRHB 1BQLH 2UYLA 2FYYB 4MXQC 5HSFA 3PWJB 3OQ3B 2HT3C 5FYKL 5T5NF 3DETC 4BZ1L 2V9QA 2WUCH 1PEZA 4NN6B 1EAJA 4LNRB 3QDJB 1YY9D 3H42H 1S7XA 4JHAL 1V5JA 2YD5A 5HDQH 4FFYL 5ICXA 2AP2A 1ZVSB 3ARPA 5E4IA 1GOGA 2E27L 3HG1E 4XGZA 4Y7MA 3QWOB 4UQ2B 1S9KC 1SJHA 4NCC2 4PJXB 5I17B 2NW2A 2Z93A 2XZCL 1MY7A 3QG7L 2OR8A 3QUXD 4WEBL 4YHPB 3BRDA 4FQXA 1MJ7H 3I9GH 4HKXA 4DW2L 2NNAA 1S5HA 1UJTA 3MRMA 3ZT5A 4Z7OE 3S4SG 5IB1B 1LVEA 5DQ9A 1K8DB 3HPJB 2PUQT 3GI8H 1I75A 1YEDB 1T2JA 2RGSA 3GIZL 4NN5C 3I50H 3CPLB 1BX2A 3O6LL 4POYA 5E9DB 1NLDL 5JO5B 3S5LG 3LQAC 5B21A 4WNQB 3DI2B 4DEPC 4F9PC 4M5YH 4LLVB 1WIUA 4Q9BA 1EGJH 5GRVK 1I7RA 2VWEE 4U1HA 3UXFA 4YPJA 1G7IA 1XF4B 3L7FB 4J3OC 4UUJB 5I1AB 1DL7L 4X6BA 1MREL 5F89B 3RP1A 4UINH 1N6QH 1DR9A 5KAQF 4RAHA 1TLKA 2V7NA 1N8ZB 1G84A 5IEHA 3UJTH 3NCBB 5LQBL 4AJ0A 1RZ7L 3BAEL 1GYAA 3TP4A 2GSGA 1H8OA 1IGCL 1P6FA 3MLUL 2HTKC 4DFIA 1FORL 3ZTJG 2FIKA 4PREA 3L3OB 3BGFB 1ZHKA 4G9FB 5TDPB 2ZUWA 4K8RH 4OZGB 4YZFE 5AYUL 1WT5C 4ELME 5C08D 2DYPD 4S0SD 5T1MB 4OCSL 4GG8B 2ESVD 3I6KA 2IH1B 1RJYB 5GGRA 1N64H 2BOBB 2MWCA 2QR0A 2X4UA 3KLSA 4MQ7B 4ZFOB 3KYAA 5F1OB 3RZCD 3MSPA 3I75B 2R29H 1CLYL 1WAAA 2R0ZL 4GG6E 3AY4C 1A3RH 3QDMA 4N0CD 4Z7WB 3WIFA 4LEXL 5K59F 5HHMB 3K1DA 2OMNA 3NABH 2B2XH 2PW1A 4K3EH 3SGJA 43C9B 1NCBL 3RNQA 1IKNC 2R8SL 3UJTL 3WO4B 3O3EA 4G8GB 5C0EA 1UH3A 2FB4L 5F7EL 2G9HA 5L8KB 5DA0B 3VD5A 5FO8A 2VXUL 4L1HA 4EVNA 2Y9RT 1HK6A 2DMBA 4RGNE 3RAJH 1JGEA 4WFFE 4GJTB 1J88A 3BE1L 5HHNB 3BXNB 2BNRE 3HE7A 3BISA 2JCCF 4M1DH 5C1MB 4FQCH 4S0TD 4DKAA 3UTSA 4KTDH 3D6GA 2PYFB 1XIWC 4CGTA 4X9HA 2UVFA 2CRIA 5J6HA 1T80A 4ZUSA 5C0DB 2C26A 4PGZA 3WS6C 3DRQA 1F4AA 1U8JB 1DQMH 4YPGB 5HBBA 1RZKL 3I6GB 3B2UC 3TVMA 5IBLD 1CK0L 4LHUD 1P53A 1LEKA 1XZ0B 2NZ9D 3MGAA 1P2CA 1ONQB 2C4XA 1S9VA 1I1YB 5HGDA 4BUHA 3DV4B 1NEZB 3MOAH 3IETB 5FFLA 4GRLD 4HMCA 3HTLX 5TE6H 2XNAB 1G9NL 3ES6A 5EU5A 3AS0A 1B4JL 1LILA 2R1YB 2AERT 1LO2H 3MRCB 2APVA 1GC1H 5ADOL 3BYTA 3WO3B 3VA6A 1A4JB 3RJQB 4J7RA 4HS3B 2B2XL 1MCLA 4YLQT 4JDZA 2VR9A 4YWGL 4N8VG 1CDHA 3UMTA 5HI4C 4LSUL 1Z6JT 3NIFF 5ITFA 5DRWB 2VDQL 1QBAA 1A7PL 2XWBA 3S35H 3OZ9L 1VKXA 1XCQB 3T0AA 5J56B 3WFCH 4Q58C 3GMNA 4PR5A 5DEGB 5FUCC 3CLFH 1FFOB 4PJIB 4JAMA 5ISZD 1MFAL 3VXPB 1ZK9A 5AYUH 3NMEA 2DWDB 1FHGA 4DGIL 1P84K 4ORGB 2AV7B 2M8XA 3MA9H 1FLRL 2VDRL 4X7TA 4M03A 1ADQL 4CU6A 4F7CA 2CGRH 3O3BA 2UWEB 2DF3A 5EU3A 1T5WA 2CD0A 5J8OA 3DX6A 5EU7E 3C60A 3HA0A 3ARED 1QR1A 3W0WB 1HQRA 1MCRA 4PY7B 4Y4FC 5JOEA 2XWJB 3BDBA 1J05A 4O51B 5IB3A 3IFLL 2Y25A 3WFEL 5FV1L 3I3BA 3FZUC 3NN8B 1OW0C 4I4WA 1DQJA 4CKVX 4N8CH 4TTDD 4ZUTA 2YC1A 2ITCA 5FF6A 3A6CL 1X7QA 3RJDA 5ACZB 4N9GA 2FX7H 3EHBD 1ZLWH 1CFSA 3RA7L 2R4SH 5D8JL 4RISH 2P8PA 2OJZL 2YEZB 2CDFA 3WDJA 1SEBB 1NEZG 3P9LB 4BSVA 4OLUH 1T03H 1W72L 3UTTE 1F45A 2DLIA 3BRFA 1RJZA 3BP4B 4JQVA 4YHYB 1KGCE 5IW1B 1X5KA 4M43H 1NCCH 4HUWA 4JPIA 1Q9WB 4QT5B 5HVFB 4IRJC 3REWB 4PJGA 2OL3H 4ZG1A 2YUXA 1HINH 3TO2A 4Z5RB 5CIPH 3RQ3A 5FECA 5GRXG 2K1MA 5GGSB 4WTZA 2E9JA 3K8MA 4ZPTA 1D5ZA 3KLHC 2P5WB 3TT1L 1JRHL 1D9KA 4OF0A 1F02I 4PGBA 1ZGLB 3SJVB 4GG6F 4YHZL 4LCIH 1O5DT 2X6MA 3VW3L 3V0VA 1FO0L 4XBGB 3ULUC 1QSFA 3GMOA 4M1CD 4F37F 3B9EA 4Q6IB 5FXCH 5E7BA 1JPFA 5EO1B 1YPZB 2OTUA 4MHHG 1EJOL 1J0HA 1IC4L 4PJAA 4XPAL 4JHZA 4N5UA 5D5MB 4ELMF 3V7AE 4EUPB 3CX5J 2AEQH 1DBBL 3DECA 1CI5A 1W72A 3BH9A 3ULVF 5HHXH 1H3XA 25C8H 4OFYD 4LQFL 3CSPA 3BZ4A 3MUGA 3VI3F 4I0KA 4OGXH 5CEYB 4LHUA 3OR6B 5IBTH 4MJ6B 1HH6A 5INCA 3IRPX 4MJIB 5LKNA 3NH7L 3WHXB 2YMXH 4AEEA 3TBVB 3IXAA 5T3XE 2BMKA 5FYJU 4OLYH 5A2KH 3GIVA 4BZ2H 1QQDB 1NC2A 2ESVA 3LSOB 2GAZA 1T1ZB 1MVFA 2C9AA 4TN9A 5BVJA 3MROB 5E94B 5A2LH 2EEAA 3V4UH 3L3KA 4QHNA 3TBWB 4TQEH 3QIWC 5D2NB 4P2OB 