4X7FC

Crystal structure of norovirus gii.10 p domain in complex with nano-25
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
b'DVQLVESGGGLVQPGGSLRLSCAASESILSFNHMAWYRQGPGEQRELVAVITREGSTDYADSVKGRFTISRDNAKNMVYLLMSNLRPEDTAVYYCNRGISNPWGQGTQVTVSSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
total genus 27
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7fC00
5CILH 3IETA 3LKSA 1TZIB 3B6SB 1NFIB 5IQ7L 5C0GB 3S36X 5E5MA 4X5WA 3FN0L 4FQJH 4XZUA 4L3EA 1U8HA 3MCG1 1YNLH 5HHPB 5HVHB 2UUDH 5IHLB 4UU9B 1NGWA 2OR9H 2WLZA 1RZJH 3O8XC 1MIML 3MYZA 3P77B 5CBAB 5KW9L 4GRWE 1H5BA 4IRSB 1KV3A 1QQDA 3SKOA 5IW6B 4FS0A 5FYLL 3RKDC 4JM2D 1UM5L 1H15A 1ZLWK 3U7YL 2XY1A 3C5SB 2CKNA 2IQAA 4NQDA 2APXA 2J8OA 1DL7L 5JOEA 3QDGE 1K8DA 4GW5A 4WEBL 3ZKNC 3WN5C 3MQIA 2W9EH 4WJ5B 3LIZH 4Q0XL 5FUZL 3FT4B 1KFAL 3OAZH 1YY9D 5E00A 3QEHA 3H3BC 2WAHA 5GGVL 1G7LA 4LNRB 5F9AC 3U4EB 2QSCL 4JHWL 3RZCD 1N8ZB 4M8QA 3U7WL 1D5MB 4D2NA 1FPTL 2PO6C 1SBSL 3ARTA 4OF3A 1T04B 2Q76B 4YFLF 3EKCA 4JHBA 3L5IA 3RWJA 4X0KA 5C8JA 1XF4A 5C0BA 1IAIL 3MRCA 3HZKB 3VJ6A 2M8XA 1DP0A 2KQMA 3LN4B 1T5WB 5C9JA 3KR3H 1NGXB 1IBGL 1FZOB 1M4KA 1KLGA 3SJVB 3U48A 2VITB 1Q1JL 1NBYB 4KI5E 1RV6X 1CIDA 2FL5A 2IGFL 1YEKH 4OLYH 1ZHLA 4MA1B 4N0YH 2AK4E 3C6SB 4JY6A 2WP3O 1IC5H 3QUYA 4JGMA 4HX1B 3STLB 2F19H 1AY1H 4PGCA 5DLML 4D0DB 3ZSSA 1UXSB 4X9BA 4BH8B 2A1WL 4MNQB 4OF5A 1OM3L 3IF1A 3G5YA 2DBLL 4L1HA 5IJVB 3EYVA 3LKPB 4WW2F 4Z7VE 1YQVH 3NIGF 2AEPH 4IOSD 3IDMB 2DQGL 1AP2B 1E4JA 3D2UA 2N7AA 3WO3B 5HGHA 4R7DA 3UYRH 5JZ7C 2XNAB 5DD6B 3CUPA 2Q6WA 3WS6C 1K3IA 3KYOB 3O81A 1R3JB 3E6HB 5CJ8A 1KTKE 5IMKA 2LAGB 5IQ7H 1VADB 2LFGA 5DJYB 1BVKA 1JUFA 1V7ML 2A73B 1G7QA 3FN0H 2AEWA 3IJHA 1FC1A 3QZWB 3BX7C 4M02A 3F12A 1IAII 2F74A 3EGSB 1SJEA 5HYJE 3VWKA 4N0FA 1QD0A 4Y5XC 4MVBC 2MQCA 4QOKD 4LCCB 4OZGE 4NO2A 4XHJC 1QA9A 5I8EB 1QRNE 1MIMH 5KW9H 5D71L 3WEXA 1PDKA 3QP3A 8CGTA 4IIQA 4PYHA 1I9JL 4FOMA 4C56D 1ZWIA 1BHGA 5FYLH 1GIGL 3MRFB 1UM5H 3HC3L 3SDDA 3U7YH 2JJSA 2ICWA 4UDTB 1A0QL 5CZKA 4HUKB 2BVOB 4PLJC 3MGOB 3VXSA 4P49A 3NZHL 1DL7H 1S5HB 2Z8VC 1MCJA 3AUVA 1Q94B 1MCWW 4NQXA 4N8VA 1OT1A 3QQ4B 5D93C 5B39G 2OK0L 4Q0XH 4PP2A 5FUZH 5JXAL 2XQYG 5JHDE 3GMPA 3FQRA 3O0RL 1S5IL 2AI0L 4YO0A 5GGVH 3BDBA 3UAJD 1TJIL 3ARGD 2QSCH 3PWLB 4JHWH 4P2QB 1YJDL 3U7WH 3X12B 3HR5B 2Y72A 4JJHA 1FPTH 1SBSH 1AHWB 5FO7B 4HLZH 4K8RH 3NPSC 3RY6C 3QAZC 1D5ZB 4PJ8D 1IAIH 5D1XA 3GSUB 1F02I 3T0EA 1AR2A 1EVTC 2ZSVB 1NCBL 3HG1D 4MJIB 4XVJL 3FOLA 2EDRA 1IBGH 4BFIB 2QADB 5CEXB 4ZS6C 4RFNB 4JZJB 5HDBE 1Q1JH 1T0PB 3NCYP 2IGFH 2FX9L 3GI8L 1HEZA 3KPQB 4FZ8L 2Q3AA 3ROLB 3VXOB 1INEL 4FXGA 3RTQD 3WIFB 1CDGA 3SGKA 3ELAT 1PSKL 5DLMH 5FCUL 4J6RL 5FA3A 4Q2ZA 1OWWA 4PRID 1MHEB 2A1WH 1OM3H 2DBLH 4YPJA 4FTVD 4HIEB 4KKBC 3GIZL 3QDME 5EOTA 1EH9A 2D31B 2YUVA 3HRZA 2DQGH 2DIJA 4O51B 1UVQA 2FWOB 5DRXA 5EZIL 4QHNB 5ILTL 3SEPA 3UJJL 4LFHD 1YN6A 1FVDB 4XH2B 5JW4N 5EFIA 4NOBA 3LAFA 2XWJA 3NCYS 2IANB 4QRUA 1RUPL 5EU6D 4NQED 1V7MH 2XTJD 3DARA 1QFWM 3LN5B 4QRPA 4QRSB 5JIPA 1N7ML 1O5DT 4ZTOL 4X4MA 4H0HB 3IU3A 3MRJB 3FT2A 3V5HA 4K8RD 4U0RC 3KPSB 1NAKL 3WDJA 3GSWA 1OGAE 5D71H 3ARZA 6FABL 5HPMA 4UT7L 1I9JH 1BLNB 1YMHB 1QOKA 1GIGH 3GMLB 3CJJA 1Q9KA 3BPLC 3HC3H 5IM7A 1W72B 1PQZB 1A0QH 3S3PA 3NACL 5A3ID 5DEGB 1NGYB 2NY1D 4RBPH 1OOAA 3U0TA 4U6XB 3A6CL 5HGGS 2AK1L 3CMOL 2BOBA 4LOUC 4JKWA 3H3PL 3RP1A 1FNAA 3OKLB 5F88A 4XC1L 5JXAH 5L2KE 1MI5D 1RZFH 2F8VA 4AEEA 3MREB 1YZZA 5EOQL 3O0RH 1S5IH 5HYFA 2AI0H 4N5EC 4OFYA 3PWPD 1TJIH 4HUXA 2DAVA 3LDBB 3K2MC 4JE4B 1YJDH 2B4CC 2ITCA 3O8XA 5L2JB 3HE7B 4LVOB 5CIPH 4DFHA 2DS4A 1NGQL 1JNJA 4PJBA 5SWZA 5D1QD 2PW1B 4YZFE 2OM5A 1FBIL 4P9HC 5HHXL 5INCA 3EDDA 1H0DB 3O41B 4NUJB 4XCEA 3S7GA 3ZKQD 1NCBH 1RI8A 5A2IH 5E8EB 4XVJH 3FB8A 2APWA 1CVRA 3O3UN 1E4KC 3WN5A 2QJDA 3QG6A 3RVXC 3GJEB 2VN7A 3DLQR 3V8OA 5C0EA 2VZ3A 1L7TL 5DRWB 5ADOL 1A9EA 3BP5B 1WV7T 5FO9B 3D0LB 5HHME 3MJ9A 2FX9H 3GI8H 1KEML 2P42B 4FZ8H 1T3FA 3DRQB 1SY6A 1OGTB 1INEH 5E1AA 4OGAC 2V9QA 3S5LB 4PJDB 5GS1B 5J13B 4RIRB 4WUKH 3BD5A 2PO6A 1PSKH 5FCUH 4J6RH 1CDHA 4PREA 5MI0C 1FO0B 3P9LA 1KJ2A 3UTSB 3QI9D 1FFPA 1KUMA 1TZGL 3L3KA 1HWGB 2HKHL 2CDGA 3TYFA 3GIZH 3HPJA 2DB8A 4ODVL 4MYWB 2EE6A 4QHKJ 1JYNA 1AGFA 1GH7A 1KCUL 1KGCD 2A6DA 3FONB 3OKNA 4M1CD 2X89A 5EZIH 5D5ME 4P23D 5MENE 3F6LA 4JFQB 2AAVA 3UJJH 5CCKL 2CLRB 1S9KC 2Z35B 4HUVA 3ARDB 1MUJB 4U2ZA 5DMIL 4QXUL 5BRZD 1RUPH 4PGJA 5TJWK 1DE4B 1GL4B 2A6JB 2P5WE 3T2OA 1R3KB 3QHFL 3VFOB 3KPLB 3ULUC 1I8MA 1MQKL 1IILE 4ZTOH 4YXLL 3DBXA 5CBEA 3KAAA 3U4BH 1N0LA 1A7BA 4NNXA 2YEZA 4BUHA 3LKSB 1NAKH 5FGSA 7FABH 6FABH 4JO4L 4PJXE 2X4TA 2KBGA 5E5MB 4X5WB 4NKIL 4EUPG 4XZUB 2ZUYA 5HYSB 4HK3N 1U8HB 2VR9A 1UWXK 3NACH 3WS6A 5L6YL 1Y6NR 3F65A 2VDKH 2NXYB 3A6CH 5HGAA 2DQHL 2AK1H 1IFHL 3CMOH 2IADA 5GS2H 5ID1A 2CIIA 3H3PH 3SKOB 3DI2B 3D85A 4OGYL 4XC1H 3WO4C 4D94A 4Z7NE 2BNQB 4K07A 1WVZA 5EOQH 3JWOC 4Y5XA 4QGTA 2IQAB 4NQDB 3W0WE 4NO0A 4BH7A 1NGQH 4GW5B 3KYMA 1A6ZB 5ERWA 4CVXA 4TOYL 5E00B 1FBIH 5HHXH 3QEHB 3MLXL 3V4UL 3R06A 1MJJA 4K94C 4M8QB 1WBXA 4JB9H 1N59B 1R5IA 