4X7FC

Crystal structure of norovirus gii.10 p domain in complex with nano-25
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
DVQLVESGGGLVQPGGSLRLSCAASESILSFNHMAWYRQGPGEQRELVAVITREGSTDYADSVKGRFTISRDNAKNMVYLLMSNLRPEDTAVYYCNRGISNPWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 27
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7fC00
2W60B 5DMJB 5TDPB 1V7ML 4PRBB 5T33L 4G9FD 1OGAA 4ZQKA 4NHCL 3CDFA 2YWZA 4HLJA 2F74B 5ALCH 1Z0NA 3C87A 2J3SA 2DLIA 4MQ7A 3QQ9C 1QLEL 1UCBH 5EUOB 3UYRL 1VA9A 4WUUD 2LVCA 3D0LA 3MUGA 5GXBB 3E6FA 3ILQD 1S78D 4PV9B 1TVHB 1ZWIB 1YEEL 5EA0L 5L8LB 1AD9B 1TJHL 1NMCB 1RU9H 3LKSB 4Y4KD 2QHLA 2DQEL 4C56D 2KPNA 4N8CL 4PV8A 2CRIA 1YPZB 4CJ1A 1R0AH 5CD3A 3QO1B 1JV5A 4HS3B 4KUZL 4NQDD 4XWOD 5TH2A 3N85H 4HS8L 4XBGA 4MLSA 2ARJA 3UPAA 4POZD 2I9LB 5BRZB 5EIIA 4PY7A 4OJFL 1ZV5A 3EYUL 3VRLF 4X6CA 2EKJA 4HHAB 4ODWB 4OIIL 1CBVH 1YYLH 1HI6B 5J1AA 4WW2A 4EZMA 3BZ4B 4NQCB 1RZKH 2K7PA 4ZODA 4YAQA 4JE4B 2PYEE 5A16A 2X4QB 3DTXA 3TBYA 1RZJC 3O41B 4LPVA 5EC1A 3BHBB 5CEYB 5IB1A 4JEGB 3HUJE 4Z7UE 3NPZB 3CVHB 3MXVH 4FNLH 4G7YH 4LBEA 4ZSOE 4X83A 4H26A 3GHEH 4Q2ZA 1U8QB 3RVVD 2WINB 2V9QA 4OTXL 4H1LG 2XIDA 3MRPB 1W0VA 4XXDA 3RWEA 4H88H 3CH1B 2Y07L 3GMRB 3WIHA 3RKDD 2VLKE 3OKOB 4OD2A 2EDXA 3QIBD 1BJMA 4R4ND 1WCBA 4NZUH 1IAIH 2XRAH 4KI5E 3KPNB 2MKLC 2ZG2A 4UI2A 2Y1VA 3PGDA 5GGSY 3HE7A 3MTRA 3RTQB 4HIHB 3T4AA 3CZJA 1U93A 4LCUA 1VPOL 3CC5B 4IBLT 3RVTC 1ZOXA 3OGOE 1ZGLB 1HH9B 3I02B 4JO3H 1M7XA 5CCKL 3AS3A 1AGFB 1IC7H 2OZ4H 1EK3A 1H9VA 5J06A 5E6ID 4LKXB 3W11D 4KKCC 4RMSA 4Y5XC 2Z9TA 2H3NA 2WUCH 1YC7A 1QFOA 3CSPA 2H2SD 2W0PA 1FVEA 5CP7A 3L3OB 3DIFB 3O81A 3RKPA 1RZ8B 1TCRB 2GJZA 3BIKB 3CIQA 4PTUA 5HHVH 1TPXC 1NGPL 1YEGH 2EYRB 4XH2A 4NQEB 5DFVD 1Q0YH 3CVHH 3WFDH 5EORH 5IV2B 4LDLB 4NP4H 1PQZB 3MGAA 3VH8G 1SHMA 1J0ZA 1JHKH 1B6DA 1ZT1A 4Z0XB 5EWIH 4P2QD 1Q9WA 3GIVA 2FL5B 1CTOA 2VDPL 4G9FA 4XCNB 2FIKB 4KV5F 1MFEH 2WNGA 4R2GB 1OPGH 3O6KH 1SYVA 1YEKH 3K2MC 1VGKA 5C0BD 4Y4HB 2R39A 3DRQA 3X12B 5HVHC 3ZDZE 1MF2L 3EYOB 4ZPTB 3H0TB 3QWOB 1KLUA 2APFA 4I3SL 5CBEB 1KJMB 3MC0A 3ARFB 4X6DA 3QUKA 1CICD 1NCDH 1ZLWH 1RMFL 2UYLB 4U6XA 5I1IL 3HTLX 1KIQA 2AXGA 3HCVB 1EFXD 2F19L 3IETA 3RWHB 1IFHL 4Y4KA 5J1TC 2AVGA 4C56A 5I1JL 2YZ8A 3LCYA 4Z7VF 1JZ5A 1JFQH 1EXUB 4OKVA 3QFDB 1X5ZA 2F58H 3CD4A 4NQDA 4R7NB 3G9VA 3UYPA 3B3IA 3EO9H 1XCTB 2YEZA 2YC1A 3PP3H 1CGUA 1V7MH 5T33H 2P1YA 3Q5YA 3FB7A 4NHCH 2P24B 2AV1B 4XRCA 5E9DB 3MGOA 4JKWA 2BRQA 1CT8B 3WJJA 3NCYP 5DD6B 3QUXB 1QLEH 3FKUS 3UYRH 5HGAA 4HWZB 3RL2B 5D7KD 4Z6AT 2EE2A 2ICWJ 3ZSSA 4QYOA 2EIZA 1DQML 1KSRA 1YEEH 5EA0H 5HHXH 1TJHH 2DQFB 5T3XE 4PLJC 2MJWA 1N64L 1WWWX 1J11A 1RD6A 2DQEH 1CLOL 4G5ZL 4N8CH 4HWBL 5C08D 1BLNB 4Y19E 4KUZH 1FPTL 2BVUA 3GBML 1LP9A 4RX4D 4HS8H 4V1DA 4UINL 2PCPA 4AZ8A 4OJFH 3QIBA 5IJVB 3V0VB 2GI7A 1DDHB 3EYUH 2BOBA 2OTUB 2VQ1A 4OIIH 1ZLWK 1P53A 4P2OB 5JNYB 4LPUA 3SE4A 5FGBC 4B50A 2CDEB 4JY6B 3KLAB 4ZO7A 3SGJC 1T22A 4RMUA 1S7XB 4KVCL 2VITA 4K7FA 1JMXA 4WTZG 1PW3A 1UZ8B 2EECA 2R0KL 1BWWA 3Q6GH 4HJGB 1MVUA 3PP3K 5FF6A 5E6IA 2GFBB 1KULA 3PXHA 4TUKL 4I2XE 3N1PC 4QCIB 5GGVY 1PEZA 5ISZE 2DTML 3BUYA 5I1DB 1HYSD 4Z5RA 3IU3A 4K2UH 2IALA 1VCAA 2AQ1A 4U7SA 5FDWB 1OTTC 2Y07H 3MFFA 5EPMA 5HDQL 4Y5XB 1F6LL 1S9YA 2PTVA 5IVOA 1H3GA 4YJZL 3LKNB 1UG9A 4XZUA 3KPQB 3FQWB 3L7FB 3C5JA 4ODUA 2V7NB 3AGVA 2BY2A 1TMCB 1TPXB 3NCFB 4LEXL 4OT1L 5ITBL 3LN9A 1WLHA 3WIIL 1VPOH 3QHTC 3U7WL 2ICCA 1RY7B 4LCWB 2NY7L 1QLRA 3PDGA 3MRBA 2FO1A 3OZ9H 2GSIA 5CCKH 2G5RA 1RK0B 5T1KB 1AC6A 2IFGA 3FOMB 3WDHA 2JCCA 4G7VL 5F89A 4NJAL 5KN5A 5C0BA 3MQIA 2R1YB 2ERJB 3EOAA 1RHFA 1CDHA 1XCQA 2DIBA 3OF6A 3S9DB 2F53E 4JGJA 3FT4B 4P48A 3B2UC 5L2KB 3H3BC 1NGPH 1SY6L 2VN4A 5KG9B 1YJDC 1CICA 5HVHB 4LCYA 2YUXA 1QSEB 5D2LB 5BS0E 3C6SB 1WWAX 2MSPA 5J9PA 4WHTA 4BJLA 3MLVL 1FNLA 2BHZA 5CBAB 2L4OA 3ZHDA 4KQ3L 4J2XA 3VXSE 3QUYD 5IKCA 4X80L 1I1YB 1U8KA 4GKZA 3OSKA 1UWEL 2VDPH 3LB6D 2OJEB 1JGDB 3VFOA 5KS9A 3DXAE 2W9EL 4YDLC 4HT1L 5D1QC 2G60L 5ECJE 2XZZA 3DUSB 4L29B 4LPXA 3ZE1E 1MFDL 1MF2H 1YJDL 1ZHNA 4X9BA 5K59F 2PYED 4U0RB 2ZZUT 4L9LA 4QHMA 3Q48A 4NSKB 1W8NA 5GS2D 1C8PA 4JDVA 1P4LA 2AXFB 1RMFH 5I1IH 2F19H 1YY8B 1IFHH 5HD8D 2VXTL 4OZGB 5IW1A 5I1JH 2H6PB 4WWKB 5C08A 1KACB 1ONQA 4J4PC 3KDMA 3RWFA 1WICA 3LN4B 4MZ2A 1WITA 4RX4A 5E4EC 1K2DA 1AGEA 4PD4J 3VRJA 5J57B 4YQXL 4GKOA 2PKDA 1DBML 1ORSB 4YPJA 1RIVH 1YY9D 3EJZC 3MRQB 3MO1B 5TF0A 3KPPA 4KI5D 3CFIC 4HKBA 3HAEA 4UU9A 1WBXB 5MEND 5FHAH 3L5XL 4LLWA 2A38A 1LILA 4HH9A 5TQ0L 1ZE3C 2N56A 4PJ7B 1DQMH 1TQBC 1G7LB 2WWKT 3HZVB 2GT9A 5JA8B 2R4RL 3HB3D 1KB9J 4NDMB 1N64H 4ZD3L 5FKAB 1CLOH 4G5ZH 4HWBH 5EFIB 2W07A 3GRWL 1FPTH 1UC6A 4XNZB 4TOYL 3GBMH 4XVUD 4JFYA 1A7NL 2N4IA 2VDRL 1FYTE 2VKWA 4FMFA 4P5TD 3VWKC 4UINH 2C3WA 3D18B 1I75A 5E1AA 3VXRE 2MNUA 4J3WA 3VU2A 1GZQA 3MXWL 1ES0B 3PWNB 2C1OB 3WBDA 4FQXD 3UDWA 5IVXB 1BM3H 1PJ9A 3BGAA 4KVCH 4JZNA 3DRTA 4P46B 4NOBA 5SX5H 1JF1A 4U1SB 3F5WB 2H26A 4XI5C 1H5BC 3BGFB 4N1EA 5ICZB 4TUKH 3OAUL 2EIBA 2DTMH 4RMTA 3IXAA 5DVOA 5LGHL 3KYOB 2AK4B 4PJHE 4P4RA 4E5XA 