4X7FC

Crystal structure of norovirus gii.10 p domain in complex with nano-25
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
DVQLVESGGGLVQPGGSLRLSCAASESILSFNHMAWYRQGPGEQRELVAVITREGSTDYADSVKGRFTISRDNAKNMVYLLMSNLRPEDTAVYYCNRGISNPWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 27
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7fC00
3G5ZA 4YBQD 5F7WC 2V2WB 4OI8A 4EXPX 5HVHB 1J8HB 4RQQA 1UACL 4DW2H 2HT2C 4L3EB 1ZA6B 4LK4A 4UINL 3WN5C 3EDKA 2GYSA 2HVJB 3GBML 4J3UA 1D3CA 1ES0A 1FYHB 4JM2C 4J4PC 1N6UA 1Y0LA 2J12B 3RVUC 1CE6B 3UTPE 3V95A 4JFQB 3WJLC 1OQXA 4GQPH 2RGSA 1G7MB 4NN6B 4V1DD 4JFZH 4BFGA 3KR3H 1KG0A 4LMQE 4LSSH 3EDEA 3QFJA 4NC2B 3FB7A 4OCXL 4ZD3H 2X4NB 4XPBL 1KT2A 5DMKB 2ATKA 2XXMB 5ITBH 1ORSA 4Y5VA 2AV1A 4TPRH 1CXKA 5I8CA 4EOWH 4MNHB 2GW5A 2VUOA 3GBNH 4ODSH 2EDBA 1KCRL 3OJDA 3R0MA 4KQ3L 4L4VE 5DD0L 1GC1H 4JQIL 1MCIA 4L3CB 3L3OB 5D6DA 5HHXH 3JTSB 4NO3B 4HKZB 1FZOA 4Y4KA 4R3SB 1W0VA 1T0NA 5ACZB 3RWFB 3CXDL 2D0GA 2ORBH 2PO6A 1A5FL 5BV7H 1XIWC 2I26N 1NSNH 2VITB 4M7LT 1FSKC 2VXUH 4XP1L 1KF9B 2VXUL 1JGUL 4JGMA 1WICA 3CIQA 3RIAF 4PJBB 2LAAA 5C09A 1L9NA 3E8UL 1RIUL 3TIEB 1OWRM 3RX7A 1MI5E 1X5IA 5A1AA 3NFPB 3ARQA 1T20B 3JVGA 3BIAX 5HYSA 5DD5L 4JY4A 1KJVB 1X3DA 3T3ME 4YHOL 3VW3L 4PRAB 3JV4A 3EIFA 1YYML 1NL0H 2JJWA 2PXYD 5BRZD 1BM3L 1GC1L 4JQIH 3L3DA 4PJ5D 3MO1B 1U36A 1X6LA 2P8LB 2VISB 4D9LL 5IOPB 1FZMB 1C5CL 1IC7L 4FQJH 4MAYA 1MCCA 3EFDH 3RVUD 2KQMA 4MD0B 1RUML 4GMTL 2CLZA 2ZSVB 5GGSB 3C09B 3QI9B 4MJ5A 1KXQE 4X6DF 3WUWB 5J13B 4G7VL 4EN3D 2QQKL 4N5ED 2FJHB 1NFDB 1JPGA 1DE4B 4U0RC 5ADOL 4P2QE 4PJFE 4AM0B 2APTA 3U7WL 2VLMD 3RIAK 2DJUA 2DM7A 1FAKT 2ATPB 4C57C 3HC3L 4BQBA 4JM2A 2NW2A 4JO4H 4O2CA 3T0EA 1NBQA 3QQ3B 1EJOH 5ECJE 1M7IB 2OSLB 2W60A 4YBHA 3ILQC 1ZLUK 3ISWA 3GSQA 1HNGA 2X4OB 3DRTA 1ZAGA 1F13A 3HI6H 5F96L 1AXIB 5KW9H 2EKSA 4X7SH 3DVIA 4GRLC 5F1NA 1D5ZB 1D6EB 3MJGX 1S9KC 3C60D 2OTWB 4GKNA 5KSUB 1UJ3A 3ORJA 1BMGA 5IMOB 2C3VB 4PJ8B 1QNZH 2Q7NA 4PJDB 1UXWA 4QRTB 4LCWE 1W72H 1A0QH 1IRAY 3JWOL 4TUJB 3P4LA 3BDXA 4B50A 4OCRH 4PRHD 4F7MB 1MQKH 2DQHL 3MRNB 1DQQA 1G7QA 2FGZA 5D1XA 1RK0A 2VL4A 4XNUL 3BRGC 2VDML 1U8KA 4S1SH 2VDNL 3H3KA 4BZ2L 4P5KA 4APQB 4R0LB 1KOAA 4JFHE 1FZKA 4QXGL 1KELL 1L7IH 5FKPB 4D0BA 3RAJH 2D7OA 3QXDB 3D69A 5F7EL 3FFDA 4XP9H 1F8TH 4CVXB 1CR9L 1EEZA 1JGEB 2Z31D 2GAZB 5DR5L 2ZG2A 5SX4H 2FJGB 2HT4C 2V5MA 4NQSB 5FIEA 1JPSL 3HNSH 4DN3H 3IJYB 1DSFL 4FQXC 5ADPH 4KVNL 5I8KH 3N1QC 4Z78A 1OSZA 5CSBA 3SE8H 4JN2B 1A1OB 2CDGA 5J89A 5HGDA 2EEDA 3GSXA 3LEXA 1CLOH 1I7RB 1YMHA 4ZXBD 5MI0B 4DGVH 2CMRH 2D9CA 3O8XB 4X8XA 5C07E 2GKIA 3OKNB 3WL9A 3MREB 3S36L 2OQJB 3E6FA 1NAMH 2OTUB 4ORGB 1XF3B 4GRWF 1MLBB 4F3FA 1G7LB 1U91A 1HH6B 4H1LB 5IBUB 4FFYL 2ED9A 5AZ2H 3QT2A 1HSBB 5IQ7L 1QEWB 3T0ED 3V6OE 1Q1JH 3I2CL 1IAIL 1YY9C 3ZTJG 4LDOB 3QXAA 1KYOK 3HZVA 4NQEB 4I3SL 43CAB 3MLVL 1KV3A 2BY3A 3CZJA 2DLFL 1JNHA 2E6PA 5H94B 3PXJA 3SO5A 1KCUH 3LRSB 2D7PA 4G6KH 1QKZH 4X7TB 3S7GA 2VLRA 1LEKB 1R3IH 2GSIA 3ARGD 1T04A 4ZS7L 3LEYH 3W9EB 1C1EH 3F6IA 3L7FB 3HMWH 5D7IA 4HWBA 3X14B 1TZIB 1INDL 3QNZA 1SY6L 3WIHL 3AY4A 4JHWL 1LE5B 1SJXA 4NQCA 3W0WB 5DJYA 4XMPH 3SE4C 5IF0A 3MC0A 4IIQA 1U93B 1UJ3C 5EC2A 2HKHH 1A21A 1KXVC 4UMGA 2PO6D 5C07B 4F7TB 3BEVB 3ECBA 1SYSB 4XNUH 3HR5B 3MNWA 3RWEA 3H0TB 3UPRB 2E3VA 2IADA 3HZVB 4NQEA 2C4XA 3BKCL 3MJ9A 4JFEA 4PJAE 4XB8A 4GKSA 3SE9L 1FHGA 4CW1B 3WUWG 1OAYH 3V7MA 3ULVH 5JXEA 4R97C 3ZL4L 1A6ZA 3O81A 4NQDD 5C6WH 1NBYB 3PQYB 3PWLA 1WK0A 1DBBL 2A74A 1FFNA 2CK0L 4PV9A 4K8RC 2R69L 4JFHD 4EZMA 1RZGA 3ARBD 3E6FB 3UTZA 4QRRB 1MWAA 5FCSH 3ARDC 5C0NC 3FT4B 1EUUA 3E0GA 5F89A 2WIIA 3V4VL 1P5UA 1WZLA 1AD9A 1C16B 4IMLB 4TUKH 3TBTA 3Q6FB 3PGCB 2CR6A 2I27N 5EBGA 3NTCH 4V1DA 1U92A 4ODTL 5I2IB 5I17B 4XNYL 4Z78B 1CZ8L 1DQLL 5BVPL 5GZND 4I0PA 1N8ZB 1QLRA 3SKUD 2HFEB 4RA0C 2EIZA 5HJ3A 3BKJL 4RRPA 4LHJB 4M6NH 1QYGH 4D8PB 5ITBL 3BW9A 1OAYL 1K2DB 1NLDH 2NCMA 2MCG1 4U49A 1G7IB 1S7RB 4I18B 3QPXH 3B3IA 4YHIA 3LMJL 3OGCB 3CFDA 3K1DA 2VLKA 1J0JA 4ODXB 5DQJA 3HB3C 1FIGL 1MCOL 5T5NF 3V0WH 3REVA 1U58A 4OCYL 5GGVH 1A1MB 3SKNA 4KZDL 2IC2A 1YEKH 5BS0D 4AZ8A 4P99A 4R6UA 4RCAA 3I02B 4QRPA 4HWEL 4TUJA 5EWIH 2WV3A 5IVXF 1T1YA 3NBNA 1H5BB 4NHCH 3AM8C 3TO2B 4ZUSA 3MSPA 3T8XA 1YZZA 1ZT4B 2VZ3A 3SDAA 3UTTA 5IBLD 3QH3A 3VJ6B 4CKVX 3TV3H 1RIUH 3MLRH 4LRIC 1FG2B 4YHZH 4XBGA 4G6JH 4CJ0A 4IDJL 5BRZA 1QLFB 5T3ZD 5HHQB 2HMID 2KPNA 5JXAH 3MV9A 2FEDD 5CKAA 5LAXB 1NMAH 2LVEA 4Y4HD 4ONGL 4N8CH 3UYRH 3AY4C 4KROB 1I85C 3V6FA 1HKLH 4XC1L 1KFAH 5F1IB 4DZ8B 1YMME 3JZ7A 3UC0L 3OQ3B 1W8OA 4Y5YA 5HI4C 1LK3L 2XTJC 4GLRI 5CSGA 1XGTA 4MD5B 1PKQB 3MYZA 2HH0H 4AEHL 4F8QA 3J7HA 5FO9B 5LKNA 3PABB 1F90H 4X5WA 5KSBF 2MHAB 4YDVB 5I0DA 3EOAB 5F88A 3U4EB 4G3YH 5T1DH 1AXSA 4BSVB 4NGHL 2IGFH 1BVKA 4Z5RA 1X4XA 1O7VA 2E5EA 3OKLA 4HJ0D 4OAWA 7FABL 3U46A 2JB6B 1R3HA 3B5HA 1D9KB 3NAAH 4N5UA 1JPSH 3D9AL 1MIEL 4HWBH 3BHBB 3OB8A 1QFUL 5B3JF 1G1CA 3STBA 4NDMB 3WSQL 4WFHE 5ALCH 3PV7A 1TJIL 3MUY1 3O4OC 4CW1A 4NRYB 1WFUA 3NIDE 3QDGE 2PKDA 5CJXC 5EBLA 4N90D 3HRZB 5CJBA 2IADB 4QHNA 