3EDKA 4P2OC 1DBAL 1BF8A 1GZQA 1LGVA 5F7LB 3DVGA 2ICWI 2A6IB 3GMQA 1Z5LA 4UTBL 5DJAA 5IGXL 1L7TH 5ADOH 4M4RA 5C8JB 2DN7A 1XF4B 5C0BB 1ITCA 3MRCB 3VJ6B 4YDLB 1KEMH 3MRQA 5EUOE 5HSFA 2FEDD 1IRAY 5GGTA 2W0LA 1I3GL 1NC2A 3QRGL 5C9JB 4WI5A 1T0NB 4G8GB 4ORZC 1TLKA 3RY6A 4PG9A 1QSFD 1TZGH 1ZA3A 3R8QA 3RFZC 2HKHH 4W68A 5GSVA 2FL5B 3CAFA 3O45A 1ZHLB 4ODVH 4R0LC 3SCMD 4XP9L 4JY6B 3GMNB 5A1AA 1KCUH 3QUYB 1J0ZA 4HGWA 4PGCB 4UAOB 3H7BA 4J8RA 5CCKH 1J8HE 4PBXA 4YBHA 5FAAA 3T2QA 3KDMA 3FOMA 1I1AD 5DMIH 3KLDA 4QXUH 3IF1B 4JFXA 3G5YB 4XX1E 3EYVB 3MACL 4PJ8C 3E6FB 3LRGA 2BY0A 3QHFH 4IJ3C 1VFOA 4HG4J 4M6OL 2EE9A 4R7DB 5BS0D 5HGHB 1MQKH 2JTDA 4H1LG 3CUPB 2Q6WB 2BOCA 4I5BB 1MHPL 2VLJA 3JV0A 1WT5C 2APBA 2R0WL 4GFTB 2BVQA 3SE4C 4LLUA 4EXKA 5IMKB 2MMXA 4JO4H 1BVKB 4L1DA 1G7QB 4NKIH 1NEUA 3IJHB 5BQ7B 4WEUD 2PF6A 5IQ9A 1LEIA 3DETC 1UA6L 4I0CC 3RWIA 5JDSA 4L4VE 3CVHA 1SJEB 3VWKB 5L6YH 4HQQL 5J57B 1V7NL 5KS9E 3UBXA 2NY6C 4NO2B 1QA9B 2BY1A 3ZE0E 2EC9T 1JI2A 2DQHH 3TPUB 1IFHH 5ISZD 3L3GA 3WEXB 3UROR 4NHCL 1ZWIB 3LPFA 4ZUWB 2AV7B 3N85L 4OGYH 3MLVL 3SDXE 4GW1A 3SDDB 5I1AA 3JWDC 5KN5A 4HSQA 1SM3H 3QWRA 1EK3A 3VXRD 4NQXB 4N8VB 3IJSA 4OUUA 4ZFFA 1TJGL 1PKQA 3GMPB 3FQRB 3MLXH 4YO0B 1FSKC 3ZDYF 4PJFB 3K3QA 5IVXF 4XPGL 3MJ9L 4J3XA 3NVQA 1DBAH 1SY6L 4JRXB 4D8PA 3TIDA 4UTBH 5ITBL 2DD8L 1DQTA 5IGXH 3OKKA 3O6FD 5DD5L 1KJ2L 4MNGA 3VGEA 1YPZE 3T0EB 4NKMA 1I3GH 2NYYC 3QRGH 1V3LA 1J88A 1RZIA 3FOLB 1YNTA 2YD5A 1K6QL 1H3VA 1A7PL 2Q1EA 2X7LA 4D3CL 3H9SA 3D25A 1CE1L 4X7TB 5I2IA 1IZJA 4HMEA 4ZAKD 4XP9H 4FXGB 1Y6MR 1OAXL 2Z8SA 1E4KA 1NBZA 1O7VA 2AJSL 4H0GA 4HJ0D 2EYTA 5FA3B 1DVFC 4JVWA 1F58L 2WBWB 1JWMA 3PHOA 4YHML 1WWBX 3MACH 4KU1A 3IFLL 2H41A 5AAWA 3HRZB 1UVQB 4M6OH 4F58L 3MGTA 1YN6B 4ORGA 2QKIA 5EFIB 5FCSH 2G9HA 4NN6B 1MHPH 2XWJB 2R0WH 4JDZB 5C08A 4QRUB 3IFOB 5CLWA 2ZG1A 4Y4HC 3UC0H 1IKNC 4QT5A 3TT3L 4Z78A 5I1DA 3I3DA 4QRPB 2J1KA 1RJYA 1V8HA 1UA6H 5DHVA 3EHBC 3IU3B 5AEAA 4HQQH 3FT2B 3RI5K 1V7NH 3V5HB 1HCVA 1A6WL 1T1XA 4NBYB 3GSWB 2PYED 5HPMB 2VL4A 4NHCH 4LHUB 4Q6YA 3RVVC 3HN3A 3MLVH 4NP4L 1Q9KB 1E0OB 1H3XA 4RRPA 1UWGL 2BFVH 2CKBA 4P23C 4XP6L 4I0PB 2HJKA 5I75C 3U0TB 5B38A 4MAYC 2BOBB 1FNFA 4XVSL 1RUQL 1WZ1L 1ZLSL 4JLRA 5F88B 1S9XA 1TJGH 2IC2A 4X8JB 1AXTL 5IB1B 4HUXB 4HD9A 4QNPE 3MOAL 1W0VA 2ITCB 3DTXA 3MJ9H 5EBWA 2WM0A 4PJFF 1SY6H 4TVPL 5GGTL 4PJBB 5SWZB 5F9DC 3J8F7 3EW3B 4X6DA 5ITBH 2DD8H 4DK3A 5DD5H 3N1QC 4MSWA 1KJ2H 5ANMA 5INCB 4WTZG 3SBWC 4XCEB 4LLYB 2VDRL 4XNQA 2RBLA 1K6QH 4U3XA 2ARJQ 4XBPA 3WN5B 3QG6B 4U1LA 5C86A 2VKXA 2HA1A 2P8MB 5DR5L 5C0EB 2J12B 1A9EB 2HVJA 1HHJB 1CE1H 1AGBA 1T3FB 3BP6A 1DQML 4ISVA 1HZHL 3RRQA 4NN7C 4P2OA 2YWZA 1R6VA 1KXTB 2PO6B 2AJSH 3MRPA 4PREB 2NW3A 1F58H 3P9LB 4C56A 1FFPB 4YHMH 3IS0X 2YPLE 2BSED 2EYSA 2CDGB 2CPCA 3TYFB 3IFLH 3HPJB 4NO3B 1WAAE 8FABB 2FDBP 1AGFB 4PJAA 2A6DB 3BH8A 5JLZA 1I8LC 1KC5L 4HPYL 2R2CA 1RHHA 3ZDZE 2E7MA 1FFRA 2BHUA 4HUVB 5FUOL 3GGWA 4RAHA 5I0DA 2GIYA 1I9IL 4JFEA 4R0LA 3TT3H 4JFHE 1C1EH 1FN4A 2EIZB 1I8MB 1WF5A 3DBXB 5CBEB 1RJZB 4ZNEA 2HP4A 3MV01 4ELKA 5DQJA 2DQJL 2CLVA 3R4DA 4NNXB 2YEZB 1BZQK 2NX5A 1A6WH 5I8CA 4CBPA 3FFCA 4CDGC 4PJ8A 3NIFE 2E5EA 2ED7A 2X4TB 2EIBA 3WFBL 1S9WA 3PL6C 4FQXC 4NP4H 2J7LA 5F7MC 3TH4T 4HF5L 1RFDL 1UWGH 4XP6H 2OJZL 4M03A 1YMME 4J3UA 1WT5A 4KK5C 2XQYK 3SE4A 4XGZA 2LE9A 2IADB 3BI9X 5ID1B 2CIIB 4XVSH 1RUQH 1WZ1H 1ZLSH 3D85B 3PP4L 4M5ZL 4OT1L 1FDLL 2CO7B 4FQ2L 1AXTH 4Y5XB 4EDWL 3MOAH 1QR1A 5F3HA 4NO0B 4BH7B 2B4CL 4TVPH 5GGTH 3KYMB 4UV7L 5ERWB 3E2HC 3ARQA 4CVXB 2HT3D 3UBXI 3QDJD 3R06B 1MJJB 1JZ4A 1KIRA 4P9HL 4PJEE 2DL2A 3TA3D 5T1KA 1Q9OA 1CIUA 1WBXB 3I50L 2VDRH 1R5IB 4A6YA 4YX2H 1GZQB 5DGRA 3BKJH 3DVGB 4FN0A 5D93B 5D7KE 4JO1H 5FXCH 3GMQB 4XNZC 5DZLA 1Z5LB 3QEQA 4AH2B 5DJAB 5DR5H 4PLOB 2QSQA 3BGMB 1EHXA 3HUJE 4DVRL 3P40A 1ORQA 3MRQB 3FO1A 4IDLA 5HI4C 4P2RA 1DQMH 3RGVC 1HZHH 1ZKAA 1MCEA 2K9UA 4BSVA 1UZ6F 3OR7A 3NPSB 2FJGA 4X6EA 3T3PF 1JZ7A 1LQSR 3QAZB 4PG9B 4EN3D 1QSVA 1ZA3B 4KJQC 5FM5M 4DN4L 5GSVB 3O45B 3NIDF 5KVDL 1JPTL 2H2PD 3VI4E 1KC5H 4HPYH 4OFVA 4KI5C 3S6CA 4J8RB 4EI5C 4RDQG 2D7NA 2CR6A 3KDMB 3FOMB 1AFVL 1N64L 5FUOH 4JFXB 2J88L 1I9IH 3QNZA 4P46D 4K3JL 4KRPD 3B5GA 3W39B 1CFNA 4UOW0 4LPUA 1JHKL 3ULUL 1DVFA 4KUCF 5FA4A 4G80B 2VLJB 4GAGL 5T3ZE 2CKBL 4JN2A 3IS1X 5C70A 2IAMD 4GKZA 4LLUB 5HTSA 1A2YA 4PP1D 1GHFL 4Y19D 3ZE1F 4NBZB 5IQ9B 3WIHA 1LEIB 4J4PC 4HWBL 4HF5H 1RFDH 2NCMA 2OJZH 3CVHB 3BDXA 4Y5VC 2ZOKA 1CF8L 4HJ0C 2DWDA 1SVCP 3AY4C 1LHZA 3L3GB 4Y4HA 3M1BA 1IKNA 2XWTB 3PP4H 1TCRA 1SJXA 4M5ZH 4OT1H 4CAGA 3LEXA 4GW1B 4F7TA 2V2WA 2VDPL 1HDMA 3O3DA 4FQ2H 4K2UL 5KN5B 4EDWH 2FH6A 1A3QA 4U0RB 3P9WB 4KXZH 3ARUA 3RX8A 5I71B 1IEBA 1EEQA 2JCCF 3GUTA 4KV5F 3IJSB 2IPUG 3SGEI 4OUUB 3CX5K 4UV7H 4PRPB 2DQEL 1S9VA 1PKQB 3G6JA 3BIBX 4FFYL 4P23A 1W8NA 3BVNA 4GKNB 4P9HH 1ZLWH 3PP3K 3JBG7 1F8TL 4K94L 4MAYA 1FNEA 4PRHB 3QQ3A 1NQBA 4PUBL 3RUGE 3VXMB 3TIDB 5L9DL 4F2MA 5FF6A 3D69A 4K3HA 1XEDA 4MNGB 3M8OH 1RZ8A 3B9KC 4DVRH 5DMJB 4F7PA 1FHGA 3DMMC 4P0DA 4C83B 1RZIB 1YNTB 2R69L 3S88L 4OBSA 4NQCE 3UTTE 3OJMB 1HWHB 