1JL8A 4RNRA 2BSTB 4NYLB 5HDQH 1T21A 3IJYA 4G6FB 4BQ9A 3T65A 5HI4C 2HFFB 2JB6A 4J6RL 4LEXH 4OT1H 5ITBH 3WIIH 4WI6A 5GS0D 2W65A 4JFQA 3U7WH 2NLJA 1WFTA 1CGTA 3P0VL 3PL6B 1LEGA 4E41B 5E03A 2D7QA 4G7VH 4NJAH 1VGEL 2ZUWA 3IFLL 5H94B 3B6SB 5DRWB 5EU6E 5F1NB 4MMXC 3PABA 5KSVA 2GAZA 1KIUA 1MHCB 3H9HB 2FNBA 1O7VA 1T0MA 5LQBL 2DQTL 3SQBA 2E3VA 4PY8J 5D1QB 2I27N 3UTSB 1SY6H 1RUPL 2JTDA 4NRZA 3HUJA 4M7JL 1S9VA 4QRUA 4Z7UA 3OXRA 4U1LA 4U3XA 4NKDB 5T3XD 4Q97A 4OLEA 1I9IL 5DJ8A 5SX5K 3NABL 1OB1B 3MLVH 3O8XC 2X09A 4JANA 4K94C 4KQ3H 1EFQA 1T66C 1YMHA 4Y19D 3FO9B 5LAXB 3G04B 4X80H 4XPTL 4X6DF 1CFSA 4NPYA 2DIJA 2RB8A 1YNTB 5HYSA 1A6UL 2FYYB 1AE6H 4PGEB 5K59E 2NZ9D 3D6GA 2W9EH 4HT1H 2G60H 4BSVB 3VFUA 2DL9A 5MENA 3JWOH 1JZ7A 1NGYB 4PB9L 1MFDH 2XZQL 4N0CC 1EEZA 3T1WA 3HE6B 5HYJB 2VJXA 4QF1A 5CJXC 3D87B 3MBEC 5IIEA 1KOAA 3FFDB 4G80A 4IHOA 3L3JA 5EU7C 4DWHA 2VXTH 2P48B 1LEKB 2DI8A 2Z31D 4ZOEA 4NT6B 1A1MA 5E2TL 2DS4A 4KY1L 5ISZD 1ZEAL 1BQHA 1IC1A 4LHUB 4CADA 4G8FA 5D7SL 4UBDD 4GRWE 4FXLA 4QTIL 2PNDA 5IESL 1DBMH 1GZPA 2HTKD 1G7MB 3CFDA 1AGBB 3F7YB 4V2BA 4BFGA 3RA7L 2B8OT 4PRNB 4H5SA 2Q6WA 1Q9LB 1TQCC 3CFJB 4ZFOL 2ZSWA 3VFRB 3VWKB 3MRRA 2GYSA 3IVKB 4RCAA 3OKEA 4XNQB 4FQXA 3UAJC 3NA4A 3L5XH 2BC4B 4OQTL 3X11A 1LE5A 5CLTA 4HKXA 3W39B 4WHYG 5TQ0H 2LU7A 3ECBB 2X4SA 3GZKA 1VEPA 3WFCL 5I8EB 3R06A 2R4RH 5DJYB 2B0SL 1E4KA 4JPKL 4ZD3H 1FL3A 1UKSA 3B8YA 1A47A 3MSPA 1NGZA 4ZUTB 4XNXL 2BY3A 3GRWH 3B9KD 4M93C 4QXWA 4FP8H 4BZ2L 2Y9RT 2P5EE 3CK0L 3DVNA 4TOYH 1A7NH 2VDRH 5HI3C 3QXTA 2Y4SA 4F7MA 1QEWB 1KTLB 3TPUB 4Z8FL 1BZ9A 1V3MA 3PXJA 4WI2A 4DGYL 1IJ9A 5DVMA 2OTPA 3MXWH 5C07E 1IL1B 4L3EE 5DVLA 1JRHL 4M43L 4HBQA 3E3QE 4ZUWB 4KRNA 2WW8A 1XGPB 3L3HA 1RI8A 1TETL 3DXAD 2VXUL 5GRVL 1MLBA 3CCHB 4ONHA 5F1IA 3IKKA 3MLSL 4JPIB 4RGMC 4YHPB 4LHJB 5GJTL 3L3DB 1CG9B 5LGHH 4C83B 1KC5L 2GTZA 4X6FA 3VI3F 4CN4A 4W4OA 5HHMB 5F6HI 3P3YA 1H15A 1CE6A 1HILB 3O9WD 5DK2A 5C70A 3QUMA 3SDAC 1MUJA 4XTRD 2APBA 1BJ1J 1UVQB 4DJMA 3BI9X 5I76A 3RUGA 2VDML 3G6JA 5KSBF 4J6RH 3SY0B 3QR2A 3LDBB 4R8WL 4R0LC 3GSRB 1CXKA 2YRZA 4JKLA 3RPKA 2W91A 3P0VH 1N5AB 2NNAB 4WY7L 4JJHA 4TUJB 5DQJB 1WGOA 3WLWD 1AGDA 1T5XA 5ID0A 2IMNA 2E7CA 4P23D 4IOFC 1VGEH 4PG2C 3TT3L 3IFLH 3NACL 1U6AL 2Z92B 3EO0A 3QEHA 4JCMA 5GGSB 4OBSA 3RWIB 4UILH 4U1IB 3TNNA 5LQBH 2DQTH 5IB5B 5KOMC 4KKAD 1RUPH 1LGVA 5EOCL 4M7JH 2E9JA 3RGVD 4IRSB 2BVOA 2GJ6E 1I9IH 3NABH 3ALWA 1KPUA 4I2XA 1E4XL 2Z31A 4CVZA 1CD1B 5ISZA 1FO0A 3L9RA 2DN7A 5ANME 4GFTB 1T6VN 3HG1E 1IGCL 1FYTD 4NGHL 5EDXA 4XPTH 2F15A 3VGAC 1AD0A 5DFWH 4N8VB 3SGDH 3AU1B 1FGVL 4POYA 3P77B 3JV5A 5FKPB 1A6UH 3KWWA 4RBPH 1J0IA 4K8RC 2F9BT 3F12A 1EJ6A 3TESA 1R3JA 2F5AL 5GSVA 1P6AB 1Q1JL 3VXRD 2NY4C 2X10A 1ZHBB 2GSGB 2Y72A 5BO1L 4ELKA 5FECA 1I85C 1LO3L 3U4EB 4ORGB 4PB9H 3OKDB 3QT2A 5IB4A 3TBVB 2XZQH 4RGNC 2JELH 4GRLC 4N5ED 5HGBA 1U95A 4Z7WB 3ROLB 3MJ7A 2Y25A 5DR5H 3WV0A 1SJVA 2J6EL 4U6YB 1S7QA 5MERA 1TQCB 3TN0C 1JWSA 2PW2B 2R15A 5IHZB 3GSVA 5E8PA 5I66B 4L8BB 5EOTA 5E2TH 4KY1H 4R7DB 4EBQL 1ZEAH 3TA3C 4K8RL 5D7SH 2IBGA 5BZWB 1JCKA 2XOTA 5IESH 3O11B 3DV6A 1UZ6F 2X1PA 3RA7H 1U9KA 3L7EB 2IEPA 2XTJE 3QNYB 2X4OA 2ZG3A 1R3LB 2VLRA 1JHTB 4NFBA 1MCPH 2VXSH 2ZOLA 1N3NB 2XACC 4OQTH 1OGTA 1P6FA 1K8IB 2ESVE 4F7PA 4MD5A 3WNNA 5MHSD 3QXDB 3S98A 3WFCH 4RBPK 2B0SH 5I1AA 4JPKH 5EU6D 5A43C 4NC2B 5CFHA 1M4KA 3KPMA 1FFNA 4XNXH 1FC1A 4WIQA 3U0PB 2EZ0C 3ZZ1A 4BZ2H 1PY4A 3CK0H 3M8OL 4I77L 1I8KB 3QDMB 3OJVC 3B43A 1RPQA 3JV6A 3L5WA 4O4YL 4ACPA 5JHDD 3O9WA 4Z8FH 4N1CA 4GAFB 1JWUB 4DGYH 3IDXL 1MY7A 1U58B 4LPTA 1NJ9B 1D9KC 5C0JB 3JV4A 2A6DA 1U0QA 3DETD 1JRHH 4M43H 1FV1A 2QQLL 1ZLVH 3MUZ1 2G75A 4OB5L 4MNHA 1TETH 3RX8A 1T0NA 3VI3E 4M61B 4P23A 2VXUH 4R0LB 3GMQB 1A9BA 4OCYL 4Y5VA 1X5XA 3MLSH 2FEDD 4JFXB 5GJTH 2AJUL 3WUWB 3AXLB 2NW2B 1B0GA 1I7RB 1R5WA 5HHNB 2CDFA 5K9QG 1J9CT 1CWVA 2AJ3B 1FIGL 1S9WA 4U3CA 3HN3A 5KSBE 4R4BB 3MRCA 3V0AC 1NC4D 4NC1E 5EO9A 3RGVA 4YR6B 2FWOA 2M1KA 5K93A 2NY0B 2HTLC 5F3BA 2VDMH 3A0OA 5TGBA 4R8WH 4RA3A 3MRNA 1KELL 2CLZA 1JJUA 1FZKB 3G6AB 2NYYC 1DVFC 4JM2B 3F7RA 4GBXB 2P5WD 3CMGA 4WY7H 1S7UB 1QVOA 4GKSA 1GIGH 3AFLA 5J3HD 2CIIA 1AQDB 1BFOB 1LO4L 3VXRA 4ETQA 3TT3H 3NACH 1U6AH 4LSTL 4LCCC 3SBWC 1VHPA 1LD9B 1OT1A 3K2UL 3V0WL 1CLYH 3EFFA 3SE3A 3QIWC 1J0YA 3HI6L 5GS1B 5IQ9A 4YBQC 4MJIE 2C26A 2NY4B 1CLZL 1B0RA 3OGCA 3HZMA 5EOCH 5FA3B 1WQVT 3NFPB 4XT1C 2DKSA 1ZLVK 4TYUA 1ZXQA 3T09A 1U8JA 1RUKL 4RGNB 3JBG7 4GRLB 2VIRA 1IARB 1E4XH 2AJZA 1Z6JT 4FS0A 1NMBL 5GRVK 5ICYB 5HYQB 4HUWB 1LK2B 5JR1L 2P5ED 5I1LB 3TYFA 4NGHH 1IGCH 3BP4B 4PJHA 4AM0B 3P4NA 4PJEB 1U8NB 1FGVH 2MMXA 3H9YA 3ILPB 4I0PD 2IMMA 5J89A 1R5VB 4DOHE 3UBXI 1E27A 1ZKAA 2BNUB 5C0FB 2F5AH 4OCRL 1BZ7B 1Q1JH 5HHOD 4GS7C 4G6ML 3L95A 4HEME 5E7BA 4Q74A 3BOVA 4KPHL 4WW1A 5BO1H 5KZCD 4HKZA 1LO3H 3Q6FA 4Y4FB 2OXGA 4PRHE 3FCTB 5CIPA 4L3ED 3CAFA 3MV01 3ZT5A 2HRLA 4P4KD 1IVLA 1DJSA 5DDHB 2J6EH 4QRPE 3C8KB 1U92B 4GW4B 1NGWB 5B38B 2XYCA 4H25A 3K1DA 4NKMA 4YK4C 3IXTA 1X5GA 4WO4A 5LXGL 3X14B 5C09B 4EBQH 3KR3L 1T5WA 4X7DC 4D0BA 4K8RH 1YUHA 4EKXA 2Y06L 4ZTOL 