4R2GD 3STLB 1K2DA 4LLUA 4FABH 1KIPB 1AJ7H 1G7JB 3FQWB 4WFEE 4MA3A 3KPRB 5AG9A 3O6ML 3RPKA 4L3EE 3QT2A 3FHQA 2VMFA 2CLRB 2ICES 3QAZC 2AEQL 3MXVL 4HIXH 1NCTA 1MCPH 3S5LB 5FUOL 3EOBB 4XNMB 1TVBA 2A6DA 5AEAA 4MD0B 2EO1A 5EUOA 2XT1B 3RWGA 3QIWD 1WBZB 3BQUC 4LLWA 2X4SB 2Z0BA 2P5WD 4GW4A 5IHUH 1U92B 2J8UB 1K9TA 4I48B 4X4YA 1CF8L 1TQCC 2C1PA 4ZAKB 1BGXL 1Q1JL 3BKJL 4BSJA 2RHEA 4L29A 2VDOH 4H20H 5E5RB 1C16A 3QR2A 1OAKH 3VH8G 4NNXB 3CSYB 5JXEA 4HKJA 1HQ4A 1UYWH 4JVUA 1EUUA 2NY0D 1JFQL 4U6YB 5EUOF 1OTSD 2OZ4H 5DTFA 5TQ2L 4C83A 2I24N 4X5WB 4XPBH 2LU7A 3QUKA 4XX1E 3C5ZC 1D7FA 1LEIB 3TC9A 1YNKL 1FZOB 4U1NA 2YD2A 5FV2A 5FHBH 2H3NB 4MCZB 4HQQH 4EOWL 3WCYA 1OSPL 3H6JA 4KDVA 4BYHA 1KPVA 1EAPB 5FGBA 4NZTH 1SYVB 4OLUL 5HJ3A 1YMMB 1BPVA 5GRYA 1IGJB 3IDJB 5FCSH 3PL6A 4FN0A 5I1HH 2Q7YB 1RIVH 1MJ8L 3WJLC 1TTFA 3SKMB 4E41E 4JFFA 5DMKB 4ZFGL 2G75B 3QCUH 4PJDA 4QCIB 5I8OH 1DDHB 1DTUA 4OFKA 4X6DE 2HRPL 5T3ZL 1IGFH 3QEHB 3T0EB 4WO4A 2AAVA 4I0CC 4APQD 3BPLC 2D7TH 4UT9H 4XAWL 5T1DH 2BOCB 4CAGA 4JN2B 1RUMH 1T5XB 1FGNH 5DFVD 5MP6H 3AFLA 3RL1A 4R7DA 4F57L 1D5IL 3CCHB 4MSWB 4OF5A 4WU7A 5JIKA 4H88L 3OBAA 2VERN 3RWDB 3LKPB 2C3GA 4RBPH 5JXED 4H5SB 3GI9H 1Q8MA 4LCCC 2YUWA 4O4YH 5IVXA 2H2PD 5F7LB 2HVKB 4KXZI 3IKKA 3HI1B 5GJTH 2Y23A 2Q3ZA 3D85D 2R29L 3C60C 1KB5L 3FQNA 4JFDA 1YEIL 4ELKB 2BVYA 3KVQA 1YMME 4LP5A 2ADJA 4JPVH 3P4MA 4QF1A 4F9LC 1IKFH 1NAKL 2XN9D 1G7LA 3QXTA 1QLFA 3OKKA 5EO9A 5A16A 5D1QC 1EFXD 3KNBB 3OAZK 3QULA 2R56L 4P2RA 1CXKA 1KACB 5CKGA 5I8CA 5C9JB 3RL2B 1X3DA 5ALCL 2EKJA 4PG9B 4NJ9H 5AYQA 1KJ2H 4WIQA 4XB8A 4G8EB 2NY6D 3O8XA 2J4WL 1P69B 4MWFB 2HP4A 5C2BL 5F8RC 2V5TA 3DX8B 4JFEB 3T8XB 1WCBB 3I2CH 3U6RB 5C6TH 4W6WB 4ALAH 2J8OA 5SWQA 3IJYA 2HVJA 4JRXE 1MH5A 1KOAA 3MA7B 4S1DC 3QXUA 3VGFA 3BP7B 5ICYB 3GSVB 1VPOH 4GKOA 1INEL 2Z91B 4MJ2A 4LSVL 1T4KA 3TLRA 2ZP0T 5H35A 3KPNB 3GJEB 1RV6X 4HS6B 4NQSB 2P5EE 1DQML 1OAQL 3CD4A 1NLDH 3WKMH 4D94A 4C59B 4HDIA 1C5CH 5SV3A 5T5FH 4NDMB 4PJHF 5CAYB 4I0PB 5AUMA 1VFUA 1X5XA 4X8JA 1KJ2L 1TCRA 2JJSC 5ALCH 1F11A 1Q9LB 3S96B 2J8UE 1RI8A 2GJ6D 1M05B 1OSZB 3PWPD 3OX8B 2D0GA 5HDBE 43CAA 2FBJL 1JGVL 3RWCB 1PY9A 4O2FB 4WUUD 3V4VH 1MCDA 5I76A 1RMFL 1OW0A 5E2TL 4ZD3H 5LBSL 3ZE2E 1S8DA 3S34H 2JE8A 4O00A 4TSCL 2D2OA 4GAFB 4QOKD 5D1XB 3SKNA 2VKWA 4U05A 3LD8C 3HAEA 3LD8B 5ILTH 4NNPL 4K7FA 4QTHA 4K3GA 2D0HA 2XN9B 5IKCA 4HZAA 1TQBC 4I5BB 4EXKA 1WWAX 3BIBX 5C86A 6FABL 4KAQL 2DJSA 3T77A 3RUGE 1J12A 4XVJL 4UQ3A 3ZHKA 2EYRA 1EZVX 3QDGB 4AIZB 1KCUH 4BQ9A 1YEEH 2XKSA 1ED3B 8FABA 2AKRA 3C6SB 3B43A 3GSUA 3DLQR 4C57C 2D7TL 3S4SA 4LLYA 3C08L 4OZIA 4U1KB 3SDCB 2HAZA 3MBED 1A4KA 4KZEL 4UI2A 5LXGH 5FGSA 3HC0A 4YDLB 3OGCA 4JDVB 3D0LA 5CS7A 2B7DT 4LCUA 3A6BL 1F6AB 1MJ8H 3D0VA 5FOBA 2ZJSH 4LSSL 1AH1A 5CJ5A 4YQXL 2E6QA 5IJVA 5CIPB 5D4QA 2B1HL 3RI5F 4R96B 2IBGA 4LLQA 2OL3B 3ZDYF 5DD6A 4WI9A 5BOZG 4NQDB 2NX5B 3L6FB 4PJBF 3KG5A 2FLRT 4OLXH 3VG9C 3BN3B 4M1DL 1CLOH 4U3HA 3O3AA 3RVWD 4OTXL 1DQQA 2E7MA 1X4YA 2XA8L 5CLWA 3HZKA 1FYTB 3E1F1 1RZFH 1H5BB 1IL1A 3CVHL 5HPMB 3DBXB 3GMQA 5DEFB 2Q6WA 3UEZA 3LQMA 4LKCA 5CJQL 3MRHB 3O9WB 3HHRB 2ORBL 1EHAA 3JSSA 1BD2E 3I50L 3CFEB 3O6LH 4L4VB 1KBGL 3CDFA 4NCDA 1DE4A 1XF3B 3FQRB 3AM8C 5F88A 3SO5A 3PWLA 3HFMH 3GKZA 5C09B 3OXSB 5EU6A 4XP5L 3OPZL 3KLAB 1LE9A 4RFEB 4R6UA 1GJIA 3SGKA 2AK4A 3T3ME 4MB4A 3C5ZA 3PWUB 5E7FA 5LAXA 1U6AL 1Z3GL 1WV7T 1I3UA 3IDUA 1A3LH 5FKPA 2KL6A 4OT1L 4X6CE 3QUMA 2MMXA 4Z7UE 1P1ZA 4JPVL 2NY7H 3P73A 2R4RH 5D7IF 5HGBB 2RAMA 2Z35B 3H3PH 4MXVE 5IBUB 5CILH 4Z78B 3W11D 3MFFB 1NUFA 4ONOA 1LGVA 2Z31B 3TH3T 5D7JC 3WMSA 1Z5LB 2BY1A 4YXKH 2O26U 2XY2A 2GIYA 2AXGA 3U4EA 5K9QI 5FB8A 1AKJA 4JB9L 1G7MB 3VGAB 3OG4B 3SDAC 5C07B 4MXWH 3NPSB 