5A2KH 3QR2A 2ZSWB 3PDOB 2X7LB 3SBWA 3H9SB 3D25B 4GXUN 3QIWD 5I2IB 3JSSA 5A16A 5IUSA 4LASL 5D2NB 1F4HA 4OD2A 3B8YA 5EC1A 1MRDL 4BA8A 4N90D 5T3XL 5F6HI 2EYTB 3O3EB 4PB0L 3V52L 1A4KA 2ZCHL 3MBED 1JWMB 1MRFL 1AFVH 1N64H 3PHOB 1T1ZA 3DPBA 4JM2B 4GRMA 2J88H 4R97B 1XF2A 5FKAA 1KJVA 2XKSA 4K3JH 3RHWF 1ZVYA 1FH5L 1CQYA 5MI0B 1JHKH 3ULUH 4ORGB 2QKIB 3ZDXF 2G9HB 5GGRA 1EJ6A 4GAGH 2CKBH 1OTUD 5DD3L 5C08B 3Q1SL 4OV5B 4TTGA 3WD5L 1P2CA 3D18A 1JFQL 4QT5B 4Z78B 5I1DB 2ZJSL 1GHFH 4GG6B 1RJYB 1I8LA 4HWBH 25C8L 5DHVB 2PYFA 3D5OF 5DUBB 2C3GA 4R8WL 2WMPA 1CF8H 3AB0C 2CRZA 3ET9F 5HYEA 1T1XB 5DS8A 4MS8C 2Z31C 3QEGL 1E27A 2R0KL 1WQVT 5BZDA 1PG7L 1KLUA 3PG2A 1WC7A 3H9ZA 2VDPH 4MJ4A 2CKBB 3VXUD 3QISA 5IBLC 2HJKB 3QFJE 4PR5A 4PJGA 1SJHB 1ZGLA 5B38B 2QHLA 3ZT6A 3QXWA 1F97A 3JWDL 5BVJA 2E8YA 2DI7A 3DX9A 4G9FD 2C3WA 1A6PA 5I1EL 3VH8G 2XZCL 2V2TA 3GNML 5K9QI 5T5NF 4K7PL 4A6YL 4FQPA 3PL6A 4FQXA 4LSVL 1LILA 1S9XB 2DQEH 3BOVA 4ZD3L 5HYIA 3HRPA 1R0AH 5D96C 5SWSD 3UJIL 5JOFA 1AGEA 1W0VB 2VZUA 3DTXB 4L5FH 5EBWB 1F8TH 3MZTA 4K94H 4Z0XA 4PUBH 2NY0D 3B5TA 4X6DB 3NZ8A 5L9DH 5JTWA 3OAYK 3KG5A 3KS0H 4G7YL 5MEPA 2VLME 4NKDA 4GS7C 3EAKA 1E4WL 3ZYJA 4HBCL 2R69H 3PGFL 4NCC2 3GKZA 2MJWA 3S88H 4XBPB 1REIA 3HAEG 4U1LB 1NEZB 5IK3A 3MJ7B 2HVJB 3G9VA 2CLZA 4NQUA 2ICEA 1AGBB 3SKUD 3F62A 1FGNL 4QOKB 1FYTD 4ISVB 4BM7A 2C4FU 4LASH 1EMTL 3E1F1 1MRDH 3NIGE 2GK2A 5T3XH 3MRPB 4PB0H 2NW3B 4RMSA 3CDGA 3V52H 1MRFH 2ZCHH 4C56B 1S78D 4XP5L 4UNUA 2FGZA 3BXNA 2EYSB 2HT3C 4YGVA 4JM2F 3RGVA 3TA3C 1NDMA 1VCAA 3BH8B 2B5IC 1RMFH 1FH5H 5JLZB 2NY5C 3WIHL 1RHHB 1LP9A 3RWFA 1D9KD 3GGWB 1CGUA 5DRZA 1RJLA 3Q1SH 4JFEB 4OM0L 3WD5H 3K46A 3V6FA 1JFQH 2ZJSH 3ARGB 2YRPA 4HIIB 4OFDA 3SPVB 4YHPA 4L3CA 3K2UL 5AYUL 1OTTD 3QSKB 25C8H 4GG6F 4EI5A 3V6OE 4R8WH 4ELKB 5DQJB 2CLVB 5E6YA 4KHTL 2AK4A 2WWMC 3RAJH 3FFCB 4PJ8B 2L0DA 3QEGH 1MREL 2R0KH 1XH3B 1PG7H 4IJ3B 4LNVA 1BZ9A 4WI6A 3DI3B 3QXTA 1WZLA 2H2PC 3VWJC 2COQA 3HI6L 4HULB 5KSAD 5I1EH 4X9IA 2XZCH 3GNMH 4K7PH 4WGWB 1IGFL 4M8VA 3WNMA 4A6YH 4LSVH 4FFWD 4P46C 4J4PA 4ZD3H 5E2TL 1ZEAL 4GAJL 3VD4A 1HXYA 1ODAA 4Y5VA 1KB5B 1CLZH 2NY6B 3CXHK 4XAKE 5C0DA 2GSGA 5T3XD 4PRIB 1QR1B 5F3HB 4JDVA 1HH6A 3AY4A 3EFDL 4FTVB 1ZGLM 2OX5A 4S2SA 1L9NA 1BVZA 4PP1C 4P5TC 5FHAL 4R4BA 3V6BR 4K71C 2Y4SA 1DUYA 4KMLB 4JQIL 5T1KB 1Q9OB 1E4WH 2GCYA 3SJVE 2FHCA 4ODTL 3F7VA 3BKML 3PGFH 5HHOD 4X7CC 3QEQB 2YBRA 3WFZA 3QUML 1H3UA 4NPYA 5JOPE 1FSKB 4OCXL 1FE8L 1IVLA 1ORQB 3QUXD 3FO1B 4GKSB 4PLKC 4P2RB 1FGNH 4JRWA 1EMTH 3STZA 5JHDA 4BSVB 4MNQE 3OR7B 3LD8C 4FQHA 2VMFA 2FJGB 5E70A 4LSQL 4XP5H 2DRUA 5HDQL 3B9KA 4QRTA 2E9JA 3CGTA 3WHE0 4I1NB 3DMMA 2EH7L 1UACL 4NZJA 1P7QA 3BKCL 3EOAB 3BMVA 2VYRE 3WIHH 2C1OB 3EO0A 1F11B 3BDYL 1QFHA 3U7AA 1HHIA 1G6RA 1ZSDA 4OM0H 1F4YL 3QNZB 1Q38A 1BFOA 1EGJL 4JFOA 3K2UH 3RX5A 1CFNB 4P4RA 5GPRA 3BRGC 1DVFB 5FA4B 2F53D 4KHTH 3TC9A 3ZTNH 3MC0A 2AXJA 2NR6D 4JN2B 4GKZB 4HFWA 1A2YB 3MRRA 1MREH 1QG3A 5E6IC 1NPUA 2NY2C 4KKAD 2YPKA 2YZ1A 2XACC 1J12A 3SKJL 3DRTA 2ZOKB 3QDMA 1CGWA 3OXSB 3VFTA 2DWDB 4OFKA 4HWEL 1VGKA 3CLEL 1FORL 4Y4HB 3M1BB 3VG0L 1DDHB 1IGFH 1AXSA 1TCRB 1QFOA 5H37G 4P2QE 4RZCA 5E2TH 1EUUA 1Q0YL 1ZEAH 4GAJH 4F7TB 1HDMB 2BY2A 2R2EA 1HYSC 3ZTJG 2VZ1A 4S1SL 2X6MA 1GOGA 1EHNA 1IEBB 4XWGL 5DEFA 3EFDH 2Z31A 1QKZL 1ZLUK 2J8UA 1A1OA 4XTRD 3WHE1 2J2ZA 3BGAA 4BJLA 3MRKA 1BOGA 3KXFD 5FHAH 4EXPX 1A64A 4XT1C 3ROOA 1S9VB 3H0TB 3G6JB 1OGAA 5DJ8A 4P23B 4MJIE 3BVNB 5T1LD 4JQIH 5I75B 1HQRA 4CADB 3PWJA 4U33A 4ODTH 4MAYB 4POZC 1FNEB 3X17A 3BKMH 3QQ3B 5BRZB 3DVFA 3D39D 3BH9A 3BUTA 3C5ZC 2XPGA 4B41A 3Q5YA 4B5EA 2VXTL 3QUMH 5FF6B 4F2MB 3D69B 1RZ8B 4XCYB 1MY5A 4OCXH 1FE8H 5B39A 4KK8C 4AEIL 4F7PB 1K8IA 1F3DH 3H7LA 5TH2A 4MQXC 2BNRA 1NL0L 5F9WC 2GJZA 4DW2L 2V9TA 5AYQA 4X6CA 2A74A 4LSQH 5CEZE 5HDQH 1T2QL 4NZDA 2X44D 4XVTL 2J3SA 1KJ3L 2EH7H 1UACH 5A16B 3AAZA 3BKCH 2AQ1A 1AKJD 1SVZA 4OD2B 5EC1B 5HVWA 2FGWL 2IANE 3CFIC 3CH1A 2GY7B 3BDYH 3RY5A 1A4KB 4P3CL 1T1ZB 4GRMB 2YUXA 1XF2B 1F4YH 3P0VL 5FGRA 5DI8A 5FKAB 1KJVB 4GOSA 5DDHA 1EGJH 2ZUTA 1UG9A 4NN7B 1X9QA 3KPSE 4H25A 4M9PA 2UWEF 3BISA 4MDJA 5GGRB 4OCRL 3HB3C 5IW1A 2VABA 1CICD 1W0WB 5HYSG 3WNNA 4G8IB 3QDJA 2KPNA 1P2CB 1D6EA 2XZQL 3TA3A 3WMSA 1DQJB 1JGDA 2ADFL 3ZKMD 3MNVA 1RY7B 2PYFB 3SKJH 2GAZB 2EXWC 1D5IL 5I8OL 4HWEH 1XT5A 4OCMC 3CLEH 1E27B 3VG0H 4HCRA 4XBGA 5IEKA 1EJOL 5BZDB 3T0BA 3MRDA 3JUYA 1KLUB 1S9YA 4K3DL 1Q0YH 2WWKO 1WC7B 5FEBA 3FN9A 5FFLA 1C5DA 1MFNA 4U1JA 2VLKD 4S1SH 4PR5B 4GRWH 4PJGB 1ZGLB 1D9KC 5BVJB 3CPLA 4APQD 3DX9B 3TWCL 4XWGH 1QKZH 3NAAL 4MB5A 2V2TB 5JIKA 3RX7A 4FQXB 3TNMA 1BZ7A 5I74C 5KSBA 3VWJA 1T6WA 1B0GA 4ETQA 1PX4A 3G6JF 1AGEB 1WWWX 1U8KA 3VRIA 1FL6A 4OJFL 4Z0XB 1LNUB 4P5KA 3DNKA 4P46A 4WWKC 2VXTH 1CDIA 4G9DA 4PJDE 5MEPB 1PG7W 4NKDB 2E9WA 4MXQD 4AEIH 3GJFK 4ZXBD 5DJ6A 3UTSE 1NL0H 1QVOA 4DW2H 2VLRD 5DHYA 3LQMA 5DVOA 1K5NA 4P5TA 1FJ1A 4R4NC 3E2HB 1G84A 5IK3B 1T2QH 5K93A 4XVTH 2CLZB 2ICEB 1G6RL 1KJ3H 3K8KA 1UQSA 1VACB 5ISZB 2DLEA 2HRPH 2AXHA 1HXMA 3CDGB 4XNZB 4YHIA 4P3CH 3CVIL 4NO5A 4KMQA 2AS5M 3BXNB 3BPOC 1CL7L 3P0VH 