4MAYC 5IMOB 5JHDA 4RQQB 3BPCB 3KLDA 1DBKL 4RFNB 1U8IB 5JW5A 4GXVL 3QEGL 1WBYB 1QLFA 2X41A 4ERSL 1KYOK 4PR5B 1WIOA 1ZSDA 2BJML 1N8ZB 2PW1B 3FMGL 4JQVA 3S96A 4ZO6A 4I5BB 4OLXL 3CSYB 1A6PA 1EUTA 1RHHA 5DURD 4OLWL 2CUIA 5J0BA 1BVKA 5SWQB 3VI4F 1WEJL 1WVZA 5DUPL 1D9KB 5C0CD 5CJQL 1CFTB 3UTPE 4D94A 4O2EB 1HCFX 1QRNB 1S7VA 3WE6A 1WJ3A 4A6YB 2HVKA 4U1GC 4KHTL 3M8OH 4I77H 5F9WC 1MWAA 3M1BA 1WT5C 1HNFA 1NC4A 4O4YH 1AC0A 1YEFL 2GJ6D 4UTBL 4CMMA 3KLHC 4XPAL 4UNUA 3VMNA 3IDXH 5IBLC 4U1KA 3DVFA 4DZ8B 4PJBB 2DI7A 4KDTA 3KYAA 2YA1A 1HINL 3HG1D 4JFOB 3STLA 2QQLH 2K3TA 2YD5A 2Z8RA 2P5WA 1JYNA 5FA4B 3V2AR 3BZDA 4OB5H 5B8CA 1UJTA 3WN5B 3SDCC 1RJYA 3N1GC 4OCYH 4LNRA 5I2IB 1IM9B 1EDQA 2AJUH 2EDEA 2ITDB 3HZKB 4M6AA 4NUGL 4RISH 3R1GL 4U05A 2ZOKA 3QZWG 3BO8A 2C7UB 4URTB 1FIGH 5DMGC 2NY1D 2E6QA 3O3AB 1K4CB 5F7MC 1EA9C 2XN9A 3CPLB 5JA9A 2CR3A 5D8JL 1IAMA 3ARBC 1OLLA 4PYGA 3F7PC 3GSUB 1JYVA 4F58L 3PWLA 3F6LA 4MXVF 3WYRA 2ZG1A 4CN6A 2XXCB 3BEVB 5EUKA 4DKAA 1JNHB 3MV9E 3S3PA 4JFFE 4MNGE 2XZCL 3NFNB 2APXA 2H2PC 5AAMA 4ALAL 1KFAL 4OI7A 1KELH 4MVBD 5DZLA 3MCG1 4HS6A 1K3ZA 2X70A 4I0PA 1S7TA 2Q76B 3L3IA 3W5MA 2OXHA 4R97C 5GPRA 1LO4H 2VE6A 2O5XL 3KAAA 5HHOA 1EZVY 4X7CC 2XTJD 5BXFA 1NFDA 3MCKA 4LSTH 2BP3A 4HWNA 5EU4A 3V0WH 4PJXB 2L0DA 2IC2A 3PDOB 1KNOA 1S7RB 1KT2B 4KK6C 4L3EA 5D7JC 3L5JA 3QEUB 3HI6H 5E8DL 2HJKA 2P8LB 4P4KA 1P2CA 2ESVD 2VDQL 3ULUF 1CLZH 3QA3A 3LS4L 4KKLD 1IGIL 1XR9A 3T0EC 2PETA 3ZKND 5IP4A 1RUKH 4KKBC 3TBWB 3MR9A 3FQTB 2FX8L 1TZGL 1I4FA 5INDB 1NMBH 3FB5A 3HI5H 5JR1H 1F45A 3OWEA 5E8OA 4Q6YA 2B5IC 3C6LD 1BOGA 4YK4B 4BK4A 3QCVL 5HGDB 3HRZB 2YD3A 1OWWA 3DI2B 4OCRH 4ZSOB 3D2UA 4G6MH 1BQLL 1RUML 2KH2B 4KPHH 2XWBA 4JZOB 4KTDL 4BFIA 5SWSE 3AS1A 3QI9D 3ES6B 5EBWA 4XP6H 1XH3B 4Z78A 2VLKB 1IEAA 1G6RL 5IFJA 5T3XL 5C0CA 4MXQD 1RJLA 2R2HA 2R56L 3MRDB 3VD7A 1ERNA 4ZYKA 3GUTB 5LXGH 1KIRA 2ILLA 5H2BA 3ROOB 4P3WA 5IUSA 5DEZA 3KR3H 3SJVD 2AGJL 4MHHG 5DHVA 3H42L 4G8GA 1TZHA 3QG6B 3Q0HA 4GQPH 2Y06H 4ZTOH 2MQCA 3LSOB 3MZGB 5FOBB 4PJFB 1DBKH 2GJ6A 5BW7C 3VFSA 3IJHA 4GXVH 3QEGH 5IVZA 1VERA 4OFKA 4CKVX 4U1GB 1MJUL 4HMEA 5DC4B 1WC7A 3NFSL 5ADPL 4ERSH 2BJMH 4S11A 3VI4E 5F9WB 4JDZB 3WFEL 3FMGH 5I0ZA 1T4KB 5ANMA 2YBRB 4U1MA 4WU7B 2HN7B 2Y5EA 3QIUC 43CAB 1KF9B 3AS2A 4OLXH 4OLWH 2DWEA 4WV1A 3KPRB 5E1HB 4H1LB 1WEJH 2AKRB 1DQQA 2J5LC 5DUPH 5CJQH 1PAMA 3PHQA 1I9JL 2OBGA 2P4AB 5EH1A 3DGCR 2G9HB 5L8KB 1FO0L 2ZUTA 4UB0L 4KHTH 4CVWA 4MJID 4A2MA 1HNGA 5D72L 3SDCB 4L4TE 3HNTL 3MRIB 4KJPC 3S5LA 1RJCA 1YEFH 4UTBH 4XPAH 1QR1A 3H7BA 5I15L 5DZNA 3T8XB 3VXOA 1RFDL 4PJIF 5KVDL 4LFHD 1FL5A 1HEZB 1IAII 2IQAB 3ARBB 1ZLSL 3S35X 1HINH 2IH3A 1M7IB 1CFBA 2QHRL 1NC2D 1BVLA 2DM7A 4N0UB 3O3DB 2EEDA 5L7XL 3FTGB 3FAWA 3RIAF 4ZFFA 5JHLL 3V95A 4YNYB 2IPTL 1FLTX 4NNYA 4XX1E 4HUUB 5CMAB 3T2PA 2BVQB 4OGYH 3VRIB 4PRHD 1HXYA 1IQWL 3R1GH 5IWLC 5C2BL 4YIQA 2EDDA 4YGVA 1S5HB 3MRGA 3K4ZA 2ESVA 3VH8B 2IPKA 5JPMB 3IDIA 5T3ZD 4QRPD 5D8JH 1DEEA 4H1LH 3GHBL 4F58H 5D7JB 1NCUA 2Z4QB 1QHOA 3L3GA 2F54E 2ED8A 4PBWD 4CDHA 2XZCH 1A1NA 4ALAH 1KFAH 1NLDL 1MQ8A 1FJ1B 4KROD 1J88A 3C6LA 5JOFB 3LD8C 1CVSC 5CGYD 2X1OA 3SCMC 3ARYA 4Y2DB 1G6RB 3TCXA 3PP4L 2K9UA 4UV4L 4MGXA 1HSAB 1LE9B 5T1LB 2O5XH 1FNFA 1H8SA 1CGWA 2GUOA 4PLKC 1D5ZB 4DKDC 4M6OL 5H8DA 5JXEC 5C86A 5TDOA 2B5IB 5I8OH 3QI9A 4QOKB 1F4XL 5E8DH 2VABA 5INCB 2NW3B 2EO1A 4M7KH 2VDQH 1ZVSB 1FVDB 3LS4H 2CPCA 1IGIH 4GG6E 1ZTXL 1DN2A 1I7UA 3GMNA 4EUPG 2HRPL 4JY5L 3P2TA 3UTPD 1K8DB 3LIZL 4HKJA 4S1DD 3O6FB 5B39G 2FX8H 1TZGH 5EUOF 2ZUXA 3SJVA 1JGUL 2P8PB 2OL3A 2Y6SC 3MV8B 3LPFA 2CXKA 2L7UA 3WNPA 3RWGB 4GW5A 3I6KB 3QCVH 1RZFH 3DO7A 3IFOB 4OF5A 2Q20A 2ADJB 1BQLH 1RUMH 4KTDH 1MQKL 3ESVF 4AEFA 1KXTB 5FYKE 4PJDE 1PFCA 2WP3T 5GJSL 1L0YA 1OP5H 1P5VA 4NHUA 3MRKB 4M1CC 3BKYL 1F3JA 1G6RH 3MROB 4LARL 5MEOA 3K4AA 5C9JB 5T3XH 3QDAA 4F9PA 2R56H 3IRZA 2EC8A 1P1ZB 4LP5A 3FOLA 4ZOBA 3V9FA 4PJ8C 1AY1L 2PYFA 3BW9B 3H42H 1GJIA 3SO3C 3EO1B 4N9GA 1QD0A 5DVNA 4RIRA 1XMWA 2X42A 4X7EC 5HHQB 1I7ZA 4XXCA 1WZ1H 3BZEB 1MJUH 2HG5B 5D2NE 1DL7L 3NFSH 1ITBB 3QUZC 1GH7A 4I18C 3MV9D 4LLUA 1S9XA 3WFEH 4JFFD 3BPOB 2MQ0A 5DJ6B 4APQC 4UUJB 2F53B 3G5XA 1GGBL 1A6AB 1NAMA 3BP7A 5EIQA 1NC2A 3AUVA 1X3DA 5DZOA 2PXYD 1MHHB 4LHQB 1SYSA 1TDQA 4FTVE 5BJTA 3C60D 5BS0B 1X5HA 3K8LA 5CEZD 2C5DC 1CXEA 4F2MB 4RFEB 1I9JH 3P0YL 4PRHA 5IJKA 1FO0H 1HWHB 3VXSB 3NGBC 4UB0H 2DQIL 5D72H 1G0YR 1OTSC 4QRPA 3HNTH 5GHWL 1OF2A 4BH7B 2OMNA 2YXMA 1JP5A 1OP5K 4I4WA 3ZKMC 1F3DJ 4ZNEE 2OK0L 2NY6B 5I15H 4IRJC 4P5MA 5F7HA 1RFDH 1Y0LA 1B2WL 5KVDH 5ITFB 1TJGL 3CDGA 4NQTA 1ZLSH 5T5NF 1XF4B 3QPXL 4F33A 1GVIA 4Z7VB 1U8PA 2QHRH 5HY9A 3LQMA 3RBGA 3GJFA 5L7XH 2X4PB 3S88L 4HMCA 5JHLH 4B5EA 2VISA 4XVJL 2IPTH 3LKPB 4JN1H 2L7JA 4F3FA 1TVDA 1KGCD 5ERWA 5SWSD 1XGUA 4G6AC 3HMXL 1NPUA 3LD8B 5E00B 4G6JH 5C2BH 2X4NB 1NGXA 2EYSA 1QPXA 2NPLX 3V7AG 3V8OA 2AW2A 5B4MC 2NXYC 4W68A 2MCG1 1MHPL 2Y7QA 2ITCA 4L4VD 4UOJA 3GHBH 3O4LB 4BKLB 1JE6A 1VFAB 4WI5A 3SO5A 4ODTL 4WHDA 4HF5L 4NZDA 3BVNB 3N06B 4OM0L 2XV6B 4XCYA 4NCC1 1NLDH 2NY3C 1JBJA 1BX2A 4WFEE 4EDXA 1IAOA 