4X80H

Crystal structure of murine 7b4 fab monoclonal antibody against adamts5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
223
Chain Sequence
EVKLEESGGGLVQPGGSMKLSCAASGFTSSDAWMDWVRQSPEKGLEWVAEIRNKANNHARHYNESVKGRFTISRDDSKSSVYLQMNSLRAEDSGIYYCTRTYYYGSSYGYCDVWGTGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG1 7B4 FAB Light Chain
publication title Translational development of an ADAMTS-5 antibody for osteoarthritis disease modification.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 223
sequence length 224
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x80H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x80H01
1FNSL 4OD3L 2P5EE 3HMXL 1L0YA 1EEQA 2J88H 3UDWA 2I25N 4ZUTA 3CZFB 2ICEA 2ICCA 4P59L 5HI5C 4QHNB 2A0LD 2OZ4A 2YSSB 5E2VL 2BVYA 4ZOBA 4NP4L 2Z92B 4YZFE 3OF6D 4FP8H 2NY0B 5DQJA 4TPRL 4MJ4A 2BJMH 2VDRL 5CIPA 1I8MA 4DCQB 5KANI 1AKJA 1RZKC 3E3QE 1AR1C 5D72H 1FZJB 2YPLB 1FFPB 4UQ3A 1TQCC 4J6RL 2VISA 3DI3B 1UH3A 4IRSB 2GITA 4M7ZC 4EOWH 2IANE 3T8XA 4Y4FC 4DAGH 2DQDL 2GQHA 3O3UN 4H1LB 1CFNB 4LBEA 3F58L 3SKJH 3OKMA 5L0QB 3MNZA 3JTTB 5DI8B 1DE4B 3ZKSD 4LLWA 3WHE1 4KPHH 1CK0L 4CVWA 4P46A 4WY7H 5C0BE 1NEZB 1U8MA 2GI7A 3VGAC 3SDDC 1MCPH 3GJEA 2MWCA 3UTPD 4Q2ZB 4Z7VB 5T1KD 3EO9H 4EI5B 3KHQA 2WWMD 3TT3H 2BRQA 3L3HA 1U8NA 2LE9A 1I7ZB 4W6YB 3O6KH 5EZLB 1HI6A 4Z5RB 3O2WH 5C2BH 2EDHA 4JVWA 4Y16B 1ZLSL 3U9UB 1BVZA 5JPMB 3MRJA 2FIKB 3L3GB 5F1KC 1YC7A 4JRXB 4HFUH 1YPZE 1EJ6A 4HKZB 5D7IB 4O2EA 1NBYA 2BJML 1OSPH 2PO6B 3TA3B 2P24A 3IFPA 3AY4C 4LRNH 2W9LA 4WTZG 5KSBF 3ZKXB 3MCKB 3SDCB 1CE6A 4R97C 3VD5A 4XI5D 3MUGA 3UTTE 1AD0A 4EOWL 5F9WC 3QHZL 2V7NA 3EZJB 3I3BA 3MV8A 4LCYB 4DAGL 3MRMA 5GGVY 5CEYB 4OLUH 1B6DA 5D71L 4LSQH 1BX2A 1FC2D 4OFYA 1U8KB 4KPHL 1Q9OB 4FQCL 2DIAA 4WY7L 1G7JA 3V0AC 4I0PC 8FABA 5KS9A 4K23L 1G7MB 4HSQA 1KXQE 5E4IA 4PD4J 4GRLC 1FV1B 3DTXB 3WS6A 4F15C 2IMNA 4FFWC 1DCLA 1LO4L 1D5MB 4HXBL 2KPNA 4BUHA 5IB1B 1HILA 3O6KL 3O2WL 3UEZA 4PLJC 4JANB 4LP5A 15C8L 1YZZA 2B2XL 3BEVA 5HGGS 3SGJC 2V9TA 4OSUH 2F8XC 5GQBA 3W82A 4HFUL 4LU5H 5DS8B 2HT3C 4XXCA 1KULA 5IVXB 1RIHL 3CDGB 1MFCH 1OSPL 2X9XA 4KV5E 1F8TH 4KK5D 3QXDA 1PAMA 4HV8A 1FCCA 1ZHKB 3LS5H 4LKXA 5HHOB 5HHPA 3SKNB 5I1LB 3B9VA 4J3XA 2YWZA 4P9HC 3VFVB 3IGAA 4U1NA 5GSRA 2XTJC 3BIBX 1HKFA 4L3EA 2HJKA 4EBQH 3T2QA 3QXTA 2H2PD 4DVBA 1OLLA 4GSDH 3TNMB 4O4YL 4X4MA 5D7LD 4LSQL 3MUHL 1CFSB 3H3BC 3OR6A 4TUKH 2O93L 3FAWA 4ONHA 2B4CC 4WO4C 2CDFB 3QJHB 5F7DA 5JXAH 5DJ0B 3WL9B 4G6AD 1YDPA 3RTQD 4R26H 5BRZA 4EXPX 5C08E 1JHLH 3OKLB 4XMLH 2EDKA 3MJ7B 4WGWB 3V52H 5DD5H 4E41A 2LVCA 3ZL4L 5CKAA 3MMEB 5JTWA 2YRZA 5F9OH 1NCAH 2ID5A 2NY1B 3QDGD 3IVKB 4NDMA 1MCCA 4GG8B 3D0VA 1T03H 5EORH 1YMHA 1A6UH 4U1IB 1FN4B 4OSUL 3MRPB 4XNYH 2IALB 1A6PA 5IB5A 3QA3A 5I1AB 2PN5A 2EIEA 1MCWW 1PD6A 4ELMF 3HZKB 5IFHH 4XPGL 1FCGA 4OJFH 3CUPA 3LS5L 2OXHA 5E9DD 3CFDA 1U3HA 1MCLA 4M43H 4NNPL 3BZEB 3BQUD 3T77B 3MLYL 1KPRA 2VUYA 1MRDL 3MRBA 5LG1A 3RBGA 5I8KH 3T4AA 2R2EA 5HYJA 5FOJA 2VQUA 3HZVB 3VWJB 4EBQL 3QCTH 1AQDA 5T3XH 4PGCA 3DUUA 3QG6A 5D70H 4WWKD 6CGTA 3AROA 1IM3B 4JM4H 1NBZA 1QVOA 4TUKL 4FQ2H 2IBGA 2DM4A 3QEQA 2ARJB 1XF5A 2VISB 5JXAL 4PJCE 1ETZA 2VNCA 4M3JA 4XAWH 5E4EB 2Q8AH 3RVUC 4XCCL 4XMLL 3VXNA 1RK1A 3BP4A 1OWWA 1NC2A 3KPSB 5DD5L 5ETUA 2QQQA 1RMFH 3MNZB 5T1DH 2FX9L 4LLWB 5EFIA 4JPKH 3RIFF 2WBJA 4LHJB 4WUUA 1NCAL 5B21A 5SWQB 4XVSH 1SEBB 4JFYB 1A6TA 2CDEB 4HS6A 4KKAC 1IEAB 3ULUC 5D1QA 1T03L 2W1NA 4L5FH 1NKRA 4HUWA 3B2VL 4N90E 1A6UL 1ZANL 3M17B 3WKMH 4PGDB 1B9ZA 4YWGL 1MEXL 4OCMC 3O6FA 4ODBD 4XPAH 5I18H 5IFHL 3WS6C 3QI9A 1XEDA 5DMGD 3LKOB 4JFED 4P2RB 4OJFL 1E6OL 3RWJA 4U1GB 5T5FH 1II4E 4MJ5A 4HPOH 1DBBH 3C60D 3RHWF 3A0OA 4X83A 1S7TA 3QNZA 3Q2CA 4IDJH 3UPCA 3ARFB 5EO0A 2Y7QA 3TWCH 1R5VA 3MBEB 3NAAL 1NBYB 1S9VA 2NLJB 3QCTL 5T3XL 1DLHB 3MV7B 4MLSA 5DWUH 2P24B 5BQ7A 4HH8A 4F7CA 3MV9A 5L2KB 2IG2H 3HPLA 3L3OB 1CE6B 4FQ2L 4DK3A 4NQDA 1VFBB 3MUGB 3E8UL 3LSOA 3QXAB 3G5XB 3VXSB 4J23A 1B0RB 1D3CA 4RA0C 3EOTL 1L7TH 5KVEH 3B9AA 2V7NB 5HHME 1Q9LA 4XAWL 5F6IC 3FHQA 2ITDB 43C9A 1QSFD 4S0SD 2KUTA 3QUZB 5J6HA 1TQBB 5T1DL 1MWAA 3RQ3A 1RY7B 1L0QA 4JPKL 4XVJH 4WU7B 3TO4D 1TJIH 4XVSL 1P7HL 3NA9L 1G7JB 4N0YH 4W4OA 1M7IB 1CFVH 3DVFA 1CXFA 5GRXG 3PIQA 2QLVB 3SDXB 4R96B 4L5FL 2ATPA 1AGEB 4K2UL 4IBLT 3SQOL 3WKML 4YFDB 2EECA 2NY5C 5HI5D 1ND0B 4NRXA 4QRTA 3NFNB 2FJFA 2HKFH 4XP6H 3PWVB 2N1KA 4WENB 3ZE0F 1UJ3C 1HILB 3SCMA 2G9HA 1J05A 1U92A 1ZHBA 4PLKC 5T5FL 2CKBB 1ZSDB 4N0FA 2Z93B 4BQ9A 1K4CA 3CD4A 3OKEB 1XF2A 4IDJL 4MA1B 1WUNT 1CR9H 2XZQH 4H88H 3PQYA 3C5JA 2RIKA 4Y5XA 4Y4FD 1H0DB 1JPST 4LKXB 3Q48A 