3QCVL 4LQ1A 4YGVB 5AD0A 4NFCA 3QQNA 1ZV5A 2OL3L 2DYPD 3RGVB 5E9DD 1GVIA 1T2XA 1J7VR 1NDMB 1NANH 4GAYA 4TTDD 4QRQA 2VZSA 1LP9B 5IB5A 4WI2A 2A83A 1Q72L 4OCRH 3HLAA 5DYOB 3G08A 1RJLB 2BVTA 3ZYIA 3EYUL 1BJMA 2XZQH 4CNIA 3MRMA 3QUXC 4L3CB 5FGCB 2VQTA 3TJHD 3DO3A 5F44A 3QDGD 4EI5B 5A2JH 1D5IH 3ARBD 5I8OH 1S7UA 5HGBA 3A6BL 3GM8A 2YD3A 1EIBA 2BNQE 4HS3A 1HE7A 3TBYA 4UUJA 4V2CB 1EJOH 1WEJL 4DGIL 4J3SA 4NQDE 4K3DH 5F1KC 3SO3C 2X40A 4X4XA 2BMKA 1QSZA 2IPUK 5ALCL 5CMAA 2F5BL 3VGFA 2BP3A 4AIZA 3S98A 2V6HA 3TWCH 3OGOE 3ZDYE 4PJGF 5IV2A 3UYOD 3BRDA 1JGLL 4ZYKA 4IBLT 2ZCLL 5E6IA 1MWAA 4PFEA 4Y2DD 3ARED 1CL7I 2V9RA 3LQAL 1TNNA 1HXYB 4Y5VB 5IF0A 2F5AL 2YS4A 1NKRA 5C0DB 4EUPA 2GSGB 4JDVB 1IQWL 4OJFH 1HH6B 4JKPL 1CYGA 4BSWA 4S2SB 5C0BE 3FQUA 1IMHC 1WZMA 4R4BB 4UQ3B 5F7YC 2AABL 3V79C 2CRMA 1DUYB 3FCTA 4U2YA 2ARWA 4G8GE 2GCYB 1RZGA 5D70L 1U95A 1B4JL 5GZND 1KACB 3G5ZA 3WUZA 3MA7B 2A6KA 2DL9A 5C07D 3CX5J 3OSKA 4EJ1C 4NPYB 2AJ3B 3EJYC 2W0FA 3WUWG 4MHHG 1G6RH 1DQQA 5D7JC 5C0NC 2R39A 1V5JA 1J86A 4FQHB 4GQPH 3O6ML 5E2WL 1NBVL 2D03L 3ZYOA 3C5ZA 1FIEA 3CVIH 2P24A 1A9BA 1PW3A 3RQ3A 2Y7QB 1MH5B 1A7OL 1CL7H 3B9KB 3QCVH 4EDXB 5HYJD 4MA3A 2OL3H 1P7QB 1QRND 1FVEA 4IOIA 3VCLA 1X6NA 5D9SA 3EO0B 1XGPA 2NY5L 1Q72H 1B88A 1LP9F 1EAPA 1HHIB 5DO2D 1ZSDB 5CZVL 2ITDA 5I1CL 1BFOB 3EYUH 3MV9A 3RY4A 3FB6A 1U3HC 4JFOB 4HCRL 3SHSA 4I4WA 2LAAA 2X41A 4HEPG 4JQVC 4P4RB 1F6AA 4KJPC 3SE3C 2NY3D 4LHUG 3RIAK 3SGDI 1KCRL 2ILLA 2AJUL 4HFWB 4XMLL 3MRRB 4IRJD 4CRPA 1WEJH 4DGIH 5FM8A 2YR3A 2Q86A 2YPKB 1IGIL 4DQOH 2EZ0C 3PGDA 2ORBH 5ALCH 4KGJA 5C7XL 3HNTL 2F5BH 4ZOAA 1NUGA 1VGKB 3ORJA 4KQ4L 5EU7E 4H1LA 1AD0A 1ZA6A 2OSLA 1JGLH 3NGBC 2ESVD 2ZCLH 1AXSB 4PJFE 3O11A 1L6XA 1Z9OA 4RZCB 1OLLA 5B3JF 5BMFL 3LQAH 2R2EB 3UZEA 5SX4I 2F5AH 3AB0B 3A67H 1IC1A 3ARXA 4JRXE 4G7VL 1DEEA 3VD5A 5DEFB 4JKPH 2J8UB 3DVNA 1A1OB 3RVTD 3U82B 1OT2A 4DVBA 4WY7L 1BOGB 3ROOB 1UKSA 3T0EE 1FL3A 2AABH 5DJ8B 5TE7L 1INDL 2CH8A 1HQRB 3H9YA 1D9KA 5GHWH 3T0VA 3F7YB 3PWJB 5D70H 1B4JH 1U0QA 3RI5F 3SGDH 4XRCB 4BK4A 4ZOEA 2VUOA 3BH9B 2H26A 3T3MF 2XPGB 1X5GA 4QRRD 5D1ZC 2X4UA 4UV4L 5D96B 3HFML 1MCHA 5B39B 2W0KA 3F5WA 1K8IB 4BYHA 4OUOA 1BF2A 1DR9A 5TH2B 2BNRB 1CG9A 2GJZB 5F89B 5E2WH 3O6MH 1NBVH 2D03H 1FG9C 1JIBA 4WWKA 5E4IA 4X6CB 5LKNA 2FCBA 4OIAA 4TSAL 4OZIA 4LSRL 2YK1L 1A7OH 1MLCB 3UDWC 5C0AA 3MCKA 4CUCA 2OZ4L 1A6VL 1JGVL 3AC0A 3VFGL 1DUZA 3AAZB 4Q7DA 5F97E 1Q9WA 3U9UB 1KN4L 4KFZC 3CH1B 3UPCA 5FHBL 2NY5H 4QRPE 5GRUL 5CZVH 1JF6A 5DI8B 5I1CH 1QO3A 4X4ME 4AIOA 5DDHB 4PY7A 4HCRH 2UZYB 3WHXB 4JPIA 1HOCA 1M7IA 2R2HA 3I85A 4H25B 3EYQC 3PXJA 4MDJB 1MCLA 3QFDA 3OF6D 4FQIL 5IW1B 5L2KD 3JV5A 5T33L 1KCRH 2AJUH 1MIEL 3IFPA 4XMLH 5FKPA 2L7JA 2C9AA 3QDJB 4DKEL 1D6EB 3QULB 3QO1A 3TA3B 1JGDB 1FCGA 2B5IB 3MNVB 4QTIH 1IGIH 2YPLA 4WIQA 3LKOA 2OR7A 1JE6A 5HHOA 4XPHH 5F70A 5DXWA 5C7XH 3HNTH 4CMMA 3Q2CA 2AW2A 1P7KA 3MV8D 4KQ4H 1NKOA 2E9BA 5BV7H 5TQ2L 4XBGB 3GSVA 5IEKB 5JQ6L 1BPVA 3QUXA 5IHZA 3MRDB 2VXUL 2JE8A 1S9YB 2WSKA 4PGDA 5BMFH 2F8XC 1U8IB 4U1JB 2X1QA 4S0TD 2EDHA 3S3SA 4PJBE 5SWZE 3CPLB 3RVWC 3T77A 1I8KA 3VD3A 5GGRY 3G5XB 4WY7H 3WSQL 3TNMB 1BZ7B 4X5LA 2GFBA 2NY4C 4PGZA 1HKLL 1D5XA 2EE3A 3FZUD 3QUKA 3U46A 2J5LC 3VWJB 5KSBB 1IL1B 3VXPA 1INDH 3LRHA 1B0GB 4ETQB 1YEIH 3CDYA 4GSDL 4R96A 1MJ7L 3VRIB 2GJJA 1FL6B 4TNVF 1CR9L 4QO1A 4Y16D 3HI5L 3UPRA 2D3VA 5JPNA 1P5VA 4P46B 1UZ6E 5MEND 1YYML 4UV4H 5CEYA 1BD2A 1OP5H 1SYSA 3HFMH 2PR4L 2YXFA 1KBGL 1UT9A 4IRZL 4DUWA 2BC4A 5TDNA 1QVOB 4HS8L 1QRKA 2D7QA 1R5VA 2J4WL 3NIDE 5DHYB 2P5WD 1K5NB 4ZO8A 1M7XA 1FJ1B 1G1CA 4HK0A 3CFKA 4K71B 4TSAH 4LSRH 2YK1H 5DFVC 4C59B 1BQHG 2GHWB 4X6CF 4LSTH 1QYGL 2H3NA 3OKMA 2VC2L 4LRNL 2OZ4H 1A6VH 1JGVH 3VFGH 3ECBA 3BP4A 1VFAA 4YHYC 5KVEL 4WTZA 1KN4H 1A4JA 1HXMB 2PXYC 5KBNC 5FHBH 2WQRA 3FTGA 1QFPA 3GEWB 4YHIB 5TDOB 4ZO6A 2AVGA 5GRUH 1BBDL 1CGSL 2I9TA 5AD0B 3L5XL 1B6DA 5J4MA 1IAOA 5CSZA 1CZ8L 4ZFZA 1A7RL 1KB9K 4TUJA 5SV4A 5D7JA 3HNVL 3CSPA 1I7ZA 4GAYB 4PD4J 4Y4FC 3X11A 3LD8B 3D3VA 5C2BL 4QRQB 5IB5B 4HUWA 4L8SC 4FQIH 5T33H 4YDJA 3FQTB 1BJ1J 1MIEH 3VA2C 4J23A 4DKEH 1S7XB 3QPXH 1W0YT 1JTTA 2XQBL 3W0WD 1KTDA 4CNIB 2HWZL 3OHXB 2YSSA 1UZ8A 2O61A 1T2JA 2XFXB 1XMWA 4Q74A 1S7UB 5HGBB 4J2XA 1LO3L 5HI3D 2Y5TA 5I73C 3OMZA 3DO7A 5TQ2H 3TBYB 1FFQA 4UUJB 5JQ6H 2DJUA 1U3HA 3L3JA 4Y4KD 2VXUH 4JQVA 4KV5E 2BMKB 5T1DH 1CFQB 3PE9A 3SE3A 4HMDA 1OB1A 1DBJL 5CMAB 2B39A 3PWUA 4WFGD 4AIZB 5GQBA 1OLZA 3W5MA 4PJCA 1JMXA 5DO2C 4M00A 3GSNA 1FRGH 4ZYKB 3WSQH 5E6IB 1MWAB 2NY2B 4AL8L 4O9HL 3PWNA 1AKJA 1T7XA 3C5JA 1CFSA 2EO1A 4GSDH 5KSBF 1MJ7H 4EUPB 3MBEB 4M5YL 4F7CA 4ENEC 3CU7A 3L95A 3MLZL 4BSWB 1CR9H 1FFNB 3LZFL 3HI5H 5D72L 2P44B 3P11L 1YYMH 2NZ9D 1J8HD 2PR4H 2V5RA 3FCTB 4D9RD 1JPST 1KBGH 1RZGB 5DWUL 4IRZH 1U95B 3ARFD 4HS8H 3G5ZB 2J4WH 4J3OC 3DHMA 4AENA 4PTUA 3IRZA 3AGVA 5F3BA 2Y5EA 1K85A 1CXKA 3DV4A 5JA9A 3MTRA 2VC2H 2W0FB 4LRNH 1DQQB 5EBGA 4YDVB 1X44A 4JREB 5KVEH 3O4LA 3BT2L 4WVRA 2FB4L 5BZWA 4OI9A 2P24B 1I7TA 5D1ZA 4L4VD 1BBDH 3ZDXE 2MWCA 4LCUA 1CGSH 3VXUB 3L5XH 3LKRA 4MA3B 1CZ8H 1A7RH 3D1MC 2X2YA 