2Q8AL 4DFHA 4P2YA 2WLZA 3PP4H 4UV4H 1AQKL 2P8MA 2SEBB 1G0XA 3OJ2C 1XIWC 2H41A 1U8MB 2WZPD 3VXNB 4PIRF 2DLHA 4MQXD 3W0WE 4PJAF 5B3JF 4M6OH 3ZYIA 1MSPA 2I9TB 1QSFA 1DQLL 1BF8A 2ORBL 4PJ9D 4Y1AB 1J1OH 2FEEL 2HLAA 1RSFA 1F4XH 1KJ3L 1QHPA 1AO7D 3IKCB 1U41A 1G7PA 2EDHA 3ZDYF 4HIIB 2G2RB 5EUOE 4HDIA 4WW2C 4NWUL 32C2A 4NO5A 1V3LA 1FZMB 1ZTXH 2A9NL 2EYTA 3RPIB 4EI6B 2EDNA 2HRPH 4JY5H 4D0DB 3O3BA 2CQVA 3LIZH 2APWA 2D7TL 2JF1A 5J11C 4MWFB 4JFDB 4OUUA 4UIMA 1BF2A 5E56A 3FQRB 2AQ3A 2HT4C 3WIFB 3SKOA 4X8JB 1JGUH 2VRAA 5LKNA 3PHOB 5IOPB 2AJYL 3JVGA 3IDNB 3GNMH 1GC1L 5CD5C 5D7IF 4D3CL 5DJDA 1YPZE 2P49B 4L4TD 5LCVL 5IBTL 1YQVH 5D6DA 4ZUVA 1PZ5A 5D1XB 2ZUUA 2FB4L 3GI8L 1SEBB 4YC2C 4GSDL 3SO3B 1MQKH 1UA6L 2NX5A 3MV9A 4JFFA 3OJDB 2HFEB 5IVNA 5GZOC 1NANI 5GJSH 4NQCE 4U6HB 1O5DT 1R24B 3BKYH 4F7TB 3QBTB 4LARH 3HE7C 3S36X 1JZ6A 3QUZB 4I18B 3C60A 1QKZL 3D25A 1T1ZB 3EOBB 5D96C 4G43A 4PREA 4FMKA 3TO4D 3TPKA 5BOPA 4ZXBC 4MDJB 5T5NG 4WEBL 1AY1H 3JWDC 1U42A 2HJFB 1NUFA 4JRYB 1FRGL 5C7XL 1IAIM 1FNEA 2A74B 2O61B 4PRAB 4YEFA 1HKLL 3NGBB 5F72S 1DL7H 4QHKI 3DYOA 3IRPX 5HBBA 4NQVA 1EAJA 4D8PB 4P99A 3IDJB 1GGBH 3OB8A 3MGTA 5HPOA 5AUMB 4H20L 5C9KA 1YEHL 4IRJB 3QRFM 4UDUB 4P3DA 1UWGL 1E4JA 1OAYL 4KK5D 5F93C 3QDGD 4RRPA 4GW1B 3WKNA 2P45B 3CXHJ 3P0YH 4F80A 2DLGA 3NIFF 5FIEA 1MFBL 2DQIH 5J56B 3RDTB 3ISWA 5DTFA 3IDMB 4ZDHA 3TVMB 5GHWH 4L4VA 1YNLL 4JKKA 2IAMD 5DWUL 2OK0H 1X7QA 1KLGA 3ILQC 1B2WH 3WNOA 1TJGH 1T7YA 3QPXH 3MLTB 4ZAKD 4Y4KC 1A64A 2PTTA 3BKJL 1T3FA 5TF1L 3U46A 5I73C 1VADB 3E6FB 5D2LF 3S88H 3DUUB 2HA1A 4G3YL 3CX5J 4M62L 4XVJH 1U3ZA 4HUMB 1XR8A 4PJ9A 3P9MA 3HMXH 4MS8D 3O3EA 1INQB 1V7NL 1AO7A 5F9DC 1ZGLM 5DSCB 5FYKD 1A8JH 1XIWB 3IGAB 5F3HA 1JV5B 1FP5A 5DJCA 4ZUUA 4EI5B 3WJJC 1MHPH 2ARJB 2GJJA 1Y6MR 3VXUD 4HIEB 4KWUA 4ODTH 1E6OL 1MLCA 5JPNB 4HF5H 4OM0H 1F8TL 3WFBL 5B3JE 4YAQB 4I0CC 1JK8A 2VQUA 5A16B 4NOFA 2Q8AH 4GKNA 4EQ2A 5J11B 1JPST 1AQKH 5EC1B 2VLLA 4NKOA 3T0DA 5IEKA 2X4RB 1L9NA 4OFYD 4LBEB 1JGLL 2DMKA 4JZJA 1DQLH 2ORBH 4CNIA 1F00I 1GAFL 4IEFB 1S3KL 5E9DE 2QSCL 1Z5LA 3QIBC 1IEHA 2P5EB 4CL7A 3L1OL 4QRQB 3C09C 1NCBL 4JY4A 5EZOL 2R9HC 1TENA 4BZYA 4XXDB 3R8QA 4NWUH 3ZDXF 3RWEB 5I8CA 4HCRA 1I1AD 1EHXA 2VWEE 2A9NH 5I17A 3TFKC 1UB6A 1T1YA 5D7IE 5IB2A 1OAUL 4JB9L 2D7TH 3FO1A 1UM5L 2VZOA 1C5DA 3QO0A 1C16A 5C07B 3PGFL 1Q38A 5J12C 3QHZL 3J8F7 1LEIB 1QYGL 2MKWA 4P9HL 2AJYH 1GC1H 5E6IC 3T4AB 4JVWA 5D96B 1HQRA 1DZBA 5LCVH 4KZDL 3ZE2F 5L2JA 5IBTH 2CGRL 1XF3B 4ZXBB 1M05B 1HK6A 2FB4H 1URLA 2VC2L 3GI8H 1HHGA 4FQ2L 5DD1L 1WBZA 2R1WB 4GSDH 1UT9A 1UA6H 1T04B 4CGTA 3WHXB 3MV7A 5ICXB 3FB6A 4KAQL 3EOTL 5CP7B 3U7AA 2PUQT 2BFVL 5F9AC 1CD8A 4XCCL 1NEUA 2VZVA 1XEDA 3QDJD 4KK9D 1QKZH 1KCRL 2X4UA 2C3XA 2FO4A 2IGFL 3DYMA 3IDGA 3QDGA 5D1ZD 4ODBD 5C0AB 1Q94A 4WEBH 2J8UF 1X5KA 5I6XB 43C9B 1ACZA 5DURB 1FRGH 4K3GA 5C7XH 5IEHA 1MH5B 2OR8A 4GG6A 2GIYA 4R96A 1IKNA 1HKLH 1B90A 2ATKB 1MCBA 3QEQD 4WJ5A 3MACL 1Z9SA 1CICC 3DGGB 2MCPL 4JRXB 4WFED 1EMTH 4ZAKA 5JDSB 2F8OA 4FZEL 3D69A 3VFMB 1C12A 4H20H 3BYYA 1YEHH 3FFCB 2PO6A 4P5KA 4U4BA 1UWGH 5F97E 1OAYH 1Y18B 4X6DB 3QUKB 3BX7C 4ORZC 3W0WD 4U6XB 1WTLA 3HR5B 4NO0A 3P4MA 3MLYL 3AC0A 2ICWI 1LDPL 1U91B 2MTPA 3LKOA 1MFBH 3WDJA 4MSWA 3UXFA 3VXMA 2V2WB 3TZVB 3QISA 2IANA 1YNLH 5FYJE 4AK1A 5I0DA 2YC1B 5L2KE 3VXUA 4AEEA 3S3JA 4CU7A 2WIIA 3DOSA 1DN0A 3G5ZA 1Q9KA 5E5MA 3QFJA 3V5KB 4WI8A 1YZZA 2ENSA 4U33A 5D2LE 3H2WA 2RJMA 5IM7A 5DJZB 1NLBL 1IGJA 4LLYB 1A0QL 5HGAB 3U2SA 3BKJH 1T2XA 5TF1H 4QHLB 4YHIA 1DUYB 4HQQL 5DUML 4OF3A 4PRIB 5BRZD 4G3YH 1IGYA 4M62H 2XWTB 3I6GA 4YHML 4IS6A 1PYWA 2V2XA 5DK3A 5IR1A 4M7ZC 4WTWA 5FK9A 1V7NH 3WS3B 1UM4L 5CSZB 4QXUL 2XXMB 3B9VA 4LCIL 4YBHA 1I9RL 3GDBA 3NA9L 4NQCD 2DAVA 2I60L 2ZP0T 1CDGA 5BZDB 4V1DB 3CFBA 4HFUL 3HC0B 2XT1B 1T1XA 5E6ZA 2M2DA 3TIDB 2LE9A 5IF0B 3C09B 2AJXL 2FJHA 2JLLA 1E6OH 4LAJH 3TBTB 1F8TH 4OZGE 1T7VA 3WFBH 1G1YA 3H7LA 3OKNA 4ZO9A 2YPVL 5F8RC 3GSQB 1MJJB 4K7FB 3V6ZA 1HYSC 4BH8B 4ZNEA 1ND0A 4HGWA 3THML 4MB5A 3VD3A 2W1NA 4WFFE 5FFLA 3MA7B 5CZXD 1JGLH 1NCWL 2ZUQB 3SDDB 2UY7A 1GAFH 4XVTL 4NM8L 2QSCH 1P5UA 2VLJE 3QJHB 4WI3A 3TT1L 5EU3A 1JWMA 3P11L 3L1OH 4L3CB 1NCBH 4PP2B 5EZOH 1CLCA 3U79A 5CSGA 3WL9B 3FO2B 3RTQD 3SDXA 3OB0K 4OZIF 4L8DA 3QDJA 5DS8B 4PG9A 4GLRI 3T0XA 1DCLA 2GTWB 3UDWC 4LSSH 5EPMB 1CGYA 1OAUH 2VL5B 5FV1L 3GSOA 4JB9H 1S9YB 1UM5H 3GB7B 3ZE2E 2R2BB 4OAWA 3TWCL 1I1FA 4PJ7E 5D1ZA 4ODUB 3PGFH 4PJGF 4EXKA 3QHZH 3P9LB 1QYGH 4P9HH 1NBYA 3V5HB 4KZDH 2CGRH 2HT3D 3QB7C 5IB3A 3GMPB 5F71A 4L8CB 2VC2H 4NQXB 4FQ2H 4MD0A 5DD1H 3QEQA 2R0LL 5F89B 4NQED 5E4IA 5BQ7A 3NZHL 3ZHLA 1UACH 3I84A 4HULB 2V7HA 2Y23A 4KAQH 3EOTH 5KSBB 1S8DA 4QLRA 3A6OA 1EJOL 2BFVH 2QLVB 4XCCH 3VW3L 5IVXE 1EO7A 3BPNB 1J5OL 5GGRA 3DV4A 3ARDC 3ELAT 1KCRH 3NTCL 2W60A 4KJQC 5T1MB 2IGFH 5TDPA 1W2KT 4PRBA 4HK0B 4XP4L 1BAFL 2Z8VC 2ZKHL 1RUQL 3FB8B 3INUL 4R2GD 3VGHA 2F74A 3ARZA 3JUZA 3LB6C 4HV8A 2W92A 3BQUD 1HDMB 2V6HA 4Y4HD 5IKCB 3IAGC 1HSBB 3MLXL 2Z8SA 3K7UA 5I75C 2D7NA 3ARFD 4PV9A 1TVHA 3MACH 3NMEA 1ZWIA 1AD9A 5HGGS 3LKSA 4U0QB 4D9QE 2DQJL 2MCPH 