1BZ7B 3F7YB 5CKGA 3VFTA 1W0YT 3QI9D 1RMFH 1RIHL 5CMAA 3D5OF 3TZVC 1FV1B 1I7TB 3C5ZD 1KTLA 3QCVL 4BZ1H 4KI5F 4WI2A 5CHNA 4YDIH 5E4EC 3U30C 5BS0A 3MROB 1VHPA 4J3TA 4QT5A 4E0RA 5F7UA 5E2VL 5GS2H 2AEQH 2BNQB 2PO6B 3RVTC 5HHPA 3W5MA 1U8OA 1Q9LB 4X6DA 2X4TA 1DBKL 1HIML 5J6HB 5KANG 4P3DB 4PJEA 2BDNL 1A64A 2OYPA 2NY5C 5HHNB 1ONQA 1ONQB 3OX8A 2XN9B 5IMLB 3FN9A 1JYNA 4F9PA 3MFFA 1MCSA 4OM0L 5CZXD 3D2UD 4OKVB 3U9UA 1AP2A 4K9EH 4G6AC 3HE7D 3DI2B 4RA3A 1PBYA 4CADA 3ZYOA 1Q72L 2BNQA 5HHPB 2ARWA 4ZUWA 4OUUA 1DEEA 4LEOA 4M1GL 4G5ZL 3QWOA 2APWA 3RJDA 4JPKH 1OSPH 2F53E 5EZJB 4M1DL 4F9PC 1FFOB 4HIHB 1ZEAH 3EYVA 1IC1A 3RTQD 3S98A 1JPFB 4Z7VA 4OCLC 1K8IA 2A6KA 1A1NA 4P5MB 3T77B 1D5XB 5BVPH 2C1OB 4PD4K 5C08B 4PLNC 4JO1L 4DCQB 1MFNA 3MRMB 3D1MC 3MREA 3WUZA 3UYPA 5HD8D 2R23B 5AYQA 3WFEH 1ZLSL 4M7ZC 2ADGA 4Z7QF 3GRWA 3P0YL 4MHHI 4P57B 4U31A 4OB5L 3GHBL 1C5BL 4NKQB 1NAKH 2V7HB 2NYYC 3NFNB 4NC1E 5JXED 4ZYKB 1EGJH 3B83A 4NO5A 4DZBB 2CDFB 3VE0A 1Z5LA 1JGDA 1FLRL 1K9TA 3OKLB 4YAQB 1NL0L 2ITCB 5GRJL 3QZWG 4JDVB 4PJDE 3BKYH 4HAFA 3U7YH 4N0CD 1Z0NA 3BXNA 5IWLC 1AGBB 5JZ7D 1QZ1A 1RIVH 5FK9B 3MR9A 1OAQH 4NN6C 5HHOB 1UYWL 2YWYA 4XMKL 4Z0XB 1HCFX 4TYUA 1SEBB 3QCUH 1PFCA 2JJTC 4YFDB 2CKBH 3QDMB 1XT5A 5SX4I 1B4RA 5CJXA 4WNQB 1EV2E 2GTZB 2YC1A 1T89A 3MRIB 3NZ8A 43C9A 2J5LC 5SWSE 1WBZA 4Y5XA 5IUSA 2Q86A 5ETUA 4Z7VF 3HFMH 4J12A 5HI3C 3LQAC 4R96A 4QF1A 1CDUA 3BKCH 4ZUSB 2FB4L 3DRTB 2FX9H 3QIUC 1AD0A 1OAQL 2P5WD 1FDLL 4NBXB 2NY2B 1YJDH 2FSEB 1CQKA 3SCMD 1PQZA 5HGBA 2X4RB 3QIUB 3SGEI 4C59B 5HHVH 4OQTH 3B8SA 4HXAL 3U36A 3DO7B 4PS4L 4NCDA 4JFDD 1LP9E 4UV4H 3T0EC 3QQ4A 4AM0A 4P49A 4M1GH 2EDDA 3MCKA 4F37F 4IRSA 1OF2A 4OZGB 1OSPL 2E7MA 2A73B 3M1BA 1HHJB 3OB0K 2GITB 4AEEA 3LDBB 3F7VB 4F7CA 3FRPA 2DAVA 3OG4B 4LVEA 2BVUA 3DVNB 3ARED 5HYJB 2LU4A 4MAYB 1JI2A 1UACH 4WI7A 3HI1B 2OS7A 5IVXA 2VXVH 4HZLA 4QOKD 2NTFA 2FO1A 1RFDL 2F53B 1JL8A 3IFNH 5TPWL 2R1WB 3JV6B 4OLUH 2CGRH 4L9LB 5GSVA 4OGYH 1GRWA 3ZE2E 4JY4B 4LVNB 4KRLB 4NGHH 5DRNA 5DI8B 4HX1B 3C5JA 4NKMB 5E2VH 4MNGA 1MPAH 4HK3J 1E4KC 3RWCA 4YC2B 4JDZB 3DSFH 3FB6B 2FBOJ 4H8WC 1ED3A 1CG9B 1U41A 3D0LB 4ELKA 5JW4N 5IW1B 1XIWA 3AROA 3MNVA 4KHXH 4ODWA 1FO0B 2NX5A 1NGZA 4JFDB 1I4FA 2B5IC 1S7QA 3S36H 4EN3C 3ZKND 5FYKU 3LIZL 4W6WB 2Z31B 5KSAC 1RJCA 2N56A 3KPRE 5KVFH 3N1MC 3I50H 1HEZB 2AV7B 5IR1A 3MCG1 1YPZE 2EXWC 2C3XA 4J3VA 2PYED 3MLRL 3RUGF 3BH8A 3WIHA 4MHHG 4GH7B 4K8RL 3KPLA 5C7XL 2OI9C 3H9SB 5IF0B 3VRIB 4U33A 4HLJA 4P59H 3WFBL 4LLYA 3MACH 5FA4A 2OI9B 1MFCL 3OMZA 4G8IA 1TJGH 5GJTL 3PWPB 5B4MC 4LEXH 4ZPVB 1U8OB 5EN2A 1MY7A 1EFXD 3RFZC 5C0JB 5B8CB 1E28A 1M4KA 1KCVH 5HI3D 3DIFA 3LS4L 5HYEA 1O5DT 2HWZH 1FV1A 1I7TA 2NTSP 2VERN 1FORL 4JB9H 3K81A 5EULV 5IB4B 3JV5A 5JA9A 4HEPG 1MAJA 5D1QC 4IJ3B 5DJZB 2WZPD 4DWHA 5J12C 2A83A 2J88L 3RL2B 4ZOAA 4XVSL 2SEBB 1C12A 2UZIH 2B7DT 3PP3H 5DURB 2P5WE 4BK5A 5DJCA 1I1YB 5BV7B 2AS5M 1UH3A 4HWNA 1UM5L 2IG2L 3I6KA 3MLYL 5EO9B 5D5MA 4NZUH 1MJ8L 3BPNC 4G8GE 1C5CH 1IC7H 3TO4C 4MXVE 2VQ1A 5DT1L 4EDWL 1U3HA 1Q0YL 3BWUC 2A1WL 1II4E 4K7PL 5EBWB 1HXMA 4XC3L 4NWUL 1ODAA 1E28B 1EFQA 3HE6D 1DN0B 1N59B 4Q0XH 3LKNA 3EOAA 5F88B 1J8HD 4LGPB 5F7EH 5DEFB 1KB5H 2DMKA 1AY1L 3JV0A 1NFKA 3Q3GA 1AQDA 2WW8A 2BJMH 4TOYL 3GM8A 1CXLA 3X13B 3QHTC 1H3XA 2CIIA 3TJEL 4LQFH 5D1XD 4HUUA 1I7UA 3BP4B 3OJMB 2W9EL 1UC6A 3MMEB 5D70L 1F3JA 4HF5H 4PJIA 5GSRB 4D9QE 5GGUA 3U7YL 1RZKH 5A2JH 3EHBC 1NBZA 4ZO9A 1M1SA 3TIDA 1UVQB 4Z7QE 4I3RH 3FQUA 4P2RB 4L4TE 1KIPA 5GZOD 3BPCA 2ICEB 3HE7B 3RZCC 4C4KT 1UWEL 5GGTA 1FCGA 2Z8WC 2XWJB 3BDYH 3RA7L 1G0XA 1KLGA 3GBNL 3LKSA 3K80A 3UJIL 2VC2H 1INQB 1F11B 2R1XB 5SWZA 3P4OA 3VFPB 3QCTL 4Z7WB 4G6AD 5GS0C 1FO0H 4DUWA 4PJHB 4DFHA 2XG5A 3QG7L 1QFPA 4C4KO 4DVRH 2Q1EA 2DLFH 3DMMA 2WUBH 1WIPA 1P5VA 1J0IA 3RBGA 5IEKB 2YD1A 1OL0A 4DK3A 2CXGA 1ETZB 5KJRL 3H3PH 5JPNA 4XP1H 1IZJA 5CBAB 2Y36H 2RJMA 5D1ZA 4P5TD 4FMFA 4PJXA 3G08B 4J6RH 4EJ1C 4WJ5A 1FNSL 1QR1A 2IAMC 4FQQB 4XMLH 3G6DH 4A6YH 5KN5A 1UCBH 1OHQA 2YD3A 3EYOB 2F5AL 3ARDB 3LY6A 5IEKA 1JHLH 1IM9D 4OM1H 4XCNB 5LBSH 4F8TA 4WO4A 3GUTB 3I3BA 4LCIL 2OL3L 3STLA 4Y4FC 2MNUA 2CMRL 4OF3A 4QXTA 4Z7NF 2VN4A 1QO3B 1WT5C 2BOCB 2XI9A 4ZAKB 3TNNA 2FIKA 4O00A 1JZ5A 5F6HJ 4JPVL 1OOAA 1JHKH 2YN5A 1QRNB 3NABL 1ZLUH 1KACB 4K94C 3L3JB 3MJ8B 2EDRA 4R96B 2KBGA 2X4SA 3WV0A 2YZ1A 4LMQI 5MP6L 2B1HL 2HVKA 4ALAL 2W9DL 4M00A 4LLVA 4YK4B 4QOKA 1AC6A 1XF2A 1NC4B 4Y4FA 5C0BA 4K7PY 5GISL 5KVGH 1G6RB 1ZE3C 1WVZA 5K9KB 4E5XA 2I07B 1U3HD 3KXFE 3RWDA 3PV6B 4WI6A 1HWGB 4Q9RL 3VXUD 2IBBA 5JXEC 1TIUA 2JJSA 5ANME 1A6AB 2AJXL 2ZOLB 1TJGL 4LLQA 4PJ5E 3L3GB 1EPFA 4XPHH 2IAND 1CFQB 5C3TA 5ALCL 5E6IA 2P8PB 3UZEA 1AO7A 1DANU 4NRZA 2OR9H 3DVGA 3CK0L 3K3QA 4KRNA 3LN9A 3TA3D 1NKRA 3SCMA 5LWYH 3IRZA 5JORA 5CP3H 1E27A 3WS3A 5EIIA 1W72L 2CDFA 2DQTH 2H2SD 4PIRF 3QI9C 2EXYD 5IHUH 2AJVH 4KROC 4LAQH 5D2LB 5ALBL 4ZS6C 4BFEA 1Q9KB 4JN1L 5D5MB 4NN5C 4OFKA 3FCTA 5EUOF 5EZOL 1KB9J 5HVHC 1NGWA 4JQVC 5TDOA 4RRPG 3WKML 2BSSB 5IV2B 4HDIA 4Y1AE 4NQTA 5JIKA 4OIIH 2IPUG 5K59E 1T4KB 1KG0B 1T66C 1HSBA 5IB4A 5I1IL 3FHQA 2EECA 