2VLJE 3HNVH 4IMKC 1FVEB 3SQOL 4IOIB 4LSUL 2A0LC 5EH1A 4JKKA 5F9WB 3VCLB 2W92A 4RX4A 5D9SB 5C2BH 1XGPB 4WFFD 4ETYA 1JGEA 3S34L 4PJIA 1EAPB 3MOBL 2BVUA 3UDWA 2ITDB 4NQCA 2P4AB 2XQBH 3MV9B 4H1LH 1JCKA 5E8DL 5I16A 3GJFA 4I4WB 1BFVL 5DK2A 3VFNA 3IXAA 1F6AB 1AXIB 2Z4QA 1TFHA 4WU5A 4B0MM 5DD1L 1PBYA 4HS6A 1LO3H 3T0XA 1YEDA 4LCWA 2BERA 2R9HD 4EQ2A 2FSEB 5TE4L 5IR1A 2Q86B 1U2CA 3K4ZA 3PGDB 3L3HB 4XC3L 1DBJH 3OXRA 1ZHKA 3THML 1MLBA 3V7AG 3EJZD 4PRPE 3T1WA 1I8IA 1E6OL 4H1LB 1PKQE 1AD0B 1ZA6B 3BD3A 2Y23A 3KLHD 3O11B 4KTEL 1UC6A 4AL8H 4MX7A 4O9HH 4DAGL 1EFXA 3REVA 1WZKA 1KPVA 3SDCD 4PRHE 4JGJA 4RAUB 2IMNA 4ZSOA 4M5YH 1DEEB 4KKCD 4MCZA 3VXME 2VNCA 4MMZC 3MLZH 3VA6A 3DVNB 3LZFH 4MNGE 3W5NA 3WFHA 4DVBB 5C0CD 4M7JL 4KK6C 4ODXA 4RGMC 4JO3L 5D72H 3MR9B 2Q20A 2J6EA 3P11H 1FL3B 1DFBL 5J1AB 2WIMA 1D9KB 4G42A 5DWUH 2R4RL 1FG2A 1NEZG 4QCIA 5F9JA 1TITA 4K3EL 3H9SE 1AO7D 2BSSA 5D7LA 4N8PA 5I74B 4HWUA 2AQ3A 5D2NE 4JCLA 1EZVY 5D7IA 2X4UB 1CBVL 1IM9A 4UQ2A 1F3DJ 3VXNA 4AQ1B 1R5WB 1Z0MA 3F5WB 2Z9TA 4HH9A 1CG9B 5J3HD 3BT2H 2FB4H 2CRIA 3SKMA 3CCHA 4J1UA 5J89A 4G6FB 3ILQC 5ICYA 4OZIB 3FZUC 3HS0A 3O3BA 3B9EA 2CGRL 5C0AB 3MCKB 3WXWL 3HC4L 4F57L 4S1DD 5KSAB 1DUZB 3B2UD 4P3WA 3SQOH 4LSUH 4HKJA 4WFHD 5C08E 2HG5A 2QSVA 1OSPH 2EEBA 1ZS8A 4FP8L 1N5AA 5LGKA 4HK3J 4GG6E 3TVMD 1FV1A 5CJBA 1QO3B 4XVUD 1NGPH 4PY7B 1OQXA 5E8DH 4YJZL 1CDCA 1BFVH 4WGVB 3Q5OA 2DMBA 1HOCB 2R2HB 5DHXB 2PXYA 3CZFA 1RPQA 5DD1H 1J05B 4ZO7A 4CU8A 4NRYA 1GGUA 3BPOB 4YWGL 3OKOA 5BO1L 5FKPB 4LGRB 4YBQD 3QO1B 5TE4H 4U3CA 1OTSD 1G7IB 3GSNL 3AMLA 4Y4FA 3LKOB 2NXZD 5HHOB 4XC3H 4L8SA 3THMH 1D6VL 4U31A 5C07A 1P7KB 3L3OB 5C1MB 5AUMB 3B6SA 3GSVB 4AT6A 1EX0A 3QUXB 5IHZB 5C0GA 1KELL 3VE0A 1XF5A 4KTEH 4DAGH 4PGDB 2EDNA 2ZKHL 4MA8L 3QCTH 4WHCA 3T2PA 1WK0A 4YK4C 2IFFL 4UU9A 3T77B 2V7NA 1MFEL 4X6DE 1ACYL 2V5SA 1WGOA 4HIXH 5IOPA 4LVOC 2XG4A 4M7JH 4LFHG 4JO3H 2GFBB 5KZCD 4QGYA 1D5XB 3BFOA 3F6IA 4OLXL 3SO3B 15C8L 3QUKB 3U46B 2I5YL 1DFBH 4TULL 3JXAA 3VXPB 4Y2OA 1GC1L 5I15L 2R56H 4R96B 4JANA 3KNBB 2NY7L 2R4RH 1FL5B 3BPNC 5HI3C 4EIGB 2B1HL 2KL6A 4K3EH 2FR4A 3UPRB 5JPNB 2RIKA 3BQUC 1ZLUH 3DGCR 3OWEA 4IHOA 4QOKE 2B2XL 2FD6L 4HLZG 3VH8A 1CBVH 5CEYB 1BD2B 1EXUA 1SYSB 3DSNA 3OPZL 3QWOA 4LNRA 3U4EA 4C56E 1N8ZA 1GAFL 2BC4B 2VZOA 1MAML 1N4XL 5GS1C 4JFHD 5J0BA 1K3ZA 5DJDA 1OP3K 4HK0B 3CFKB 1J11A 4MXVE 3FQWA 5CFHA 2CGRH 3WXWH 4UBDD 3V7MA 2H3NB 3HC4H 3KPMA 3OKMB 4F57H 4OZIF 3HZKA 1X5KA 1GOHA 3ECBB 3ULVC 1P53A 4X7FC 1VFAB 5FOJA 3TZVC 1T5WA 2JJVA 1A4JB 4JFEE 4HUUA 5EU3A 3SJVA 4FP8H 4X4ZA 3NA9L 1YMMD 2I9TB 3HAEA 1IAOB 5CSZB 4ZFZB 3GKWL 4TUJB 3AMKA 4Q97A 4OLWL 5D7JB 5DT1L 4YGAB 3QPQC 4XMKH 3GZKA 3X11B 3D3VB 3TEUA 1HSBA 4XNMA 4D0DA 5LXGL 2D7MA 2W9LA 2Y25A 3LMJL 4YDJB 4YWGH 3RWCA 5BO1H 3MLSL 1JNNL 3P9MA 5T1LB 5LJYH 1KTDB 1TMCB 5DMKB 3LOWA 4IMKA 2YSSB 5F1IA 1UZ8B 3GSNH 2O61B 1AP2A 4DTGL 2VL5A 2FHBA 12E8L 1UM6L 3S8WA 2XNAA 4ZFOL 3D39B 2XOTA 5DD6A 1BGXL 1D6VH 3UEZA 3MNZB 1R3JA 1T83C 4QRRA 1S3KL 3DO7B 4PJHF 1HHHA 2R29L 3O2VL 3UTQA 1VADA 5DJYA 1INQA 3BN3B 3L3JB 1KELH 1G1YA 2YC1A 1EBAA 4PS4L 1KSRA 2BY3A 5A2FA 1P6FA 4PRIE 4KKLD 2ZKHH 4MA8H 4WI8A 1IT9L 5D7KD 2HFFA 4FTVE 3EGSA 2IFFH 3PWUB 3LVEA 4KROD 1MFEH 1ACYH 4PJCB 4Z7WA 4UI2A 4GT7A 3GSNB 4PJ5A 4JEGB 1DQDL 4OLXH 15C8H 3PWNB 2I5YH 1AKJB 3C5JB 2KKQA 1CFSB 4YHLL 1GC1H 5I15H 3HA0A 3BJ91 2R8SL 2BVOA 4BELD 1T22A 2NY7H 3L9RA 3QEQE 3MGOA 1MVUA 5E24E 5JIHA 2B1HH 1S5HA 3NGBB 1J0YA 5DA4A 4R6UA 5EPMA 2R9HC 2YOCA 1MJ8L 1I1RA 4P2RE 2B2XH 2FD6H 1X5LA 3OPZH 2H45A 3EOYG 1KCVL 2EDYA 3IT8D 1GAFH 3EJZC 3X12A 1CICB 1MAMH 1N4XH 2HH0L 2IH3A 5E4EB 3MLTB 4JHAL 3KJ4C 4AENB 4PTUB 5MP6L 3KLHC 5CD5C 2HMID 4E41A 2VISA 1DANU 4QTHB 4JRYA 3IDJA 3DV4B 5T3ZD 5I6XB 4W4OC 1H9VA 1YEGL 3MV8A 4KJWD 4CKVX 3O4LB 3GJFH 1Z9LA 1N6UA 5BZWB 4OZHF 1JYVA 3NA9H 1I7TB 4Z76A 5D1ZB 2X1OA 4LCUB 4JO2L 1WICA 3N1FC 3LKRB 3B9DA 2X4RB 3GKWH 3GBNL 3KPQA 4OLWH 5DT1H 4X7DC 3ROLA 4HG4K 1IGCL 3WIFA 3FQNA 3I6GA 2YD4A 3LEVL 1OP9A 5LXGH 4PJIB 1J8KA 2XZAL 1JJUA 2JELL 3L5JA 3LMJH 5EBMA 1IEAA 1QLRB 1JNNH 1RVFL 2DWEA 4JFPA 4YFLI 1CFBA 1CFTA 5I16B 4YXKL 3LH2L 5KOVC 2Q87A 5DK2B 3X14A 4DTGH 3VFNB 5IB2A 4E42A 3IXAB 1NCAL 1UM6H 2HTLD 2Z4QB 1T7VA 4M43L 4WU5B 1BGXH 2QV2A 5D2LA 2WWKT 4BQ6A 1YEDB 5IIEB 4LCWB 1S3KH 3FFDA 5TFSL 3W82A 2CQVA 2R29H 3O2VH 3LCYA 4PS4H 5IR1B 4QRSA 4ZXBB 3HE6D 1IT9H 4KKNA 1H3GA 3MRJA 1ZHKB 5E95B 1ZE3C 1MLBB 2ZWLT 1AD9A 1BAFL 1I8IB 1SMOA 3U2SA 4JAMA 3G6JE 4U1IA 5DJ0A 1JBJA 4PJCF 1DQDH 3GMLA 1EFXB 1J1PL 1KPVB 4OAWA 5EU7C 1UH4A 4PJ9D 5M95B 1PQZA 3LRSA 5BRZE 4ZSOB 2R8SH 4AEFA 1U8JA 1NGYA 4MCZB 2YD7A 4N0CC 4Z95L 4O2CA 2LU3A 3WFHB 1ZVSA 2GI7A 2DYPB 1MJ8H 1CLYL 1VFUA 3OKLA 4LSDA 2W65A 2NXZC 5GS0D 1JWSA 1EHLL 1KCVH 4G42B 2HJFA 3UZVB 4P4KC 2DMKA 2OI9C 2HH0H 3GMOA 3P0YL 4QCIB 4JHAH 1U8PA 2G2RA 2NY4B 2EDQA 5D7LB 5MP6H 1I1YB 2KDGA 3QEUA 4GRLD 4HUMB 1WUNT 2WBJC 5D7IB 4RMTA 1PJ9A 1IM9B 5E0QA 3SE8L 5EDXA 1BM3L 4ACPA 3O41A 2CJUL 3NA4A 3VDCA 1U93A 3LB6C 3ZHDA 1YEGH 4HH9B 1MCPL 2PUQT 2GT9B 3BQUA 3Q3GA 2VQ1A 3SKMB 3CCHB 5ICYB 1N6VA 3HS0B 3O3BB 