5HHPB 2IG2L 4PRAB 3CFIC 3IXAA 2VXUL 3REWA 3S96B 3UX9B 3WNNA 2HJKB 3VFGH 4ZO9A 2XACC 1OP9A 4QF1A 4TNWK 3GGWB 2JK5B 3TVMA 1GRWA 3U7AA 2ED8A 3L6FA 4L4VD 4NN7C 1NCTA 1OOAA 2Z4QA 4JFZL 3VWKC 4ZS7H 5DRWB 4Y19A 3CMOH 2BNRA 4ZSOA 3GBNH 3EYFB 3Q6FB 2X4QB 1T1WA 2NR6C 1HEZA 4PFEA 2VSCA 2HKFL 4GXVH 2HKHH 1TLKA 5K9OB 1FYTB 3ARDB 4NDMB 5M95B 3CH1A 3OXRA 4N0RA 2I60L 1LO0H 5F7WC 4LDEB 1T7ZA 5JOFA 2MOVA 2XZQL 1F2QA 5I9QB 4J3WA 2VH5H 3NPSC 3B3IA 1I8IA 4RRPG 1IAII 5FDYA 1U3HB 5ICYA 4OI8A 3QUMH 5F70A 2FEEI 1KPRB 3JV4A 4NO3A 3MREA 3O41B 2QQNH 2UUDK 5I71C 3X14A 5FYLD 3B8SA 2A77L 4M8QA 2JF1A 2O5ZH 4HGMA 5I66B 3V4UH 3DETC 3VFGL 3H6JA 5FYKL 1G84A 1BQHB 2B0SL 1BAFH 4OGZA 2X1WL 3AS2A 4I0PD 3ZLQC 1JTPA 5DRZA 1ED3A 5EUKA 4GRLD 2J8OA 2E27L 4ZS7L 2VABA 5H8DA 1TNMA 4LSRH 4BK4A 1VPOH 3VGFA 3DV6A 4PYHA 4FFWD 3GBNL 3VGDA 2FDBP 2F53B 2YPLE 1HCVA 3H2WA 4PV9A 5HI4D 2UY6A 1VACA 4U6XB 3CDYA 3M8OH 4BH8B 3Q5TA 3MJ9A 4PJIB 1ZA3A 1YN7A 1ZVSB 4EZMA 1QD0A 1F97A 5C07D 4U3HA 4JFDD 5IBTL 2IEPA 2CMRH 1Y6MR 2HT3D 5DJ8A 4ZFZB 4ZUVA 5GIRA 4NCC2 5CAYB 1LO0L 4H20L 4TSBH 1W72B 3QIWC 5F8RC 3EJZC 2DQEH 4D0DB 2YD7A 4PRBA 3P4MA 2FWOB 3X17A 3O6FB 3WXWL 3LD8C 4Z7VE 3PGFL 3MLRH 2XTJD 2ATKB 2AJ3A 3T3ME 3UTQA 3AB0C 3MRNB 5AZ2H 2VDPL 1ONQB 3MRIA 3QUML 1FZOB 1MCFA 4X9FA 5M94B 2PW2A 1R5VB 3V4UL 4WO4D 5GS1B 2UZIH 3JZ7A 4HIXL 1S3KH 2X4TB 4JRXE 1PYWA 3E3QC 4YPJA 4IS6A 4WV1C 4XMKH 1PGRB 4YH6A 1IQDB 3V6OE 3ILPB 5D7IE 1GGBL 1VPOL 1BQLH 1GOGA 3MOBH 4XNUL 43C9B 4EXKA 2BXYA 3ZE2F 2W9DH 4P46D 4PS4L 1QQDB 1S7WA 5HY9B 3N1MC 4MD4A 1I1YB 3NIFF 5D8JH 2WZPD 1SVZA 4HHAA 4MQXC 1MREH 1PEWA 1T80A 1JPTL 2CMRL 3EO0B 4OZGF 4MXQD 4ZPVB 3WFEL 4RCAA 5IROA 4R3SB 2ATPB 4TSBL 3MC0A 3HRZA 4KKCD 3ZKNC 1G7HB 4NKIH 4QRTB 3BZ4B 4NRXB 1OPGH 5DQ9A 1J8KA 5I1HH 4KTEH 3NVQA 2AEPH 1CL7L 3MLRL 1Z2KA 1FVDB 2VE6A 3MGOA 1DTUA 1ZHBB 5AZ2L 3ULUF 1KXVC 1K5NB 3VRIA 3C9NB 4LCUA 5FKPB 1XF2B 5HHNA 1P1ZB 2J8UA 1HHJA 2N4IA 1KCVL 1S3KL 5H2BA 1NSNH 1B90A 5D2LB 5F9DC 4XMKL 1UYWH 4BH7A 3TBVA 5GJSL 3RVUD 5C0EA 2MCPH 4XPTH 1RJYB 3SDYH 4Y5VA 5HHOE 3MOBL 3BPOB 4X8XA 5EO9A 1SY6H 1DUZB 3GSNL 3RWGB 4XHQA 3DMMC 4KKAD 1ZGLM 3G5ZB 4F80A 3BP5A 5BMFL 5CFHA 5IGXH 2Z4QB 5K9JL 1TNNA 4LCCC 5D8JL 4Y19B 3A67H 2HLAA 3U4EB 1MREL 1LWRA 2I9LB 4WHYG 2YA1A 1FNGB 1KC5H 2AGJH 1QYGH 5D1XC 4PJ7A 4IDLA 4ZAKA 4LEOB 3QUYA 1HN1A 1FP5A 4D0BA 1DFBH 5E0QA 5E2JA 3BWUC 3VXQA 1OPGL 5J13C 4R2GB 1RURH 2DQFA 2HH0L 4KTEL 4LPWA 5I1HL 1WTGT 4LAJH 4P2YA 1WAAE 2IADA 4WDIA 5HGAA 1MAKA 2R15A 3OXRB 4MAUL 3W9EA 4OM0H 4HWZB 4KK8C 5FGRA 2GEEA 1E28A 4J3UA 4IMLB 3ZTJH 4ODUB 2G5BA 5DJZA 4PJXA 2O5YH 2PUQT 3EAKA 5IBLC 3B3IB 3PE9A 1HSBA 1I8IB 5T1MB 5I16B 1UYWL 4M00A 5D1ZC 5IMOB 2MCPL 3ISWA 4XPTL 1GZQB 3JV4B 1X5JA 4OGXH 3V7AE 4PJAB 3D5OF 4EN3C 3HR5A 3NFSH 3V2AR 1SY6L 1FNFA 1TVDA 4RQQA 5DRZB 2C9AA 4IEFB 5IGXL 4Y8AA 5DJXA 4PJEA 5EUKB 3C5SA 3WIIH 4HC1H 2DYPA 2CLRA 2BERA 1AO7D 4KRLB 3O8XC 1FLRL 5ANMB 1KC5L 4JPIA 4MS8C 4NUJA 2IBZX 5EU6A 1E4XI 5GJTL 1N64H 4PLKD 1DFBL 3GI8H 1YN7B 4X5WB 3MXWH 4AMKH 4M1CC 4HMDA 4HUVA 2JJTC 4M7LH 4RMSA 2J7LA 1RURL 3L7FA 3KPSE 2YR3A 2FJGA 1QO3A 3FQTA 4X6CA 4K3EH 3SHSA 5ADOL 4PGEB 4KI5D 5C3LD 4OM0L 2DDQH 2DKUA 4U1HA 2ZG3A 2OR8A 3EIFA 3P4MB 1KTDB 1QOKA 4KU1A 5K59E 1CE1L 2XXCB 4JHWL 2NZ9C 4QNPF 4Y5YB 5ENWB 2O5YL 3K7UA 4FQ1H 3RWCA 2AJ3B 3UTQB 2HT2C 2AV1B 4LSDA 5EOCL 1C08B 5KSUB 3CU1A 1GYAA 4FQJL 4CL7A 1E4WH 4GQ9H 3RKDC 3VD7A 4P2RE 4ELKB 4YHMH 4CN1A 3VWKD 3O9WB 5DMIL 1IEHA 5MEPB 1LNUB 2PW2B 3G6AA 1DN0A 1X5ZA 4YUEH 5BZWA 3NFSL 1JV5B 1F3DJ 1SMAA 2EEBA 2QHLA 1YMME 2EEAA 4P2OA 2IAMA 5CEZD 3FMGL 3QEQD 2GT9B 2NR6D 4K55A 1R3JB 1E27B 1NCCH 3MXVL 4PJHF 1TTGA 3MV7E 4NBXB 1OB1B 3W9DB 4JO2H 4Y2DB 1CDIA 1F4AA 3QWRA 4HBCL 2X7LB 4XRCA 5L2KE 3FRPG 4U2ZA 2IPKA 1BFTA 3L1OH 5MP6H 2B5IC 2FGWH 1N64L 3HMWH 4NHCL 3VXSE 2WBJD 2D7TH 1GCFA 3GI8L 1S7WB 5C9JA 2UVFA 4MD4B 4HIEB 4XVUC 2V7HA 1UM5H 4JO1H 1YC8A 2FD6H 4F2MB 4ZDHB 4Z8FH 1KSRA 4XBPB 4ZUWB 4XP1H 3QI9D 5TQ2H 2H41A 3ULSB 4OV5A 2VIRA 4JZJB 4Q9QH 3SDXE 1HCFX 2P42B 3OKKB 3IFLL 4PTUA 1IAMA 4AEHH 2XG4A 1KCRL 4LOUD 2NY3B 5DA0B 3TZVA 1HH9B 3QIUA 3LQAH 3DETD 5DJ2B 2IH1B 3ALXA 1E4WL 4O51A 4KJPC 1MVUA 4YHNA 5JHLH 2CDGB 3MRLA 2BVUA 1AD9B 1XCQA 4GQ9L 2FJHA 3K2MC 4OLYH 4YHML 4L8SC 1GGUA 4LHQB 1WZKA 2J8UB 1FH5H 4IRJC 3QQ3A 3QRFM 2IFGA 1I85C 4YUEL 1WZMA 3HB3C 1NCWH 1KPVA 2YA2A 4OBSA 3L5XH 4ZXBA 1MJ7L 2ZSVB 2BOCA 4QY8A 3FN3A 3TBVB 2DTMH 1NCCL 5BJTA 4YHYC 4JO2L 2YUVA 1QSVA 3DHJA 1VSCA 3EDEA 2H2SD 2R1YB 4YZFF 3GKWL 1T6VN 2AERT 3L1OL 4PRPD 4CMMB 4JY6A 2QADD 2YEZA 3WS3B 5HD8C 3HMWL 5FA4A 1S8DA 3BP5B 4Y4KA 3SY0A 2D7TL 4HS3B 3RNQB 2ERJC 3V0VA 4ZOCA 