1CBVL 5DJAB 4E42A 3SY0A 4WUUB 5IESL 1XF3A 3B2UD 3GBLA 1WCBB 2LVCA 2B4CH 4KQ4L 1XF1A 3KYMB 1V7ML 2D31A 3FN3A 1TNMA 4P46D 3A6BL 1KENL 2V9TA 1H3WM 3MV8E 4Z7WE 5JO5B 5E2UL 2QQLH 4NFCA 1UWGL 1JNNH 1QTYT 3C8KA 1BX2A 4L9DA 1AKJB 4PJ8C 4XWGH 5KS9F 4LCCA 1CL7L 2WP3T 4LPUA 4NNYA 2NXZD 2BVPB 4QXWA 5LXGL 2EE6A 3N0PB 5DSCA 2A6IB 3BRDA 2XN9D 3EYQC 4LPTA 3VWKB 5JHLL 4MQTB 2LU7A 3PWUA 3B9VA 2OL3A 3W39A 1EEYB 1H3GA 4FQCL 4RWHA 3L3KA 4N0FB 3S88H 1QRND 3QXDA 4NZJA 4FQHB 3V7AE 5AG8A 3EZJB 1KN2L 2LAGB 4NN5B 4G9FA 1MCWW 3HN3A 2X89D 1L0XA 1OTUD 4APQA 4GW4B 4MA3B 1KC5L 4ELKB 4JANB 1KPUB 3V6OC 3GMLB 3VXSA 3O6LH 3MZGB 4OZHA 1IL1A 4GG6B 1T80A 3MLPA 3KPRD 3WFHA 4PYHA 2AGJH 3K0WA 3CVHH 4HJGB 1GAFH 4P5TB 1MLCB 4CVZA 4HUVA 1NCDH 3BP5B 1AC0A 1ZGLA 1T66D 3BDYL 4P5TC 3RA7H 3O2DA 3MGTB 3TN0A 3EJJX 3WKNA 3LMJH 3CUPA 5E9DD 5DLML 4QHKI 5FV2A 3T4YB 5I15H 2CKNA 3FRUB 3HUJE 3C2AH 1MRDH 3MRHA 5C1MB 4KROD 1JF1A 2EDTA 1OM3L 1UB6B 1KN4H 2VXQH 4GKZA 4PRID 2E7HA 2GCYB 2BSSA 2IPTL 5DC0A 5C0AA 3B9KD 1IC4H 2DQEL 1U8JB 2V2TB 3FO9B 4D2NA 3QDMD 4TNWF 4XAWL 3QIUA 1D5BB 2YSSA 1LO5A 4RMRA 4EIZC 3QDGB 4NQXA 5J3HD 5GJSH 2IBGA 1DL7H 4NO0D 4Z7UE 4WWID 2Y25A 5IB5B 1A14H 5TDPA 1FJ1A 2V17L 1F58H 3MV9B 4TUKL 4GXVL 4QF1B 1IKNC 1BVLB 1NMBL 3HAEA 1KCUL 4GS7C 5I1EH 3CFBA 4RSVA 4UT7L 3Q5TA 3I3EA 1A7QL 5L7XL 4L1DA 1PY9A 4WI8A 3WFHB 1E4XI 1F4WL 2BHZA 5DK2A 4YE4L 4M7JH 1DVFB 4M93C 1MRCH 5J1SC 3VFOA 2IFFH 2BXZA 3RIFK 2GTZA 4YFLI 2OP4L 2GIYA 4HH9A 4PB9L 4PG9B 5DUMH 5BVJB 4M03A 4B7LA 4KH2A 4XPFL 5DYOB 3TPKA 2AQ1A 3O3AA 1S7VA 1YUHB 4HV8A 4TUOB 1DQJB 4APQD 5E94B 3MJ6A 5SWSB 2DOCA 4HK3N 5L2JA 2HT3D 3C87A 2J8UF 1ZA3A 2FGWH 4BSWB 3MRFA 4I4WB 5FM4A 3QDJD 4U1IA 4Q9RH 2N4IA 4AQOA 3ZHDA 3VFWA 1IVLA 1MHEA 2A6DA 5CGMA 1MFDH 4RMTA 1B3JA 1IGIH 3O4LD 4PGDA 2NY7L 1QRNA 1QRKA 2HG5B 1FPTH 3DV6A 1V5JA 4ODHH 1HH9B 4ZAKA 4UIKL 4XCEA 1F4HA 1JGLL 1UGNA 3FO1A 1F00I 3KPQB 5CEXA 3Q3GB 3IJSA 3MCLL 3DLQR 1RUQH 2EYSA 4E41B 3SDAD 1CR9H 4KI5E 5DMJB 4FQXB 4XPAL 3WXWL 3G5XB 3TBTB 1S7UB 3TO4D 1G9ML 1UEMA 4NFBA 2FDBP 3OKEB 2JJTA 1QFUH 3U7AA 5L2KD 2EE3A 5SX5K 3T0BA 3KLHD 1JWMA 1A7OL 2AJVL 2NY4C 1T89C 1TLKA 5EDXA 4Q9BA 4UZGA 3G6AB 4HC1L 4X6EB 1KN4L 1T22A 4LRNL 4DQOH 3EKCA 4J7RA 4HIEB 4GKSB 2VXTH 4HDIB 4S2SB 4KJPC 1YJDL 1IBGH 3HZMA 4MAYC 1SJHA 4MB4A 4CL7A 4OLUL 5EZLB 2X7LA 1A6PA 4HFWB 3IETA 2CRYA 4R2GB 4IEFB 4L3EA 1Q8MA 4JEGB 4M5ZH 1KPVB 1YEDA 2X41A 1CFNA 5ILTL 1BQSA 5CJQH 2F58L 2Q7YB 5T1LB 4YGAB 3T2PA 1GZPB 1DBJH 3H9SD 4BYHA 5FHBL 5KSVB 2HKFH 1NCCH 4PJ5B 1LVEA 1LDPH 1Y18B 3GSVB 3MBEA 3KPMB 4ZOEA 4PJGB 2X9WA 3EDFA 4XXCA 2LFGA 3SHSA 4LLYB 4OQTA 1KIPB 3ZDZF 4PJHE 5JR1H 1RSFA 5KOVC 3O9WC 1YEFL 2AJZA 1T04B 3W9EA 3UTSE 4FZ8H 4EN3B 1QPPA 3MRJB 4GBXD 4OSUH 3A6CH 1XH3B 2VNCA 3EAKA 3BH8B 2JCCF 4RFOH 2W65B 2VDLL 1BJ1J 3DGGB 2ZNXA 3FAXA 3G6JA 1AJ7H 4PB9H 1U42A 4KMQA 4PRDA 4XPFH 2PCPA 4JPIB 3FN0H 5HHOE 2X1OA 5DMYA 1DQTA 1NBVL 3GSOA 2I60L 1QP1A 1DN2A 1GJIA 4ZXBB 1G6RA 2GJ6A 5B3NA 3VGBA 5FKAB 3A67H 2HT3C 2NY0B 1HWHB 3D0VA 4YWGL 4P9ML 2HVKB 2RR3A 1J0ZA 1YQVH 3GJFA 4PJ7F 2VDQL 2OTUA 4ONFH 5JW4R 3TVMD 4GAJH 3D3VE 2J8UA 5KVDL 1JZ4A 2AK1H 3JTTB 2FIKB 1IKFL 3AS3A 5MEPB 1WBYA 3KHOA 3ABZA 1TTFA 3PHQB 3QDJE 5DQ9A 5C0DA 4J2XA 2N7BA 3SE3C 4R7NB 3ZKMC 1KGCE 3MUGA 2NY2D 3B9AA 2NZ9C 3QRFM 1UFUA 3V4UL 4ZQKA 4HIEA 2JKXA 2VLLB 3ARGA 1SMAA 5BO1L 2ADJB 4G6FB 3QA3A 1AQKL 2D3VA 3EYFB 4EKXA 3VFGL 4KK5C 2PTUA 4AL8H 32C2B 2DQIL 2APFA 4U3HA 5EOCJ 2KZ1B 3MLUH 4D3CL 2A6JA 2ZUQC 2J4WL 2Q6WB 3F12B 3DMMC 4QRPD 5JPMA 1J1OH 1LNUA 4UDUA 5D2NC 4ISVB 1UM6H 2MCPH 3T1WA 1QLFA 4R9HA 4X98B 4TSCH 2FZ3B 2VJXA 1FORH 2YPVH 3MYJA 2HTLC 3BISA 2X4RA 3DXAE 3FO1B 4OFYD 5D7SL 4GAFB 5DWUL 1YC7A 1A6TB 3IAGC 3DV4A 4PJ7E 1N6VA 5D9SB 1HHKB 4OJFL 3VW3H 4L8BB 1INQA 2OMBA 1UXWB 2V5YA 1F3RB 2AJYH 4OLZL 5C0CE 3MV8D 2FHFA 4JR9L 3ULVE 2DBLH 4KRPB 3ILPB 4ZUTA 3BMVA 3T65A 1J11A 3RWHB 3CVHB 4OFVA 4JZJC 3TA3C 1TQCB 2NXYC 1ZHNB 4X4ZA 5IG7A 3VGAB 1AR2A 4TRPH 4I48B 1YEFH 4OZIE 2W59A 2DRUA 4GO6B 3ARFB 3BIKB 5DFTA 5F7FA 4D0DB 1F02I 2Y6SD 5LGHL 1HI6B 5CD5C 1VGEH 5DJ2A 5E8NB 3PGFH 3EYFA 1S5HA 3BZDA 5DXWA 2Y7QB 3BP6A 3O6FB 2XQBH 1DJSA 2HJKB 3TP4A 3O6KH 4NJ9H 3MGOA 3MOAL 4QYOB 4XBEH 4MLIA 3I6LE 1MCRA 3VXPA 4ZUUA 4G8EA 4JJ5A 4MJ5B 3TESA 5IGXH 4IMLA 1U3HC 3OB0H 1FJ1B 3SDYH 1OAZH 2WWMC 4DQOL 3CSGA 5FA3B 1QQDA 4NQXB 1XR8B 3F7VA 2PR4H 4WFEE 2VQ1B 1RJLB 4X7SL 3QEGH 5AWNL 3RNKA 1IQDA 5AUMA 4XBPB 1DBAL 3SJVD 1FFNB 5CEZE 3MV7D 4UAOC 4UQ2B 2X10A 4MA1C 1MI5B 1KYOJ 2BSRB 4HHAA 4QO1A 3EYSH 1RZJH 2CDEA 1WAAE 3ARRA 5L6YH 3JV4B 4HPOL 5I19H 3EDJA 2OK0L 2VR9A 3LN4A 2NXYB 2WBJD 4JQVA 4YFLF 1K3ZA 5D7LA 2E27H 5DJDB 4CVUA 1K8IB 2OJZL 2EDXA 3DUUA 2FHCA 2QQNH 3M17A 1S9XB 4KZEL 2XKNA 2EO1A 5AZEH 3H3PL 5JMRA 1FNAA 1T3FA 1KJ2L 1WWCA 3LZFL 3QHFH 1F8TL 1FDLH 4CADB 2BFVH 2IQ9L 1J86A 1N64H 5DWUH 4PGZA 3R1GH 3MZTA 1K4CA 2WBJC 3C9NB 1JZ6A 1Z9SA 1JYXA 4KK6C 4WNQA 5K9JH 4WTZA 1HHHA 3PJSB 2R1YB 2BVYA 1EEUA 1B6UA 5GRYA 5T1KD 3EDDA 5IEHA 4YH6A 2VZ1A 1IQWL 4I3RL 4E0RB 2Z31A 2W1NA 3ZE0E 1TJIH 4PY7A 4PRHE 4YHPB 5JW3H 1KJ3H 2GK2A 3M8OH 