3R0NA 4JO2H 5LWYL 3GSOB 5E8PB 5C6PB 3GBNH 4P59H 3VW3L 3DRQA 1OGTA 1IGCH 1G9MH 1C08A 3QHZL 3OR6A 5GS1A 2HG5B 1ZLVK 2VDOL 3BW9B 4WWID 3LEVH 1AC6A 5CGTA 3U36B 5LVEA 1ZS8B 2WV3A 1LEGA 2Z93B 2XZAH 2JELH 1N5AB 1MEXL 1L7IL 4OKVA 1RVFH 3K81A 1J10A 3OL2A 2BSTA 3CDCA 1NCWL 4YHYB 5E94B 3TZVA 5FYKD 3CZFB 5F71A 3U6RA 4M43H 1MAJA 2E27H 1NCTA 4NRYB 5HXMA 3OKOB 1G7PB 2MHAA 1B2WL 4F8TA 4B53A 3ZMRA 1DE4A 4RDQF 4PJGE 3DURA 4ZQKB 3KPLA 4Y4FB 4WDIB 2JIXD 1AQKL 1QSFE 1MFCL 1UCTA 2VR4A 4I0PC 3W81A 5C07B 1BAFH 2VLMD 4OCLC 4AT6B 3TIEA 3RJQB 4YC2C 3VE0B 5BJTA 1XF5B 2QEJA 1MHHA 1J1PH 5HYSA 1F2XK 4AEHL 3I6KA 2V7NB 1T83A 4Z95H 5I73B 1LK2B 5IOPB 2GQHA 3U1SL 1B0WA 1CLYH 1I85C 1S7SB 4CJ1A 3OB8A 2BNQA 5BXFA 1HK6A 1I75A 1M7DA 3EFFA 3C87A 1EHLH 4XBEL 4JANB 2R4SL 5DZOA 4FQLH 2H32A 2FR4B 2EDOA 4XB8A 4IHOB 4KH2A 4PRDB 1A6ZA 3NBNA 3FAWA 2EDFA 3VH8B 4KKLC 1EXUB 5IVXA 5ISZE 3SE8H 3QWOB 4ZUVA 3TP4A 1BM3H 2CJUH 3WS3A 5D7IF 1GJIA 3HAEH 1C8PA 1MCPH 1T0MA 4KROC 4RA0C 3BKYH 4NKOA 3VI3F 1N59A 3N0PB 1B4RA 5DJDB 1Z3GL 1BWMA 2A6IA 1AI1L 1MCQA 3FQWB 1L0XA 3BP7A 2RHEA 2FEEI 3MJGX 4OLEA 5KVGL 3KPMB 3SDAC 4W6YB 2W59A 5LWYH 1LP9E 4YDIL 3VW3H 3K80A 3ARVA 2VAAA 4MQSB 3QIBD 4X4YA 1EO5A 4DUVA 3QHZH 3JVGC 1EEUA 2VDOH 2VAJA 5CEZL 3H2WA 1JK8B 1T0NA 3RWEA 1HKFA 4G8GA 4HUUB 2ESVB 5EU3B 1RSFA 2NMSA 5FGCE 1MEXH 1L7IH 3KVQA 1S7WB 3BZFB 3RIFF 3HAEB 3WE6A 4W4OA 1WITA 1NCWH 3GMNA 4BZ1L 1OSZA 4P57A 2VDQL 3EIFA 1QBAA 1HSBB 32C2A 2I27N 5IBTH 4OZFG 4XNMB 6CGTA 1T7ZA 4PGBA 5K9OA 2BX5A 2HMIC 3VU2A 2XYCA 3RWCB 2EO9A 1LWRA 3JZ7A 2JJUA 4BQCA 3P9MB 2HT2D 1B2WH 5HD8D 1G0XA 3E6FA 5CGYD 3TNNB 3U0WL 1XF1A 5F1IB 2UUDK 1T89C 2VL5B 4UILL 4PG2C 2LU7A 4CMHC 2DLGA 1W72L 4I5BA 5I30L 4XCFL 5DURB 3CSGA 4Z9KB 5LGHL 4QRRB 4HZAA 1HHHB 1WLHA 1PKOA 3UTQB 4GLRI 1INQB 1QFUL 1IAMA 2YC1B 4KY1L 1W8OA 2X1XR 5D6DC 2NNAA 3TF7C 5BQ7A 4YHKL 2HFFB 4QLRA 4G6ML 4NIKB 4AEHH 1FYHB 3HHRB 2ZOLA 1I7RA 2Y6SC 4ALAL 1PG7X 4I2XB 4MDIA 4OF7A 1RK0A 4XI5C 3TPUA 4Z7WB 3V9FA 1J18A 3BN9D 3BPCA 4PJ5B 3U1SH 4ZUWA 1TQCC 2AV7A 5C09D 4MNQD 5F9OL 1KF9B 1XGYL 4OZGF 2UZXB 1MCKA 1J0HA 4XBEH 1T22B 3K74B 3CFDA 3L9RB 4K7PX 1P5UA 1MVUB 2OMBA 3PV7A 3ME0A 3RIAF 3S4SG 2FLBT 4WEBH 5EPMB 1VEMA 1KFAH 1YYLL 5J6HA 1LVEA 4LPXA 4PJFA 1CK0L 2IH3B 1EO8L 1RUKL 5EULV 1TXKA 3DX8A 4RGMB 4GLRH 1Z3GH 4JRXA 1AI1H 2KQNA 4FFVD 1KTRL 4E41B 1AR1C 2VISB 3O9WC 4BK5A 1S7RA 1FO0L 3IDJB 4JRYB 4WU7A 4YDIH 5IEHB 1CN4A 4P4KA 3MV8B 1NUFA 5CEZH 2W0PA 3HMXA 4Z76B 1B90A 1P84J 3PQYA 5F7DA 2WBJA 5C3LD 3D48R 3HZYA 3BZ4A 4X7TA 3RVUD 3ZKXC 4BZ1H 3FQNB 2EDBA 2VDQH 3I6GB 2Q8AL 1VEPA 3WUWA 4P2QD 4WTWA 4QHLA 5EBMB 1IEAB 3MO1A 4KK9D 2DWEB 4JFPB 5FYLD 1G9NC 1CFTB 3GO1L 4XPAL 4HAGA 3U0WH 4IOFD 3X14B 5IB2B 4E42B 5DF0A 4UILH 1X3DA 5DK0A 5GRVK 4Y16B 3PDDA 2NTFA 1W72H 5D2LB 2GEEA 5I30H 4XCFH 5LGHH 1CE6A 3FFDB 4JDZA 4MJID 5HGDB 5SX5K 1KULA 1T20A 3BEVA 3IFOA 5A40E 2CUHA 1QFUH 1CD0A 2QADD 3IKCB 2ZCKL 5JXED 3W11C 5IKCB 4YHKH 5JMOC 5KVFL 4G6MH 2J8UE 3M17A 3OTTA 2GUOA 4ALAH 1AD9B 2UYLA 4HWZA 2F9BT 4I3RL 3CFEA 3U2SB 2F54A 4JAMB 1FVCA 2AXFA 2XWBA 3WBDA 4U1IB 5DJ0B 5I71C 1R3HA 3KHOA 1AE6L 3BGFB 1X5JA 4LHUA 1X5IA 4Z7WF 1P7HL 5F9OH 4OAWB 5DC9B 1XGYH 2BVPA 5CWSA 4FFZL 3LRSB 4DKAA 5GGQL 2B8OT 1DSFL 1LD9A 5EZOL 5LAXA 1U8JB 4I0PA 3NZHH 1GSMA 4O2CB 3QQ9D 2XN9D 4JFDD 1ZVSB 4QXWA 3G6AA 3RNKA 2X42A 2OK0H 4Y1AD 1U41A 2IAND 2W65B 2BNRE 4Z77B 4X8JA 1YYLH 1SJVA 1JWSB 4YK4B 5IB1A 4HXAL 2HJFB 1CK0H 5E99L 4X6CE 4FRWA 4JN1L 1A1NA 3T4AA 1EO8H 3M45A 1RUKH 3GMOB 3ZL4L 1X6LA 1U8PB 2G2RB 5K59F 1I85A 1G0DA 2GJ6A 3QEUB 3KPSD 4M93C 1FO0H 4LLWA 1DQLL 2VKWA 5B4MD 3QXVA 4ZUTA 3MUGA 1U93B 3BPNB 4LLYA 4YZFF 5D2NC 4OIIL 1IGJB 4JZOA 2CXKA 3UP1A 3BQUB 3Q3GB 2VQ1B 4Y4KB 1A3RL 1Q9LA 2P8MA 1UCBL 4LKXA 2EXYD 4JM2C 3NPZB 5IW3A 1GZPA 1HHJA 4HKZA 4R97C 1QFWL 3CLFL 1TDQA 1T80A 4YNYA 1C08B 3OR6B 5CZXD 3FT3B 2Q8AH 4ZMAT 1MCCA 3QDJE 5DZNA 1LEGB 2B0SL 2DQUL 3HE7D 3LS4L 4OKVB 3SDAA 3HKFA 1YY9C 4JFFD 2O26U 2FZ3A 3GO1H 2BSTB 4NO3A 4XPAH 8FABA 1JTPA 2D7OA 3RZCC 1MCSA 3KPRD 3JVGA 5K9KB 3TZVB 4M7LT 5IMOA 4QWWD 1RAMA 5ILTH 1UH2A 1M71B 3U6RB 3O6KL 1U92B 1A6UL 2Y1VA 3L7FA 2JF1A 4OKDA 3GB7A 3FB7B 2MHAB 5D2LF 1CD9B 4ONFL 3NCJL 5D5MF 3FHAA 2JK5A 1VFBA 1XFPA 2P5ED 3DURB 3ARFB 3QIBC 1N7MH 4X99A 2EIZA 4RBPK 2GK0A 3X13A 1RJZA 1RK1A 3EYFA 3GM0A 4I3RH 3FHQA 5KSBE 4NBXB 1AE6H 3TIEB 4UT7H 2ADGA 5BJTB 3NN8A 3UTSD 2H32H 4ZFGL 4O2EA 3FO0L 1MHHB 1T89A 1GPOL 4TSCL 2ERJC 4PG2A 4FFZH 2FX8L 5GGQH 1QFWI 3I6KB 4S0SD 1DSFH 5EZOH 5HHVL 2WINA 3PV6B 1MCDA 4PV8A 3MOQA 3RU8L 4ZUUB 2FIKB 4OLUL 5D6DA 4U6HA 1YEJL 1AIFA 3ARDD 5L7XL 5BXFB 1M7DB 3EFFB 2DQFB 4HXAH 1C5BL 5E99H 4JN1H 2JCCA 3ZL4H 2H32B 3RDTD 4NSKB 4XP1L 4LLDB 3HMXL 4I8DA 1BIHA 1DQLH 5IVXB 4ZUVB 1F45A 2FIRT 4F15C 3WS3B 1YEFL 2KH2B 2W60A 3QUZD 1T0MB 2EECA 4HMCA 4JFYB 4L3ED 3FJTA 4NKOB 1KLFA 5FYJU 2IPTL 2MNUA 3GHEL 3DXAA 3JTTA 1A3RH 1T5XA 1JRHL 1UCBH 3BP7B 4AH2A 3WKML 3BGMA 2ID5A 4KRMB 5CD3A 1QFWH 5ACMA 2VAAB 4OF8A 3FMGL 4X4YB 4RNRB 5J8OA 3KJ4B 4Z0BL 1A1MA 2N56A 1OL0A 4JPKL 3RWEB 1LO4L 4NQDD 2B0SH 2DQUH 4I9WE 2BZDA 3L3DB 3O9WA 