2WUBL 5FCUL 2P5ED 1UM5L 3KYNA 5FYKU 1VESA 4JO1L 2FD6L 4ETQA 5HHXH 4MWFA 4ZAKB 1KCKA 4XTRD 5TQ0L 4P2QA 1KB5L 3ARUA 4QOKE 4YE4H 4E0RB 4ZFOL 2XRAH 4XP1L 5IM7A 5IB4A 3SCMD 1J18A 4Q9QL 3RJQB 3FOMA 4UIKH 2HN7A 3U7WH 3BRFA 2R0WL 1HK6A 3PV7A 3CJJA 1JFQL 3OAYK 4N9GA 1I1AB 2X42A 3D85B 1CT8A 5FGBA 4AL8H 1FFNA 2W0KA 5JHLL 4CVZA 1FYTE 3VCLA 4YHIA 5IHLB 3DI2B 1G1YA 1FH5L 2G5BB 2IAND 3ORJA 1YEKL 3B6SA 3LVEA 3L5XL 3HKFA 1FL3B 1ZE3C 2AXFA 1KT2B 2XWBB 2QR0A 3WCYA 5EPMA 1BZ7B 1AHWA 3WJLC 1YPZF 1DQTA 4HWBL 5D6CB 5C0BD 4NKMB 1IAOB 4X8JA 4MQXD 2WUCH 5D96B 1KCSL 3F8UB 4M93C 1TPXC 3KLAA 4MCZA 5EZJB 3T4YB 4P4RA 3C5SB 3OB8A 5GGTH 4KRPC 3CZJA 5J12B 4HGWB 2DYPB 3ZKND 2VTFA 4F3FA 3D6GA 5HHXL 3UPRA 4L4TA 1A7BA 1LO3H 2I26N 4YE4L 1JPFA 3QP3A 3U4BH 2IWGA 5IEHA 2F53E 4HUUA 5DYOA 3V6ZA 5FM5M 3WNMA 4HUVB 3WXVH 5DUBA 4PJIE 3U7WL 2FJGB 2XKUA 5DJAA 4MD5A 4LVNC 3FQTB 2I27N 4KROC 4AL8L 2NXZB 2Y9RT 1E4KC 2D7OA 5JLZA 3MACH 1C5CH 5LGJB 1RVFL 4W6XB 3UTTD 3MODH 1I9RL 2GSIA 2EDFA 1P4LA 5DVLA 1ZGLA 4YAQA 1CG9A 3U7YL 3B9KC 3BSZH 3BWAA 5E1AB 3KS0H 3CPLA 3PDOA 1FVEA 4QHKI 2AK4A 2V5MA 4WI5A 2PYEB 3FFDA 4UIMA 2WLYA 4YX2H 1HYRC 4MMZC 3GNMH 1CQYA 5GS0D 4BSWA 4KV5F 3UAJC 1BVKB 5D7JA 3EYUL 1J1XH 5B38A 2NY0C 1H3XA 1YN6A 4MYWB 5EOCJ 2EH7H 2Z31A 5BZDB 5HJ3B 2XA8L 4QO1A 2VZSA 3MRHB 3B5HA 5SX5K 1UXSA 4HIJB 1IBGH 3OG6B 5DHYB 2YPVH 3KHOA 4BQCA 3NCCB 1LO3L 3KPRA 3U4BL 1BJMA 1NJ9A 4WI9A 2DICA 1AE6L 3ARYA 1GAFH 3WXVL 4U6VL 3VXMB 1IE5A 4AZ8A 4X5XA 3QFJA 3BVNA 2LAGB 5C86A 3V5DB 3S36H 5IBLD 5IMKB 1KJ2H 3LN4B 5I75B 1UM6H 2C3VB 4LLUA 3PJSA 5IR1B 3MACL 4OD2B 1MQ8A 1HXMA 2VIRB 2ZSWB 4RGOL 1ZWIB 1JWMA 2AKRA 3ETBF 3INUL 3EOAB 4YDKH 4EI5C 3QXUA 3QPQC 1L4IA 2DL2A 3QQ4B 4NKOA 4EN3D 5FO8A 1HHIB 1A9EB 3BSZL 3MNVB 5E6IB 1JNLH 4OFPA 1FJ1A 2Q8BH 4PJ8A 4Y16C 1ORQB 1RUQH 4FQQB 1MIEL 4YX2L 1ZA6B 1Q1JH 1JRHH 1KPVB 5IHUH 2OL3B 4ZXBB 5C08D 2X10A 3V6OC 4HMCA 4QY8B 5GRVK 5CKGA 5CSZA 4JAMB 2PO6C 5DZLA 5JO5B 2EH7L 4C4KT 5D2LE 5F9AC 3ZKXC 3WO4B 4M1CD 1NH6A 2AP2A 4GAYA 5JDJA 2NY7H 2YPVL 3ZT5A 4OGAC 1NDGB 5FA4B 4A6YL 3SY0B 1U2HA 1OP3H 4I3SH 1GAFL 5GRYA 1A9BB 1DP0A 1SJEA 2VLJB 4LSTH 1UXWB 3N1FC 4PJCF 2QEJA 3HLAA 2NZ9D 1A6WL 3KPMB 2I9TB 1MJ8H 3VFOB 1UM6L 5F6HI 3FQNB 1F90H 3TBYA 5IB4B 2NTSP 1FNLA 5EOQH 3BEWB 4TTGA 5GRWA 4HULB 5EUOA 3FOMB 2NCMA 1PY9A 4XP9H 1HNGA 1SYVA 5HGBA 4JFXB 2VR5A 4TNVK 5LAXB 4N9GB 4Z76B 3ARSA 2BNQA 2J5LB 1FFNB 1JNLL 2Q8BL 1WBXB 3I75B 4WU5A 5GS2D 3RA7H 3O2VL 1G9MH 1AGBA 1A2YB 1INQA 1VFAB 1Z9SA 3KXFA 3TC9A 3MROA 1Q1JL 5L8KB 1JRHL 5DC0A 5JOPD 4F33A 4P5KB 3HMXA 1MRCH 5ICZB 3Q6GH 4LHUG 4LEXL 3H7BA 2R2HA 5HYSG 4YHLH 2GUOB 5EPMB 4Q58C 3U2SA 3UYRH 1XR8A 4U7KA 1GZPB 1AHWB 2ZJSL 1F6FB 4POYA 4XVUD 5FHBL 4PJAE 1JRHI 2DQCH 5HVWA 4FTVB 3S3JA 1U95A 1KENH 3ROLB 3SO3B 4JY5H 1S7XB 3NCJH 3KPQA 3AMLA 4LSTL 2B20A 2D7QA 3OX8A 3QJFA 2A2QT 1GOFA 2GTWA 1ES0B 4G43A 3UPRB 3VG9B 3IAGC 3D48R 1MJJB 3FONB 5KZCB 2HJFB 1NMBH 5ANME 1P84K 3PWLB 2L7JA 3EYOA 3P0VH 3CGTA 1FZKA 3OKDB 4KJPD 5DYOB 2ZCLH 4TNWF 3IAPA 4JGJA 4XP9L 5HDBE 3IJHB 3EZ8A 1MCWM 5E8PB 4IRJD 4MQ7B 1IGJA 5AD0B 3RUGB 3I6GB 2DLFL 3BOVA 2P7TB 5CLTA 5JLZB 3DXAA 1UG9A 1G9ML 4KKLD 1ZLWH 3FO9A 3CU7A 2AXHA 5B22A 1NUDA 1DQLL 4QLRA 3OJVC 4CKVX 4OIBA 4XP4H 1J5OL 2HMID 5EU4A 1P4LB 1MRCL 4PTTA 2BVQA 2CLVB 1H5BA 1FO0H 3BWAB 1PKQB 3CPLB 4MJ2A 4LARH 1IMHC 1CFBA 2X9WA 3EO1B 4YHLL 5BVJA 4HG4J 5IT2L 3UYRL 4ZYKA 1A7NL 4UIMB 2OQJA 1M71A 3MLXH 2P8LB 4PJ8C 4WJ5A 1KFAL 3U6RA 3JTSA 5I8EA 4FXGB 3FTGA 2DQCL 5D7JB 3WHXA 1D9KC 3VWJC 2GAZA 4LQFL 1JK8A 1KENL 2E8YA 2X1OA 3NCJL 1R5WB 5EU6D 3S4SG 3C6SB 3LPFA 2LU4A 1OHQA 2AJYH 2YOCA 1RZJL 3U1SH 2VXSL 4H8WH 2Q86A 3VGEA 2DQJL 2GFBB 3C5ZC 5DHXB 3H9SB 1NMBL 1OD9A 2VDNL 1H3WM 4XBEL 3KPPB 4HUXB 3WEXA 2OTUB 1FQ9C 2A6JB 1J10A 2ZCLL 3PHOB 5C71A 1H15A 1TETL 1KJMA 2D03L 2W38A 4G6FB 5DR5H 1F13A 3NMEA 5GRUH 3C2AL 25C8L 3UCRA 4F8TA 1BQSA 4LLUB 4NYLB 3O4LB 5JIPA 2AJZA 3KNBB 2ICES 2VLLA 4AENA 1RD6A 4U1LA 4D2NA 1RZFH 3BPCB 4P3DB 1DQDH 1T04A 2X41A 1FO0L 5FGSA 3OPZH 4LARL 4OZFG 1YNLH 1T1ZB 3W39B 2H6PA 3QUXB 4KRPD 5J56B 2QQLH 4MNQB 2IAMD 3MLXL 4U1JB 1FLTX 3RX5A 5L7XL 3OAZK 2EKJA 2FHCA 3ARFC 4FQLH 4M7JH 3MBEC 4FG6C 4OF0A 4YK4B 4ODWA 4PJBA 1OSZA 3KS0J 2F19H 4PIRF 4DQOH 2JJUA 3UO1L 4PUBH 3UBXI 1MJUH 2IPUG 4B7IA 1RZKH 2AJYL 2VKXA 1ZS8B 3U1SL 4WRLA 4H8WL 5ESAB 4RGNE 2R0LH 2JELH 1ORSA 3HI1B 3QUZC 3PWJA 4GG6B 1S7UA 2QQKH 4UDTB 5DZOA 1JGDB 2EDRA 3PABA 4PJFA 5GRUL 3HLAB 3F5WA 4UU9B 5BV7B 4LIQE 4X7SH 1FIGH 3B9KD 1OTTD 3TZVD 3KPNA 3C6LA 3KPOA 1LGVA 2KDGA 3QIUD 4MZ3A 5D6DC 5DDHA 5DZNA 4XH2B 1RZFL 2YN3A 4Q9RH 1DQDL 4NO2A 1U8HA 3FOLB 4CRPA 1ULVA 2E7HA 5SWSA 4MNHA 