4MJIB 1MCLA 4OCLC 1F6AB 1C08A 3AM8A 3QCUL 4FZEH 5F1KC 4HS3A 4X5XB 2Q7NA 2I9LA 4HX1A 4KHXL 5BRZA 4LAQL 4RZCB 5K9JL 2OZ4A 5TE4L 3MLYH 2V2TA 5IW1B 5E9DD 1YY9C 4ODWA 4FQ1L 1HI6A 1LDPH 2J7LA 5DJ0B 5F6IC 1IM3A 3BZ4A 2YD9A 3QUXD 4NQCA 4M5ZL 4JQIL 3CVIL 1K2DB 1W72L 3BKCL 3EFDL 2FLRT 2X4QA 4XC1L 4M7ZB 2NXZC 3UTSE 2V9RA 3BHBA 5CEYA 5JQ6L 2FX9L 1MVFA 5E2VL 2YOCA 3KPPB 3CVHA 1PLGH 2WQ8A 2VL4A 3BXNB 2PF6A 4JFPA 3BN9D 4FQIL 4HH8A 1NLBH 3HPJB 3HB3C 1U8QA 1A0QH 2WINA 5JXAL 5CZKA 3STBA 2V5MA 3VG9C 3MRPA 2I25N 4HQQH 1D7FA 3LS5L 5DUMH 3CH1A 4OKDA 1IAKB 4XVUC 4J3OC 2ZCHL 3OKOA 2GT9B 1IZKA 4QO1A 5C0IB 1MHEB 1UM4H 3DHJA 2A1WL 4QXUH 2XY2A 4P2OD 3KPNA 4LCIH 1I9RH 3NA9H 3RTQA 2I60H 4JFYB 3F58L 5FGCB 4E0RB 3LHPL 2FSEA 4HFUH 3MOQA 4KMTL 5HYJE 1TZIB 4FQXC 1Q9OB 1HH9A 3I02A 2AJXH 1AGFA 5E1AB 5J7CC 2IWGA 2DF3A 4TVSa 2EH8L 3MMEB 2V5TA 4LKXA 4UZGA 4OGZA 1ZHKB 4TSAL 2UUDH 5FHBL 3RVTD 1E4XI 4AIZB 5A1AA 1E4KC 1EGJL 1JUFB 3L3OA 2YPVH 3DIFA 1IRAY 1RZ8A 1TCRA 2KDGA 4M8QB 3GM0A 3THMH 4WU5B 3D0VA 2W9DL 4L5FL 3MPCA 1NCWH 4NQEA 3TNMB 1AI1L 1PG7X 1ZHLA 2O26U 4XVTH 1VEOA 4NM8H 4YO0B 3TT1H 1PQZA 3P11H 3ZYJA 3MRLB 4JO2L 3SN6N 1K4DB 1IILE 3FN9A 4LRNL 5ENWB 3REWA 4Z0XA 3KJ4B 3U6RB 4P4RB 4BQBA 1BFVL 2JE8A 2R69L 4LCWD 2FL5A 5GS0C 4MJ6B 2VYRE 1T21B 4M48L 3TWCH 4XCNA 2DM4A 2FIKA 1RK1B 5T1KD 1I3RB 4JN2B 4LMQI 2DKMA 1ULVA 1SJEB 3X12A 1JPGB 3ARDB 1XF5B 5A3ID 4X8XA 2XPGB 2ZSVB 3JSSA 5EC2B 4GOSA 4U1NA 3EYOA 3OR6B 4EJ1C 5LWYL 4ZPTA 3H0TA 5L2KD 1TTGA 1QBMH 3QG7L 5CBEA 3MJ9L 1KJMA 2B20A 3ARFA 5D93C 2R0LH 3EYVB 2UYLA 4L3AA 4W4OC 3HCVA 3NZHH 3RWHA 1VDGA 4NN6B 2OCFD 3DROB 3FZUC 5F7NC 1EXUA 3QFDA 2XZAL 1T0MB 1EJOH 5I75B 1W72B 2F8VA 2UUDK 3UZQA 3VW3H 5J6HA 1J5OH 4LVNC 1JI1A 1XCTA 1S9VB 4UQ2B 4QRUB 3NTCH 4XP4H 4ELMA 3MOBL 3MJ6A 4DEPC 2ZKHH 1RUQH 5DJ8B 3NZ8A 2AV1A 1HHJB 3INUH 4MNGB 1QFHA 5E9DA 4YXHL 2YUVA 3WDIA 1CT8A 3KYMB 1UGNA 5F44A 5DD6A 3QUXA 4J23A 1X5LA 3RWJB 4NN7C 5GZNC 3VDBA 3MLXH 3VWJB 3RL2A 4P59L 4Y8AA 1CDIA 1OD9A 3B2VL 1AKJB 3LQZA 1OSZB 5HHME 4EQ3A 5F6IB 2DQFA 3P4LA 5DA0B 1D6EB 2DQJH 2NXZB 4J8RB 3ULVC 1EEZB 3T3PF 1BLNA 2Z31C 1MCSA 2OLDA 3CZFB 3X3FL 5IMKB 4V2CB 4HG4J 2ADGB 3QZWB 4YZFE 4UV7L 1HIML 4KHXH 4PLJD 4LAQH 1PEWA 3VXQB 5IJVA 1RZIB 5K9JH 3D3VE 4HIXL 5TE4H 2OTUA 2HTKC 4FQ1H 4P2OA 3VG9B 4HSQA 5JNYA 5E5UB 2CDEA 4JY6A 4TSCL 3KLAA 3V8CA 4G8FB 4JQIH 4M5ZH 3CVIH 1W72H 3BKCH 1OAQH 3DVIA 3EFDH 5CINL 3BD5A 3HHRB 5AZEL 3ZHKA 4XC1H 1S7XA 1DLHB 2DWDB 2UWEF 3UZVB 5JQ6H 1GZPB 4XNUL 1GGTA 1UZ8A 2FX9H 1NSNL 3V4UL 5E2VH 3EYFB 3ARPA 4HJGA 2Q6WB 4EDWL 5E8NB 2GFBA 4FQIH 4GRMB 35C8L 5CGTA 4QCIA 4JLRA 5JXAH 3BKML 3O2VL 2XI9A 1P9MA 4FN0A 2NCMA 2XY1A 3I6LE 2FHCA 5FDWA 4XPGL 1VEMA 4LASL 5EU7E 3ULUL 4XNYL 1A6ZB 2ZCHH 1O0VA 1GGIL 2D03L 3RX5A 4Y5XA 3UPCA 1I8IB 3RVXC 1KLFA 3LKNA 3KPQA 2A1WH 4OSUL 3L7FA 2V7NA 1GGUA 2Y5TB 3T0WA 5HPMB 3RNQB 5I1KL 3F58H 1T2JA 3LHPH 3D39E 4Z7WE 1A1OB 1CZ8L 4KMTH 4LCWA 4J3SA 4P46D 1AH1A 4PJCA 3QXWA 1Q0XL 3PG2A 5T1KA 2EH8H 1WZMA 4TSAH 2R1YA 3SDXF 3F7VB 5FHBH 3B8SA 3JTSA 3DHMA 4JG1L 4RAVB 1EGJH 3FT4A 3SQOL 4J7RA 1BP3B 2AK4D 5L2KA 1PDKA 5KG9A 2W9DH 1ED3B 4L5FH 4WENB 1AI1H 1QSEA 4G6FD 2XTLA 5DJXB 4OF0A 2O5YL 3EZ8A 3O9WC 4D9QD 4M7LT 4P57B 5CBAA 4JO2H 3KJ6L 4LKCA 4LRNH 4Z76B 1WWBX 1B4JL 3QH3B 2FR4B 5D93B 5BCAA 2EDKA 3UBXB 3IS0X 1T20B 1I1YA 2VUOA 1BFVH 2R69H 25C8L 1H15B 3PL6D 1LDSA 5IBUG 3A67L 4M48H 3LEXB 4PGBA 4A2LA 2XA8L 4YLQT 2OJEA 3EGSB 3VG0L 3VDAA 3WLWC 3DUSA 3FJTA 4L29A 4LVNB 4HWBA 1A2YB 4XNMB 5IMMB 4Y5VC 2HT2C 1MCDA 1X5JA 5LWYH 4H0IA 3T0BA 3QDME 4O51B 5D1QD 3UTSD 3FRPA 3QG7H 1FBIL 5IMLB 1T5XB 2AXFA 5ID0B 1PD6A 1CXFA 1YY8A 4CW1B 3RGVC 5ILTL 2CLVB 4OZGA 4WWKA 3FN3A 2YN3A 4L9DA 2XZAH 5ID1A 3LN4A 3ARGB 3LEYL 1MCWM 2X4TB 4K7PL 2CKBL 3BAEL 4K23L 2NY5C 1D5IL 1BIIB 2BVOB 3MOBH 1M6OB 2F54B 3MRQA 1RV6X 3E1F1 3MO1A 4YXHH 1XZ0B 5CS7A 3FQNB 1WBXA 1MCNA 2YSSB 3O2DL 4OZFG 5JIHA 1QO3B 5I9QB 3EJZD 3HE6D 3N1FC 5HYJD 2GHWB 4M5YL 4P59H 4N5EC 4JDTL 3B2VH 1R3JB 5FGBA 4PJ7A 5TDNB 3SGJA 1G7LA 3HZVA 4ODHH 4NDMA 1J0JA 4N0YL 5FKAA 4LLVB 5EFIA 1U95B 3RZCB 4UOW1 5DVKA 4LHUD 3MJ7B 3X3FH 2IAMB 2VZTA 1AGCB 1L7TL 4CMHC 1S7QB 4UV7H 1HIMH 3O45B 4RMWA 4LOUD 3LKRB 3D18A 4HIXH 2X89A 5E8PB 5EOTB 2BNRE 4XB7A 1N59B 1QRKA 4PUBL 4TSCH 3FRUA 3PWNA 2C1OA 4ZUSB 3VWKD 4OF7A 4M4PA 5IVXA 5CINH 3Q2CA 5AZEH 5C3LD 1SY6A 1SMAA 4P46A 4XNUH 3OR7B 3ZTNL 3DV6B 3JZ7A 1AHWC 1NSNH 3V4UH 5FEBA 4U1SA 5GSRB 1EVTC 4IIQC 4EDWH 3EIFA 3LPGA 4RGNE 2VLRB 35C8H 4J1UB 1WZKA 1KENL 3NN8B 1EAPB 3BKMH 4AQ1B 3O2VH 4WO4C 3BDBA 2FH6A 4F15C 2OP4L 4EN3B 4F7PB 2AK4A 1ZVYA 4WFHD 1MI5A 1S7WB 4XPGH 4LASH 3ULUH 4YDJB 1GGIH 2BSTA 3QHFL 2D03H 2VH5L 4MD4A 3S4SA 1X5FA 2D7OA 4EUPB 4OSUH 1CGXA 3KPMB 4FFWD 4XMPL 3MJGX 5B39B 2N1KA 3VFNB 2HFFA 2DMCA 2VUYA 3D1MC 3GI9L 4LSUL 5I1KH 1CZ8H 5E6YA 4JQVC 1N2RA 3PL6A 3MNZB 5D2NB 5DUBB 5HYIA 4E41A 3S37L 4MYWB 1Q0XH 2VXVL 4UT9L 3S6CA 4E9LA 1IEBB 5H94A 1LNUB 4RSVA 5I18L 3B6SA 3P40A 2MHAA 5DRWA 2VSDA 2D31B 4JG1H 4LRIA 3QXAB 2DIAA 2FEDC 1MHCA 3H9HA 3SQOH 4FTVB 2CKNA 3STZB 5D1QA 5HHPB 2AP2A 2CKBB 1RZ7L 2YXFA 5HHMD 