3W39B 3FB5B 5C08E 5E6ID 1R3JA 1HH6A 3FB8B 5DZOA 1WZKA 2X9YA 4X99A 4W68A 5C09D 5CEZH 1PLGL 1KIUA 2CO6B 4Q74A 5I6XC 4ORGA 3MRLA 3IXTA 5E2JA 1FFPB 4IOSD 1XGUB 4N90E 4NNYB 3G9VA 2Z0BA 4JREB 4N9OB 3UBXB 4NDMA 2RB8A 5C0CB 2VLJA 1SVCP 4BKLA 4BQ9A 1FAIL 4Y4KD 4JM4L 4JREC 4YEFA 5C86A 3VH8A 1J8HA 2R23A 2V2WA 4LLUA 1BFOA 3V52H 1AIFB 1X5LA 2AXFB 2R4RH 4JFPB 4KWUA 2BOBA 4PRPD 2E9IA 2H3NA 4KK8D 4QGYA 1P4LB 3G6DL 2H26A 1SJEA 2BY0A 2B4CL 2X4PB 3D69B 1G9NC 4KQ4H 1JRHH 4JDTH 2UUDH 2RHEA 2QV2A 4ENEC 5I75B 2AJSL 5GS0L 3UTPD 3BN3B 3CAFA 2A38A 3LVEA 1HHGA 1OCWL 1ROWA 5L2KE 1MJUL 3DI3B 3RGVD 1G7QB 2FRGP 5D1XB 2APVA 3DRQB 3OF6A 4ETQB 2QSCL 3V6ZB 3AVEA 3SGKA 1BF2A 3KLDA 3V6FB 1ZGLM 3CDYA 4PPTA 4JFYB 1JV5A 1WTGT 3O3DB 5D1QD 1NSNL 2DQDH 2FYYB 3KPTA 3LHPL 2JELH 5JORB 2DMCA 5FM5O 1RQ5A 4I2XB 1ND0A 4FXLA 2CIKA 5CFHA 4JKMA 4OZGE 1EHAA 1ZANH 5KZCB 3UJIH 2XWBA 4WENB 1QFWI 5DTFA 3RVVD 4XB7A 4PJ7B 4KI1A 1A7BA 2XXCB 3I6GB 4N8VG 3VG0L 1BJ1H 2VDPH 3WMSA 4YC2C 4P2QA 4TTDD 4X6FA 5I74C 2CSPA 5FOJA 5D2LE 4Y5VC 5INCB 1U8LA 3KLHC 2UZIL 3L3GA 5CEYB 1A3LL 3GI8H 4RIRB 1HIMH 2C3HA 5D70H 5DURD 5ID1B 1YN7A 3LKPA 3GMMA 1RZKL 3LN4B 4JKLA 4Z95L 4NRYA 1VGKB 4EI5A 4Q6IB 3OWEA 4MAYD 3RRQA 1PG7L 4JFOA 4FS0A 1CLZH 2V2XB 3EBAA 5DD6A 5F70A 3CSBA 4RDQG 4ZFZA 4UQ2A 3LSOB 1G7PA 2X4PA 4Q6IC 2X05A 5FCUH 3PIQB 1D9KA 4UT9H 3FQRB 4XMPL 3QIBC 1AGDB 3SDXB 5T3ZE 2CLRB 1MFBL 2PN5A 5D1XC 5I1LA 3L5WA 4Z6AT 2BERA 3EJZD 3AS2A 1EVUA 1QLRB 1FZMA 3STLB 5IOPA 3GSWA 4M4PA 1MJ8H 4Y88A 1CK0L 2ZUSA 5I1JL 3BZ4B 4FA8A 1BEYH 1AGCB 5LGJA 4JFOB 2QQNL 3N85L 4FFZL 1DUYB 1CTOA 3MJ7A 4OFDA 5DJXA 2EICA 4KAQH 4ZMAT 1T7YA 2FWOA 5C9KA 4L4TD 1OAZL 2GJJA 1LK2B 1S7XB 1WFNA 3G5VB 4U2YA 4WHYH 2CXKA 3PWLB 2DDQH 3VFNA 3AB0C 2UV3A 1CLCA 1A6UH 4N1CA 3PNWB 5IWLA 3DX6A 5E03A 4H25B 1MPAL 2P46B 3AB0B 2MQ0A 4PYGA 3HPLA 2XWBB 3BPNB 3OJ2C 1NMCB 3VXRA 1OGTB 3GHEL 3H42H 3MV7E 2ENYA 1CL7H 3SDAB 1JN6A 4C56B 1YMMB 4KY1H 4HMCA 1MAMH 3MBXL 1XR9A 3MLZL 3RDTD 3VWJA 1BEYL 4PJ9D 3FTGB 4NNPL 4FFZH 4ONOA 3SN6N 5CAYB 4OLYL 4HS6A 5DJYB 3TEUA 1CFTA 1ZSDB 4TVPE 1YA5A 3P2TA 3FOLA 4XVJL 1F97A 3H6JA 4CMHC 3QDJB 1BJMA 5J56B 1IAIH 1JWSA 2HN7B 3OTTA 3QRGL 2UYLB 4OBSA 1OAXH 2YEZB 4F37K 3HC3H 4MQ7A 2IAMB 3H9YA 4FZEH 3BW9B 5EOQH 5DJDA 1CLYH 4XPTH 2VOTA 3HI5H 3KLAB 1WV7T 4ZUVA 1RZ7H 3OHXB 1BFOB 1LGVA 2E9WA 1RV6X 2VLRE 4XCCL 3OSKA 5J12B 1GGIL 3HZKA 1E4XL 4TVPL 5D7IE 2OP4H 1N3NA 5EU6A 5DQ9B 5C0DB 4BFBD 4WTWA 1U91B 4JZOA 1VFUA 1XGUA 3HNSL 3P77B 3MBEC 1J1PH 4KK8C 1HN1A 1MWAB 1PZ5B 2VSDA 3PWNB 2F54D 1LO2L 4LCUA 1FO0L 1ADQL 1YMHB 2UUDK 2VDOH 4JJ5B 2BVTA 2RQ8A 3TT3L 3PF2A 4DOHE 3L5XL 4FG6D 2HT4D 3GNMH 3EO0B 2H8PA 3MGOB 1RJZA 1MAKA 5FO9A 1F4YL 1EJOL 4PRBB 3IDIB 3RAJL 2V5TA 2BVQA 5KJRH 1IFHL 1NLBL 3Q5OA 3LV3B 4NRZB 3MRDA 2Y36L 3ZKSD 4NM8H 3ZSSA 3EOBB 1MVUA 3DYMA 3L7EA 4KPHH 5FHAL 4PUBL 1JUFA 4F58L 4OZIB 5EU6D 2LABA 3LQAL 4ODUB 4HJJL 2EKJA 1S8DA 4JGJA 4RMVA 3BAEH 1LD9B 1QLEL 4HKXA 2XFXB 1B88A 1XGRA 1PJ9A 4PRPE 3DVFA 4B5EA 4PJGA 4Y4FB 2JB5H 3TC9A 3NFSL 4ZG1A 2BNQD 3FQNB 4ZUTB 4FFVD 5CP7B 3ILPA 3T8XB 4DAGL 3F5WB 4HMDA 4YHMH 3QQ9C 3CVHL 1INDH 2MCPL 2ZOKB 4CVWA 1E6JL 4KMTL 3FMGL 1F5WA 4LKXB 1UJ3B 2DQDL 2OTWA 3VA2C 3L95B 1VFAB 5EZLA 3QSKB 2WNGA 2CRMA 1WGOA 1JK8B 1IGYB 2B0SL 4PRIA 2F8OA 1N7ML 2DN7A 3NCYS 4Y19A 1X5AA 2D0FA 4K3JL 3HG1A 1CWVA 4FQIL 4WDIA 1T03H 2F74B 3HG1D 4AENB 3VWJD 2A6JB 2XZCL 2Y4SA 5E8DH 4U1JB 1EVTC 3FB6A 3L5XH 4U6XB 1KC5H 1AH1A 3QQNA 1IAIM 3ZTNH 3NTCL 4JCLA 2J2ZA 3DYOA 2OJEA 2EXYC 4MNGB 1IKFH 3GJEA 2FWOB 1WWBX 3TT1H 5DO2C 1UB5A 5F3BB 2HFEA 1I7RA 2XN9E 4JVUA 5SV3A 5I71C 3D39B 1ZT7A 2MFNA 2NR6D 1IT9L 3LN5B 2ARJB 5F1KC 5IKCB 1NFDA 1VESA 1YMMD 3TNMB 3UDWC 2NTFB 4HCRH 4GLRH 3VFSB 4XNMB 2W92A 4PP1D 1PGRB 1AD9B 1C16A 2Y7QA 4EDXA 2NY3B 3VXSD 2IALB 2R29L 5EG6C 3ALPA 3VI3E 1KIQB 5CILL 4XX1E 1KIRA 1OARH 5TH2A 1K6QH 3MRFB 1OPGL 1DQDL 5D96C 1NCAH 1AE6L 4OF0A 4QRSB 2UWEA 1CDCA 3FL7A 4FTVA 2XRAH 3HE6C 3P3YA 1FZKB 3FQUB 4P2RA 2NY6D 3Q0HA 5F9JB 3VFUA 2Z8RA 3LKPB 4CU8A 1T20A 2NQCA 5HGBB 2W65A 3KPRB 4Y0GA 2IPKB 5E6IC 5TGBA 4JRXD 4PS4H 4KVCH 3CLFH 4N0YH 4LSVL 2YD5A 3NA9L 5JDSA 3RY6A 3MUHL 4O9HH 5JXAL 3IKCB 5C0EA 3O6FD 4EBQH 5I1GL 1L7TL 2OXHA 5DO2D 3W0WA 1H5BC 1O7SA 5FGBA 1RK1B 2R29H 2EH7H 1FPTL 2QQLL 2EC9U 3TBYB 3IAQA 5D7KD 4C56E 4I5BA 4P9HC 5IROA 3W2DL 1JRHI 1TTGA 5MEND 2X4OA 4KDTA 4LCIH 3BT2H 1KJ2H 3TCLA 4J3OC 3Q5YA 3QDGA 3D25A 1I8MA 1VENA 1JUFB 3U83A 5J13C 1U9KA 1IGML 4ZNCD 4MNHA 3LV3A 2B8OT 2FLRT 1FRGH 3O2DH 5JTWA 5EUOE 1GZQB 4WUUE 5LQBL 1GGBL 4ELMB 2G5BB 3V5HB 2FJHA 3AM8A 1DL7L 1KPRA 5D2NA 3RZWA 5CLTA 2XZCH 1PKOA 5DMGD 3WDJA 1S7WA 2J6EL 3OGOE 3TN0D 2EDOA 4WEBH 4BFIA 3CJJA 2ID5A 3CUPB 1BD2D 1EEQA 1LILA 5L9DH 1P1ZA 2PR4L 3L3HA 2Y72A 5SX5H 1H3TA 5H35A 4N0UE 4LLUB 5C0RL 3UMTA 3BD3A 1U2HA 4NC1C 2P8LA 2VISA 5F9OH 3O8XA 4G3YL 1OP5K 1FNEB 4XP9L 1D9KC 3RZCD 3LD8C 4NYLB 1ZA6A 5D71L 5L8KB 3WIIH 4LBEA 5IFHH 1N0XH 4XNZB 3ESVF 4JPIA 3O4OB 2YD7A 1OLZA 3RY4A 2RFXB 2J8HA 2AQ3A 3GMLA 2WWMD 4IHOA 3VXSB 1X5FA 4QGTA 3ARBA 4DGYH 3UC0H 4JHZA 4HS3A 3U9PH 3MLUL 5FGCB 1OPGH 4U1IB 