1A4JA 5CD3A 1KG0A 2XWTB 1YNLL 3WDHA 2XY1A 1MCBA 3ABZA 1INQB 3KXFB 1XAUA 2M2DA 4L3CA 2ARJQ 4G8IB 4Z7VF 3P77B 4F33B 3T3MF 4FQLL 4MA1C 4XC3H 1U93A 3H7BB 2NTFA 2ADJA 2R2HB 5EWIH 4WW2A 3VGHA 5I1JH 4NO5B 3U2SB 4FFZH 3HG1A 3LEYH 4C83A 1RZKL 3BGMB 1IARB 4DKDC 2EE9A 2Y6SD 1R0AH 1GGYA 1UA6H 2HVKA 5FYJH 5D7IF 1AXIB 2QQKL 1NAMH 1DQJB 3BH9A 4YEFA 1IKNA 4R0LA 4P2QD 3OX8B 1HQ4A 1DLFH 3O3EA 1KJ3H 2GTWB 3K46A 2UZXB 4G43B 1X7QB 3RL1A 2HRLA 1SMOA 4EI5D 3OG4B 3QPQD 2W60B 1SEQH 4X7SL 1FIGL 2FBJH 1AGFA 3IXTB 3NFPA 4KK6C 3UTSA 4EIZC 5FAAA 4HD9A 5F71A 4NT6A 4Y16D 4Q9RL 5CJXC 1HHGB 5IVZA 4PREB 5IK3A 1DR9A 1KV3A 3BP7B 5C2UB 4JRXD 2Z35B 4QXUH 3RX8A 4OBRA 3ARDC 2AEQL 4YIQB 3D2UB 4C58B 1VCAA 5HHQB 4QXTA 4LCWA 5E56A 3FO9B 4OTXL 4APQA 1VEMA 3TBSA 5C0RL 4JPWL 5IW1A 4MJ6B 5HDQH 2HG5A 3B2UD 3MV01 4XC3L 2LV4A 2VITA 4MQSB 4FQHB 4MA7H 5I9QC 3P0GB 2WK2A 4HMEA 5E08H 1DBKL 3SQBA 5BVJB 3NZHH 5LGHH 3TV3H 2E6JA 3VFPB 3MA7A 5C0FB 3LMJH 4EUPH 1EVTC 3LEYL 5E2TH 4IJ3C 2WSKA 2VYRE 2XOTA 1WCBB 2CLZA 2FCBA 2PYEE 3FTGB 4P9HH 1UA6L 1BFOA 3D39B 1QSZA 2XN9B 4C55A 2F74B 4K3JL 2NW2A 1TTFA 1JWSB 1IAKA 3QIBA 1MLCA 5EO1A 1NAML 4L4TD 4UTAL 1YY8A 5IVOA 4LVHB 5FDWA 2OI9B 3NOIA 2XV6B 1KJ3L 3TBWA 1F4HA 2XICA 1FAKT 1I4FA 5FYLL 3TJHC 3D18A 5IFAH 4HJ0C 2VSDA 4OZIA 2B4CH 2UWEA 4U1SA 3FB8B 3F7YB 5CP7A 4RIRA 3LQMA 3D3VA 4JQVA 4PRIA 4PJGB 3QEUB 1KIUA 3IYLW 3HHRB 5JQHC 1TENA 4N1CA 5KVFL 4QXUL 1CXKA 4Y1AA 1WITA 4NHUA 1HSAB 3PF2A 3QZWG 4BFIB 3VXME 1YYLL 3LH2L 4NQVA 1NPUA 2DLTA 2VLLB 1I8LC 4U1LB 4R7NB 5E99H 1T3FA 5SV4A 3IDIA 4N1EA 4ZFGH 2AK4D 2F8OA 3L3DB 4KJWC 1WAAF 5BXFB 4MA7L 2EYRA 3GHBH 3SDAA 4TULH 5CP3H 5I1DB 1NAKL 5LGHL 1NDMA 3CXDL 2H6PB 5HVGB 2YMXH 1RIUH 5T33H 2VDKH 3SE9H 5GRZA 4JY4A 1NCDH 3KPLB 5TF0A 4P9HL 1VGKB 4ODWB 2DLIA 4X6EB 1VDGA 5L6YL 1IQWH 1A7QH 1Q0XH 2JKXA 2CRIA 3BX7C 4X4YB 3KPRD 3EOYG 4XZUA 4KTYA 4OKVA 4UDUB 3DO7B 1OGAB 3CDCA 3S35L 1YQVL 5IFAL 4HJJH 5F96L 2LVEA 2B4CL 5ITBL 3QCVH 3KWWB 3QFJD 3DYOA 5EC1A 1ZHNA 2PCPA 1BBDH 2YXMA 4XWOC 4LHUA 2NW3A 2BK8A 1IFHL 3P9WB 2HTLC 2ZPKH 4NN6B 2VLJE 4LMQE 1QZ1A 1SBSL 4NQCA 4WW1B 3RWDA 2VQ1A 4OZ4A 3TJEL 4O5LH 3MRQA 3ULUH 3QDJA 4JJHA 1MVFA 4DN3H 4ZFGL 3L3IA 1T0NB 1OCWH 4PJ8D 4CUCA 4HS8L 4K7PY 1M7DA 1A4JB 4TULL 1KF9B 1D9KD 3P9MA 4MDIB 3L3KA 1T20A 2YC1A 2YMXL 5K59F 1RIUL 5T33L 4CNIA 4PBVC 2VDKL 1NCDL 4DGIH 3MR9A 5C7XH 3E2HB 1U93B 1EXUA 1YEFL 2XA3A 3FQXA 1O7SA 2AJUH 2QKIA 5HXMA 1IQWL 2WANA 3LY6A 3C5ZD 4IOFC 1A7QL 5ITFA 1Q0XL 2A6DB 5GZOD 1GJIA 1CGUA 1MAMH 3SPVA 2HLFD 4C83B 2LAAA 5K93A 3BZDA 1AXTL 3MOQA 1RFDH 1A7OH 4H0IA 3T0EB 1XGPA 5CS7A 1S9XA 4YNYA 3BPOC 1OWRM 4LPXA 2ORBH 3SJVA 5IKCB 4ZG1A 3NN8B 2DQUL 1BBDL 1VFUA 4PLOB 1ZXQA 4FTVE 1UM4H 4R0LB 1HQ4B 3O3EB 5FB8B 1NFIB 1UGNA 3SGKA 5JW4N 3GMPB 1R3HA 1U58A 1A3LH 1ACYL 2MHAB 3X3GL 4KZDL 1AGFB 3MBXH 5DUPL 3GDBA 4M6MH 3CFEB 4R8WH 1NBVL 2AJSL 4O5LL 3LRSB 3STBA 4DN3L 2BNQD 3WE6A 5IVZB 1KEGL 4YGVB 1OCWL 3O45A 1CDCA 1YMMD 2NY5H 3S37H 3LS4H 4QGTA 2R2BA 3QDMB 3MBED 5INCA 1OF2A 2QSTA 1QEWA 4MLIA 1I1FA 1CFTA 3RUGE 3SDXF 5JW5B 5DD3H 4APQB 4YO0A 5IW1B 4JDVB 1HOCB 4BSJA 1ZKAA 2ADGB 2BRRH 5DD6A 4DKEL 3ARWA 4YHOH 2AJUL 5AYUL 3VE0B 7FABH 1J8HA 4BFEA 3K0WA 3QUZD 2DQHH 3WDJA 3QUMA 4MCYA 4I18B 1PKQE 3GK8H 1EERB 5EG6C 1A7OL 1AXSB 3R0NA 3GBMH 5C0CA 1EJOL 4XNZB 5C09E 2ORBL 3MLVH 4OKDA 5EO1B 3QIBB 1MLCB 1E4JA 2YUXA 4G9DA 5J6GA 3WMSA 5L8LB 1UEMA 1SYSA 3FO1A 5CHNA 3CFBB 2AJVH 5DO2C 5IJKC 4F7PB 4M03A 1CICA 4ALAL 2YD9A 1BEYH 5DEGA 3SBWA 5CP7B 4YR6B 4F58H 4KXZH 3BW9A 2DMCA 3QEGL 4R8WL 4Z0BH 2X44D 3DSNA 1QLFB 3H9SE 5IG7A 1D6VH 4P5TC 3HAEH 3VXRB 4XCEA 2FO1A 3DXAD 1JJUA 1D5XA 2NY5L 5DJYB 3S37L 3LS4L 5C6TH 4NCC1 3STLB 2UV3A 5E6ZA 4NQVB 1LO2L 3EHBC 4PJ5E 4QRQA 5DD3L 4GBXA 3O4LE 3U46B 5E00A 4HZLB 2XZAH 4RBPK 5C0GB 4Y5YC 4PV8A 3O6LL 3D9AL 4YHOL 4Z9KB 3GMLB 1EHLH 2DQGH 4BSVB 2DQHL 5IB3B 3GK8L 5IMMB 1TZHB 4JY4B 1NCUA 3D69A 3KYOB 3O9WC 2V2WA 1F3JA 1DVFB 4MNQE 1MHCB 1S7VA 1OY3B 4QOKD 2NYYC 4RMWA 4Z18A 2KQMA 5GZND 3T65B 1A6VL 2VZUA 4KK6D 1WWCA 3CC5A 5B39G 5CJOH 2AJVL 4HAFA 1BD2A 1BEYL 4TN9A 4F58L 3ARDD 4Z0BL 1D6EA 3OHXA 5EC1B 4GW1A 4M6NH 5KVDH 4LHUB 3RY4A 4KKNA 3TT1H 4MXWH 4GG6E 1CLCA 5IW6A 5HYSB 3I6LE 3DLQR 1RJLB 1WISA 1EMTH 5EA0H 2ZNXA 5F1IA 4JVPA 4FQIH 5DURB 2I07A 1AGCA 4OZ4B 3PV6A 4XWGH 1UC6A 5HHVH 1FG2A 1XR9A 1XIWB 1DSFL 4FFYH 4PJIF 4ENEC 3H0TA 3L3IB 4JZJC 3PXJA 5F21B 3H9HA 4CADA 5F7NC 5HGDB 3V8OA 2CXGA 3HNTL 1WEJH 2NY3C 5IHZA 1KLUB 1OAZL 2YN5A 4FHBD 1NUFA 3U36B 4Z95L 3V0WH 2DQGL 2BSTA 4UNUA 1S5IH 4Q0XH 3V5HB 1N6VA 2A9NL 4WI2A 1T20B 4I2XA 2VERN 2SEBA 2AVGA 3MFFA 4UNVA 4XPHH 5I73B 3WLBA 3M1BB 1QRNA 4RAUB 4O2CB 