3E6HB 2D4DA 1G9MC 5D6CB 4R26L 4Y5VB 2O5YH 1T03L 3PWPB 4LSVL 2XKNB 4PJIB 3KJ6H 2HVJB 4K3JL 1B4JH 2HMID 3T2NL 4ZS6D 3OG4B 3LEVL 5LAXA 3MRCB 3W9DB 25C8H 5ALBL 4JPVL 1U3HA 1X44A 1FGNL 3Q5OA 3A67H 4M6NL 3FQXB 2FYYA 4PGEA 2C3VB 2XA8H 3VD5A 5IQ7L 2HJLA 5J4MA 4C54A 4JCLA 4BSVA 4EUPH 3RFZC 3VG0H 1T1WA 3LRHA 2DTSA 2BVPB 1D6VL 1NGYA 3GRWA 5KANG 1CFVL 3HE6A 2EE6A 5HYJA 5E5RB 4ELMF 4YHZL 5GS3A 5BVPL 1FBIH 4Y89A 2M8XA 1NDMB 3KPSE 4IRSD 4F8TA 1UH4A 3FFDA 5SX4H 3BH9B 2CK2A 1EVUA 2EKSB 2NTFA 5DJ2B 4NNPL 5ILTH 3MA9L 4N0CD 3F7QA 1LEKA 2VR4A 3EFFB 5DYOB 4NT6A 4PJBE 3HS0B 4LHUA 2OQJB 1OW0A 3I6LD 4Z7QE 3LEYH 1B0RB 4K7PH 3KYKL 4AQOA 2CKBH 3BAEH 5B3NA 4K23H 1A7BA 1D5IH 3UEZA 1U8JB 4YE4L 4ENED 1AGBA 3F7YA 5SWZB 3ARQA 2MPAL 4D9RE 2AJZB 3W2DL 3DX7A 4QHUB 2ADIA 3HLAB 1F4AA 4AY0A 3CFJA 4CMHB 1BPVA 3VFRA 5FYLL 3O2DH 3IVKA 4W70A 4XNQA 2ENYA 3TLRA 3D39D 5DO2C 5DK0B 4M5YH 3UJJL 3W0WB 3W39A 1P7QB 1QFPA 4JDTH 4YH6A 3E3QC 3ECBA 3NBNA 4X0KB 5I8EA 3UAJD 5DJYA 4QRTB 3LN5B 3TJEL 4ZUTA 1CXHA 1YEIL 2D9CA 1MPAL 1AHWB 3DX9B 5AD0B 3K8KA 2M26A 3TF7C 1L7TH 4IIQB 4HUVB 5HYFA 1QEWA 1AXSA 3V6OA 1KTLA 2Y36L 3TPUA 1V3JA 2CSPA 1G1CA 4WO4B 3F65A 4PUBH 4J12A 1FCGA 4YFLF 4D0BB 4PJXE 1PX4A 3NCMA 1IL1A 1YUHB 2LTQC 3IFNL 4Z77B 2CLRB 4DVRL 4ZUWA 3ZTNH 3U9UB 1IQDB 5HYEA 2FATL 5BV7C 1XGPA 3EAKA 3U1SL 1G9NC 5F9OL 2WAHA 1QLFB 3PWVB 1BOYA 1ZSDB 3CCHA 1KENH 4RWYL 4YHPA 3GSWB 5HVWA 3L3DA 1CG9A 4HK3N 4C83A 2OP4H 5LGKA 4QRRE 3QDMD 1DBAL 1A3LL 5KSAB 1QACA 2R1XB 3QHFH 2VH5H 1HILA 3RIFF 4XGZA 4O2FB 4AH2B 2YUWA 4XMPH 1UVQA 3RIAK 3MX0A 3O4OB 3GI9H 4LSUH 4NO3B 3U30B 3SY0A 2E9WA 1F2QA 3GSRA 4LSPL 1G9NL 3MNWB 1MFAL 5FYKU 3I75A 2NNAA 4LLQB 3S37H 4TUJA 5DQJA 2VXVH 4UT9H 2VN7A 3AY4C 2I24N 4WV1C 3BZFB 2X40A 5C0GB 5I18H 5F6HJ 1RZJL 3RWIA 3MYJA 4U1IA 1MCIA 4RGOL 1CIUA 5IB5A 3RI5F 1FNSL 1RZ7H 5GRZA 2NY1C 1MEXL 2ZUSA 2DBJA 4IRSA 4X4ZA 4PJFE 4FFZL 4PTTB 2E8ZA 5HSFA 4R26H 1GPOL 1NBVL 2NY0D 3UTZB 2E27L 4UIKL 2ADFL 1T03H 1HHKB 4LSVH 4ZFOA 1EX0A 1IGTB 4U31A 4K3JH 3C8HA 1MELA 4WHCA 3T2NH 3LEVH 1HHHB 1KCLA 4OQTA 2XN9B 1W0YT 4JM2D 4N8VA 4NQSB 5DD0L 5ALBH 3AU1A 4JPVH 4GBXD 1P4IL 3P77A 4GUPB 1FGNH 4RAUB 5FKPA 4M6NH 5J13C 4PGCB 5IQ7H 3KPRE 3V4PL 2UZXB 2OSLB 1ZHBA 5EUKB 2GSGA 1WAAE 3LQAC 4ORGA 1D6VH 3OKDA 3IT8D 4YXKL 3BJLA 1CFVH 4Z7WA 4K8RD 3ROLA 3MODL 1L7IL 4KGJA 4YHZH 1S7TB 2NY4D 3LMJL 5BVPH 3QPQD 3TYGL 1J05B 4FFYL 2PW2A 5IHZA 4KKLC 3RHWF 4NNPH 3BQUB 3MA9H 4RGND 4GRLD 4JREC 3IDYC 3T04D 2CIKB 5I66A 4L8BA 5D71L 5JOEA 3AREB 3RWDB 1KTKE 4WUUA 5DEFA 1O7SA 1P2CB 4X98B 1EEQA 2B4CC 3KYKH 1FZOB 5BZWA 4N0UE 3WFHB 3I50L 3O11A 5KVFL 3C6LC 4YE4H 5HDBF 4JM4L 3MR9B 2MPAH 4LLMB 4WCYL 3BGMB 5DMYA 3L7EA 3QNYA 1DFBL 4PJAB 5C2UB 1R3LA 4TQEL 4ZOAA 1CR9L 5FYLH 4Y4FD 1JHTA 2D2OA 5E8OB 5FO9B 3FT3B 5FYJL 2GCYB 2J8OA 3PDDA 1Z3GL 1QTYT 3UJJH 1K8IA 5L9DL 3BH8A 5HGHB 3QXDA 2C3HA 4KK8C 3D2UB 1HYRC 4CRPA 1VKXB 3BP6B 2LTQB 1JN6A 2EH7L 3TJEH 1C7SA 2X9YA 4MXQC 2Z8WC 2A83B 2RFXB 3K3QA 1YEIH 4X5LA 1MPAH 5C09D 3U0PA 1OSPL 3WO3B 3LZFL 4K9EC 4LVEA 3QDMA 5D7IB 1BD2B 3N0PB 5JUEL 1PY9A 5IFJB 4M1GL 2VDLL 4ZYKB 2R2HB 4XVSL 2Y36H 4OBRA 4R4FL 2DD8L 4NC1C 1JWUA 1NH6A 2EZ0D 1U58A 5L6YL 4MNQE 2KKQA 4WUKL 1NJ9A 3NVQA 3VRLE 3JTTB 4QOKE 5DHVB 4G8GB 1TZHB 3IFNH 1FNGB 4KMQA 1MCKA 4ZTPL 1IBGL 4DVRH 5C0RL 2FATH 4HWEL 3RJDA 1KJ2L 3U1SH 4K07A 5F9OH 1D9KD 1N6VA 4M61A 5CUSL 3GMQA 3MLRL 1Z9LA 2ARWA 3AAZB 3HFML 4ZFGL 3FN0L 4F9PC 4JFXA 4RWYH 1QRND 2GY7B 3SHSA 1LHZA 3VCLB 1R5IA 2HYMA 2NW2A 3FRPG 3WEXB 5CEXB 1I7RA 2BOCB 5HHNA 3U4AA 2AJ3A 2B1HL 3MV8E 1T83A 1DBAH 4X6EA 1A3LH 4M3JA 4UNTA 4M1DL 5E2UL 4YR6A 4XAWL 1A7QL 1KIPB 5JTWA 3P0GB 4XXCC 4FG6D 5FGSA 4OTXH 2FEEI 5D70L 4LSPH 1G9NH 1MFAH 1D5MB 1FZKA 3G6AA 4JM2A 4KJYA 4GBXA 4FQJL 5I16B 2J6EA 2HTLD 1AQDA 1BFOA 5JO5B 4D9RD 1NFKA 2BY0A 4PFEA 1LMKA 3S8WA 1LD9A 5D5MF 1RZJH 2NYYD 4PJ5B 1IM9D 4FQHB 2KQMA 5E0QA 3WKML 3VXTB 5J13B 5JOPE 4P2QA 5GS1A 2JJUA 5IJKC 4RGOH 4XAKE 4RFOL 4GH7B 1FNSH 1OL0A 1N5YL 1DQDL 3C5ZC 5FA3A 3NFPA 1MEXH 3U7YL 1I85A 4KC3B 4FFZH 3SGKA 2QSVA 1GPOH 1PBYA 2E27H 4UIKH 2ADFH 4YBQD 4MAUL 4Z7OF 1J12A 2WQRA 5ICYA 5HYQA 2EE9A 4HUWA 1LK2A 5I1LA 3TC9A 1JGVL 3O2WL 4AM0A 5DD0H 4PJEA 1U8NA 3ILPA 2EDRA 1P4IH 3C9NB 3IDYB 2DQDL 3IU4L 4KH2A 4MA3B 3BESR 3V4PH 4CBPA 5C0FA 1EFXA 1ZMYA 3G5VB 3FT2B 2WMPA 1J87A 4KV5E 3IAQA 2YD4A 4Y4FA 5JLZB 3FCTA 3QXVA 1NCAL 4YXKH 3MODH 1L7IH 1EBAA 5DDHA 1P84K 3LMJH 2NY2C 3C8KA 1U92A 4GW4A 3TYGH 5B38A 4FFYH 2D4FA 1HXMB 5D71H 4LVHC 1A6TB 5C09A 5CAYB 2B39A 4TTGA 1SJXA 4I3SH 1QFWL 4Z7VE 3T4YB 3EYQD 4OLVL 1NUGA 3S4SG 2RQ8A 4JAMA 3GMNB 3I50H 5KVFH 4RQQA 1KJ2B 3BPCA 1VESA 1D5XA 3MREB 4JM4H 1U8IA 4WI4A 4WCYH 1DP0A 1WBYA 1DFBH 4TQEH 4PR5A 3V6FB 5EBLB 1CR9H 2PW1A 2AERT 4WTXA 4XP9L 4X4ME 3ARTA 2DI9A 4MAYD 4YDIL 4UOW0 5FYJH 1KV3A 1VFBB 1Z3GH 4I5BA 5L9DH 3CSYA 5TE6L 1G7IA 4K3DL 3EHBD 5SWQA 2VLKD 5GGRY 3BEWB 4EVNB 5GQBA 2VLJB 1CFTA 3O4LE 2RR3A 2EH7H 2B1AL 2FCBA 1NANH 3P4OB 4O2EA 1QRNA 1OSPH 1QUNA 4CU6A 1AJ7L 1FIEA 4F7CB 3LZFH 4NHUB 5JUEH 5DMKB 4OZHA 5MEOB 2DBLL 1XGYL 4O9HL 3JVGC 4M1GH 4X6CF 2VDLH 