3ARWA 3MV01 1V3MA 3M1BA 3HI6H 1NCDL 1ZA3B 2NW3B 2EZ0C 1XH3B 4XCEB 1AO7B 4RQQB 4ZPVB 3VFWA 4M4PA 3FOLB 1IQWH 3WIIH 5AAMA 3BKYH 3QPXH 4NJAH 1DP0A 3V6OE 3IAGC 4OGAC 2DL2A 3IFOA 5EFIA 1S3KH 2AJ3A 4FTVB 4TUKL 5AD0B 4QRPD 1DQDH 3KDMB 4TUJA 2VDML 4M62L 4PRIE 4X4XA 3GMRB 3T2NL 4BQ6A 1R3HA 4HCRH 1I8LA 4Y19B 5FK9A 3GBML 5E8PA 5BS0A 4KROB 1F3JA 5E5MB 3EFFA 4YX2H 4PFEA 1EJOH 2MJWA 3VFPA 3DVNA 3EYOA 5F9WC 5JHDB 2BERA 5ESAA 1CD0A 1DANU 3SDAB 4WCYL 3VRIB 2M2DA 1R3JB 3HG1D 3ULVC 1WFUA 4LGSB 4WV1C 3VFGH 3F7YA 4KVNH 4M02A 4XCCL 3VXUB 1ZANH 5F7YC 3BSZH 5L7XH 1CGUA 2QSVA 5FHAH 1J8HE 1U3HB 1HHHA 4XZUB 2YD9A 1J1PH 4KY1H 1IEAB 4L3CB 1BD2A 2ZOKB 4P57A 5E4EB 1GHFH 3G6JB 4FTVE 1G7PB 1E4KA 3C6LC 1UEYA 1DVFC 2VIRA 4M43L 2XRAL 5IQ7H 3NCFB 1MFBL 3DMMA 3GJFA 1KCLA 5CJ8A 2VDNL 5C0RH 1FL6A 3QIUB 3DO7A 4CL7A 4KQ4H 4PTTA 1U91B 2OSLA 4U6HB 5I1CH 1ND0B 4X6CB 4HF5H 4GLRI 3MXVH 5LGHH 2VLLA 3BT2H 3B3IA 3MRQA 3SDDC 3FQTB 1FPTH 2VSCA 3EUUA 1GZPA 1Y0LA 1BFOA 2VDMH 1A2YB 2UUDH 1ZHNB 1HCFX 5KSBE 2PCPB 5DR5L 3FRUA 2WWKO 4P2RE 4PRAA 3SO3C 3BQUB 4IMLA 1ZLVH 3JZ7A 1HZHL 5BS0D 4OLZH 4YO0A 3HN3A 3NACL 5EPMB 2Q8AL 2JIXA 2F5AH 5B39A 1ZHBB 1A6ZB 4HLZH 4BZ2L 2PTTA 3STBA 3DURB 2W60A 1CYGA 3G6AB 3MUHL 4MXWL 2HT2D 4U3XA 4W81A 4XPHL 4AG4L 2ATPB 1ES0B 4Z7VF 1N2RB 4M3JA 3BVNB 3MXWL 4QRRA 4E0RB 2ZSWA 3OXRA 3VD9A 2WINA 1G9NC 3U9PH 3N1QC 3U2SB 4KTYA 1A7NH 5HVHC 3BT2L 2W1NA 3SDDB 3DROB 3LMJH 4ZXBD 2YBRB 5EZIH 1QEWB 1CLZL 1E4XL 3IF1B 3X13A 2OQJB 1ITCA 2I60L 3E3QC 4PD4J 3LKNA 3L3HA 2Y07L 3OKLA 3M8OH 1KELH 1FYTE 3DHJA 3T0ED 4ZXBA 3H7BB 1PJ9A 2P44B 2XZAH 4XP5H 3V5KB 5TDOB 3VI4E 4WFFD 4YNYA 5LJYH 3F12A 3O2VH 1WC7A 1MEXL 3DX7B 4RRPA 1IKNA 3KYMA 4PJCE 1AXIB 4D3CH 3BKCH 3DARA 1WEJL 2H26A 4U7KA 4XCCH 5DHVH 3HS0A 1KYOJ 1BM3L 1EZVY 3BFOA 3GSQA 4U2YA 5EBMA 5ADOH 3RIFK 5BV7H 4HJGA 1Y6NR 3G6JF 1AXTH 4PY8J 3GSXB 3MZTA 4RIRA 1YDPB 1EX0A 1IAOA 5EO0B 5HHOB 3RY4A 4OTXH 3LKQB 3C2SA 2VTFA 1LP9A 3C09B 1P9MC 4X9FA 3VXSD 4NQCA 4QXUH 4IOFD 3NFSH 1AHWB 1L9MA 2DOCA 5DJ0B 1XGYH 3LV3B 3LH2L 1QG3A 5ENWB 5L0QC 5CEZD 5JDSA 4EN3D 4JRXA 4FG6D 3W9DA 2I9TA 2KKQA 4Q74A 4P5TA 2CXKA 3EFDH 2YHGA 1C8PA 5FUZH 1QO3B 1AR1D 4CADB 2BVOB 2FZ3A 3QXWA 4HD9A 4JPKL 2PF6A 5FGRA 3V6ZA 1OQOA 3MNVA 2ZUQC 1DBKH 2B4CL 2HH0L 2MKWA 4OM0L 4JY4A 3BUYA 5CMAB 5DVLA 3WDIA 4HC1H 1AD9A 1WBXA 1DSFL 1YPZF 5MI0C 1LD9B 1PSKL 4KXZH 5HYFA 5IB5A 3DV6B 1A64A 1BVLB 2NY1B 5F1NB 2BC4A 5ERWA 2I07B 4EEEA 5C0GA 2R8SH 2O5YH 5JR1H 2PNDA 1OAZL 3BW9B 3X3FH 5E9DD 4HXAL 5DLMH 3I3DA 4FG6C 1LP9E 2IGFL 1XR9A 4C4KT 4YXKL 5TE4H 1FSKC 4X7SL 1C1EL 4AEIL 4UNVA 3WLWD 3WL9A 4N0RA 3KPQA 2W9EL 1LO3L 1CGWA 1HI6A 5GGVL 1V3JA 1GCFA 3OL2A 1T22B 5DMGC 1RMFH 1FG2A 4I8DA 1QLEH 4OT1H 3MLVL 3WS3A 4D9QD 1JGVH 4G6AC 3KPMB 3L5XL 4Q2ZB 4Z7WE 4PRIA 1A6TB 3Q1SL 1RZ8A 4OD3L 4KHTL 5GISL 2LAAA 1PKQB 1VGKA 2VISB 3MCKA 4PJFF 1YMMD 5EN2A 4HZLB 2YPLE 3IKCA 3WBDA 2W65A 2VUYA 5SWSB 3KXFD 5EBWA 2VDLL 4YDKH 4PJ7B 5IGXH 4DCQA 1D6VL 5D7JA 3FL7A 1FNEB 3NIGE 2K7QA 4G7YL 4NRXA 1N6QL 4KFZC 3FTGB 2DQJL 5SWZE 3UC0H 1ZT7B 4XVUD 2VLJD 1WWWX 5CINH 4AZ8A 3G6JE 5D1XC 5GZNC 1F4XH 3MRNA 4OLXL 5J9PB 1UVQB 4RDQG 3G5YB 4LCCB 4NO0D 2DQFB 4HV8A 1RUKH 2JF1A 3SE3C 5ABDE 2AJYL 1QYGL 4KPHH 5GRVL 1VEMA 1XGRB 4L5FL 1BLNB 4KKLD 4I9WD 1A0QH 5KSAC 4M6OL 2Y36H 2F74A 4HCRA 3EKCA 1KC5H 5E6IB 5I18H 5E08L 3T4AB 1WIPA 4KKAD 1MPAL 5BW7A 2UY6A 1E0OB 4M7KH 1YZZA 4HEPG 5I2IB 4O5LL 5FKAB 3ALWA 2AJUH 3JXAA 3O2DA 4WWKB 4AMKL 5H2BA 2GT9B 4JJ5A 3RKDD 3N50A 1QLEL 3WN5B 2VLKE 1RPQA 4HS8H 2WUBH 2IQ9H 5GSVA 5GGUB 4KJWC 1NCBH 2HLAB 1U8PA 5EA0L 3QZWA 2VLMD 3D3VA 3QQ9D 4HKZB 1NQBA 4R4NC 3DSFH 2A77L 3D2UB 4N8PA 1CFTB 1SM3L 4HH9B 1WZ1L 4IOIB 1YJDL 4R7NB 2A83B 3C6LD 4YEEA 4POZC 