1HEZA 2V9RA 2VUYA 3PL6A 2A2QT 4XZUB 2DD8L 2VDKL 5BXFA 3VMNA 1NGZB 4WFFE 3SDCA 1SM3H 3VXMA 1YDPA 4GSDH 3W81A 1RHFA 1B0GA 3HE6A 1CFTB 1FZOB 4Y4KB 2YOCA 4OKVA 4NM8L 2R15A 3KVQA 3VFMB 1P7KA 4NWTL 2QQKH 4I77L 4PJGF 4Q2ZB 1J5OL 5T1LA 1X5XA 4JY5L 3OJDB 4PLJD 1U8IB 1HYSD 5E7FA 4K7FA 4A6YB 4LBEB 3LQMA 2V17H 3V4VH 1AGEB 4X5XB 4GKNB 4L4VB 5HPMA 5D93B 3SDDB 2HJFB 4OFIA 5ISZA 2DM4A 1MCPH 1DVFC 4M93B 3C60A 3OKDB 4DAGH 4XNZC 4PJFA 2VIRA 3WEXA 1GGIH 1FYTB 4LIQL 4RMSA 1BREA 2AEIT 1GCFA 3MODH 3SBWA 2WP3O 5MENE 1NEZG 3KNBB 3K74B 1NCNA 4JAMA 3GO1H 1FBIL 2A0LC 1IGJA 1JTOA 2FNBA 3EOTH 3DX7B 3KPSA 3RUGA 2VLKD 5I15L 3Q2CA 2CDEB 1NUNB 4U3XA 2DTML 3OKOB 4E41A 4L3AA 1VA9A 1Q9KA 3V2AR 4ZFOL 4JPWL 5F93C 4RQQB 1QBBA 4HIXL 4UB0H 2B2XH 3I9GH 4AT6B 1A7PL 3D25B 3ZYZA 4G42B 2NLJA 4MXVF 1SVZA 3DV6B 4OB5H 2H45A 4FNLL 3CZFA 1LO0H 4MD0A 3GKZA 4JM2F 3PWJB 1DR9A 3LEYL 3PIQA 5TQ0L 2HRLA 1J5OH 4G8GD 4CU7A 5A2LH 4DTGH 2A77H 1DBJL 1E0OB 3IKCA 4X6BB 4GS7B 5CS7A 3FZUC 5BMFL 3ZYJA 3QIBA 2F54B 5DYOA 3F6LA 5FF6A 4U1LB 1M7DA 3I75A 5I8EA 4LSRH 5F1IA 2ITDB 1GOGA 5CBEA 4PTUB 5T3XH 3IDNA 3U0WH 1JGVL 1PEWA 4Z0XA 1BOYA 3K1KC 5FM5M 4FQPA 4MNQB 5C0BB 3O9WD 4QOKB 3U4BH 1XF2B 5TE7H 4IRJD 4U1GC 5D7IF 4JFFB 2P24B 1H8OA 1A6WH 1WBXB 4O5LL 5JOFA 3TO2A 5I76B 1A9EA 2C4FU 4XX1G 4DOHB 3MRQA 2A77L 4K3EH 2O61B 5FHBH 2AI0H 4Z8FH 2P5EA 4LVNC 1NFIB 3VXNB 5INDA 5B3JE 5IJKC 2B1AH 4WO4B 1MIEH 3X11B 3P40A 5HSFA 4G8FA 1BQLH 2E27L 5IKCA 4KKLD 5HHMB 2BX5A 2OJZH 3DX7A 3WJJC 2O5ZH 3MRPB 1CD0A 5F3BA 2C1PA 3P11H 3OBAA 2NX5E 5GRWA 2XZZA 3RPIB 3MRHB 2VR5A 1F3DJ 1C5DA 3BN9C 3O9WB 3CSPA 1S7TA 4XHJC 5D7KE 4C56D 5GISH 5A40E 5KVGL 3MXWH 3S37L 3B6SA 1TNNA 1B2WH 1I1AB 4UOW1 3INUL 3QA3B 4JFDE 2F74A 4AENA 3MGTA 3QWOB 3KWWB 5E6YA 3WLWD 4MMXC 5L88H 3MV11 1RUKL 5L2KB 4NJAH 1I1AC 2A0LD 5TDOB 4BKLB 5T3XL 2FL5A 1QD0A 5I30L 3QB7C 4MA8L 4A6YA 2WIIB 4GG6A 4HMEA 1BQLL 3CK0H 2JK5B 1DFBH 3BYTA 3LZFH 5HHNA 4XH2B 3OKMA 2HTKD 4KTDL 2QKIB 3NVQA 2EYTB 1RU9L 3EHBD 1JGLH 3FQNA 4CNIB 4YXKL 4WCYH 3X12A 1OTTD 1TQCC 5IFAL 2Y07H 1U8NA 1JYWA 1XGRB 2R69H 1A4KB 2H2PC 2PXYA 4M7LH 1LD9A 4KUCD 1NBZB 1XCTB 1MJUH 2PCPB 4KXZI 5T3XE 1EEYA 1NMAL 3MNWB 3RWEB 1ITBB 3ECBB 4X9HA 1CGWA 2ICWJ 3QUZB 2HFTA 2R8SL 2XWTA 4LCCC 1A6AA 4NZRH 4S1QL 3O6FC 5EBLB 4O2FA 2P5WB 4ZO8A 3CU1A 2H8PB 4LSTH 1MH5A 4NYLA 2WWKO 4R4FL 5C2UB 1DANT 1M7XA 1NC4A 3BKMH 3ULUH 1NLDL 2PYEE 5BOPA 3PL6D 3SDXF 4F2MB 3NCCB 4V1DE 5F21B 3OAUL 5E2TL 1N0LA 1WZ1L 2EC8A 3FOMA 5EU3A 3EZ8A 4MJIA 1FL6B 2DM3A 3IJHA 4YHOH 4LHUA 4WFFD 5DC9B 4WV1B 5DJAA 3V0WL 3T0XA 2YRZA 4JM4H 3SGJC 1UWGH 3DETD 5I18L 4MXQC 4PJCF 3VGAC 1A47A 5LG1A 2LQRA 1CDGA 4NUGH 4YQXL 3BO8A 4LFHG 4YO0A 1AXTH 1PKQA 2NW3B 4ZUVB 2X1QA 1V3JA 3BGFC 1QHOA 2BSRA 3QFJD 3TH3T 4JKPL 1T2QH 1I8MB 1N7MH 4M8QA 1QQDB 3KPOB 4M7LL 5D7JD 5EBMA 1IEAB 4IMKC 2AABH 2IWGA 5LAXA 4LSQL 4P4KB 5E8PA 1OB1A 3L3IA 1FN4B 4W4NA 2X40A 3SO3C 5B38B 4QRRE 5F7KC 3TBYA 4G8IB 1HOCB 3DMMB 4DGYL 3HHRB 2GFBB 3NACH 4YWGH 3HKFA 3IKKA 4LSDA 3MLSH 1U8MB 4EUPG 4ZD3L 1UM6L 4JG0H 4NO2B 5JOPD 1BGXL 2X5PA 1QA9A 4D0DA 2YMXH 5LCVH 1Q0XH 5C08D 5I1CL 1TPXB 1QLEH 3D18A 2NY5L 1JRHL 3X17A 4N0CC 4XGZA 3SOBL 5I1AA 1JCKA 1LQSR 2GEEA 2D4DA 1OTSD 1HDMA 3N06B 4HBCL 1C08A 4JZJB 3HNTH 4XNQA 4WHDA 3RGVC 5IW1A 1CG9A 4G5ZH 5BVJA 2GJZA 1GH7A 1RK0B 3WLBB 1IARB 4PJCA 1DQQB 4J8RB 4IIQC 4JRXA 5GRVL 2Y5TA 1IQWH 1CGUA 2L0DA 2EYRA 4K3DH 1AR1C 2ORBL 5DRNB 3WSQH 1I7UB 1MY5A 2O5XL 4JFEE 3LKRA 3IDJB 4PJAA 4YHLL 3MJ7B 1G0YR 4OCWL 2AW2A 4MAUL 4CAGA 2COQA 5KSUA 4J1UA 1RZFH 2NNAA 4I1NB 2PW1A 3QPQD 4M3JA 2EDJA 2VDRH 1KEGH 3IDXH 3IU4H 3NPZB 2XZAL 4JY6A 4KRPD 2EKSB 2DJSA 3S5LB 3D87B 3OAUH 5I1DA 4P4KA 3OKKA 4W6XB 1NJ9A 2H1PL 1OP9A 3VXUB 5JW5A 2J88H 2DYPB 3ES6B 1U3HB 3SDXA 4HULB 2OJEB 1HYSC 3TYGL 1DSFH 2FR4B 2C7UA 1CGSH 1G9MC 3N85H 4RAHA 5ANMA 2VZVA 4DUVA 5LBSL 1IGTA 4KUZL 1RZ7L 3PQYA 3ZDYF 4EQ2A 4WW2F 3O4LE 3ZO0A 3ULSA 3H9HB 2DS4A 2OR9L 1P4BL 3STZB 3B43A 3BO8B 4ZQKB 1JTPA 1P53A 1S3KL 3OXSA 5DHYB 3LRHA 2ZCHL 2FBJL 1B4JL 5HGAA 2UZYB 3RVVC 1EXUA 4LKXA 4N68A 1TCRA 2KDGA 3F58H 1T5XA 5INCA 3SBWC 4WV1A 5SWQB 5ID0A 3S4SG 5C0AD 4IIQB 3IJHB 4KDWA 5C7XH 3DUSA 5FO7A 5GS0D 4CMMA 2VLKE 4PJFF 4QLRA 4GG6F 2CKBA 1R0AH 3R06B 2VDNH 3S36X 4FQ1L 4HJGA 3PWPA 5HPMB 4LSPH 2GJ6B 4M7ZB 4N1EA 2AK4A 4FQLH 1HSAA 3NCJH 4K7FB 2DL9A 1WAAF 1WC7B 5D7JA 5T3ZL 1LEKA 3DJ9A 1IL1B 2ADFL 2BNRD 4LGSB 3RVWC 4OZGF 3VFMA 3BDBA 2Z9TA 3SJVB 4KI5C 3TIEA 4DJMA 1X6NA 1XH3A 1JPTL 3NA9H 1P9MC 1BFVL 3ZKMD 2AV7A 2L7UA 5AG9A 4P23C 4GXVH 5DD5H 2VWEC 3DWTA 1D5MB 5E9DB 1NGYA 2AJXH 1QNZL 3OR6B 1CXIA 4MD4A 4JRYE 1UZ6F 2OM5A 3GSVA 5EPMB 4D9RE 4HKZA 2YA1A 4PLKD 3CDGA 2IH1A 4UTAL 3BKJH 1INEH 1LEGA 4IHOB 2ERJC 2AEPH 3GSNA 2A6IA 2DICA 3NABH 1MHHA 2UVEA 3TBSA 1P2CB 2F5BL 4MCYA 4P2RD 4FTVD 1HCVA 3LHPH 5I73C 3NFNA 3IETB 3QWRA 3T0AA 4Q0XL 4JHBA 5E4IA 5JA8B 5DJCB 4KQ3H 4S2SA 3QXWA 1TJHL 3C8HA 3U7WH 1L6ZA 4JFED 4L8DA 2VLJD 2HJLA 1LEGB 4NIKB 3R4DA 5AD0B 4F7CB 2F5AH 2MKLC 4ONHB 3NIFE 3V8OA 4Z7VB 4QXUH 1IAII 4RBPK 4KI5D 3CFJB 5FO7B 5LVEA 3DIFB 3RPIA 1W72A 2YPLA 4GG8B 3D3VD 4HLZG 