4TNWF 4XVSH 2HAZA 4R4FH 5ESAB 2DD8H 4WW2F 5D6DC 1FZJA 4DZ8A 1XFPA 4TNVF 5L6YH 4WUKH 5DXWA 4Y1AE 4CVXA 2AJVL 3QRGL 5DLML 3DMMC 5CHNA 5I74C 4JFOA 4K71C 4ZTPH 3KLHD 3GSXA 1IBGH 5C0RH 1QG3A 4RIRB 5FA4A 5IBLD 1NQBA 4HWEH 3KPRD 1KJ2H 4MB4A 4MQTB 3WN5A 1B0WA 3IF1B 3Q1SL 3MLRH 4ZFGH 4LVOC 3HFMH 3C60C 1A21A 3CUPB 3FN0H 4P2RE 5I2IA 1IM9A 2D9QB 3G5XB 4JFDE 4U7KA 4IDLA 3HZKA 2P44B 2J8UB 2C7UA 1N6QL 4S1QL 2B1HH 5EZLA 3O3AA 1MCJA 1K4CA 3SDCD 3CPLA 4M1DH 2R0KH 5E2UH 1JF5A 1L9MA 1A14L 1H0DB 1MFCL 3P30L 3IYLW 2WBJC 4XAWH 1A7QH 2P47B 5JIPA 2A6KA 1UADC 4O2CB 3BEVA 3QCTL 4ONGL 5F9JB 4TVPE 3C5ZB 5D70H 3ARBD 5E8EB 1OWRM 1NBQA 4KUCF 4IDJL 5CZVL 4N1HB 3L5IA 4FQJH 1ACYL 2Q76A 3KNBB 1KXQE 1OQXA 3HNSL 2YN5A 5L8JB 2V9TA 1S7RA 1KT2A 3GSNL 3WKMH 5DI8B 4F33B 1U8PB 1TTFA 3QEUA 3QUYA 1UKQA 4XB8A 1A4JA 3CFKB 4P3CL 2NY7H 5HDLA 2A6JB 4JRYE 4RFOH 4Z7OE 1CF8L 1N5YH 4QXTA 4NRXA 1FDLL 1DQDH 2ED7A 3U7YH 3U9PL 1JVKA 3ARVA 4OI8A 5D7JD 5ERWB 3TBWA 5IW6B 3UTOA 2DQGL 2ZCKL 4MAUH 1ADQL 1WISA 5INDA 4CN1A 2NY2B 1NGXB 4XCEB 2PYEA 2CR6A 2PTUA 4LLDB 5E2JA 1JGVH 3O2WH 4YDLB 2ITCB 1HQ4B 3T2QA 1XF2B 2DQDH 2MOVA 2AI0L 2Q1EA 3IU4H 4Y2DD 5HGDA 3HRZA 2UVEA 5T1LD 4Z7NF 4ZSOA 1AIFB 4B41A 2EO9A 4MNQD 2WANA 3CMOL 4QOKD 4YXLL 1NCAH 3T3MF 1FAIL 5KVMC 1XH3A 5BVJB 2VLKA 1UWEH 1DQJB 1BBJB 3MRDA 3TIEB 1SEQL 1JPTL 1OGAE 3GUTA 1QSFB 3O6FD 1LK3L 5E4EB 3VFTB 4MX7B 3ROOA 1TVBB 1YJDH 3TGXA 4HBCL 5K33A 4E42B 3QG6A 3MV8D 4OLVH 3F8UB 4M00A 1KCSL 2EYTB 3UTTB 3QQ4A 3LSOA 4W6YB 5FOBA 4PJFA 4K94L 3P73B 2ZUVA 1IC5L 4OUUB 5LBSL 1YYML 4JDZA 4XP9H 1T4KA 2DJUA 1UH3A 2YBRA 4WU7A 4YDIH 2HN7A 1TQBB 3FL7A 43CAA 4P5TA 5TE6H 4YQXH 1PX3A 4K3DH 1PZ5B 4OZIB 3KPRA 4H1LA 2AKRA 1KB5L 3DX8B 2AEQL 2P7TB 4HIJB 2ICWB 3VDCA 2B1AH 2NX5B 3DMMB 3M17B 3RAJL 4HZLB 3QIUD 1LVEA 4X6CE 2G9HA 4PJGB 1LP9F 4N9OB 4LDOB 1AJ7H 2GK0A 5JOPD 4IOIB 4W81A 4QHNA 1FE8L 4XAKD 3EYSL 3SDCA 2DBLH 3DVGB 3WD5L 1XGYH 4O9HH 4LIQE 5EBGA 3K0WA 4PREB 2V5RA 3DX6B 3T8XA 5I19L 1JZ3A 7FABL 1UH2A 1ROWA 3GSNB 3PGCB 2AJVH 1HEZA 2F53D 2IQAA 3ARBA 3QRGH 4JKPL 5DLMH 2WBJB 3CFEA 4YFDB 1CFQA 1FFOB 1H5BB 4H8WC 3BT2L 4IMLB 2AS5M 3FTGA 5F70A 2DMBA 5BS0D 2QJDA 5K9QI 2R23A 2A0LC 3DSNA 3Q1SH 4I0KA 4YNYA 5DD3L 4NQVB 4HUUA 5CMAA 5DRZB 2BVQA 3VRIA 1J18A 5EN2B 1DR9A 1EEUA 1KG0B 2LU4A 3VXSD 1CL7L 3LVEA 1VFOA 3Q3GB 4U1JB 1MAKA 1AP2A 3DURA 1N6QH 1JGEA 4S1QH 1S5HA 4Y16C 3VH8A 5JPMA 4KRLB 5E70A 2YS4A 15C8L 1A14H 3EDDA 1MFCH 3P30H 2GW5A 4FHBD 3PUCA 3GEWB 4FQPA 1R3HB 4NRYB 5D7JA 2NY6D 1U3JA 3G08A 2Z4QA 4HJ0C 2JIXB 3V6BR 3QCTH 5C8JB 3OAUH 4ONGH 4DN4L 1FN4B 1TNMA 3K4DA 5CZVH 4IDJH 2DJSA 1PKOA 4NNXB 1A9EB 4Y2DA 1G6RA 4ZAKC 1ACYH 2JCCF 1HSAA 1OAKL 1LE9A 5T1LA 4JGUA 2PO6C 4W6XB 3HNSH 4NN5C 1VB9A 3KS0H 4ETYA 1EO8L 2QBWA 3X13B 4QOKA 4Y19A 2QADC 5C0AE 2H1PL 3GSNH 5MEQB 5FV2A 4MS8C 1F42A 4P3CH 2NW3A 4L4JA 4HC1L 1X4ZA 3RWCB 1ZVSA 1CF8H 5C0NC 1FVDA 1FDLH 4PLKD 2ZWLT 3O8XB 5I1HL 5JXED 1KTDB 3D3VB 4EIZC 3U9PH 1PZUB 3MNVB 3O4LD 2VZ3A 1CYGA 1K8DA 1SBBA 1YMMB 5T5FL 3O6FA 2DQGH 3TO2B 2ZCKH 1ZA3B 1ADQH 1FVCA 4Z7NE 3OQ3B 2P8PA 2XNAA 4HFWA 2BNQB 4F7EA 4JRXE 1EO5A 3MV8A 5A2FA 3RWGA 4LSQL 3FFCE 3I6KA 5KS9F 3OAZH 2AI0H 1KB5B 2EDYA 3IFOA 4I3RL 2D7PA 2W59A 4HXAL 4X6DE 2P46B 2ADJA 2H9GB 2IH1B 3WNMA 2Y6SD 4DAGL 1YN6A 4Y1AD 3CMOH 4YXLH 3MBEB 4AIXA 4C56E 1G7QB 1FAIH 5BW7A 4JHAL 1XGQA 1XGTA 5DRNB 2B7DT 5C9JA 2IBBA 1PVHA 1DANU 1SEQH 1JPTH 5F7DB 3R8BB 4EEEA 3AB0C 2DM2A 3OXSB 1LK3H 4CJ0A 4JFDD 2YPLB 5GGVL 4HLZG 4HBCH 2Z35A 3D39B 2EC9U 4GLRH 3BW9A 1N4XL 1MRDL 5H35B 5I8CB 4OFDA 1I3VA 3VD9A 2FHFA 1T1YB 5D1XD 4K94H 5HHQA 2BSSB 3BZEA 4PRIE 1IC5H 4WTZA 5LBSH 1YYMH 3MRHB 1PKQB 5I8KL 4Z0BL 4TVPD 5DJ6A 1U8LB 2F53A 3B9KA 4TPRL 4UUJA 1A6AA 3IFPB 2OTWA 4OZHF 1V5JA 4QTIH 1RZGB 3QDHA 2EIDA 3QULB 5DF0A 5ESQB 3REVA 1I3UA 1K85A 1KCUL 1II4E 4V1DE 1MHHA 3BRGC 1KB5H 2AEQH 3QUZD 5BS0A 2Q8BL 1SJHA 5IROA 1EERB 3OAZK 2FDBP 4KJWD 4M93B 4CDGC 3RAJH 4KK9C 1I7TB 4F2MA 1CFNB 4HMDA 4JJ5B 4UDTB 3VXSA 4X4XB 2ZUYA 5D1ZC 3W82A 3FQUA 4QWWD 1FE8H 4KRPC 3EYSH 4JRYD 3WD5H 4I48B 5D7LB 4BH7A 2A77L 1YQ2A 5ACLA 3GMOB 4OV5B 4MA1C 3DXAA 4M03A 5JW4R 2EEAA 5DGRA 5I19H 2IADB 4Y16B 1KJVB 1Q94B 3PNWB 7FABH 2NTSP 4JKPH 5FO8A 3DSFL 1H3UA 2WM0A 4Z7VA 3ZKMD 5IEHB 3ZE0F 4XMKL 4X99A 3EJYC 4IRJD 3BT2H 1RZKC 2X4PA 4RGMB 4KU1A 2JK5B 2R0WL 4KZEL 3H6JA 4L1DA 3LKPA 5DD3H 2LABA 1M1SA 1HKFA 1CL7H 4OCNC 2X7LB 2X4NA 1INEL 3D69B 5D9SB 3SDAB 2LU3A 3RDTD 2PO6B 1F5WA 5FO7B 3TVMD 1A5FL 3BRDA 15C8H 3HMWL 2XKSA 4G6AD 4NFCA 3H9SB 2QADB 3O4LA 4BFEA 4BKLA 4NO0B 2EXWD 5DRXB 5IBUB 3TBSB 1GOGA 3BVNA 1TNNA 1UENA 3LKOB 3VXMB 4DN4H 4NZTL 5FOJA 1KPVB 4QRSA 1KC5H 1NMCC 2YRLA 2IANB 1W0WA 4XP1L 1MY5A 3ULSB 1F6FB 1OAKH 4CAGA 1U8MA 1DN0B 3G5ZB 4R90L 3QFJB 2DYPB 1EO8H 5KSUB 5GIRB 5IM7B 2I9TA 4Y1AA 4O00A 4A6YL 3T2OA 1FYTA 5DT1L 1XIWD 3HUJF 4HIIA 2G2RA 5IGXL 4HC1H 4Z7UF 3OJMB 1ZT4A 4EI5D 1FZMA 5I1HH 5ETUB 3HAEG 2UWEB 1ZS8B 4O5LL 3RPIA 4EI6A 1IGYB 4D0DA 5EZJB 2BNRB 4IS6B 4YPGB 5T5FH 5FK9B 2X1QA 5DJAB 4CVUA 2UV3A 2JJTA 4MWFA 3VGAB 4JFDA 4PD4K 3WS6A 4GMTL 4K3EL 4DTGL 4GAJL 3FQRA 1R3KB 3WIFA 