1JZ7A 1EXUB 1L7IH 3FQXB 4R7DA 5C3TA 1H8NA 1T21B 3ES6B 5JHDA 2HWZH 5SWZB 1MLBB 1NGYA 1N0XH 1G6RH 3GIZH 5CJOL 4RGNC 4BQ6A 3NIDE 2L4OA 1WBZB 4WFGE 4YNYB 2A74B 1SY6A 3K1DA 4ORGA 5JXEA 3SGDI 1T1XB 2YRPA 4HDIA 1ZT4B 4M6NL 4NBZB 4DFHA 3OGCB 5KVDL 4MJIB 1V7MH 4K9EC 2W0PA 5DHVH 2COQA 1URLA 3GM0A 2AQ1A 4PP2A 3TT1L 1FVCA 4RFEB 1NL0L 4JE4B 4P23B 2EYTB 1BZ9B 1I3UA 1UQSB 4FQIL 2CJUH 2JB6A 5KN5A 4LRIA 4LLDB 2X6MA 5HHVL 2PXYA 1WLHA 5SWSD 3L5WA 4Z78B 3GI9H 1EAPA 4PRHB 5E8NA 4X98A 4HCRH 3H3PL 1T7VA 1EBAA 2K7QA 1IC1A 3S4SB 1JNNL 3BUTA 2ZCHH 3V0WL 3JUYA 4GO6B 1XF3B 1S5IL 1I1AC 1QEWB 3QQNA 2AXJA 4L8BB 1CFTB 2XPGB 4IIQA 4XXDA 1BVLA 2J8HA 4LLVB 3DGGB 2D7MA 3RL2B 1EFXA 4LKCA 2BY3A 2XZZA 3RWHB 1JZ3A 4R4BA 3GMOB 4TNVF 4LL9A 2H32B 3KJ4B 2Z9TA 4KVNH 2YD2A 4QWWD 4F9PA 1PX3A 4IHOA 4XWOD 5HPMA 3FB6B 5C0CB 3LRGA 3OAUL 2HTLD 3L95A 4JO3H 4XBGA 4PG9B 1UWGL 5D96C 5HGHA 4QTIL 5D2LF 5LBSL 1JN6A 5J6GB 4G9FA 1WFOA 3D39E 4POZC 5J3HC 4HC1A 2XN9E 5FIEA 4JEGB 1LK2A 1SYSB 3CFKA 4HF5L 4UQ2A 3W0WA 5CHNB 5J12C 4OZFB 4PYGA 4HLZG 2HFEB 4OCNC 1CICB 3CX2A 1N26A 5DEGB 2CJUL 4NZRL 3QB7C 3DBXA 3LKNB 3HE6B 5E95B 5HYQA 2DB8A 2BOBB 1EO5A 5IG7B 3GI9L 3UC0H 4HCRL 4XCEB 4PJGE 4YGAB 3LPGA 2A1WH 4LCWD 3REVA 5J1AA 2P45B 4Z7WB 2R0KH 3H9ZA 5B8CB 2PW1A 3FJTA 3ZKQD 4MB3A 2NXZC 1KELL 4GBXB 4N0UB 2Q76A 3AM8C 1X5YA 2GTZB 4QRSB 5D2NA 4KHTH 4PV8B 2XQYG 4Y0GA 2W65B 4NQEA 5GGRA 3O11A 4NKDB 1X4YA 3VFRB 4FNLL 3GSXA 2V2TB 1QBML 3FT4A 4OUUB 5BS0B 2CH8A 4MX7B 4EI6A 2OJZH 1WIPA 3O4OC 1JNHB 3BN3B 2GIYA 3UXFA 4TRPH 1F2XK 4JO3L 1XGTA 1RZIB 3T1WA 3BO8A 4I5BA 4JVUA 1P9MA 4F7MB 1BOGB 5EU5A 4OM1H 1I8KB 1TJHH 3IDJB 5H94A 4PRID 3SOBL 1UZ8A 3RWIB 4PJAF 3VMNA 3MRDB 3GJFH 2B1AH 3BD5A 4CGTA 5GS0L 3GSNB 2R23B 4MHHG 5DSCB 1OGAE 2D31A 4YXHL 4Y1AD 3LEVH 3W11C 2EH8H 5EZIL 3AS3A 1DEEA 1S78D 5DEFA 5IW3A 5IW6B 4L8CB 4KFZC 5D5MA 2A1WL 2OP4L 5JA9A 4XNQA 1XGUA 4JM2A 5LCVH 2W0FA 3DARA 1OAQH 2R0KL 2RHEA 1A1MB 3O3DB 2FO4B 1QA9B 1UWXK 4HEME 2EC9U 5I75C 1KB5A 1XF1A 1NMCB 5HDBF 3SDAD 2AV7B 3X11A 2OX5A 3DX8B 3QDHA 4OZHA 5TPWH 4CADB 4J7RA 1S9YA 1A47A 1O5DT 3J7HA 2ICWI 4G5ZL 1PQZA 4OCRH 4I2XB 5E6IC 4JG0L 3LIZL 4JFFA 4PR5B 3ZHLA 3GSRB 4GMSL 3KYKL 1QRNB 2R29H 2OJZL 1XMWA 4ELME 5KG9B 4C59B 5DO2D 1TVHA 2EYSA 3TYFB 5AUMB 5KSAA 1KXTB 3D25A 3QHFL 4KK9D 4XP5H 3WFDH 1Z6JT 1N3NA 4G42A 5T3ZE 2VQTA 1YA5A 3RWFB 4X6DA 4L29B 1INEH 5CGYC 1TJHL 2A73A 4P5TD 3WO4C 4U7MA 4OF3A 3SE3A 4L9LB 3MRFA 2NPLX 5EIQA 3P11L 4DGVH 5EU3A 4HPYH 1U8IA 1YNKH 4HDIB 1CXEA 4P4KB 1AC6A 4U2YA 3T0EE 2HFTA 1LEIA 4XCFH 1L0XA 4NQCD 4PY7B 2W9EL 4J4PA 3A6CH 1XH3A 5HYEA 1R3LA 5LCVL 3SKMB 1OAQL 1A1OB 1LO5A 1ZGLP 2PXYB 2UZYB 3EFDH 3BKYH 3P4OB 5TPWL 4YHPB 2EXYD 1EFQA 4ZUSA 4JFPB 1N59A 1MI5A 1JUFB 3O9WD 4YQXH 3ULVE 1FZMA 1IILE 4TUJB 3HC4H 5IWLA 4OCRL 2R69H 3RNKA 2J5LC 1NGXA 32C2B 1UVQB 4KI1A 3HS0A 3QDME 4NUGH 1DBAH 5KAQG 3JWNC 3IKCA 5TGBA 1O7VA 2R29L 5GHWH 3DX7B 4PJDA 2YWYA 3ILQC 3VXOB 1EBPA 2DF3A 2GSGB 2CR3A 3RX7A 3QNYA 3WFDL 1HWGB 3FQRB 3QZWB 1INEL 1QTYT 5HBBA 1Q72H 2NQCA 3OWEA 4HJGB 2J8UF 3L95B 4N0CD 4DGVL 2E7BA 2P47B 4ZOEA 5J9PA 4UUJB 3G6JA 1CTNA 4UAOB 5GGTA 4XCFL 3SO3C 1LK2B 3CFKB 2C7UA 4ENED 3VD4A 2JE8A 3A6CL 4XCYA 3FFCB 1WT5C 1NKOA 1T5WA 4GRMA 3VG9C 3RIFK 3D1MC 1U8JA 3DBXB 4HH9A 5E5UB 3BXNB 1CLYH 4K07A 3OF6A 4R90H 3RZCB 1T0MA 3EFDL 3BKYL 3HN3A 1J88A 2WWKO 4JRYE 4WEMB 4V1DA 3VXRE 3ZYZA 3MRGB 2R69L 3GB7A 3MYJA 5KJRL 2NY4B 4QT5B 2H9GB 4JKWA 2A9ML 4NUGL 3NTCL 5HYIA 4NQUA 1R3KA 5TDOB 5GHWL 1PVHA 3OBAA 5D2NB 4BFBD 4RGND 5MENB 1W0YT 3B9DA 3PWPB 1FFRA 5GGRB 3O11B 4C54A 3FT2A 4IMKC 4ZQKA 1CBVL 5I8CB 1RIVH 2VLKA 3GSXB 5I30H 1S5HA 4DZBA 3LQAC 1G9NL 4M5YH 5IESH 4Q6YA 2APXA 3F7PC 1Q72L 3HPJA 4Y4HC 5DFTA 5T1KA 3ALPA 1G0DA 2ADFH 1XGTB 1JHTA 2UUDH 3LKRB 1IGMH 4JO4H 1T22B 4YJZL 1XCTA 1HHKB 3AXLA 1WWWX 3GO1H 1VA9A 3DUSB 4TTDD 3HFML 1KTKE 1NUNB 3GSVA 4GMTL 1CLYL 4R90L 1U8OB 4E42A 1I1AD 3LV3B 4M8VA 3BP6B 2Y25A 3DROA 1EEYA 5AZEL 3LPWA 4BK5A 1KIPA 4XNQB 4CJ0A 3I02B 3KAAA 2BSSA 4MD0A 3L5IA 1MF2H 1KJ2A 3KGRA 5FO7A 1KB5B 4ZFOB 4S1QH 5I15L 1K4DB 3FCTA 1WFUA 2P43B 2YPKA 4KTDH 4NM4H 2BVPB 4HQQL 1N5AA 3JWOH 5I30L 2ZCKH 2OS7A 2EICA 2NY6B 3X13B 2OLDA 5EU7E 2Z8SA 1CDHA 5J3HD 3QUXC 1S9WA 3MA9H 5J0BA 5KSBA 3IJSB 1Z5LB 3BKCH 5TF1H 4GJTB 4FXKB 1WBYB 1Q9KA 2J2ZA 3ZSTA 2HTKD 1IGML 1BLNB 4JO4L 3OSKA 1N3NB 4OAWB 1UENA 1SJVA 2GYSA 1MFAL 1TTUA 1YEDB 4ODXB 5SWZE 3MRFB 1P7QA 5D93C 4AEIH 3TIDA 2DM3A 3FRUA 4ZUUA 1MHHA 1U6AL 4JFQB 2VLRB 5FYKE 4U0RB 5FA3A 2IQ9L 1V3MA 4H1LH 4DVRH 5MEOA 1R3LB 2X1PA 4MJIE 4NPYA 4YPGA 5BV7C 3Q3GA 4L9DA 1KCUL 4ZOAA 3QNXA 2L0DA 5DVMA 5IJVA 1HH6A 2E7MA 3GSOA 3L9RB 3RDTC 