5EUOF 4F7EA 3LS4H 1WISA 3WNPA 2X4NA 2OMNA 5DMGD 1FNHA 2WBKA 3MCLL 3WE6B 5F7UA 4HC1A 3UAJC 3ARGC 4RMVA 3WLWD 1FZKA 3I84A 1BQHA 1OSZB 4P57B 3ULVF 32C2B 2X1WL 4YIQA 1YECL 3WIIL 5L8KB 5DC0A 1A6UH 4PGBB 3OB0K 4PBWD 5GS2D 3WNKA 1KIUA 4FFVC 5K9OB 3TV3L 4ONFH 3NCJH 1JHLL 4YLQT 5HDOA 3TBVA 4XNUL 4TN9A 4AG4L 1KJMA 4LLQA 3IDYB 3PUCA 2IQ9L 5GRWA 3GDBA 3W39A 4W81A 4YXLH 3QIUD 5C0BD 4ZODA 3OBAA 1AO7B 2R1WA 4G80A 4JHZA 3FRPA 4OGZA 3RWHA 3LSOB 2OYPA 1I1CA 1R3LA 4N90E 3W9DB 4AZ8A 1JRHI 4MHHI 4ZFGH 2NNAB 3FO0H 1IGTA 1GPOH 3IDNA 3PHQA 4TSCH 3RTQC 4R3SB 1AC0A 1EO7A 3OX8A 2FECL 2FX8H 3BHBA 2ZOLB 1I7RB 5HHVH 5KSUA 5F8QC 2DLFL 3RU8H 4MDIB 1RK0B 5FB8B 3BPCB 4NQVB 4OLUH 3Q6GL 2XWTA 3MRLA 1YEJH 5L7XH 1X5AA 5KS9F 3ESUF 2XXCB 4GUPA 4N0UA 1C5CL 1C5BH 3CFDB 3D2UD 4QHKI 5DUPL 3TVMB 5MERA 2DICA 3GHBL 3QT2A 3MLUL 2P46B 4D0CA 1II4E 4UINL 4XP1H 2XTJC 2YZ8A 4PRPA 4TOYH 4I3SL 3HMXH 5IB4A 4G3YL 3V4UH 3KYNB 4AY0A 1Z6JT 5J6HB 4GKNA 1YEFH 2QR0A 3MV7A 3AU1A 2YA0A 3HNSL 4K8RC 2E7LC 2IPTH 3GHEH 3I9GL 4PRHA 3DX8B 3VWKD 3VXUE 5TGBB 1P4BL 1JRHH 3VXMA 1S7RB 3WKMH 1K9TA 2NXZB 4WU7B 1HCFX 4Z5RB 2DQCL 3GSRA 5A3IC 4P4KB 2OI9B 2NY1C 2W07A 3FMGH 3A6OA 4C83A 2FECI 4Z0BH 3UTZB 2NTSP 4CN6A 4EOWL 4JPKH 5CSBA 1LO4H 1OAYL 4ZNCD 4XCNA 3MV9E 3VXSD 3PQYB 5F7DB 2WBJB 2ZSWA 3PDOA 3RWDA 3MCLH 2XI9A 5B21A 3HZYB 3BZ4B 3ARPA 3K8LA 5I9QC 1SEBA 1NJ9A 1TPXC 4IMLA 3BE1L 5D2NA 1X5ZA 2VE6A 4GAFB 4NRXA 1Z0NA 3WUWB 1YECH 1T4KA 3O3EA 5D1QC 5KZCB 4F3FB 4DZ8A 2ED9A 4QHLB 2OTPA 3MO1B 3TV3H 4JM2A 2QQNL 1JHLH 4XNUH 2X70A 4AG4H 2MTPA 3AS1A 2XRAL 2IQ9H 1UYWL 5DK0B 5D1XD 2YD1A 3ISWA 4PGEA 2NTFB 5FIEA 4NT6A 3T0ED 1CE6B 2N7BA 2IFGA 1T20B 3BEVB 4OV5A 5EO0A 4OCNC 3RZCA 4GG6A 2Y06L 5FYJE 5DUBA 3M17B 4R2GD 2GUOB 3T0DA 4TQEL 3DYPA 4LHQB 2UYLB 4HWZB 5DSCA 3QI9C 1XR8B 3CFEB 3TFKD 2F54B 1FVCB 2AXFB 2XWBB 3N06B 4R26L 1R3HB 1A21A 1M1SA 2R1XA 4WHYH 1FLTX 5HJ3B 1IZKA 4AK1A 3NOIA 2VDNL 3N85H 3QIBA 1J0KA 2BVPB 4M1CC 1HQ4A 5CWSB 3QNXA 1TTFA 3BD4A 1C5CH 1G7JA 1LD9B 1OAQL 5LAXB 3P2TA 4R9HA 2HN7A 1NMAL 2IMMA 1SJHA 2GTZA 1MCWM 5TF1L 2I07A 3GHBH 5F7FA 4YC2B 3MLUH 3M07A 4JR9L 4CN1A 3G6AB 4UINH 3RNKB 3MA9L 5B3NA 1FCCA 2G5RA 4I3SH 4IM8A 4UB0L 4OCSL 4QHUB 4G3YH 3C2AL 3VXQB 5J1SC 1SYVA 1PEWA 4LK4A 3PXHA 4BFGA 4XPGH 1A1NB 3T4AB 3HNSH 4OZIE 2E7CA 3I9GH 4N8CL 5C0AE 1C7SA 4WHTB 1P4BH 5E5UB 2GJ6B 2P43B 4QNPF 4LLWB 4RGOL 1KCKA 2DQCH 4ZUTB 1JZ5A 3MUGB 4NWUL 1ONQA 4HZLA 1F3RB 4HC1L 1NCNA 4EOWH 4JZOB 4Y7MA 4JGUA 1OAYH 1Q9LB 4LKXB 3NTCL 3TGXA 1A7PH 1NEZA 3MJ7A 2VZVA 4D3CH 1GZPB 1WSST 4HKZB 5IB3A 2NW2B 4QOKA 4BQ8A 4KROB 4YNYB 1OAXH 3BE1H 3OJDA 4Y88A 5EO1B 4OFYD 3O8XD 3ARWA 2E9IA 5GIRA 4LRIC 2G5BB 2QQNH 3SDAB 5SWZD 5HHOE 2FZ3B 1L6ZA 1F00I 2XRAH 3QUZC 5EU4A 5IMOB 4F58H 1UYWH 2W1NA 2ADIA 3L7FB 3CVHL 1WAAF 3CFBA 3GB7B 5JO5A 1U3ZA 3ZKND 2QTEA 4BFBD 4DWHA 2JK5B 1VFBB 3MRNB 3ARGA 3SPVA 4HIIA 1JN6A 2FEDC 2Y06H 5I1GL 1DEDA 1CGVA 4X99B 4FG6D 4Q9CA 2GK0B 3PJSA 3X13B 2OCFD 1RK1B 3EYFB 4TNVK 1NDGA 4Z7QE 1LE5A 4TQEH 2P48B 4F33A 1KCSL 1RIVL 2FBJL 5IG7A 5F6IC 4TUOA 4R26H 2PO6D 4HJJL 5DMGC 4MB3A 4JJ5A 1NFKA 4U4BA 2ADGB 1B6UA 3IU4L 3NN8B 1XH3A 2VDNH 1CGTA 4N1EA 4O2EB 3SCMC 2FRGP 1MY7A 2DI9A 3HG1A 1GXEA 1ORSA 4CMHB 4L3AA 4AYFA 1OAQH 2SEBA 5HHNB 1NMAH 1FFOB 2WINB 1BQLL 2ZUQC 2X89D 4PV8B 1I1AC 5TF1H 4HBQA 4LSPL 1BD2E 4ZUSB 1VDGA 4POYA 5ENWA 4JR9H 4OFIA 5AWNL 3MRIA 4U6HB 1P4IL 1AIFB 3MA9H 3RTQA 1KIQA 4UB0H 1G7HA 4OCSH 3P3YA 2RAMA 3C2AH 1B3JA 1WWAX 3QIUC 4X9HA 4KWUA 1VPOL 2I9LA 1KB5A 2Z91B 1ZTXL 2EH8L 2JCCB 1SBBA 4PRIA 5EA0L 3NH7L 2I26N 3HC0A 4FTVA 1EBPA 4N8CH 2X09A 4GMTL 1TQCB 5E2UL 3ARSA 1IGYA 3MPCA 2MQ3A 4M3KB 4OZHE 3RWGB 1CXHA 4YHOL 4NWUH 2W60B 4BQBA 3BIKA 1LDPL 4HC1H 3ULSB 1P9MC 1OW0C 3DXAB 3JTTB 4M1DL 3HZVA 5I1JL 1T5XB 5EU6A 4NQEA 4X6FA 2DLIA 2YWYA 2JJWA 3NTCH 4PJEF 3D3VE 4TUKL 4WUUD 1T7YA 4WNQA 5CD3B 4RQQA 3LHPL 4GKSA 2PCPA 4MJ2A 3KXFE 4WI3A 2P8PA 3AROA 2E7LA 2R1YA 2DM4A 4NHUA 1A1MB 4MVBD 3HUJF 3O9WB 4F7EB 2PW2A 2X4NB 1UXWA 1YC7A 3D39E 3QXAA 1FZKB 2DKUA 5B8CC 1BQHB 5C0RL 3EOAA 3CSBA 4C58B 4YIQB 2C1OA 1F11A 3C60D 4PLJD 1ZLVH 2K3TA 3CVHH 4KUZL 1RQ5A 4Y1AA 1MI5A 3O6FC 3TBVB 4X98B 1KJMB 1LO2L 3PWPA 4ODWA 4LLQB 3ZKXB 1TVBA 5I1GH 1WFOA 2A38A 2BK8A 2UWEA 4PJCE 2IALA 3K7UA 3WCYA 5D1QA 2R1WB 5AAMA 2DQJH 4TVPD 3VRJB 1KCSH 1RIVH 2FBJH 4GRLB 1NC2D 3RWHB 4HJJH 3B9VA 3I6LD 5JNYA 1R3LB 3WFBH 3IU4H 4ERSL 1RULL 5ESQA 4L9DA 4ZAKC 1IGTB 3IDNB 3PHQB 1BIIA 4RWYL 3OX8B 2P8LA 3BHBB 1NFDA 4DKDC 5KSUB 3OXSA 4KPHL 1AGCA 3LKQA 1BQLH 1YN7A 3RPKA 4U1SA 5EN2A 2I60L 4LSPH 5DQ9A 1DDHA 5AWNH 3GMRA 3MRLB 1P4IH 1KPRA 3V5DA 1FDLH 4GUPB 4N0UB 5D4QA 1J9CT 1VPOH 4JVPA 1ZTXH 1IKFL 3JWOL 1NAMA 3QI9A 5BW7C 3NH7H 1KXQE 3IFNL 5MERB 2B4CH 2BXZA 2XG5A 4GMTH 4IS6B 2VLJD 4D0CB 3G9AB 3GSQA 5E2UH 3CNKA 3KPRA 3H0TA 5IB4B 4KKBD 1VB9A 3O4LE 5DJCA 4YHOH 5C2UB 2QR0B 3MV7B 4XXCC 4CADA 2CDFA 3AU1B 3I50H 1LDPH 3BWAA 4LDEB 4M1DH 5BRZA 2D9CA 3VFWA 5GGSY 5I1JH 2VLKE 3SKNA 1I3RA 3FAXA 3EYOA 2P5EA 4NUGL 1NCCL 1E28A 4H26B 1F4AA 4TUKH 3S37L 4XCYA 2UY6A 5C92A 3LHPH 1CGYA 5CIPA 1LMKA 3GSRB 3RUGF 1VGEL 3N9GL 3QHTC 