3IGAB 4ODSL 3U0TB 5CSZB 5KN5A 4GQ9L 3K1KC 1Z2KA 4R97B 1RJLB 5D71H 2HTLD 4JFDE 2Q8BL 4K3DH 5KSBF 4OM1H 5GRJH 1E4WL 1KV3A 3W9EA 3W0WD 5JTWA 5I18L 2Z4QA 5GRWA 5DJZB 1C5DA 3L1OH 3I6LD 2C3VA 3ZYJA 1OP3K 5IHZA 1NFDE 1UACH 3VXMB 5JW4N 5C0IB 1N0LA 4MGXA 4ONGL 2XKNA 3UZEA 3IU3A 3NGBC 2B0SL 1JN6B 2WIIB 1DL7H 4P0DA 1GOHA 2DQCL 5FHBL 4GBXA 4NKOA 4U6TA 2CIIA 3O3DA 3HE6B 3H0TA 5DSCA 3PHQB 2EE3A 4OCLC 1XGPB 2W9DL 3T0BA 1IZKA 1N5AA 5E56A 1QFWM 1QBML 4ODVL 4YIQA 4PJAF 1KN2H 2A6IB 1BZ9B 1XMWA 2DLTA 3NFPA 3RWHB 4JM2B 3WE6B 3HNSH 2AJVH 2JCCA 3ROOA 4LEOA 3TZVB 3VXQA 1V3LA 4PP1D 4NP4H 1IBGL 5DS8B 3FCTB 5TJWK 4HUXA 2QHLA 3JUYA 1UB5B 3QNYA 1I4FB 3IS0X 1B9ZA 2DQDH 3HZYB 4OCNC 5JPNB 1KYOK 8CGTA 3QO0B 1BEYH 3D9AH 3FAWA 1KLUA 1S7RB 3O11B 5DGQA 5F1KC 3AAZA 3FMGL 5MEPB 5KVEL 2BHUA 1L6ZA 1E4XI 1BD2D 3EIFA 3L5WB 5B39G 4YBQC 3LKOA 3PABA 3DVGB 1R5VB 4YDIL 1J86A 2W0PA 1KTRL 1X5JA 5GXBB 2N7AA 4RFOL 1A7NL 3DRTB 5FM8A 5K9OA 5F3BA 4HWEL 2Q20A 4JO1L 2B4CC 1T21B 1DUYA 5IVZB 2X4TA 4KROC 4HHAB 4GRWE 4P9HL 4Y4HA 5EIIA 2ICCA 2UZIL 5F7WC 4P4RB 3VCLB 4GKZB 1INQA 4PJ5B 4UIMB 1N59B 4WV1B 2CLVA 4PGCB 1Z0MA 4XAKD 1ITBB 2ERJB 3D25A 1MELA 1Y18A 4HUUA 2QSCL 4ZOEA 1I9JH 1BVKB 1SEQH 3TN0A 2G2RB 5D7LA 3TV3L 5I74B 5IBTL 2NR6C 4KRPB 2DQTL 2CDGB 3GHBH 4CVXA 4Q6YA 2XN9E 4OZGF 1CDGA 1MOEA 5D7IE 4EN3B 1XGUA 3ILPB 5HHVH 3RVWC 3X12A 3V52H 3PHOB 2YRPA 4JY6A 1W8OA 4KJYB 3NAAH 3T0XA 2VDNH 3N85L 3STZA 3EBAA 3WKNA 3QRFM 1UKSA 4R0LC 3VFNB 1CD1B 1P7QA 2D0FA 3HUJA 5KS9E 5T33L 5IFAH 4QWWD 2OBGA 2R1XB 3VXRD 3VFSB 4CVWA 1GZQB 1JP5A 4HX1B 3MLRH 3ZT6A 1XR8B 1KTLB 2OXGA 4P46D 3TZVC 5IV2A 5KSVB 1NEUA 5IM7A 3GMLB 1Q0XL 2QQNL 3NZ8A 2A6JB 1F97A 1PDKA 2XQBH 4KRPD 4DJMA 4KDWA 5T33H 3GBLA 1VDGA 2WP3T 3ZYZA 3EO1A 1JZ8A 3QPQD 3UBXB 2E6JA 1KJ2A 4X6EB 5MERA 2NY4B 2RJMA 1PG7L 4KVCH 5C0BA 1MCWW 3V95A 2IPKB 2ICEA 2J2ZA 3MJGX 3BP5B 1VFBA 4KRLB 1Q0XH 4Z0BH 2F54D 2BSRA 3LMJL 1YNTA 1E28B 4F7MB 5EZLB 4MLSA 2CO7B 3RU8H 3VWJA 2VL4A 5JORB 1H3UA 4Y16B 3W39B 5IFAL 3HMXH 5I75C 1NCWH 2AEWA 5D9SA 1II4E 3MPCA 5F1IA 1CQKA 3SE4C 1KCRH 3LEYL 4OUUA 4HWNA 2JJWA 4HBQA 4ZFFB 2VL5A 4X9IA 5LGJA 2WV3A 1FVDB 1XCTB 1H3VA 3RDTA 5ADPH 1CT8B 3F7VB 2N7BA 4U1LB 2H1PL 2QTEA 3GUTA 3CDGA 3EOAB 3MRGB 4LVHC 4QHUB 3RUGF 1S7SB 3WFDH 3HB3D 1BP3B 1B0GA 4FXGA 2OR9L 4V2CB 5CD3A 2QADB 2VR5A 1A22B 5B8CB 3EYQC 3K80A 3WYRA 4FOMA 2AK1H 4OV6F 2FSEA 4R3SB 5MEQA 2EDLA 3L7EA 5LGKA 5DR5H 2X44D 4BJLA 5JW3L 2X5PA 1ZOXA 4PBVC 1MWAL 4ZFZA 3QAZB 1JK8B 1MI5A 2EYTA 1PZ5B 4QRSA 4OCXH 3QYCA 3CSBA 4NUGL 4O2CA 1M7IA 1RUAH 5CUSH 3OKMB 2J8UF 2GYSA 3PXHA 1HWGB 1OD9A 3GMPA 1MIML 4P4KC 4NRZA 3IJSB 1YEFH 5C8JA 3PWNB 3TBTB 4PJXE 3F7RA 1YUHA 4LRIA 1T7WA 2BRRH 1IM9D 4HGMA 3RTQA 5HYEA 1FZJB 1M6OB 1NJ9B 3P9MB 4LVHB 3EDJA 1GC1C 4NQVB 3ARGD 3NIDF 4RAUB 2NY5H 4LF3A 4D0BA 4DVBB 2ADGB 4F7PA 2GCYB 1BOGA 1OY3B 2AQ1A 1W0WB 1EJ6A 3KPSE 1IM9A 1OWRM 1IGTB 3NZHL 1RZFL 2IMNA 2CKNA 4H1LB 4ODHH 1M7XA 1EEYB 2PYEB 4XBPA 4K94L 4XPFL 3FT2A 1C08B 4ODWA 3S3PA 4NKIL 5T3XH 2I5YH 4RGNB 1QA9A 2H2PC 5IF0A 4RFNC 1PYWB 5GGTH 4PYGA 1AGFA 2ZUVA 4D2NA 1D9KD 1U8LA 1FO0A 1I7ZA 2EH8H 4HIIB 1KT2A 2FIRT 3EYSH 4M8QA 4YQXH 5EU6D 5E2UH 5CP7A 2JELH 1UWEL 2FJFB 3MRLB 4KUCF 3WHE1 2HLFD 4W4NA 4NWUL 4AL8L 1KPRA 2X9YA 3MREA 3IDYB 5KANG 4DTGH 3BP6A 2IBZY 3B2VL 5KS9B 2LQRA 3PDOB 2IALA 4XNYL 5GS1A 1BZQK 4MAUH 1AGDA 1BZ7B 4UOW1 5IJKA 3B5TA 3QJHA 3VH8B 3ECBB 3CVIH 4M7LT 4L4VE 1MQKH 2MQ3A 3QUZC 2V9RA 1U95A 5D6DA 4ONGH 1I9RH 1S7WA 1P7KB 1MFEH 4OF6A 4HJJL 3V7AG 3L3JA 3JV4B 4F8TA 2VDLH 4JFQB 5DQDL 2DMCA 1CFNA 5SX5H 4OZGE 4NPYA 4OIIH 2UZYB 2SEBA 3RWEB 1T6WA 1IEBB 1PLGH 4KKLC 4LPWA 5E9DE 2HFFA 2EYSB 4MD4B 5ID0B 2NQCA 3FT4A 5KG9B 3FAXA 4QOKB 3MLZH 4ZD3L 2P8LB 1YY8A 