2FX9L 1TFHA 3T3MF 3TZVA 5D2LF 3EFDL 1DUZA 2HVJA 5CGTA 4M6NL 5FYJD 3WD5L 3C5SA 4KC3B 5HGAB 1I75A 1T5WA 3U9UB 4PGCB 4M43L 4WU7A 4LCYB 3IU3B 4HUNB 4OD1H 4WW2C 2GUOB 4XVUD 1KN2H 2F19L 1S5IH 3WLWC 4GAGH 3I85A 2AABL 2CJUL 5HHXL 3U30B 5F8RC 3P4MA 4YHML 5FB8B 1A7PH 3DX6B 1FP5A 3B9KA 4WW1B 4NNPH 2A1WH 2ZSWB 3VMOA 2Q8BL 5B39A 2VO5A 1KTLB 4YJZL 5E08L 1NLBH 4L4TB 3D0LA 1JGUH 2PYEB 1QG3A 1F6AA 1KCSL 5JLZA 1ACYH 1LK2A 3ARUA 4JHAH 3QWQB 1BZ7A 1OP3H 1E4XH 3DXAD 1WFOA 4AIOA 4M6MH 2FX8L 4X80L 4O51A 2QSQA 1V7MH 2BVEA 4K9EC 5FYKL 4Z7UA 1JMZA 1T21B 3IXAB 3AU1A 1VFBB 3NN8B 4XAKE 2RIKA 5D7LD 3SDAC 4G7YL 2XG4A 4DKAA 2EO9A 1RUAL 2DYPD 3ULVD 2P7TA 2WBJA 4XNYH 1JNNL 1T6WA 3V4PL 4AJ0A 1H8SA 3PWJA 4WI3A 3V6BR 3TA3A 4D9LH 4FZ8L 2VWEE 5CSZB 1MHCA 1WWAX 3NH7L 5FA3A 3VXUA 3T1FA 1UWXK 4XPBH 1X5YA 5JW5B 2BVOA 3UO1L 4RMUA 3D18B 4MXQD 5EB9A 4KTEL 5IMKA 3TWCL 1T2JA 3S4SB 2QSVA 2A73A 3M1BB 4GW1B 2V2TA 1DBBH 1G9NH 1RVFH 3SDDD 3LN5A 3RUGB 1N2RB 2DQTL 3JUZA 1QHPA 3V7AG 5EC1A 3BZEA 35C8H 1S9WA 1CDBA 1YN7B 5I66A 4YGVB 2Y5TB 4LNVA 2YXFA 1G7HB 2PW2A 2CLVA 4X6CA 1YC8A 3WLBA 4TULH 3RQ3A 5K33A 4LVHC 4IDLA 4QWWC 4NQDB 4PJHF 1HDMB 3HI5L 1U2CA 4I48A 3G5YB 1YEJH 3C60B 3OKDA 1Q9WA 3UTTD 3CVHA 5DMIL 1JP5A 3MRKA 5FB8A 3H2WA 2ZUWA 2XIDA 1PSKL 4KMLB 3ARXA 4WWKA 5GPRA 5GS1C 3BSZH 4LLWB 3S34L 2FYYA 3P4OB 3VFPA 3VDCA 3UYRL 1I8IA 1NGPL 4WI4A 3DV4B 4KVNH 4M6AA 5DQDH 2YC1B 2DBJA 8FABA 3TO4B 2Q76A 1YEEL 4UQ3B 3B2VL 2OZ4A 4KKNA 5A2FA 2DQJH 4OZFG 1SEBA 4E41D 3QDAA 1LK3H 3MLVH 5MHSE 1BQHB 5F7YC 1JNLL 4WEBL 4M1CD 5DMKA 5B38G 5JPMB 5BXFB 1JHKL 4OFYA 1UVQA 2X4NA 3EFFA 4NRXB 1I8KB 1TZGH 4KKCC 3KS0J 4F2MA 4I18A 1MCKA 5IT2L 4O5LH 3X3GL 1I1CA 5D7SH 4DKEL 3DBXB 3S3JA 5C6TH 1G7JB 2NZIA 4JCMA 5D5ME 3DETC 2Z8VC 3T09A 35C8L 1NAMB 4PTTA 3LEVL 4L8DB 3X13A 2YN3A 1NAMA 4PTTB 2BNRE 5C0ND 5JHDA 2FD6H 4QHLB 3UCRA 5HYQB 3GB7A 4GQ9L 1DDHB 4RGNC 1WLHA 1J05A 3MNZB 4M1CC 1KTRL 2JTDA 3CFEA 1CYGA 4Z7UF 5KSAD 4M48L 2AKRB 5CD3A 3CFKB 3NH7H 2J8UB 1N4XH 3QYCA 2MKWA 4ELMF 3GJFB 4POYA 3E2HC 1MHPH 3PDOA 4BFIB 2EDLA 3KYKL 2IANA 4CNIA 1LO3H 4TSCL 4XP4L 3RU8H 1A6ZB 4YDVA 1T4KA 5JW4Q 4IOFC 3WHXB 3HC4H 1U8HB 3DHJA 4YBLC 2AQ2A 2G5BA 1GHFL 2FECI 4OTXL 4ELMA 4PD4J 4FQIH 4NKDA 1S5IL 1A9BB 4WFED 3H0TA 2FL5B 4Y5YB 3MRGB 4JPWH 4P9MH 4DFIA 4IRJA 5HDQL 2QJDA 1TVHA 2X4UA 1XGPB 3BQUD 4URTB 5C6PB 1AXTL 3C2SA 3K8MA 4XRCA 1WC7A 3SE3A 3S6CA 2LTQB 4P4RB 1QFWM 5I1KH 4Y16D 1TCMA 4S1DC 3W82A 3SCMB 4L4JA 4FHBD 3H7BA 3JWOC 1QSZA 1KXTB 3KGRA 3KYKH 5DZLA 3AAZA 2R0LL 3QUMA 3B4NA 5MEOB 4KJPD 1XZ0A 4TSAH 3LRSA 1IJ9A 1CFNB 1OP3K 3HZYA 5D96B 1L0QA 3DX8A 1FLTX 3UBXG 3NFSH 5IFJB 1NFIA 2NY4D 3A67L 1A6VL 3BVNA 2R0KL 2X42A 5DEGB 4OLXL 3TM6A 2HLFD 4LLMB 1MRDL 5D1ZD 1ZLSH 4RGOH 1FL3A 2XACC 4KUCF 2BNRB 2F54E 4Y89A 4L3ED 5C0IA 2ZUQB 3P0GB 1I1AA 2BHUA 4JFFA 1K4DB 4ZXBC 4GFTB 4OIIL 4JZNA 2HLAB 1D6VH 5AUMB 5C6TL 3HPJA 1JPST 1OVZA 4M9PA 3OKEA 1CIUA 5K59F 1FVDB 1ZT1B 5DK0A 1SEQL 4IJ3C 5GSVB 1MRFH 4MNQE 1NCCL 1R5VB 4O4YL 4TSAL 1AGCA 4WI9A 4QYOA 2MOVA 3UZVB 2HJKA 4G6KL 1JE6A 3ARYA 2DQCH 1TVBB 1N5AB 1WT5A 1Y6MR 4KV5E 1CS6A 3PDGA 1HE7A 1UB5B 1V7NH 2DI7A 4PJAB 1KJ3L 4GOSA 5L8JB 3T1FB 3LPFA 3KXFA 1N4XL 3VH8G 3CPLA 3P4NB 2H2SC 4WJ5B 1QR1B 3MRCA 4B7IA 1PSKH 2XZAH 3VXMD 1NUDA 1IBGL 4KKAD 4XNQB 5J57B 2PTVA 2G9HA 3LAFA 2XQBL 4M9OA 4HV8B 3QQ4B 2VLME 1S7VB 4WY7L 6FABH 2HKHL 2X4QB 3GMRA 3LPWA 1DBMH 1VEPA 4XBGB 4P4KC 3UPAA 4ENED 5FAAA 1T7WA 5BZWB 1U8KB 3FQWB 3MOQA 4RIRA 2IEPA 2Y9RT 3U1SL 5E8EB 5HYJE 4BJLA 5F7MC 5JLZB 3FONB 2Y06H 5KS9E 5DJ6B 5EA0H 3LKQA 4YPGA 5B39B 2O5ZL 4XXDA 1TZGL 5DFWH 1OD9A 3CFJA 3KS0H 4OM0H 4WGWB 4I3GA 5CP7A 3TF7C 4WCYL 4BZYA 3TV3L 3BP7A 5AD0A 4OGAC 3C08L 3H7BB 3HE7C 5MERA 3X14A 4MB3A 3AXLB 4L29A 2AJYL 5TDPB 4EI6B 2NMSA 3CDFA 43C9B 4LKCB 4LARL 5ISZB 3IU3A 1KBGH 1NGPH 2HJFA 1TVHB 2X4UB 3S96B 4O2CB 1ZVSB 1BZQK 2DQCL 2VKWA 1U8IA 1A9BA 3B9DA 5C0AB 3O41B 4HC1H 3TZVB 4J3WA 4YO0B 1BD2A 2Q8AL 2ICWB 3GMPB 3KYNA 1P9MA 4S11A 5FGRA 1JFQH 3MR9B 2QHLA 1Z9LA 3GBMH 4O02H 5TPWH 2YUZA 2J3SA 5JUEL 1W8NA 4JQXC 1GGCH 5EFIA 1NCUA 3CFCH 1IAOB 4U1SB 1I7ZA 3CSYB 1D5MA 4G9DA 1GGTA 6FABL 4P2OC 3QXUA 1NCWH 1RZGB 3UTZB 1KTKE 2GT9A 1RHHA 3C6LA 3OXRB 4UV4L 4ZTOL 3KPNB 2AI0L 4HJ0C 4Z8FL 3BPOC 2B1AL 4O4YH 2EE9A 4YBQC 3DNKA 4L4VA 3GEWB 2RFXA 2NY7H 5FYJU 4EUPA 5B21A 4MSWA 2YHGA 3OHXA 5DJZA 5DGRA 1EX0A 2WK2A 3VFRA 1ZWIB 5C0FA 3TVMA 1G7JA 3IDUA 3U4BL 5EC2B 3BKML 5H37H 2DLGA 3T0EE 4CMMB 2YS4A 4G9FB 1QSEE 2XYCA 5F7NC 3WFDL 2VDPL 1CFSB 2JCCA 3EO1A 4NZRL 3NCBB 4QRQA 1P84K 4UQ3A 3LOWA 4P4KD 1EHLH 1ZS8B 4NO3A 5KSVA 3VG9C 2ICWA 2GSIB 4R2GD 1BPVA 2WBWB 3RWGB 3OL2A 4QWWD 3CXHJ 4W4OC 1ZLWH 1EK3A 4HFWA 3WYRA 2ICES 3O11B 4XAWH 1FNEA 2XZQL 3ES6A 3BPOB 1QOKA 5GS1A 2DYPA 4I77H 4AEFA 4H25A 3X3FH 4WHTA 2R2CA 4HIIA 4JY5H 3SDDC 5BS0B 3SKMB 1WCBA 3S5LA 1LP9A 3G04B 5T5NG 1AQKH 1W2KT 1J0HA 1FNGA 3QIWA 3RY6C 2F8VA 4LQ1A 3RWIA 2WUBL 4IRZL 4HX1A 4ZS6D 4S0TD 3OXSB 3U9PL 1OAUL 3LB6C 1JZ2A 4C83A 4U1GB 4RGND 2XQYG 2F53D 3ULSB 3BPLB 3FCTB 2GHWB 1D5IH 3BHBA 2F53A 5CEXB 1LO3L 3S4SA 5C09E 1TJHH 1ORQA 1CL7I 