4PJIE 5M7QA 1IJ9A 2MQ0A 5GRXG 4XCNB 4U1HA 4DGVL 3QWRD 1SEQL 4CDHA 2VZTA 5AZEL 4M93B 3RWDB 2G75A 4DN4H 2MPAL 4GBXD 3GFUA 4UDUA 4NJ9L 5KVDH 1JPTH 1SEBB 1QACA 1NJ9B 4IMLB 2D0HA 5C0RH 1S7QA 2VE6B 4MD4A 2VSCA 1Y18A 4LCWE 4NRXB 1T4KB 3P4MA 2QBWA 5DHVH 3SGEH 5IMMA 4HKBA 4DZ8B 4KUZH 2AV1A 4LOUD 4HWNA 1UKQA 4LL9A 2X70B 1IAIM 1LO2H 2VLRE 5FO8A 3BJLA 3AS3A 3PF2A 3UYRL 3V95A 1HI6A 3B4NA 4PGEB 3T04D 1A8JH 2F15A 4NT6B 3TM6A 4J3WA 1K2DA 5FUCE 3CFCL 4V1DD 35C8L 1A02N 4AMKL 4LRIA 2R0ZL 1W0WA 4KGLA 4G8IA 5EO0B 2VERN 1WFTA 4PRNA 4Y5YC 1A6AB 4ERSH 1RULH 4ZSOE 3QUZA 3RZCB 4L4TD 1DQJA 3MJ6A 4RWYH 4LVEA 3ZSTA 3H9SD 2GAZA 3VFSA 2RQ8A 5HHQA 4KPHH 3VMPA 5E9DE 5GRVL 3EO1A 5DSCB 4Y8AA 2FJFB 1KB5L 2K7PA 4FMKA 2I60H 3NCBB 1KT2A 2DMCA 2R1XB 3RVXD 4GG8A 2IF7A 2DM2A 4C57C 3QIBB 2CUIA 4U6TA 1BFSA 1OD9A 3ZT5A 1VKXB 1VFMA 1HQ4B 4C4KO 4K2UH 3QNXB 1G7JB 3O2WL 2HN7B 1IKFH 1UEMA 3JWOH 5CUSL 4OGAD 2GTZB 5D7LE 1WIUA 3IFNH 1VEOA 1QSFA 3BUYA 2I07B 5D7IE 1CQKA 5J11B 3VI3E 3BAEL 3SCMA 2BVYA 5C08D 5IVZA 2ERJB 4FG6C 4ZDHA 5C3TA 4FFYH 5F21B 1SYVB 5L0QC 3P4LA 1I1AA 4Q9QL 3U0PA 1MRCL 4BSJA 1LNUA 4K8RL 43CAA 5EG6C 4ODUA 4NUGH 1NCCH 1LDSA 3B2VL 1CWVA 3U83A 5BS0A 3S37H 3QIUA 1MFAL 2VOTA 1U58A 1ONQB 1VGEH 4HZLB 3N9GH 4XCCL 3ULUD 1D3CA 5DK3A 4DGVH 1U36A 1SEQH 4WCYL 5AZEH 3DECA 1ADQA 2WP3T 1A14L 3N1GC 4WV1C 2MPAH 3Q48A 5IB3B 4F15B 5ADPL 2HJLB 4NJ9H 2OTUB 4I0KA 3OJDB 1P9MA 4U7SA 1OW0A 4WO4D 1VACA 4A2MA 5ISZA 2BCKA 1ED3A 4ONHA 1A6TA 3DX7A 1HSAB 5C09B 3NFPA 3TJEL 4MQTB 3VG9C 1QPPA 5GIRB 3TO4D 5E03A 3KPNB 1BEYL 1PFCA 3U9PL 5EU4B 5C07E 3WNOA 5H94A 4JG1L 3VXRA 1FAKT 4LIQE 2ADIB 3CFCH 3MLWL 35C8H 4FQCL 3LV3A 4LEXL 3SY0B 2M1KA 4AMKH 3CFBB 5DD3H 2R0ZH 5L88L 5DYOA 3UZQA 5JO5B 3RZWA 2ZNXA 5IBUG 4CW1B 5DA0B 1JN6B 5B8CA 3UPAA 4YEFA 3IAGC 3PJSB 3TT1L 1JGUL 4QHMB 1NDGB 2VXQL 1LE5B 2PTUA 1N3NA 4EN3C 4F33B 4LVHB 4P2OD 5IG7B 1KB5H 4TUOB 2WQ8A 4RFEB 3O6FA 4P2CG 1NAML 2VH5L 3AXLB 4JJ5B 4NC1C 1IC4L 5SX5H 3ESVF 5FV1L 3O6LL 3DJ9A 5AG8A 5JHLL 3HG1B 1ORSB 4D0BA 2SEBB 3O2WH 1I3UA 1FZJB 2X4SB 3MJ8A 3C60C 5CUSH 1EPFA 3JWDH 1MOEA 5F1NA 2ICCA 1KIPA 1LEKA 1HINL 5ENWB 2ARJB 3U4AA 3MRIB 3BAEH 4ZAKA 4KRPC 1L9MA 3RTQB 1RZFL 1KIQB 1H3PL 1G7HB 2X4QA 4JFED 4NQTA 5ACZA 5M94B 2I9LB 3UJIH 1T03L 4YH6A 3DGGA 4FMFA 2CMRL 4Q9QH 4M61A 1U3JA 2IAMC 1MRCH 3HC0B 3KHQA 5LBSL 4PV9A 4JG0L 1GGIL 4YHNA 1KCLA 3PWVB 3OG6B 2NX5D 1IGYB 1U8LA 3B2VH 1XCTA 4UQ3A 3FFCD 1U91B 1NBQA 1BBJA 1CDYA 4G7YH 1MFAH 4MNHA 4BZ2L 2ESVE 4KZDL 4XCCH 5BW7A 3BIKB 1CD1A 4HBCH 1BQSA 4RGND 1E6JL 3V6ZA 1KG0A 2EYRA 3HZVB 3MA7A 5EU6B 4NQEB 2XTJB 4H5SA 3ZLQC 4X6FB 4WCYH 1ITBB 5AZ2L 1N2RA 1A14H 4D9QD 5DVNA 4WNQB 2AJ3A 5ADPH 4XXCA 4RQQB 4EEEA 5LGJA 2XKUA 2PCPB 5TPWL 1MQ8A 4PD4K 2P8PB 3DETD 4UTAL 2R1YB 4LKCA 2ED8A 4WUKL 4NHUB 2PYEA 3WV0A 4WRLA 3VGBA 2NY6D 3OAUL 3TJEH 4LVNB 3SOBL 2PW2B 1UXWB 4U49A 4B7IA 2Y7QA 1MH5A 4EDXA 1BEYH 3K4DA 4HPOL 2HLFD 2NY1B 3QXAB 3U9PH 4NGHL 5MHSD 1K4CA 2E6QA 4JG1H 4QRRE 5KAQG 2E3VA 2XN9B 4JFDB 1TIUA 5F96L 5T1KD 1VENA 3MLWH 4FQCH 4LEXH 3H6JA 3KLSA 5T1MB 4Y1AB 5L88H 1MI5B 2NPLX 5EB9A 3EYSL 4MXWL 2Z92A 4ODWB 3PWPB 5I9QB 5FM5O 3QEQD 1TVBB 2D0GA 1Z9MA 1TPXB 3LPWA 1PGRB 5AYUH 2V5TA 2UWEB 2IALB 2WANA 3TT1H 4I2XE 4Z7WE 1JGUH 2VXQH 2ICWJ 3U4BL 1JTOA 1UB6A 5D1QB 1U6AL 4P2RD 2FJHA 1OY3B 2JB5L 4PJ5E 4RA3A 7FABL 1NAMH 2VH5H 5JNYB 1WTLA 4OZFA 1IC4H 4GBXC 5ICXA 1XGTA 2ENYA 3QIWC 5ESQB 3O6LH 3F8UB 5JHLH 1BIIB 2P8LB 3HI6H 3EDEA 5EO9A 1NFDB 4L9LC 4LDLB 4RMQA 1QHPA 1AGCB 3LKQB 2NYYD 3MBEC 2EC9U 1YN7B 2RJMA 1F42A 2VDKL 4EIZC 4U1SB 5EN2B 5DQ9B 4O4YL 2APFA 1HINH 4PPTA 4Y5YA 3GMRB 3DUSB 1KPRB 1DCLA 4QF1A 1QUNA 4P99A 3INUL 3V5DB 5K59E 1H3PH 5LCVL 4UNTA 1T03H 2CMRH 3QNYA 1NAMB 3QI9B 1UWXH 4E41E 5TDPA 1OTUC 4HLJA 3PIQA 5LBSH 1UWEL 2Y07L 3H8NA 4JRYE 1DVFD 4JG0H 4JFFB 1GGIH 2P1YA 3GSQB 5JPMA 4MGXA 3L3IB 3KPRB 1A7QL 3RKPA 3MV8E 1RURL 1ADQL 5DJCB 4DFIA 2C3HA 5JUEL 2CDFB 4BZ2H 4UMGA 3VFPA 4KZDH 3F7YA 4JB9L 3BWAB 1TZHA 4LBEB 3BYTA 1E6JH 4XRCA 3L7EA 4JREC 3VFWB 3P73A 1XGRB 3SKNB 3JV4A 1I3RB 3EYOB 5EIVA 1KNOB 2P5EB 4ZS7L 5AZ2H 1E28B 4YDKL 4G8EB 1IM3A 3R0MA 4Y4HD 3S4SA 4EI6A 1OAUL 5CIPB 5TPWH 1EERB 1NSNL 4UTAH 2C4FT 4WI7A 5C0FA 3EHBD 1KYOJ 4LPVA 4Y89A 1QP1A 5F89A 2RGSA 5CHNB 4U1HB 5IVOA 3OAUH 4ZTPL 3SOBH 4OD1L 5BCAA 1P1ZA 2G75B 4XP4L 1QSED 1AGDA 2MKLC 1MLCA 4MJ6B 4HPOH 3RVVD 4UDUB 4BFEA 5ESVA 4NGHH 4UIMB 3KPTA 5D2LE 4HDIA 1S7QB 4MD4B 1Y18B 2O5YL 3U9UA 2M26A 5F96H 3P4MB 5IMMB 4HKBB 5F7KC 2NY0C 2O5XL 3MODL 1JI1A 4FQQA 2AV1B 4MAYD 4WV1A 4XX1G 3EYSH 3TO2B 4MXWH 2IH1B 1OQOA 2OXHA 5FO8B 4FXKA 3WHXA 1ZOXA 1N5YL 3SE9L 1ZK9A 1HI6B 1U6AH 3RDTB 1S7VA 2JB5H 1K2DB 4G6AD 2EKSA 3IETB 3O4OC 1L4IA 2MSPA 3OB0H 4X7SL 4PRNB 4OF6A 3VGHA 4WFEE 3QULA 3QUZB 5T5FL 5KANG 4HV8A 3RL1A 4RMRA 3CZJA 4L3EB 4U05A 4WO4C 5LQBL 3N1PC 1MNUL 2HFEA 4X7EC 2D2OA 3MFFA 1F2QA 3VFSB 4J3VA 5HHQB 1NGWB 1HN1A 2O5ZL 3DV6A 3IAPA 3EO1B 1NFDF 1S78C 1RZKC 2K1MA 1RJCA 3TO4C 1FORH 1KT2B 1H5BB 4WUUA 4O4YH 3TN0D 1T21A 4GG8B 1QQDB 3INUH 1JZ6A 1H15B 5LCVH 1JMZA 2ZPKL 4HH8A 1U8IA 4LEOA 3T09A 1SM3L 4EN3A 3HR6A 3BIAX