5I8EB 3WFCL 3IB4A 5E8EA 3BH8A 4U1IB 1ADQA 4ZUUA 4ZYKB 5HHQB 3OKOB 3MGOB 2FHFA 4JFZH 5GZND 1HHKA 5GGVY 2E7LA 1TDQA 3ARRA 3OPZH 3BPOC 4X7SH 4DGVH 1JE6A 3VJ6A 1U36A 3OKEA 4JKPH 5E99L 2A73A 3P4OB 1FL5A 4XXDB 3RVUD 2O5YL 4M48H 3BIKA 3HNSL 2VC2H 5DD3L 1LK3H 3D5OF 4RAVB 5KSAB 4P5KA 1V8HA 1H8SA 4QTIH 3PIQA 1QBMH 4ODVH 4AMKH 2LE9A 3ULUH 3FB5A 4CVZA 3QH3B 2EXWC 4JG0L 3WLBB 2B4CH 2O61A 3FRPA 1WWCA 3BEVB 2YSSA 4LKXA 4E5XB 3F5WB 4JPKH 2GSIA 3ZTJH 5EUOE 1I9IH 3MJ6A 2V7HB 1E6OL 3GB7A 2HJKA 5CZKA 4XCFH 2DD8L 4RWYL 4P46A 3MO1A 1VB9A 2RCSH 1NBZA 3C5SB 3IXTA 2X2YA 3VWKB 2WSKA 2X7LA 1KB9K 1KJVA 1RUKL 5FUCE 3QJFB 2HYMA 1FE8H 4LCWE 3QXDB 1QUNA 1EHLL 1U3HD 4BH8B 1BIIA 1KPUB 3VG9B 5HGAA 3N1MC 5FM5O 3IU4H 3BJLA 3G5VA 4OZFA 3NZHH 4P99A 4P2QD 1IAII 4JE4B 4L8BB 1MI5E 3UJJH 4PJEA 1CWVA 4PJIF 4O9HL 3VXRE 5HYSA 5EORL 1ETZA 1TVHB 2VAAB 4OD1H 4HKBB 4KK6D 3IDNB 4JZJC 3U9UA 2AQ2A 1AGBB 2KZWA 3CFJA 3S9DB 3GSOA 1AR1C 3QUXA 3AGVA 4O2EA 1CLYH 1YN6B 1HXYB 2X4QA 2HKFL 4PJBA 1T7ZA 3S36L 4C56B 1AGCB 3QUML 5AZ2H 4XCYB 5B38B 3QB7C 3B9KD 3TBSA 4BH7B 1RUAL 4L8SC 5CBAB 3JVGC 4NM8L 1PSKH 5GGVH 4OV5B 2HMID 1TPXC 3QFJA 4M61B 1IRAY 3AB0C 4F8QA 1VADB 4ZDHA 1B0RA 3TIEA 1ACYL 2YR3A 1OB1B 1HNGA 1XGTB 1S9WA 5D70H 3TIDA 3MRJA 4OFDA 4AH2A 4YHOL 1SBSH 3JUZA 1K5NA 2HN7B 4GFTB 4U6VH 1I3RA 4KPHL 3VFUA 3BPNB 4MX7B 4QRUB 1VESA 3VD4A 4U1GC 4TVPH 2ARJQ 1AP2B 2V5YA 1OAXH 1HYRC 3QCVH 1T6VN 3DXAE 4Y1AD 1I85C 1EEQA 4Z76B 3UTQA 3MBEA 1YA5A 4WJ5B 5ACMA 4UV4L 1BAFH 4Z8FL 2D7QA 3EAKA 4Y2DB 3B9KB 1RIUL 4R8WH 3F62A 1HDMA 1U3ZA 4XWGH 5HHPB 5TQ2H 1TITA 3FJTA 4PJFB 3UJIH 5EZJB 2CKBL 4LAQL 5CJOH 4TTDC 1C7TA 4CMHB 3U4AA 2CSPA 2HWZL 5EBLA 3HI5L 3NFSL 2PN5A 1D3CA 3QQ4B 4PS4H 5I1CL 3FONB 3QQ3A 2GEEA 4OCYL 1FFPA 1R3LA 3UYRL 2ERJC 4KRMB 4YC2B 4XPFH 3ZZ1A 1WJ3A 4PGEB 2F53A 4NQEB 2WBKA 4OLEA 2EEDA 3EO9L 2FATL 3PWJA 5BQ7A 1KLGB 2J88H 3GKWH 2W0KA 1G6RA 4KMLB 2J3SA 3VXTA 1WZLA 4G3YH 4QNPE 5LVEA 3L5HA 3S3SA 4J1UB 3RGVA 5GJTL 1ZANL 3EJZC 4OD2A 5ICXB 4MQSB 4S11A 4XGZB 3RZWA 3SCMA 2ICWI 2BK8A 3LRHA 3P9WB 3VFRA 5I17A 2NW2B 3V4UL 4DZBB 2ZOLA 1I1AA 3ULUE 5IVXF 4D0CB 2FLBT 1CZ8H 3M17A 2O5XH 2E9WA 4EI5A 1X9QA 3GBMH 4FQHB 2PO6C 1KG0A 1VENA 2FO4A 1CU4L 5E9DA 3QQNA 3S88H 5CWSB 1KB9J 3KWWB 4P5TC 4PJ7E 3GJFH 4PJ8A 2JKXA 4WNQA 3ALPA 4XAKE 4KI5E 4LLVA 4FZEH 2YD4A 3MMEA 3OR7B 4F2MB 1S78C 4MCYB 1I9JL 4U1HB 1LEGB 4LQFH 3C8KB 3QRGH 1DBAL 3L7FA 3LRGA 4YK4C 5DHVB 3VRJB 5LGHL 2W07A 1CXEA 1JL8A 1LK2B 2X1QA 3H9SD 3S36X 3LN9A 1TENA 5DO2D 3PNWB 2F5AL 3QUYB 1U8OA 2Q8AH 5IFJB 2V7NB 3HNTL 1Z9LA 1FNGB 5IEHB 2NY0B 2V6HA 4XC1H 1ZLWK 5IBLC 4D9RD 1GPOH 4Z7NE 4UAOB 3U7AA 4QRPB 4FZ8L 1LO4H 3T04D 3S6CA 1FJ1A 3TNNB 3VGEA 1HSBB 4NQDE 5JLZB 5F72S 1TNMA 1EEZA 1T0MB 2EIBA 3KPLA 4PP2A 3ZE1F 1EXUB 4LDLB 1Q94A 2GJ6B 5T1MA 1I85A 4PJFE 3I6KB 3ZTNH 2IH1A 4KVNL 1RJYA 3MLSL 2FRGP 1KENL 4KK6C 4XPGH 3VXUE 4CW1A 2FX9L 2NPLX 3SQOH 1DUZB 3I75A 3QDME 1U6AH 4U1JB 2FX9H 1VERA 5I9QB 1MF2H 4YX2L 5JIPA 2LTQB 1NGWA 4P9ML 5DQJB 3S37L 4G80B 3U7YH 3WIFB 9CGTA 2QQNH 1IGYA 1ZEAL 4X7CC 5JNYB 2X4PB 4QOKE 5C92A 1MJJA 1F5WA 1IQDA 3V6FA 5C0EB 1YYLL 3O3EB 2R69L 3VWKD 5EIQA 2G9HB 1AXSB 1KFAH 1NGPL 1FZKB 3MXWH 5F44A 3LKSB 1F6FB 4YHYC 1R0AL 2X9WA 4M7ZC 1X44A 3LS4L 5HHNA 3EZ8A 1JGLL 3CDYA 1ZSDA 3WIIL 5J7CC 3MCG1 3KPTA 2FDBP 4U1SB 2ITDB 4WTZG 5J12B 4P3CL 2VXQL 3AU1A 4L1DA 1N6VA 2E7BA 3WIHA 1A5FL 4TVPL 3WFEH 2W92A 3X11B 5I19H 2GJ6E 1CE1L 2MCG1 5K59E 1QSED 1UACL 4YPGA 3QSKB 4GS7C 2V2XB 4PJCB 3A6BH 2NY2C 4WEMB 2R2CA 1IARB 4H26B 5IESH 3DNKA 2HG5A 1XZ0A 2FEEI 5LXGL 3JTTA 2IFFH 1S9VB 2AXJA 3KYKH 5HGDB 5I8KH 4BKLA 4HAGA 4GAJH 4D0DB 2OS7A 1XF1A 4JQXC 1PAMA 1NCUA 3BZFA 3QHTC 4ONHB 1T1YB 1G7QA 5ALBL 1IVLA 3HUJF 1DANT 