4LPCA 4X8JA 3PHOA 5IOPA 1OP3H 5ELIA 4OV6F 1JPFA 3D48R 4LSQH 4IJ3C 4OZFB 4KI5F 5D1XA 4I3RH 1KXVC 4HXAH 4RA0C 2G5BB 3PWUB 1SEBA 4M02A 4NC0B 4X9GA 3SOBL 4OF8A 3WUZA 5CD5D 4DAGH 3VJ6B 4NFDA 3OJDA 1HE7A 2HFEA 3TN0B 3NCBB 5LGJA 1YDPB 4U6HA 1KB9K 4JHAH 5E24E 1YN7B 4F7TA 5F96L 2FLBT 1RIUL 4POUB 4RDQF 1ND0B 4HGWB 1F97A 3RTQC 1EEYB 1T1ZA 3EOBA 4MHHI 2RGSA 4FFVD 2BVYA 2YD7A 3TA3B 3EZJB 5GZOD 4MMZC 3P9WB 4D0CB 5K9KB 3M07A 5GGVH 4BYHA 5EU3B 5CJOL 5C07D 2Z93B 3A6BL 3NCCB 3SDXB 1N4XH 2HJFA 4OZ4B 1MRDH 4JPWL 4JRYA 1F02I 1UB5B 4L8DB 2CDGA 4R6UA 4PG9B 2NMSA 4RMRA 2A74A 3CGTA 2WLYA 4ZXBD 5JMOC 2O61A 4KUCD 2COQA 5KTEL 5EU6A 1MIEL 1NBZB 5I8KH 2CUHA 2YK1L 4KRPB 4Z0BH 4X5WB 3HMXA 4D8PA 4WEUD 1ODAA 1UZ6E 1F4HA 4TPRH 3IDJA 5MEPB 4P9ML 3L6FA 4Y5YC 4MA1B 2ICEB 5AUMA 2P43B 4IRJA 1CXIA 5FGCE 1OP3K 4UDUA 3ZL4L 4QGYA 1KCUH 3BYTA 2Q8BH 4OLYL 2YD8A 2D0GA 4YHOL 3ZDZF 5BQ7B 4GW1A 5EBMB 1BMGA 1C1EL 3TCLA 1ITCA 4WRLA 4WEMB 5C0AD 1F90L 3QXUA 4R2GC 1MIML 3BE1L 3RDTA 4QHKJ 4GJTB 3TVMA 4DK6A 3L3KB 2A77H 1AR1C 1LO5B 3ZE0E 2AV7B 1SMOA 4HV8B 3RRQA 1YEJL 4S2SB 3IJSB 3ARFC 4IMKC 2YZ1A 4YHNB 3DSFH 4JRXD 3MLTA 3AMLA 4OLUL 4S1RL 4XMKH 3HA0A 3NAAL 3FFCD 5C6WH 3KPSB 1VADA 3DUUA 2LVEA 4KZEH 2R0WH 2RAMA 2EXYD 1J8HB 5HHXL 1E6JL 2W38A 5HI5C 5EULV 2X2YA 1INQA 1C08B 2BK8A 1INEH 5DSCA 5HYSG 4IOSD 1XIWA 1ZA6B 3IGAA 1KCKA 5IG7B 1GXEA 1F58L 3TZVD 3D85B 4EI5A 3WMSA 1A5FH 1S7SB 3QUXC 3HMWH 4HX1B 1MFNA 4Q0XL 3GJEB 2VWEC 3G6JF 4HIEA 4LF3B 3RUGF 3IS1X 2V2TB 1DVFB 3PQYB 5A2IH 5JPNA 2LAAA 3EKCA 1IM3B 4NZTH 1ZT7A 5TFSL 3Q5TA 4HZAA 3BN9C 4XP1H 4AEHL 4DCQB 4L8SA 4LCCB 4RDQG 1CGVA 4ZFZB 4G8IB 4R90H 2X4RA 3QIWB 1XGRA 4PRID 4XPBL 4AT6B 3Q6GL 1BQHG 4JFPB 4A6YH 3QWRD 4IJ3B 3VGGA 2P5EA 1IZJA 4PRDB 4QRQA 5DT1H 5IGXH 4P2OC 5GGTL 4K2UL 4QNPF 4U1HA 1F11B 4V1DD 3ULVF 4O5LH 1QFUL 3MLWL 3KPOA 3O6LL 2QR0B 3K2UH 1AR2A 2R9HD 4GMTH 4K3EH 4LQ1A 5C07A 4DTGH 4F57L 5SX4I 4GAJH 1LEIA 5MENE 5JQHC 3TFKD 4GS7B 1OLZA 2FSEB 1T2QL 2H45A 4BSWB 1XF3A 4YEEA 4ZXBA 2H8PB 1M05A 3OZ9L 1GCFA 2YA0A 3MLPA 1GRWA 1P9MC 2C1PB 4JGMA 3SOBH 3MRJB 2R1WA 3OKLA 1UXWB 3SDDD 3PV6B 1T04A 2YA2A 4PRPB 3WHXA 2DRUA 1OHQA 3VGDA 5ICXA 4QRRB 1BJ1H 1CDYA 1H8OA 4MJ4A 1K5NB 2FH8A 5JMRA 2BRRL 5F96H 1RIUH 4LEOA 3D0VB 4MDIB 1ZHLB 4Y5YB 2QKIB 5K9OB 5CJOH 5C0AA 4MAYB 3A6BH 3T08A 4YHLL 43C9A 3REWB 4JPWH 2VXQL 1MH5A 2ERJC 4FQQB 5A3IC 1TTUA 1P7KB 3KHQA 2ATKA 5KTEH 1OAXL 1MIEH 1I3GL 2YK1H 3ARUA 8FABB 2H32B 3BWAB 5EZIL 3DGGA 4HUXB 4P9MH 5CWSB 4MCZB 1LO0L 4JRXA 3W5NA 5JDSA 5JIIA 3KPLB 3OF6D 1DANT 4U1NB 3VFMA 3NH7L 3RL1B 3FFCA 3ZL4H 2C4XA 1G7HA 5B22A 5DEGB 1Y18A 5JW4Q 4HPYL 4OLYH 5F1OB 4ISVB 3ZE1F 2EC9T 4YHOH 2BMKB 2RIKA 3HR5A 1C1EH 1HOCB 2W0LA 1QA9B 1F90H 4XCFL 1U91A 3HG1A 1XT5A 4KXZH 1MIMH 3BE1H 3HZYB 2V2WA 4Q9BA 5J6HB 2DICA 3TZVA 1TIUA 2YPKB 5EU5B 2YMXL 4ELMB 4JRWA 2GEEA 1RIVL 4U0RC 1KN2L 3NZ8B 4D2NA 3V5KA 1YEJH 4KVNL 1FQ9C 2ATPB 5DJZA 1F13A 3DBXB 1E28B 3GGWB 5FHAL 3QJFB 4OLUH 4LLYA 4S1RH 1B88A 3N50A 3NAAH 4WWKC 3WXWL 4QHLA 5EO1B 4AG4L 1CXLA 1DUYA 1CD9B 5JZ7D 3OMZA 3KXFB 5JW4N 3LQZB 1T80A 4PRIA 5DQ9B 2R8SL 1FYHB 1Y6NR 1E6JH 2XWTA 1HHIB 1M7DA 2QV2A 3DUHA 2H32H 5E2WL 3GKZA 3HI1B 3QWRA 3TJHC 3WS3A 5CSZA 2NR6C 3RUGE 3G6JE 3BUTA 1F58H 5BZDA 4DVBB 3HC0A 3KS0J 3ZO0A 4MJ5B 3K80A 4Q0XH 3TIDA 5IF0A 2BHUA 3R0MA 3RVWC 4NUGH 4M9PA 3TBTA 1IGFL 4GAYB 4MXVE 5TFSH 4R97B 4PBVC 2WP3O 3OHXB 1BM3L 3TH2T 4AEHH 1WCQA 3GSQA 1MJJA 2FJFB 4BH8A 4XNZC 4XPBH 5JORB 2XWJB 4QNPE 2HFTA 3MA7A 3SDDA 5F88B 3ULVE 4YDVB 1EHAA 3QJHA 4OCXL 3C5SB 3T0EB 1MREL 4JLRB 4L3CA 4FA8A 2QEJA 4PP2A 5GGTH 3WL9A 3FO2A 2EDLA 4DGVL 5DS8A 3K81A 4P0DA 1QFUH 2GTWA 2VL5A 3MLWH 2YUZA 3ULUE 3O6LH 3GB7A 2CO6B 2R2BA 1DUZB 4MNQB 4QT5B 5CILL 1VSCA 1W8OA 4P46C 3ME0A 4F57H 3PF2A 4PJHF 2R2EA 3P9LA 2GKIA 4ZOCA 4DK3A 3BGFC 4TTDD 1T2QH 3IDUA 3V5HA 3ESUF 4R9HA 4X7TA 3GMPA 4PJCB 1VENA 4L8CA 3QQ3B 4BZ1L 4NQXA 1ORQB 2Q86B 1JZ8A 4JFEB 2VAAB 3CU1A 3BP5B 2BCKA 1X6LA 4CU8A 4DZBB 1U8OB 3JTSB 3UJTL 2J8HA 2EDJA 1GGYA 4W6WB 4J3XA 1DE4A 5KSBA 2BRRH 3JWOC 1U2HA 3CDYA 4KTEL 5T1MA 4G8EB 3KYNB 4HK0A 3I85A 1J10A 3FB8A 1T7XA 2X05A 3PL6C 2VTFA 3SKNA 4Y8DC 1NDGB 5C71A 1HDMA 2VLRE 4LKCB 4YHLH 1SM3L 4QTHB 4Q6IA 2WV3A 3FHAA 3VXPB 3EDEA 3ARDD 4KJQD 2VXQH 3GMMB 3U0TB 3VFWB 2I26N 3VFVB 1HSBA 4MQSB 4LRIC 2JJSA 4PGBB 2DOCA 1AE6L 4PS4L 3WHE0 3BFOA 5E94B 1OAXH 3QIUB 2NZIA 1I3GH 1CN4A 1QNZL 3PWJA 3WLBB 5C0EB 5FB8B 5EZIH 2AGJH 1T7ZA 2DLFL 3JWOL 1LO0H 4MJIA 1DTUA 1F6AA 2J5LB 3QNZA 1TLKA 5I1EL 1I9EA 3C2AL 3NH7H 3SKMA 1HH6B 3U36B 1NFIB 4X5XA 3GMLB 5AEAA 4NUJB 4HPYH 1N0XL 5ADPH 4RZCA 4I9WE 1U3HC 5H37G 3UPRA 4XCFH 4N0FA 5DJ0A 4G6KL 5ID1B 2RBLA 4NIKB 1NCTA 4QY8A 5ACZB 2F8XC 3VWJD 2YMXH 1FFPB 4PP1C 1YEDB 3HE6C 1KN2H 4R3SA 1AKJD 4JVUA 3BXNA 4TVPL 4KVNH 4GRWF 2D3VA 3PWPE 2NXZD 3HPJA 4UQ3B 4PJIE 1N26A 1U8HB 4FXKB 3WXWH 4F8QA 4AG4H 2A6IA 5GGUB 1MCCA 2QSQA 1IAKA 1L0XA 2CMRL 1OW0C 4PGDB 2R8SH 1BFSA 1L0QA 5AWNL 3TEUA 1ETZB 5E2WH 4LOUC 5C0IA 1MHEA 3OX8A 1IGML 3G5YB 5F1SA 2FJGA 3MUJA 3G9AB 3ZKSD 3ORJA 4FP8L 1ZGLP 2QTEA 4E0RA 5FXCH 1X9QA 1TZIA 4TUOB 1Q9OA 2DLTA