1BOYA 4C56B 4ZUSB 1MI5B 3AREB 4NM4L 6FABL 1EEZA 4PRHE 1NFDB 1FGVH 3KJ6H 2ZCKL 3PWUA 2WMPA 4MAYB 5CGTA 3KDMA 4QGYA 4AM0B 5JHDD 1F00I 4FMKA 1NFKA 1PDKA 4J3TA 3BKCL 5TF1L 3NPZB 4H5SA 3TESA 4M02A 2JJSA 4GFTB 4RNRA 4H26B 5EOTB 3QDGA 3K8KA 3IDNB 3DUHA 3DIFB 1VADB 5C9KA 2Q6WB 1I3GL 3W11D 3ARBA 4OIIH 5CEXA 3V5KA 1K2DA 2XQBL 3RP1A 4Y2OA 5FGCB 4AEIL 4L8DA 4LAQH 3VXMD 4BZ1L 1A3RH 3L3JB 4Z6AT 3QFDA 4TQEH 2A6IB 4F57H 4U6HB 3EYVA 3OKNA 2DWDA 2PTTB 1MPAH 2YBRB 4KY1H 2C7UB 3NZ8B 3ARGB 3VRLE 3PGCA 2EDWA 1LE5A 3U9PH 2Y5TB 5EBMB 4OV6F 1CDUA 1GVIA 2FEDC 2OSLA 5TE6H 5CBAB 3GMNA 5INDA 5GGUB 1T5WB 4GRMB 1UT9A 1KLFA 1U8JB 5E5MA 1FL5A 43CAA 4O9HH 4MB5A 4AIZB 3W2DH 4PG2A 2EZ0C 3IF1A 1T0MB 2D3VA 4TYUA 5E6ID 4FABL 1V3KA 1LEKB 1UADC 2NNAB 4I48A 4QYOB 1FNHA 4WWKA 1T66C 3AU1A 2Y1VA 1RZGB 5B39B 1FGVL 4YBLB 3MYJB 2VR4A 4Q9CA 5I6XC 2LTQB 3HI6H 2E7LA 4Z7WE 4RWHA 3GIVA 4GKNA 1Y6KR 4NM8L 3P73A 4F8QA 5CGYD 1NC4D 4N0UE 3RGVC 3QRGH 5F97E 3MV11 4NRYA 5EC2A 1FO0A 4QHUB 4DZBB 1WSST 3TN0A 1AGDA 3UBXA 5IQ7H 4UOW0 4XAKE 4OIIL 3WLWC 3O2DL 2P4AB 3OZ9L 4LASL 4G9FD 1HDMB 3Q1SH 2DKSA 4JHZA 5BS0E 1UKQA 1T4KA 2QBWA 1T2QH 1YJDC 3G08B 4K71C 4F57L 2XTLA 3U30C 1UFUA 3LHPL 3AXLB 4JFEA 3ZT7A 1KPUA 4HXAL 1MPAL 5DQDH 5L8JB 2ZUUA 1P4IL 3NIGF 4LVHC 1PZUB 5C0AB 3U9PL 5TE6L 3O6MH 1N7MH 3VG0H 1CD0A 3HE7B 4KRMB 2BCKB 4O9HL 2MPAL 4NQXB 4A6YB 1P4BH 1M05A 1P2CA 5I2IA 2ZUVA 1KBGH 3K8LA 1T1YB 3FO2A 3T08A 2VOTA 4I3RL 2C3WA 1X5AA 3T0AA 4LLYA 5DXWA 3ILQD 5HI3C 1KIQA 5C0IA 2IPUK 3WIFA 1GIGH 5LXGH 1QSFA 3H9YA 4EIGB 3TBTB 1JYVA 4F7TA 1F6AB 3FQUA 2R39A 1ZLVK 3TO4A 4WHDA 3RUGF 1U8LA 4FTVD 5J1TC 5EBWB 4NFCA 3DX6A 4ZS6D 4B50A 1ZHLB 2JIXA 1S9WB 1J7VR 2X09A 1H3GA 4R6UA 2BVEA 3DPBA 4JDZA 1AP2A 3RIAK 1Q9KB 4N9OB 4RGMB 1W8NA 1QRNE 3VFTB 1QR1B 4KJYA 4NGHL 5TDPB 2R56H 2Y06H 4YC2B 1ZAGA 3QPXH 3P30H 5DK2A 1NEUA 1HQRB 4HBQA 3TIDB 3VG0L 3HZMB 4PRDB 4KJQC 3FRUB 4N8VG 4DZ8A 4S1SH 1JPGB 1P4BL 5IB2B 2GK0B 4JM2D 3LZFL 5EH1A 4Y4FA 4KUCD 4LNRA 4RMTA 1P7KA 1EZVY 4P5MA 2VDQL 5MEOB 4JHAL 2UYLB 4AH2A 4NPYB 4YPGB 3Q3GB 2Y36H 5DJDA 4NN6C 4P57A 2VDMH 3HNSH 1RJZA 2BMKB 3GSWA 3QNXB 4JQIL 1HH6B 1B4JH 1AIFB 4HKXA 3EGSA 5D7LB 1IKFH 1P69B 4L4VA 3SDDA 5F1SA 1S7SB 3GSUA 2BNUA 4G8GA 1K9TA 5C09D 4Y4HD 2CGRL 3K4AA 4CW1B 1VHPA 5HDOA 2XXMB 3RTQB 35C8H 4OLWH 1MQKH 3C8KA 3EFFA 5IQ9A 2XFXA 4X6BA 1F4WH 5KSAD 5DUMH 1YEGL 2ZOKA 4UMGA 5CBEA 2IBBA 4D9RE 1VKXB 5CZXD 3P2TA 2RAMA 5EZOH 1RUAL 1IGIH 1IGYB 4HX1A 3E2HC 3FN0H 4UB0H 4X7TA 2C5DC 1IT9H 3H9SD 2Y06L 2ZOLB 1FDLH 3O3BA 3NH7H 1PZ5A 4JFHE 5CEXB 3AY4A 3FB7A 3IDMA 5ICXB 3G5VB 4N1HB 4G6FD 3MSPA 3T0EC 1B0GB 2ADIA 4S1SL 2VAAA 3F6LA 2EO9A 2J6EH 4J4PD 4PJ5D 3OKNB 2Z8RA 1IJ9A 3MRRB 3O4LD 1NAMA 4ETYA 1RULH 1OAXH 5E9DB 3PGCB 1MCHA 2DWEA 3TNNA 3BQUB 2IC2A 5TH2A 5ADPH 2OSLB 2YD8A 1E6JH 3GMNB 5JORA 3NGBC 1CD8A 1AQKH 5E5MB 43CAB 3HNSL 1WIUA 3FFCE 1IVLA 5MHSE 1A6ZA 4B53A 4I0PA 1IKFL 1I3VA 5LGKA 4K7PL 4GG6F 3ULVC 4WWKB 4GRLA 3EYSH 5D9SB 3QUXD 5I1CL 1G0YR 1Q9WA 2WP3O 5D4QA 2FZ3B 1K6QH 3F12B 3O3AB 4K7FA 4PGBA 1QLRB 5HVHB 3PHQB 1Q8MA 4OLWL 1YQ2A 4J1UB 2FR4B 3OAYH 5LQBH 3HNVH 2X4OB 5HSFA 2IPTH 2G2RA 4X99B 2CKBH 3RY6C 5LWYL 4RMUA 1VB9A 1NGQH 5TQ0H 1R5IA 5C07A 3FN0L 4NRYB 3LDBB 3U83A 4JFDA 5F7EH 5MENE 2DMBA 2P1YA 3HUJB 1IT9L 3PWPE 3QO0B 3VW3L 1FDLL 1UZ6E 4EUPA 3I6LD 3FHAA 4I18C 2GJ6A 2WW8A 1D5BA 4AIOA 4UOW1 3U0PA 1QACA 4XNZC 1LD9B 3MUY1 1I75A 4JFEB 1ERNA 2X4RB 3SE8L 3THML 1JL8A 2J1KA 2IH3A 5JDSA 4M61B 3NIDF 1ZV5A 1YEHH 3C60B 3H8NA 2AEIT 2DBJA 3QUKB 4HK3J 3RDTD 4S1RH 3CSYB 1AQKL 2EIZA 5TFSH 4MA3A 4WO4A 1MUJB 5I2IB 4D0CB 3OXSB 1CGSH 4V1DD 1W0VA 3ARQA 1MFEH 5FUOH 3FO2B 4QXGL 3JV0A 2R4SH 3RBSA 3F62A 4CU8A 3OKOA 4Z7QE 2CIIA 4DK6A 5CZVL 1QSFB 4ZNEE 4QRPA 1T2JA 4U0QB 3NCMA 3HNVL 2VLKD 4R4NC 4WFGD 4JFOA 2AJXH 2IPTL 2VLME 4NNYA 1N2RB 2CKBL 4RFNB 4X6FB 3WFHA 3QULA 4X9HA 5IIEA 2XIDA 1RK0A 5F7EL 3VXTA 5AAMA 2C3XA 1QP1A 1YYMH 5CP3A 3MGTA 2GJZB 4O00A 3CXHJ 3MCLH 3W5NA 1CD1A 2F5AH 3ALWA 3DX6B 3UTZB 2ESVA 1ADQH 2J88L 1V3LA 5A3IC 4JDZB 2K3TA 3BUYA 2FEDD 4N8PA 1DVFC 4QHMB 4LLQB 2NX5A 1D5IH 4Q74A 1CGTA 2O61A 2EZ0D 4O2FA 1YEHL 2JJVA 3QDAA 4FP8L 4XMPH 2B1HH 4HZAA 4S1RL 1MAJA 1Q94A 1KIRA 4LSVH 1QSEB 5TFSL 1P53A 2F54A 4CMHC 4OZGA 5D72L 5E8OB 3UROR 1CGSL 3WUWA 3HTLX 3EOBB 5SX5H 4Y4FB 5HVFB 1MFEL 2AQ3A 5FUOL 1P6AB 4Q6IC 2OR9H 3LKSA 5E7BA 3ARVA 2OK0H 1NGZB 2VLRE 2JLLA 1IEBA 4P57B 3RGVD 3PGDB 3LQZA 3CVHB 3SKJL 1A22B 3KLDA 2L7UA 4HKXB 1QPXA 3EGSB 4U3XA 2CSPA 4PJGF 3HR6A 1XIWC 1W72H 3WLWD 4OD1H 5K9KB 4WUKH 3RVWC 1MCPL 4C56E 1S7QA 1YYML 4HT1H 3CVIH 4UT7H 2H3NB 1DEDA 5EU7C 3GHEH 1NMAH 3EO9L 3EFFB 4KDTC 5F72S 4GW4B 2DIBA 