4OZHF 1WF5A 3LN5A 4HS3A 3UTPE 3BKML 3T65B 4WW2C 4XC3L 3BX7C 2VXSH 2Q86A 2Z9TA 4JDZB 2GK0B 5I75B 3QNXB 5L8LB 2YD1A 4OCRL 4TSAH 1NUDA 1UXWB 3HFML 4X98A 4NT6B 1WITA 1BQHA 2B39A 2R0WH 3W0WE 4BFGA 5DEGA 5CZVH 2DM4A 4AM0B 1RFDL 3ZYOA 1IFHL 1NCCL 5CBEB 4WUUA 3EYFA 4GBXD 3G04A 1HH9A 3MNZB 1YY9C 4QHMA 3X3GL 1J8HB 1JWUA 1JWMB 3L3DA 3PGDB 2WQRA 2UWEA 2HT3D 1CFVH 4KZDL 2FL5B 5JUEL 3NA4A 1JMXA 1GIGH 3FOMB 1JPSL 1MIEL 3VMPA 2NLJB 4C55A 4FQJH 1J05B 4O51A 1IAKB 4ZNEE 1JPTH 1MUJB 3MRFA 3RDTD 3V5HA 1AKJD 3H9SA 2W91A 3BKYL 4MNQE 5GRUH 3W2DH 1JYXA 3WXVH 4J3TA 4G9DA 1INEH 4NZJA 4ZAKC 2MFNA 2E9BA 5BXFA 4LSDA 3HC4L 3MGTB 2D7MA 2XPGA 2DDQL 3FB7B 5FF6B 1WBYB 4JM2F 4XCNB 4J6RL 1CFSB 4JZOB 2VC2L 5DD3H 2YEZA 3RVTC 2XZQL 3AS3A 5BO1L 4P5TD 1I7UB 1SY6H 4IRJA 4UV7H 3MJ8A 5IQ9A 1ACYH 2PO6D 3C87A 4K3DL 2Q8BH 12E8H 2NXZD 2FBOJ 2H9GB 5F9OH 1Q9WA 4QT5A 5MENE 1T2QH 2DQEH 3ARSA 3BI9X 3S7GA 4JPWL 4PJGB 2COQA 4G6JH 1IKFL 2FEDD 2Y7QA 1AGEA 3O41A 3SGDH 4UB0L 5C0CB 5AZ2L 1MCHA 2VZVA 3V0AC 5DJAA 5F3HB 2W38A 3CXDL 1DQLH 1A14H 1MRCH 1SM3H 1F3DJ 1IGIH 5E6ZA 2BNQB 3SJVA 4S1DD 5EU4B 3CZFA 4JFHD 5D7IA 3REVA 4GRLB 1W0YT 1NMAH 4NZRH 4MA1B 3RWIA 1KNOA 1ZT1B 4Z7UB 3AS1A 2GTZA 3GGWB 4PJAB 5DRZA 3U4BH 5CJQH 1AD0B 4X0KA 4A6YA 3EYQD 4ETQB 5CEXB 3W5MA 2GTWA 5BZDB 1DFBL 4N0UE 4P3WA 2W0FA 4F7TA 3ARGB 4WTXA 2D03L 2DJ4A 1PFCA 5DJCB 4MD5B 2VN7A 4L4TE 1BJ1J 4P49A 3O2DL 4LHUB 3WFHA 4KKCD 5IG7B 5D7SL 5KVGL 5D6DC 4J4PC 3HMXA 2JELL 3WKML 5E00A 3TA3C 1PG7X 1BBJA 1DQTA 3CX2A 4RA3A 5C0CD 1T20A 4B53A 2FGWH 1A9BA 1QQDA 4QY8B 1NLBH 4JFEE 4OAWA 1HOCB 3ZHDA 1K3IA 2GAZB 4NO0B 4TVPE 5DF0A 5JXEC 1UKQA 4NQDD 5EB9A 4FQLH 1F4XL 5BVJB 2YPVL 4DW2H 3HE6C 2ZSVA 1VPOL 1OF2A 2VLJE 3L3KB 4R0LB 3TBWA 5JHLH 2CK0H 3MR9A 2OK0L 5IMKB 4LLUB 4PTUB 4EI5D 4HMDA 4G42B 3KPRA 4NN5B 1OGAE 4YAQA 2RFXB 3A0OA 4MNGE 1ZE3C 3VWJC 3CVHB 2RB8A 5IMMA 3E6FA 2JB6B 3OWEA 4K23H 4RNRA 4PJGE 3TGXA 2BVTA 1QNZL 5IR1A 2ENYA 1XGQA 1TVBB 2A6DB 1M71A 3OJDB 1XIWB 3VD3A 4JVWA 2FR4B 1Q1JH 5GISH 1RULL 2MQCA 2XICA 1QZ1A 3TYGL 1TFHA 3KPRD 4MXVF 1A21A 4H88H 4JFPA 1HSAA 2GJZA 4X4YB 4Y5YB 3G9VA 4LDOB 4L9DA 4F57H 3P77B 4MB3A 1C16B 3CMGA 1E4XH 4NNXA 2D7OA 2DQEL 1A9EB 4PG2C 1VGEH 2GI7A 2VDPL 4I3RL 4TULH 4RSVA 5F96H 3FO2A 3MV8D 2KPNA 2FECL 3FO0L 5F71A 2IFFL 3VFVB 4OZ4A 1MRFH 3DYPA 3A6OA 3MV11 5IROC 3DUUA 2CRZA 4M3KB 3GK8L 5FM5M 4GKNA 1JZ4A 2AK1L 5C0NC 3SJVE 4HT1L 4KTEL 2EDWA 1SJXA 3HG1B 4M9PA 4CMMA 4PB0H 1RZGB 3S35X 1KPVB 1EAPA 1U3HC 3ZMRA 4P2QE 5HJ3B 2GFBA 1YMMA 3U46A 2NMSA 2KUTA 1LE5B 3SOBH 3WXVL 1JNNH 1YC8A 1KCRL 3LEYH 3LS4H 1D5MB 1R0AH 1FIGL 5DMKA 4DTGL 3HMXL 1PQZB 32C2A 2G75A 5D2NC 1A02N 4V1DA 2J8HA 4M7JL 2ZUUA 5DYOB 1WQVT 3TCLB 2A2QT 3GIZH 1U93A 1AFVL 5F93C 5C3TA 3SPVB 2DICA 1T5XA 3GBNL 4JFOB 3T4YB 4JVPA 4JFXA 1NCNA 4JRYA 3DI3B 4I2XE 4GUPB 4PRBA 3V6OA 2JB5H 1CF8H 3MFGB 3FB6B 2IMMA 5DURB 5ISZA 2WWKT 4G43A 4Y88A 3RTQC 4F3FA 4P9HC 4YXHH 1FN4A 5BCAA 4KV5E 3RIAF 3SJVD 1HILA 3MRBB 2N1KA 4LU5L 4E41D 5L7XL 3PJSA 1YECH 2PXYA 1CN4A 3L9RA 4QHLA 2XIDA 4H20L 2CUIA 4EI6B 5B3NA 2XYCA 5HYJE 5EO9B 2R0LL 2D31B 4RZCB 2OTWA 3KNBA 5L2KD 1PX3A 4P2RB 3QFJD 4JLRA 4WI2A 1TTUA 1EFXA 2OX5A 5I8CB 5L2KB 4YGVA 5IMLB 2R1WA 4ODBD 1EDQA 4NUGH 4Q0XH 4U7SA 3FQUB 2DQUL 1J1OH 1H9VA 5CHNA 4JFEA 1NPUA 3NBNA 1D6EA 4XNQB 3U6RA 3OAYH 3Q5TA 5J3HD 4GRWB 2LVCA 4M1CC 2ICWA 1JF1B 2FWOA 2BNRA 3TBYA 5SWQB 2Z92B 5IESL 1MH5B 3MA7A 4OLVL 5J1SC 5ICYA 3QPXL 3E8UH 5I1HL 4S1RL 1I8KB 2EECA 2VLRA 2Z91A 4F7EB 3BDYL 4HW6A 1CU4H 2R2EB 1DBJL 4QRRD 3NGBB 2DQUH 2LTQC 4XH2A 2X4NB 2WP3O 1QPXA 4XP6L 3RNKA 3QUZB 5IOPB 4H0GA 3KPNA 2VYRE 3GJEA 1FFQA 5EC1A 4PB0L 4H0HB 1R3KA 3MV7D 4KTEH 2XFXB 3WEXB 2DI8A 2AK4E 1NGQL 5FIEA 4NDMA 2APXA 1NGPH 