2XY2A 3JBG7 3JWDC 3QI9A 5E2TH 5C9JA 3DHMA 1M6OB 3TJEH 3Q6GH 4XHJD 3S8WA 2LV4A 4UIMA 1E27B 4Z5RB 3VI4E 4L9LC 3QUZD 1YYMH 2LE9A 3OR7B 3CFIC 4RAUA 3SKJL 4K8RD 2WLZA 3I3DA 4PJBE 1LDPL 3M07A 3QJHA 3NPSC 4N0UB 4HWZA 4UTAH 2EDYA 4OZ4A 2KUTA 1A22B 1KCKA 3E1F1 2AXHA 1Q0YH 1TVBA 1RU9H 1YEHL 4XMKH 5KTEL 2E9JA 4PG9A 4NNXA 3KPRA 1VKXB 4LPVA 4FQCH 4UDTA 4NHUB 4UDTB 1UADC 1U8LB 3SDCC 5ICXA 2ZZUT 3FO0L 3GIZL 3QIBB 1AJ7L 5F9JA 5DD0H 1AO7D 5E5RB 1IEAA 3ARBC 3MGAA 3VGFA 2ZWLT 1BZ9A 1SYVA 4HWZB 2NY4B 3HPJB 2NY1D 4U0RB 4JO2L 1JYVA 3OR7A 1CD1A 4NQUA 4HPYH 3WNOA 4N1HB 3LH2H 3NMEA 2ADFH 1BBJA 1KCVL 5C0BD 4POZC 4Y19B 1NC2D 4QRPB 5DZNA 3EOYG 2OR7A 4KJYB 4Y16B 1U8JA 3SKNB 5I8CB 1VADB 2ATPA 4UILH 2AXGA 4UILL 5D6CB 4LHUB 2JLLA 3KPSB 3ZE2F 2OCFD 3ARDA 4NN7C 3WHE1 1NCWL 4MQSB 4JAMB 5H2BA 3OGCA 3QUMB 4Y7MA 1MRFL 4WO4D 1Z0MA 2OK0H 1T83C 2Z4QB 3BXNB 3PDDA 4TVPD 3RBSA 5ACMA 4HWBL 2OZ4L 4PP1C 1P4BH 3QIWB 4PJXB 1MFEH 3UTOA 1BF8A 5FV1L 1CFSA 2EC9T 3T4YA 1I1FB 4MB5A 4JFQA 4XP5H 4J4PA 1IM3A 3HCVA 2EIZB 4MZ2A 4OLYH 3VH8B 1ZHKA 5F3HB 4QTIH 3WIFB 3TVMB 4IRJB 4P5TA 3OAZK 3PHOA 5IJVB 3EOBA 1YNTB 3EO9H 1H3UA 1DVFD 4K71B 2VE6B 1N64L 4H8WH 3QNXA 4O58H 4MSWB 5MEPA 4QY8A 5SV4A 3MJ9L 2D0HA 1FL6A 3QIWD 4KU1A 1U8NB 5GRXG 4KK5D 1A1NB 2R56H 1V3KA 1ZS8A 3D0VB 4BQ6A 5IIEA 2UWEF 1GVIA 2O5YH 4HQQL 1NANI 3S5LG 1EBAA 4AY0A 5I9QC 5C3LD 1S8DB 1AHWA 4XMLL 5TDNA 5FYJH 1ZKAA 3UX9B 4UT9L 1JJUA 3PWUB 1AP2B 3Q1SL 1CF8H 4PV8B 1DDHA 1ZWIA 2B1HH 2HAZA 3WIFA 1RZJL 4U7KA 1T2QL 3KYNB 4M6OH 1BD2B 5CUSH 5EU5A 3MLTB 3C9NA 1LEIA 3U0PB 3O2WH 4LCCB 4P46B 2DQHH 3UROR 1AHWC 3DPBA 4AIXA 1K6QL 1ZV5A 1VB9A 4WVRA 3QG7H 3G6JF 4TSBH 1TZIA 5EZIL 3DURA 3KPMA 1WWWX 1RUPL 2BHYA 2FH6A 4ZNEE 3L1OL 4FQ2L 1HXMB 1T3FB 2J8OA 2CRZA 2Q8BH 5AAWA 4CN6A 1VPOH 4Q58C 1F6LL 4LNRB 5D6DC 3CSYA 1IT9H 4G8FB 3BP7B 3CD4A 5CMAB 2PYFA 2YD2A 4NFDA 4NKOB 4AMKH 1FNSH 1C5BH 2DIAA 2WIMA 4R4BA 3UTSB 2X7LB 43CAA 3RHWK 5DHYA 4CDHA 3VGEA 2M26A 2J6EA 4L5FH 5T1KB 1WJ3A 4KRPC 3FQTA 3QO1B 1QR4A 1IM9A 1PEZA 2Z93B 2VKXA 1CD1B 4QXUL 1LE9A 4NQVA 4HF5L 4HBCH 1DQLH 1D9KD 1A7RH 1QSFE 1FC2D 3VXRB 1JWMB 3WHE0 3BE1L 1Z9OA 1RZJC 4X4YB 1Q38A 2F9BT 3BGFB 3QIUD 4W6YB 4ZDHA 5CD5D 2R9HD 1F4YH 5I8OH 1RUMH 4RBPH 1S7UA 2JELL 5J0BA 1P69B 1MCLA 4G8EB 3D3VB 3S88L 3QP3A 3T2OA 2YXMA 2EYSB 3FOLB 1RK1A 3DTXB 3SO3B 3IF1A 5D1QA 2P4AB 3QDHA 3VRIA 1JPTH 3MRQB 3HMXL 3WN5B 3BUYA 2R2BB 2JIXB 2VH5H 1QFOA 3HNVL 3BZ4A 5DD1H 4GQ9H 3RGVA 5BRZE 4M4RA 1MHEB 1KJMB 2ZOLA 4IOIB 4LLQB 1W0WA 4LEXL 4NSKA 3L1OH 5BZWA 4P2OD 4U6HB 4L8SC 4LASH 4OGAD 5D72L 1C1EL 1QFWH 3UJJL 1CDYA 3WE6B 4FTVB 4N0RA 2ZKHL 1I4FB 1YUHA 4XVTH 5FHAH 3U48A 3WE6A 3CXHK 4I0PD 1GYAA 2IPUK 3NZHH 1P4IH 3RX8A 1ORQB 4ZTPL 4JKKA 3G5VA 4RFOL 5I71B 1JHTA 5L0QC 5C70A 1SY6H 2D7TL 1UA6H 2PXYC 4HH9B 3ULUD 1ZT4A 2ERJB 3RGVB 1VFBA 3NN8A 5DI8A 3FQTB 1MWAH 15C8H 4DKDC 2DQGL 5IB2B 1N5AA 1CQYA 4ZSOE 1ZTXH 1IZKA 5FYLH 1V8HA 5ICYA 4OD3L 2DQJL 4N8VB 1DQDH 4NZUL 3WEXB 4ISVA 1NAML 2DLHA 3D2UB 3NIDF 4GRWE 4F15C 5L9DL 3C6SA 2QHRL 2Q6WA 1B6DA 3DUHA 1WCQA 4QRPE 3NCJL 3GJEB 4YNYA 3LH2L 2NYYD 4AT6A 1FSKB 2W38A 2YBRA 1LO5B 3EO9L 3C08H 1I9RH 4GAYA 1MNUH 1Q72H 2H6PA 5FECB 1K4DA 2FHBA 3ULUF 1BFVH 1MQ8A 4ZODA 2DDQL 1E4KA 3D6GA 5FFLA 3RTQB 1NPUA 1LEIB 2A9NL 4EBQL 3CNKA 5GGRY 4PY8I 1A6UL 3RWGA 5T1KA 2K7PA 1LDSA 1XGPA 1IC5L 3KNBA 1KBGL 2IFGA 1CDHA 2VQTA 4PRNA 5EOQL 3UTQB 4Z77B 1ITCA 2D7NA 3T3PF 3SE8L 1WSST 3H9ZA 5A2IH 3PHQA 3FRUA 4B53A 1U6AL 3BT2L 4H5SA 4YE4H 4WUUD 2VIRB 1AD0B 4ZFFB 4P2QB 4X6FB 1CGTA 4JQXA 1BHGA 1CGXA 2J7LA 2XA8H 1EH9A 2VZSA 5IIEB 1P4LA 5F6IB 4P2OA 4ALAH 4PP2A 1NBYA 3HAEG 5C0FB 1RZFL 4I2XA 2BOBB 1MFBH 2AXFA 4JFPA 4Y5XB 4X4XB 5MENB 2FCBA 2DTSA 2HYMA 3GSNL 4LL9A 1ZTXL 3QNXB 2AXJA 3CC5A 2FGWL 5HYSB 2UVFA 1J12A 3T3PE 4ETQA 5C0CA 1H15A 2XWTB 4BZ2H 5HYQA 1F4AA 1XEDA 5HGGS 1J10A 3KPNA 2ZNWA 1YDPB 3VGGA 5EU7C 1CDIA 5CZKA 1A4JA 1IM3B 3HCVB 1QFWL 2AJZB 3QEQE 3UJJH 3C5ZC 2BC4A 4HUKB 5KSBA 4Z95H 1BAFL 1F4WH 4OZHE 1IAOA 1TENA 2Q87A 4F9LC 5FK9A 1MRCL 2IQAA 3F7PC 3QNZB 1YYLL 3WO4B 1CGVA 1CXEA 2FLBT 4NRXA 4PJ5A 3GDBA 1RPQA 4K2UL 1AO7E 1G9NL 3VE0B 5IHZB 1RZIA 3T4AB 1F2XK 3GJFK 4EVNB 3CFEB 2JJSC 1BX2B 2XTJD 5EO9A 3ROLA 2WMPA 5E4EB 1NDGA 2VDOL 4GRWH 3GSRA 3QXAB 4X6DE 1T1WB 4MVBD 4YXHL 2G75B 4MJ6B 4YXHH 3I9GL 4QHLA 2XKSA 4YZFE 1J0KA 5EA0L 3EGSB 4E9LA 3QO0A 2IPTH 2AK1L 5H35B 1P1ZB 3L3HB 4HC1A 1YNKL 2AJUL 1D6VL 2X9XA 4X99B 2CK0H 4NWTH 4UBDC 5CINH 5ESQA 5BZDA 4POZD 2G2RA 1A8JH 1YPZB 3GRWL 4R8WH 4TN9A 4UAOB 4M62L 2EZ0C 3L6FA 4OUUB 4X80H 1N6QH 3QJFB 3FONA 5DD1L 4X6CB 3F8UB 4NHUA 2CUHA 5D7LB 5E00B 4HWEH 3VFGH 3FQWA 3TPUA 2R1YA 4KJYA 4OUOA 1BM3H 1A7QH 3BGMB 5E99L 3H9SA 1V7NL 3RKDD 4RZCB 1R3KA 1FH5L 4WFGD 4OZ4B 4QRSA 4PJEB 3PGDB 2GTWB 3QEHA 1NCDL 3NGBB 4LLWA 3AMLA 2F5BH 3QDME 3QFJE 3RU8L 3MV8A 3RNQA 2OBGA 4JG1H 4NM4H 5F6HI 4H26A 4D0CA 3ARGC 1CICD 2AK4D 1P7QB 4HGWA 2XKNB 4ZTOH 4ZUUB 2P7TB 2WBJB 1YQ2A 2Z8SA 5GZNC 3RDTC 2PW2B 3VFOB 3BH9A 5CCKL 4OF5A 3IDGA 1X5HA 2FATH 4F7EA 3WXVH 1EAPA 4G43A 4S1DD 1CE1H 1NGXA 1JZ3A 4RGNB 5HGHA 2ZP0T 1IE5A 1BAFH 1H3VA 3GFUA 