4HGKC 1IC4H 3TT3L 1NFDE 5F88A 5I73C 2JCCA 1F4XH 3LKPB 4JG1H 3GMMB 2K7PA 4MGXA 4P2CG 1WQVT 5C2BL 4HX1B 5K9QI 1AH1A 3P9LB 4YDIH 1PY4A 1EX0A 3F7QA 3LOWA 4ZPTA 4WCYH 5F3BA 5KSVA 3MJ8B 5LVEA 1P7QD 2P5WE 1LDSA 3MRKA 1U8PA 4DW2H 1Y0LA 4OCWH 4XMPL 3IDMB 2B1HL 2EE2A 4TVPH 5A43C 2C3GA 4LRNL 4LSVL 5HI3D 4OCYH 4WNQB 5FGCE 4CVXB 5J57B 4XNMB 1KNOA 4HWEH 2F5BH 2FLRT 2OR9L 1OTUC 5IF0B 5T1LB 2P46B 5FK9A 5TH2B 2OK0L 3BD4A 1A4KA 2BVOA 3BKMH 3RVXC 4U7SA 5I1IH 5JORB 4S11A 3JV6B 3NCFB 3WKNA 2X4NA 3FAXA 4OLUL 4EVNB 3SE4C 5FV2A 4P23C 4FZ8H 4U6YA 1A6ZB 3BHBB 5E94B 3WFCH 3OR7B 1W72L 1INDH 2DKMA 3GSQA 4AT6A 1KLGA 1S7RA 3TFKC 2IQAA 4JLRA 4WGVB 3PP3H 1AO7A 4HT1L 4UT7L 2YD4A 3DURB 3IFOA 3PL6B 4S2SA 3ZKMC 1PG7W 4HG4K 1NMAL 3VXUE 4HIHA 1J86A 1UJ3A 3R8BB 1IC4L 5FO9B 1REIA 2JJWA 4P48A 4PY8J 4PGJA 2DBLH 2R2CA 2EDBA 1G7IA 4NO0A 1R5IB 1BBJA 4YDIL 3ARBD 3P4NB 1AI1H 1G7QB 1OGAD 3CSGA 4KJQD 4WCYL 4GUPA 5B3JF 4BKLA 1LP9B 3KJ4C 4LU5L 1QUNA 4DW2L 2AXGA 3DWTA 1GGTA 5ISZA 3S35X 1MFCL 4JDTH 4ZUTB 4ONFH 1D5BB 1F8TL 4M1DH 2ICEB 2I5YH 1K8DA 1ZT1A 3GMQA 4HWEL 2IH3B 5JDSB 4LPCA 1EA9C 4OQTH 5J1SC 2R8SH 3F7RA 2E9JA 5DQJB 3BKML 5EN2A 5CIPB 2N56A 1I8MB 1BWWA 4GSDL 3VWKA 1AKJB 4JZOA 4WO4B 5ERWA 5C0AE 4NSKA 3GJFK 3BH8A 1K85A 4UQ3B 3WFCL 1JWUA 2Q7YA 3HE6C 2GITB 1INDL 3HAEA 3T8XB 1HYSC 4R26L 3AAZA 1YEIH 1JHLL 5DRXA 4LBEB 3V52L 3OKMB 4QHLA 5T3ZD 1F5WA 1IM9A 4KUZH 1XZ0A 5B8CC 1DQQA 2F15A 5K33A 2FH8A 5F9OL 2O26U 4MB4A 2DBLL 4N8VA 4TSAH 4P46B 3WFHB 1C8PA 3ULVF 1U8MB 3TN0D 4UT6H 2R0ZH 5EORL 3PP4H 5DMKA 3GJEB 2XY2A 4MQTB 4XNYL 1TZIA 3LN5A 4HUNB 3L3HB 1U8NB 3S97C 4JDTL 4PJHA 1HI6B 5DVKA 4M1DL 1PG7H 1I7TA 1OW0C 3MLSH 1T83C 5F9JA 4M43L 1JZ4A 3MRJB 5ESVA 5JPNA 5I8KL 1JI2A 1RUMH 4OQTL 2KBGA 4G80A 5DTFA 3H7LA 4O2EB 3ULVD 3IFPB 2KL6A 1WC7A 2OJEA 3KYAA 5D70L 1M6OA 4JM4L 1IGCH 1JF1A 3WNKA 1T0PB 5CUSH 2IGFH 1AD0B 4GXUM 4KKBC 2BFVH 3R0MA 3MV8B 3MRMB 4A2LA 4UILH 2Q8AL 2AS5M 3OJDA 3QWOA 4NZDA 5DMYA 3T0WA 3ZYIA 2AI0H 1BX2B 3X12A 4PRPA 1RMFL 4IM8A 2ZWLT 1GH7A 3UPAA 5JW4R 1I3RA 4TSAL 1NMCC 3IDYB 1A6AA 1PLGH 3QIWA 8FABB 5KS9B 4U31A 1DDHA 5DJ6A 1DBMH 5D7LE 2G75A 2LU7A 2P5EA 1CI5A 2JIXD 1GPOH 3N06B 2DQIH 4U1MA 3BI9X 4G7VH 4XPAL 5I18L 5JR1H 2JCCB 1N5YH 1BMGA 1IAIH 3VXPA 1KB9J 1PG7L 3E6HA 4ZPTB 5F3BB 4UV4H 4HPOL 1DBBL 5KSVB 4TVSa 3BEVB 1AR1D 3OAZH 2X4UA 1RUML 3TWCL 3RU8H 1Y0LB 4JRYD 1EAJA 1RZ8A 4WV1A 1G6RA 3MPCA 5C70A 5DWUL 2FYYA 2DI7A 4YBQC 3H3KA 3QXDB 1EVUA 4HV8B 2E6QA 4L9LC 2IANA 3I84A 4IOSD 1A1NA 4BQBA 2WBKA 5ALBH 4P4KC 1DUYA 2D0FA 3IGAB 1B2WH 4HK3N 1G7LA 4NZTH 3VH8A 5CUSL 2IGFL 4PPTA 4U1NB 5GSRB 1L7TL 2APWA 1G1CA 5KVEL 5IFJA 4QRRE 4L3EB 2MKLC 5FKAA 1FBIH 3CFJA 2ENYA 1XF4A 4R4ND 4RAVA 4UILL 3S37X 2EIDA 3KLHC 2BDNH 4DVBB 5E9DE 2FB4H 3GZKA 3SDDD 5C0BA 2CO7B 3OR6B 4G8GD 4NZUH 4UNTA 1JGEA 4ONHB 4YDLC 4PGZA 4XVJL 5I1EH 5I76A 1C7SA 3O81A 5F7DB 3RKPA 1TJIL 1F58H 1TIUA 4MNGA 3PWNA 4N0YL 1PLGL 3ZYOA 4AT6B 1YDPB 1CFVL 4HCRA 1Z9OA 5BRZB 3BE1H 5A3ID 3IFOB 4OT1H 4E41B 1CFQA 4JN1H 1UJ3B 5IV2A 4QRUA 3Q0HA 4XP6L 1U9KA 1G7IB 1IAIL 2WAHA 3DSFH 2E8ZA 4LP4A 3D0VB 2FEEL 2P8PA 4D9QD 1YMHB 1YPZA 3I50H 5H35A 1JNJA 1K3ZA 4YXLH 4GUPB 3V4VH 5IB5B 1OP5K 3QA3B 3ZDZE 3RU8L 1CR9L 5CGMA 2C1PA 5FYJD 4H88L 5GSVA 3HUJE 4XGZA 3S5LA 4J2XA 2WV3A 3CUPB 3CFDB 3UTTA 5GS3A 2BZDA 4BZ2H 3MRBB 4DTGH 3T4AB 4UAOC 2R2EB 5HYJB 3DMMA 1FBIL 5DF0A 1AQDB 4PGCB 3DUUB 3QG6B 2VWEE 4K9EH 3WJJC 2VL5A 4LCCA 5ERWB 4LIQH 3MJGX 3RVWD 3LEXA 1NBZB 1H3UA 1QVOB 4NZUL 3BMWA 3RZCC 4MSWA 3CMOL 3QEQB 1XF5B 5D1XA 1OTSC 1ETZB 3DJ9A 2ICWA 5F7MC 5E7FA 3TO2A 4PP1C 5L88H 1MCEA 3VXNB 4DN4H 1X9QA 5DK0A 1RK1B 3BP4B 1TMCB 1NC2B 5ID1A 2Q3ZA 1FSKB 3QCUH 4QHLB 5ETUB 4JN1L 5IMLA 4PLJD 4GKSA 1XZ0B 1D7FA 5EFIB 5FOBA 4GXVL 2NY4C 4RWYH 2X4PA 2HKHL 2WBJB 3MOAH 5CILH 1BIIA 3ZDXE 4N8VB 2EEDA 4WUUB 5C0JA 5SWZD 4BQ8A 1A6TB 4HS6B 1N6QH 5D1QB 1T7WA 4KGLA 2VDLH 2ZUWA 4HUWB 5DMKB 5F1NA 3PNWA 1LE9A 4YXLL 3D0LA 4P49A 1MFBH 2GJ6D 4CDGC 3V4VL 2VRAA 5I8OH 4RAHA 4G8FA 5FHAH 3VFUA 3QI9B 5D1ZA 2VH5L 4MJID 4OF8A 3RWJB 4QCIA 3MNWA 4KAQH 5F9JB 4KMTH 1A21A 4MJ5B 4GRWB 4P23D 4XB8A 3DOSA 4EN3A 5JPNB 3K81A 2QQNL 1J0JA 1S7TB 1Q0YH 3QNZB 4DTGL 2O5ZL 4G80B 2Y7QB 5EO0B 1PEZA 1S9VB 4J8RA 1BAFL 2WBWB 5JMOC 3EYQC 5IEKA 5BQ7B 4WHTA 4M62H 4F7CB 3MV9B 3HPLB 5JZ7C 1JF1B 1PSKH 2VXVH 3O8XA 3TPUA 5I17A 4LSRL 4NQDB 1KJVA 5C08A 3ZKMD 3LSOB 5FV1L 4HK0A 3VRLF 1QSEE 2BVTA 3UMTA 5DFVC 3STZA 1Q9LB 1RV6X 3I9GH 3HI5H 3OJDB 4FQXA 4QRPD 5L88L 4HIIA 3M8OL 3MZTA 2IFFH 5J6HB 2JJTA 2QADB 4DJMA 5FF6A 1J0KA 1MWAB 2RR3A 1FHGA 3MOAL 2GCYA 1JVKA 1N6QL 3PIQB 2VDLL 1P84J 2ESVD 2HFFA 2ARWA 2K9UA 2RBLA 2DQEL 1WZ1H 4Z7WF 