4R4BA 4TYUA 2CGRL 1F58L 2Z8VC 4CNIA 4YBLC 4D8PB 5JHDE 5B4MC 4Y5VC 4NWTH 3OB8A 4UU9B 2R69H 1PGRB 5E8DL 1M05A 1OSZA 4XMPL 43CAB 4XMKH 2H8PB 5GIRB 2M26A 1CXFA 2VDOL 1YNLL 1T66D 1XF5B 5EUKB 3CC5B 4TRPL 3ZO0A 2OL3L 4NC2B 4OFYA 5HYIA 1N5YL 3WD5H 3H8NA 3GEWB 2Y1VA 2ATKB 3SKNB 2AQ3A 3QG6B 1N5YH 1U8QB 4U1MA 4K7FB 4QTHB 4ZUVA 3TH4T 2HJLA 2XN9A 5IKCB 4I5BA 5K9KB 3TF7C 4XP4L 5TFSH 4KI5D 4JCMA 4JGJA 1JI2A 4RA0C 3VXME 2Z31C 3VXUD 1YJDC 1FLTX 2EYRB 1LMKA 4YHIB 5ELIA 1FRGL 1FVCB 1MHPH 2AKRB 3C6SA 3C8HA 3INUL 3U0PB 4B41A 2X1XR 1DEEB 2IANB 5H94B 3KHOA 4UTAL 5BW7C 4N8CL 5JW5B 3WDHA 5IK3B 3B6SA 5KSBB 3ZSSA 1PW3A 1A4KB 3CFCL 3OGCB 4H8WC 3QI9B 5DVMA 4ZO9A 1HWHB 2Y5TA 4JKLA 5FOBB 2NY3B 3QEQA 3PGFH 3MV9A 2OYPA 4WO4D 1I1RA 4YHML 5CIPA 1QRKA 3K2UL 3P0YH 5D5MF 4ELMB 4PJEF 3ZKSD 2OL3A 1JIBA 1FFNA 1FIGH 1NAMB 5DD6B 4FQ2H 4MDJA 3D69A 4P3DA 3HZMA 1IQWL 1ZHLA 3O3AB 5DK2A 2LAGB 4YR6B 4TULL 2H6PB 5IW6A 3KXFA 2X4OB 3HZKB 1FYTA 3BD4A 1H5BA 4L4TD 1NCDH 3HI6L 4N9OB 5CJXC 3JVGA 4FQPA 4FXKB 3ARDC 1G7HA 3GMQB 3PQYB 4LCYA 2O5XL 3O9WA 2FB4H 3SGJC 2LFGA 5I0ZA 4K71B 2IH3A 2A0LD 3CFEA 3QNZB 4XRCA 1A7PH 1DE4B 1X5HA 5CP3H 2V2WB 3SE8L 4JM4L 3OXSA 5EU6B 5TGBB 1FLRH 1U58A 1YYMH 2VDRH 3O6FA 4RFEA 2AK4B 4YDVB 1Y6MR 4S2SB 5FA4B 1U8MA 1ZXQA 3V7MA 3MV9E 4UT7H 3RZCB 4K9EL 3U79A 4OZHE 2Z8SA 3KS0J 4I0PC 2IBBA 4NKDB 5DMJB 3UJJL 1XIWD 4GG6A 2AJZA 2WM0A 2Z35A 1S9XB 2BFVH 3QWQB 2ILLA 3MFFA 1KXVC 1U8HA 2DQDL 1UG9A 1Z5LA 1HHIA 5HY9B 1FORH 4HK0B 1R5IA 3D3VD 2HFTA 3HI5H 3TJHC 1RZIA 4M9OA 3K74B 5FB8B 5LQBH 3SKUD 3THML 1AKJB 4OI7A 4LMQI 1VACA 4JHWH 5DI8B 1N6UA 4OKDA 2R2HB 3LDBC 4ENEC 5AAWA 2OP4H 4H0IA 4DEPB 3PQYD 1F4HA 5ACLA 2VZSA 4XCEA 1AO7A 3VFWB 1VFAA 3AXLA 4C56D 4JN1H 1DEDA 3FOLA 4Q7DA 2BXZA 4FQLL 1WVZA 1JWSB 2IQAA 3N9GL 3S98A 1HYSC 1WFOA 3MYJB 4R2GB 3KJ4B 2B1AH 5ANMB 1JZ5A 4DKFL 1EFQA 3IFOB 4G7YH 4PG2A 1S9YB 3K81A 5F7MC 4FTVA 3PWPA 1NMBH 4QXWA 5DDHB 5D7LD 3G6DL 5MEOB 3H9HB 2NR6D 5D1QB 3VWJD 1QPPA 2GITB 3GMRA 2ZNWA 1HXMA 4P23A 4G8GE 2CUHA 5T1KA 4ODXB 1UB6A 1MRDH 1QOKA 1ERNA 2QSQA 3GSWB 3LN4A 4CDHA 2DLFL 3IFPA 3EFFB 4Y5XA 4HWZA 1R5WA 5E95B 2PTVA 2CKBB 1FH5L 3EYOB 2VDPH 3ARBD 4TNWK 3C08H 4JFYB 1Q9KB 4M1GL 5ESAB 5EDXA 1TNNA 3ARDB 2BVQA 2FEEL 1N64L 4I77H 5FGBC 3F7YB 1JHLH 1YEGH 3VXUA 1CGSL 2AGJL 4KROD 3ETBF 1HNFA 1H3PL 3CZJA 5JQ6H 1UADC 2H32B 5F9OL 1KB5H 2GJJA 3DUSA 4J4PD 3MLYL 3BO8B 1NANI 4JR9L 4L3CA 1IEAA 4ZXBC 1S7QB 1ROWA 1A6UL 2L7UA 2IGFH 5HYJA 4X5XA 1G7PA 1OT1A 2DBJA 4HFWB 3ROLA 1I1AC 5KVFH 5JOFA 5BO1H 3SDXB 2AGJH 3BGMB 4PV8B 5I1DA 2O5ZL 3FT3B 3QIUA 3V4VL 3QBTB 2APFA 1U91A 3H7LA 3V8CA 4P2QB 1ND0A 1W0VA 2B20A 3D39B 4TSBH 4OZFH 5DRNB 1HIMH 2HRLA 4JY5H 1I1CA 3KYKL 4MAUL 3B9DA 3CLEL 5E08H 3G5XA 3PV6B 3BEWA 1TZIA 4KI5F 4G8GD 3JTSB 4AL8H 5I1LB 4IHOB 3AVEA 3IVKA 3K4AA 2YZ1A 4J6RH 5EC2A 5ITBL 1QYGH 2R23A 3DETD 1BIHA 1ZHBA 3RUGB 2W60B 4QYOB 5C3LD 4K94H 4QGTA 1ES0A 4XVTH 3PGCA 1SY6A 4QRRB 4JO4H 3CFBA 3HPLA 4HIEB 3G5ZB 1L7IL 3LPWA 2EDKA 1S7UB 4CU8A 4FFYH 4GAYA 5HDQL 5DD0H 4U6XA 3BHBA 4NQED 3CFKB 3DROA 1EMTH 4PRHA 1OGAB 1AQKL 5JW4M 2WUCL 3IF1A 4W68A 4U0QB 5ETUA 1OGAD 3MUJA 4JKKA 3LKNB 4YC2C 1MI5D 1EGJA 1LO5B 4XWOC 3A67L 3OKLB 5IHUL 5BV7C 3HKFA 3R06B 3ARTA 2EE2A 1NAKH 2QQQA 3K8KA 3H7BA 3WJLA 3R0MA 3UTTB 4JANA 3KPPB 3F58H 3TWCH 5T3ZD 2QLVB 3QDMD 3WXWL 1TPXB 4YNYB 1UWXK 2Q87A 4YHPA 5L6YL 1PLGL 4JDTL 4DN4H 3RI5K 1S5HB 3CH8A 4TSAL 3GSQB 5EBMB 2ADIA 3GI9L 2G60L 4NOBA 1MFCL 2JJSA 3GSXA 1GSMA 1PY4A 3LB6C 5EO0A 5HHOA 4PRNB 1GPOL 1JF5A 5D96B 2VITA 1CDCA 4LASH 3HZVB 2EDHA 2L0DA 3I85A 1A7RL 4L3EB 4XP6H 1DSFH 4G9FE 3C8DA 3UPRB 4NQEE 1P4LB 5I1JL 5E4EC 3W9DB 4H8WH 4PV9A 4U33A 1X5FA 3NH7H 3Q48A 1QSEB 1XF4A 4P5TB 2F54A 1UM5H 4YZFF 2NTFB 