4XHQA 3ARFA 3BIKA 5F1NB 4N9GB 5GHWL 4RAUB 2EDFA 4JZJA 3L3JA 2JB6A 3PL6C 4JHWH 3V0VA 4Y2DA 1NC2A 4UIMB 1G9MH 1CI5A 2IALA 3OV6A 4JVPA 4MA7H 3RWHA 3VGHA 3FQXA 3O8XC 5ADPL 1HHIA 2OSLA 1G6VK 4JFXB 3QQ9D 5E2UH 1FVEB 1KJMA 1P84J 3GUTA 1G7PB 3S97C 3D85D 4WUKL 3UAJC 2XTLA 3N1PC 1R3LB 1TZHA 4MNGE 3IXAA 1OP5H 3A6CL 1UB6A 3IFPB 1S7SA 3SPVA 4FOMA 1DCLA 4GSDL 4BSJA 2GFBA 4CMHB 1SM3L 5J06A 4ZFGL 5KS9B 1MEXH 3BIBX 1PQZB 4XCFH 3X3GH 2ESVB 3P73B 4K9EL 2Y07L 3TLRA 1F4XH 3RDTB 1PY4A 2XT1B 4TQEH 5J1AB 4HPOH 1YPZA 3SKMA 5JPNB 3ARWA 4MWFB 5FO8B 4PBXA 3KJ4C 1QSFD 4ONHA 4K94L 1P6FA 4HXBL 1J9CT 1LE9B 3OZ9L 2B4CC 5DS8B 3W2DH 2VR4A 1H5BA 3QO0B 3O3DA 5TE6L 2PNDA 1U95A 1KJVA 2YRPA 4RMWA 3F5WA 4LCYA 4Q2ZA 3GSRB 4QTIL 4R4BB 1KPUA 3UTSA 1UXSA 3VFVB 2I9LA 3IYLW 3QHFL 1T5WB 2PYFB 4NKOA 2PUQT 2FZ3A 4MCYB 3QCVH 5FUCC 4OGXH 2VXSH 5IHZA 1PZ5A 3DX9B 2JCCB 3FOMB 5EU3B 3CLEL 3RPKA 5JQ6L 5HHOA 1I7ZB 5DC4B 1HKLL 4HKJB 1HZHH 2GY5A 5C2BL 4OQ1A 32C2A 2XV6B 1J05B 1MCQA 3MMEA 3RL1B 4KZDH 4R97B 1MVUB 5EZOH 2B2XL 2EXWD 3GMPA 5E9DA 3NA4A 3GJFH 1X5GA 4JRYB 3HRPA 5IW3A 2BVQB 3IDIA 3QUXA 5HXMA 3UTSD 3U4AA 4DVBB 1AKJA 4NHCL 3TZVD 4X4ME 5TQ0H 4P2YA 2IAMA 2A9ML 3MRJA 1N59A 2JE8A 4P23A 5B4MD 5F89B 3EFFB 3TBSB 2ZG3A 2MQ3A 1WEJL 3L9RB 4CU6A 3CMOH 1MSPA 4F57H 2IH1B 3VDBA 4U1SA 4HXBH 5JNYB 1X7QB 4FXKB 2YPKB 4JO3H 4NJ9L 1N3NB 2O5XH 5EU6B 4PFEA 4PJXE 4RWYH 3NIGE 2J4WH 4PGBB 4N8PA 1JMXA 4U7SA 1NGWB 4FP8L 1K5NA 5LGHH 1DLFH 4HT1L 4LIQH 2AVGA 1MEXL 4IRJC 4JLRB 1YECL 3L5IA 3MFFB 1QBMH 4QCIA 4DN4H 5EO1B 4DN4L 4LQFL 1U93A 4OQTL 3QHZL 1GOHA 2Z35A 3D85A 1Y6NR 2JJUA 2V7NB 4PRHB 4IM8A 5DHVB 4NQEE 2I25N 4CBPA 1R24B 2AK4B 1IGTB 1NKOA 1LE5A 1SY6A 3QG6A 3QFDB 2CLVB 2DBLL 1G7HA 1I3UA 1MFAH 1Z6JT 4YQXH 4ONFL 4RFNB 5IB3B 3S35L 3BWAB 4H88H 3W9DB 1T0PB 4OF7A 3OKKB 5GRUL 4XP6L 3QAZB 3D2UA 5GRUH 2K1MA 5IM7B 5E95B 1HQRA 2CK2A 3NIFF 2ZG1A 4HFUH 4OV5B 4HFUL 2AGJL 1T5XB 1J1OL 1EAJA 2VB5A 3HUJF 5IFHL 5IB2A 2E7LA 3MODL 3PV6A 4YDIL 3SEPA 1A9EB 3QHZH 1QEWA 1RUKH 5C0CD 4P46C 1KB5A 3AS1A 4DGIL 4NQCE 4N9GA 1KIRB 3LSOA 5ANMB 5C71A 3GMOA 2X4SB 1R3HB 3MJ8A 3V52L 3CPLB 3P4NA 5HGHB 5HDQH 2E7LC 4NUGL 2EIDA 2DD8H 2VDKH 4J23A 4X9GA 3S35H 5HI5C 3JUYA 4HT1H 4F7EB 3IDGB 4J3XA 4W81A 3PP4H 4PLJC 1A1OA 2CDGB 3SKOB 1RI8A 5EU6E 1J18A 2VZOA 5IFAH 3ZKNC 5CEZL 1HNFA 1M71A 4BK4A 5F7HA 5I1HL 5K9JL 2DKUA 4KGJA 2VQUA 1VDGA 5DJ2B 4JPKL 4P2RE 3QJHB 3I84A 1P6AB 4J8RA 5ESAA 3G08A 4FQ1H 3DXAB 3RY5A 1OGAA 3QEHB 1S9VA 4S1QH 5F1SA 5M95B 5IHLB 1JV5B 4LAJH 3T2NL 3FT2A 1FL3B 4IRSC 3P30H 4LPWA 5T5FH 1D5BA 3VXTB 1JK8A 1IGYA 1MCHA 1S9YA 4Y4KC 2VABA 5EORL 2BSTB 5KOMC 3TFKC 2O93L 3R8BB 1B2WL 2VAJA 2W91A 3FJTA 4Z7WA 3QRGH 1IGJB 4UBDD 4KJWD 3GMNB 1JF1B 2NXZC 3MACL 2OXGA 2XNAB 3I02A 4WRLA 3DROA 3AAZB 4FXKA 5DJ0B 4P23D 5D5MF 3V8CA 1ND0B 2BDNH 1MAML 1CGYA 3ARFD 5FDYA 4NBYB 5E1AA 5EU4B 3HA0A 3LIZH 3A6OA 2FBJH 4JFYA 1XCQA 4UI2A 5LWYL 1EERB 4QKXB 3QISA 4Y8DC 3RGHA 1X9QA 3BP4A 3L7EB 3JVGC 4AG4L 1MCFA 5I19L 3S37H 4DUXA 2ADJA 3NOIA 1VCAA 3C6LD 4RISH 2BY2A 3ROOA 1PYWB 3VXSE 4LAQL 4L8CA 3LQZA 1GGUA 3CDGB 3HB3D 1OAXL 3EO0A 1FGVH 3ESUF 4AL8L 3C5ZA 4KK9C 5TDNB 1JGVH 3WFZA 5KZCD 1I8KA 4OI7A 5IGXL 1PZUB 5T3ZH 1HQ4B 5E08H 2YD4A 5BQ7B 1TQBC 5AYUH 3RX5A 3O3BA 2QSTA 2VDRL 1FE8H 3P9MA 4PV9B 3VG9B 4AEHH 3AUVA 3NZHL 1JF5A 2PF6A 3E6HB 3QUYA 3GB7B 4ZXBA 1NUFA 4AEIL 1C12B 15C8L 4Y4HB 1TVDA 12E8L 3MTRA 5HYIA 2GQHA 3C8KB 3HNTL 2NY6C 2C1OA 4JGUA 3SJVE 4F7TA 4POUB 3R06A 2MPAL 4OKDA 4GW4A 4MA3A 4LOUC 4PGEA 1KJ2A 4TRPL 1RHHB 3C6LB 1UYWH 3G5YA 1D7FA 3T2NH 5I6XB 2BRRH 2JF1A 4NQDA 5B8CA 1HQ4A 4D3CH 5C0JA 4R4NC 1NDMB 3GI9L 1BWMA 4HSQA 2ESVA 3O9WA 5KVEL 3PG2A 5DFVC 5HI4D 4YX2L 5IQ9A 3THMH 2YRLA 4LP4A 4TTGA 3JTSA 5E5UB 2YPVL 2H1PH 4M62H 1GZPA 2EDQA 4PREA 3K2UH 2AAVA 5D6CA 1J8KA 3VWJB 3NCYP 2CR3A 1I9JL 2EDNA 1FAIH 5D2LA 4JJHA 4U6VL 4CUCA 3MUJA 2O61A 3SKJH 1CXFA 1OGTA 5JO5A 5I18H 5BS0E 1GL4B 3QNYB 5EO0A 5K9OA 4LKCA 1MFAL 3GSUB 1Q9WB 3LS5L 1BVZA 2ADIB 5E1AB 3C6SB 3E8UH 2VAAA 4K3DL 4AMKL 5IMMA 1QYGL 2XPGA 5I1DB 5GGQH 3VFNB 1MJ7L 3KPSE 4Y4HC 4K7PH 3QIWC 3CCHB 5CJOH 1REIA 3O8XD 2NNAB 2NY6B 4M6OL 4WHCA 4QHNB 2B0SH 3V4UH 5F72S 2AJSH 3QR2A 3THML 5FGBC 5JDSB 1FVCB 3CH1A 5E8NA 5EC1B 1ES0B 3DMMD 4L9LA 4PR5A 1A7NL 4JRXB 2I24N 4I0PC 3WFDH 5LGJB 3VXQA 5I73B 1XAUA 1CIDA 3VFUB 3DOSA 3ZKXC 2BVOB 5E8OA 3WFEL 1MF2L 4H26B 4D0CB 3T65B 4Q9QL 5T33H 3ULUL 1T7ZA 5F1OB 3GHBH 2P24A 3CX2A 1QA9B 4O58L 2N7AA 3WIHH 4C54A 4P9HH 3GZKA 4K7PX 3E3QC 1FCCA 4L8BA 1PDKA 4HBQA 2XA3A 1IGCL 2NLJB 5ENWB 3BP6B 3DO7A 1MCBA 4XPTL 4HH8A 1EZVY 5E1HB 1ULVA 3OPZL 5ID1A 1FZJB 3MRNA 1I3RA 5CWSB 1DUZB 5I8EB 3MV7A 2DLEA 3ARSA 5T1LD 3CXDH 3SE4A 3F12A 1UG9A 1J1XL 4HKBB 3QUML 3TVMC 1PAMA 5ICZA 4R7DB 5KN5B 1HXYB 4F9LA 1EO7A 4XC3H 3HC0A 4K71C 3DO3A 5TQ2L 4JZNB 4FFYH 1FG2A 1WIUA 4DW2L 3B5GA 3HAEB 1ZMYA 2CIKB 1KCRH 2YUXA 5ETUB 2Q86B 3BJ91 3MXWL 3QEUB 1EO8L 5TJWK 2IQ9H 4HIIB 1TETL 3MV01 2E7CA 4U3CA 5TFSL 2G75A 4MJ6A 4OZHF 1QO3A 1T1WA 1LO4L 4PGCA 4WU7B 1YY8B 4TSBL 5EZIH 3SDDA 4MLSA 3QIBD 2ESVD 4W4OA 4ZFOA 5I1EL 9CGTA 3HZYB 5IP4A 4EVNA 5FYLD