4K9EC 3BD3A 1ZA6A 1RVFH 3AREB 1QO3A 4CADA 3TNMA 3EFDL 4OGXL 2BJML 1UWEH 3WJJA 3EYSL 1I1AD 3V6ZB 1UXSB 4PLJD 3BUYB 4CRPA 1ZT4B 4GW5A 5GGTL 1AD9B 1WBXB 3LKRB 2YN3A 4P3CH 3UX9B 1GGYA 1D5XA 1X5AA 4MDIA 4MNQB 1NBQA 3QUYC 1ODAA 2JCCE 5F1NA 3L3OA 3X3GH 5TDPA 3HE7D 1LWRA 1U2CA 1MFBH 4OZGA 5GSRA 3BW9A 4XPBL 2DN7A 4GG8A 4KJPD 1XR9B 3UDWA 2E27H 5JIIA 1PD6A 2OZ4L 4ODUA 3WL9B 3ZTNL 3ARBC 2BOBA 2QR0B 2X4UB 3BKCL 4MQ7A 5HI5D 3TT1H 3FFCE 1K85A 2J6EL 2MPAL 4DZ8A 5GZOC 3MRIB 2XKUA 3I02A 1BWWA 1T22A 1FG2B 1FVEB 3EOTH 5E03A 3QDMB 4CJ1A 3D1MC 3RPIB 2JK5A 2DBLL 2P5EA 3BWAB 3KPMA 3UYOD 3CUPB 1YEFL 5K93A 4AT6B 1A6TA 3TO4B 5SWSD 4E41B 1U8IB 2CQVA 4G8GA 3SBWA 4OCYH 5J4MA 3MCKB 2AJSH 4LCWA 4EVNB 2W65B 5SWSA 1S7TB 3PP3K 2HWZH 4LK4A 5HGHA 4WI8A 3MV9D 1JGEB 1AFVH 3KYOA 4PRDB 1LNUA 3QRGL 1JPGA 3BXNA 3DTXB 3HE7B 5D7JB 5IWLA 2WNGA 4Y4FA 4IMKA 2PYFA 3L5IA 1J5OH 1OHQA 3FTGA 3A6CH 2ED7A 5J6HB 3TV3H 3SGDI 3U30C 1IM3B 3DRQB 3F8UB 3TJHD 4GRMA 1UVQA 5IW3A 1QFWL 4KK5D 1NFIA 1DN0B 1K4DA 1MVUB 5ADPL 1ONQA 1T0NA 3VG0L 3ZKMC 4LASL 1CZ8L 3FN3A 1AE6L 3V6OC 15C8L 4X6DA 4BFIA 1EO7A 1TQCB 3M07A 1PKQE 2R1YA 3MRCA 4Z7VB 5C6PB 1CL7H 1AIFB 4W4OC 5E2VH 5I2IA 3VGAC 3RX8A 1A4JA 5ID1A 3HAEH 5F7FA 5H2BB 2P4AB 2ZPKL 3UTOA 3H3PL 2F8XC 3QI9C 2MNUA 2VH5H 2ZUXA 1SJEA 5DO2C 4Z7OF 3WN5A 3F7PC 2N4IA 3IFNL 2KZ1B 3EJYD 3GDBA 1PG7H 4KVCL 1CIDA 5GSVB 5GGUA 1U8PB 4WGWB 1KN4L 2XWBB 5DRWA 3B4NA 3UTPD 2YOCA 4LSUH 5FA3A 2VXVL 2EDFA 3ARDD 1VKXB 1KENH 4ZS7L 1J1PL 1CL7I 1CVSC 2DLEA 4JAMB 4NHUB 1LO0H 4YUEL 1J0YA 4K23L 4KK9C 3T09A 3T0EC 3ZE0F 3BSZL 1JUFA 5SWZA 2A83A 3BJ91 4M7LL 2XA3A 4S1SL 4ORGA 2BY0A 1LO2L 4X7TB 1FDLH 1RIUH 4R8WL 5EU3B 2VABA 2CK0L 2W9DH 1T5WB 2D3VA 2F54E 5HHOE 2KQNA 5L88L 4E42B 2XACC 2BVEA 1I8IB 3MV7E 1HQRB 4PY7A 3W9EB 2DQCH 3GO1L 1QFUH 5CKAA 5DT1L 3R8QA 1XAUA 4IMKC 5FDWA 1C5DB 2NXZB 1HE7A 4K94C 1EA9C 3DVIA 1X4ZA 1VHPA 5IHZB 3KHQA 4PUBL 2DD8H 3MRRB 1QVOB 5D8JH 1CIUA 3HAEG 1BBDH 2E3VA 2FX7L 1FAIH 1L0XA 2XKNB 3IU3B 2ITCB 1CR9L 4G6KH 4FHBD 3CLEH 2E9IA 1QRNA 3TT3L 2P8PB 3O3DB 2ZUQB 4KI5C 5GGRY 5DJYB 3LQAH 3PHQA 1MHEB 1JNHA 5I6XC 4HXBH 4YJZL 2A74B 5IEKA 4RMTA 4BSVB 4JO3H 4GQ9H 4XP9L 3K3QA 3DYOA 1BFVH 2FJGB 3CFDA 4GW1B 1BZ9A 5F7EH 1RJZB 3WE6A 1JV5A 4FA8A 5IW1A 5KVFL 1J18A 4JPIB 1RK1B 3K4ZA 4M6AA 1IC7H 3REWA 4LP4A 4O02L 1UB5A 3QNYB 5DWUL 3Q5OA 5FECB 1AI1L 2AI0L 5DJDA 3C60D 3HZYA 1C7SA 4IRZL 1KIRB 4RFOH 1IAIH 3QO0A 5C0BD 4P2OD 3AAZB 4EQ3A 2P5WA 5MEPA 4IS6B 4Z77A 5B4MD 3JWOC 4ONFH 5DZOA 1DVFD 2K7PA 3LS5L 5DJ6A 1WFTA 4OFVA 4OSUL 4PD4K 1QSFB 2BNQD 3VXSA 2EO9A 3GMOB 3UPAA 4I3SL 1JPFB 5BZWA 5EO1A 2IADB 1U3YA 5JDJA 1KCVL 5DFVC 1N7MH 5KANI 2ZG1A 5L9DL 1MLBA 3E6HA 1DUYB 1JYNA 3RBSA 4OQTL 4HHAA 3WUWG 2D9CA 3OV6A 1JHTA 3DOSA 4XTRC 3KPOA 1W72B 5EIIB 5DVOA 4J3SA 1T04A 2ORBH 1DN2A 1RU9L 1NMBL 1CDYA 1INQB 4PJ5A 1AC6A 1KEGH 4HWBH 4HG4J 2QSTA 1EO5A 1UT9A 2AXFB 4MJIA 3TBVA 3IXAB 1BVKA 2J5LC 2X70A 3LEXA 1FE8L 4DK6A 5D7LB 3SGKC 3VXOA 1JZ6A 3NCCB 2CDGA 4QTIL 1T1ZA 4OGAD 3N1PC 5J57B 3RVXC 3TN0D 3U0WL 5E94A 2A9ML 4R26H 5D2LF 5KVGH 3PHOA 5JUEH 1XFPA 5E6IC 1OTSC 4CJ0A 3G08A 4P2OA 1UEMA 3DXAB 4WHTA 1GGBL 1QACA 4NUJB 4L4TA 1KIPA 2EZ0D 3RHWK 4MA3B 2AXHA 1OT2A 5DZNA 1MWAB 3MJ9H 1OP3H 4JGMA 4F58H 1MJ7L 2XXCB 3AS2A 5FDYA 1R24B 3VFNA 4KUCD 2BNUB 5EOTA 1P7QB 2R15A 2VXUH 3K2MC 3EOBA 4XNMA 4XNXL 4MD0A 4QKXB 3VFSA 3U4BL 4WI4A 4JQVC 1LQSR 4HX1A 1WISA 3ARFC 4MNQD 2ZUTA 5KSVA 5D7JD 3BQUD 4GW4B 1N0XH 2OI9B 1LO3H 1UWXH 3HRZA 5C0JB 3GMLA 5MHSE 3BZEA 3NZ8B 3VXSE 1FFRA 4JR9H 3K0WA 4WW1B 2I9LB 1QR4A 4HPYH 1MHCB 1BQLL 3CSYA 3EO1B 4LLDA 4G8IA 4JZNA 5HXMA 2EXWD 5MERB 3EGSA 1A7OH 5DTFB 3KPSA 3O45A 4X5WA 4XNXH 2YPLB 3L95A 4UT9L 2ZCKL 3LOWA 3KGRA 1E28A 2X9XA