5B38G 4X9IA 2IMMA 4U1MB 2FJFB 4OLXH 3MLWH 5M7QA 1I7UA 2XWJA 3SCMB 2G9HB 2DD8H 2NX5D 3VXPB 1BF8A 1J05B 1U92B 4U33A 4V2CB 4KAQL 1W8OA 1D5ZA 2R1XA 3CLFH 4HUMB 4N0FB 2D2OA 4K8RC 3SGEI 4D3CH 1K4CB 4RISH 3QH3A 1C5DA 1CQKA 2F54D 3HE6D 4WV1B 2UZIL 3MGAA 3PQYB 3C5JB 2Q20A 5A16A 3NBNA 3MRCA 4Y5XB 2FX8H 4H0GA 4M62L 1MCOH 5IVXE 4PJCA 1PSKL 1U0QA 3RIAF 4GKZA 1DUYB 3IXAB 5SV3A 4XCNA 2DLHA 3V95A 1BQLL 3IDGA 1V8HA 3REWB 5IFJB 1CU4H 3IJYA 1E4XH 2KQNA 4U0RC 3HI5L 4QF1B 2W9DL 2X70A 3TVMB 3ULUD 3L6FB 3V79C 2VDOH 5FYLE 4ZODA 5F7FA 5L2JA 4XAKD 5E24E 4MNGB 1JGLH 2PKDA 2VUOA 2BNRB 1C12A 4ZSOB 5ACZA 4G8EA 3C09B 4YHKH 3BPLB 1T1WB 5GGSA 5BS0D 1HEZB 3AREC 3IDXH 5TDNA 1CFQB 1WZ1L 4M48H 4NKIL 2XT1B 3MLWL 3TCLA 1DANU 1WGOA 3ZMRA 2AEPL 4MAYC 4ESKA 5J89A 3DYMA 3FT3A 3EDDA 1IGTA 3CH1B 5D7KD 4L8SA 2K1MA 3CLFL 3G9AB 3UJTH 1FORH 2QSVA 5JOFB 4IRJA 4D3CL 1I85A 4YEEA 3HCVA 2OL3H 4MZ2A 2FBOJ 2H26A 1NSNL 4XPBH 4KKBD 1LP9E 2XKNA 1MCOL 5ICYB 1T5XA 3OGOE 4NO3B 3SDYL 3MREB 3U48A 1FNEA 3JVGC 5TE4H 3X14B 4M8QB 1BJ1H 3RY5A 1CN4A 1CU4L 1E4XL 3I85A 4NBYB 1HINH 2FHFA 4GAGH 2Y23A 3ARGC 1U8QA 4NRZA 3SKOA 3IETA 4JREB 2BHZA 1NLDH 1ED3B 3K4ZA 1J87A 3C08H 2VABB 2VDOL 3M45A 4GS7B 3A67L 3DV6B 1JGLL 4NWUH 2AGJL 1T89C 4LLMA 3L7EA 1QYGL 4PV9B 4OFDA 1VACB 5DK0B 2HT4C 1IRAY 5ID1B 1V3JA 5J13B 1ZA3B 3P0YH 4X7EC 4FQXC 2VN7A 4MDJA 3VDAA 4NO0D 5KANG 4YBLC 2BC4A 2LTQC 2X4PB 5C0JB 1YEEH 1MCQA 5FECA 4V2BA 3DVGA 5DJ8B 4F9LC 3I2CH 1NQBA 4ZUVB 5GIRB 4YDVA 3OJ2C 1FORL 5AG8A 5ISZD 2HVJA 4PRBB 3ARZA 1XGYH 1JCKA 2OL3L 1MCKA 4P4KD 4JQXC 4CU7A 4XPBL 3DO3A 5I1KH 1JMXA 4JN2A 3MNWB 3KLHD 4YDJA 1HXYA 3MRIB 3WJLA 2C1OA 4EN3B 4OGXL 3HZYA 5TE4L 4WFFE 3DRTA 2F58H 1X4XA 4GAFB 1TZGH 1LEGA 3ARRA 4ZO6A 1EDQA 1JGVH 1BJ8A 4J8RB 3T2PA 3VFSA 3T0DA 3R4DA 1PYWB 4IS6B 4ISVA 4ZD3H 3C08L 3HE7C 3WIIL 2OTWA 4HC1L 4Y8DC 2D7NA 1CLOH 5C08B 1AY1H 1C1EH 1IL1A 4LDLB 4D9RD 4NWUL 2PYFA 1IM9D 2H1PH 1EH9A 4KDWA 2X4SA 1HKLH 5A1AA 4DEPB 3BDYH 3P0YL 3MV8E 4U3CA 3BZFA 3MXWL 4GAJH 4AMKL 3NACH 1RHHA 4LMQI 4JFHD 1RUKH 4M7LL 4HHAB 3I2CL 5L9DH 1E4KA 3ZTNH 4K3EL 1QBBA 5A2LH 5JW4Q 2OYPA 2BHYA 2DDQL 2ED9A 4LNVA 3HRZB 5KVMC 5KS9E 5CJ5A 1XGYL 3S6CA 4RBPH 4AG4H 5DQ9B 3B9KA 4FQ1L 3S34H 4HEPG 4WFEE 2VE6B 2EC9T 5JW3H 3MGOB 4K3DH 3JBG7 5I1KL 5BW7C 3VRIB 4LCUB 4QHNA 4RGMC 2F58L 1UZ6F 2YSSA 1TZGL 1F4YH 5HHNB 1C5DB 2Z92A 1JGVL 1HHJB 4YC2C 3U4AA 2CK0H 3LCYA 5H2BB 1OTSD 3S88H 3MRCB 4DCQA 3BKJH 4BH7B 4PP1D 5C0EB 1FZJA 2YPLA 1FFPA 1U36A 2DOCA 5EBLA 4Y5VB 1AY1L 3BRDA 1B3JA 2NY4D 5MP6L 5EO9B 2H1PL 2FGWL 4UI2A 4H1LA 4RMRA 2EE3A 1CFNA 1HKLL 5ESQA 5MEND 4L3EE 4G7YH 3JTTA 5DI8A 1DE4A 3QIWD 4GAJL 3EJZD 4MXVE 3NACL 1RUKL 4X4ME 3V8CA 3WN5C 2HLAB 4RZCA 3CNKA 1NEZA 4TSCH 3ZTNL 3A6BH 1X6LA 4PJ7B 3QUYB 4Z7QF 4XC1H 4Z8FL 3K4DA 4D0BB 1N8ZA 4Q2ZA 5TQ2L 4Z7VA 5TDNB 1T2XA 5C0DA 4EI5A 5BRZE 3VXQB 1SM3H 4AG4L 1F11A 3RTQC 4AEHL 2DQFB 1I7ZA 1FGNH 3S34L 4E41E 4NN5C 5EZLA 1PKOA 4Z5RA 3LQAL 3N85H 5JW3L 2CUIA 2IADB 4WDIB 5HGAB 4K3DL 3W9EB 2N7AA 3EYQD 4WHYH 4Y16A 1HIMH 4PB0H 3U9UA 5JPMA 3QSKB 4KDVA 4IRJB 2BX5A 2FIKA 1NUGA 3L3GA 4OLYL 1E28B 4JRXA 2Z0BA 2FX7H 1F4YL 4HKZA 5DJZB 3V6OA 4PJXB 5D7IA 4KMLB 1BGXH 3R1GH 1NCWL 2PO6A 3S88L 1HSBB 2E6PA 3O2DA 2O5XH 5IUSA 1JBJA 4KI5E 2DTML 3IRZA 1A64A 3HR5B 2VLMD 5CEYA 4RQQB 3BQUC 3IETB 4KMQA 5HYJE 5DJXB 4PJEB 4G7YL 1P5UA 1RZJC 1U8KA 5EBGA 2CLRB 1Q9OA 1NANH 1CGVA 5BV7H 3ARTA 4YFLF 4JPIB 4TSCL 2CXKA 4NUJB 5E6YA 5EU6B 1G7MA 2R9HC 4PJ9C 4PRNA 5CEZE 3QEQE 2DI9A 2XRAL 2YA0A 1W0WA 1FV1A 3DTXA 1SM3L 5HVHC 1GC1C 4UIKL 4WHCA 3L7FB 5FECB 3BJ91 5IB1A 4OFIA 2YD6A 5EIIA 1QO3B 4X6CB 2VL4A 3RWEA 3WYRA 1CGWA 4JANA 2OXGA 4WUUE 2JB5H 4U1HB 4U1KA 3LDBC 1MCRA 4LVEA 2FX7L 1FNSH 4OD3H 1NFDF 3HMXH 5DS8A 4EDXA 3JWOC 3CDGA 3WSQH 4I13B 3RWCB 3FQWA 5KOVC 2BXZA 5HHOA 4P59H 3SKNA 3BPNB 4YDJB 3DMMD 1T7YA 5I1LA 3VFVA 3F65A 3V6BR 1LEGB 3G6AB 1DN0B 4GRWE 3T0BA 5BZWB 2B8OT 1OQXA 2VWEC 2WUCL 4KRPB 4BA8A 3TNMA 3VMOA 4P2OB 2IAMB 3C60C 3PDGA 5BCAA 1CFSA 5D1XD 5GGTL 2P44B 2CDFA 5B4MC 3QJHA 2XNAA 5BV7L 4XRCB 3MV9E 5DJ0A 4TVPE 3WL9A 1BJ1J 2IPKB 4NQDE 4IRSC 3RI5K 3MJ7A 1PW3A 5EULV 3F58H 3BGFB 5JMRA 3BZFB 5C9JB 2P5WD 2VAJA 4KK8D 4G6KH 5L0QC 2OR7A 1CK0H 2V7HB 4DUVA 3IVKA 4WTWA 1NANI 4RFNC 3WIHH 5DC4B 2JB5L 1FN4A 1B0WA 1C5CL 5D1ZD 4OV5B 2IALA 5I1AA 5JIKA 1X6NA 4PTUB 4U49A 3B9KB 3W5MA 3HZKA 3MODL 3WSQL 1AR2A 3TZVB 3QIUB 1QG3A 3ARGD 3BT2H 5E8DH 1ZLSH 4QTHA 4O51B 1MVUB 4YHNB 3TEUA 3BZEA 3MRLB 3T77A 1XCQB 2FJHB 1Y6NR 1CLZH 4KVCH 3QQ3B 3GNML 1D9KA 3HZVA 1YJDH 3VWJA 4BYHA 1JZ6A 3O8XD 3WNPA 2VR9A 1J1XL 2Z8VC 4MS8D 3AMKA 2BOCB 3ECBA 4RDQG 3TA3C 1IM3A 5BJTB 2HT4D 5FM4A 3PQYE 3VXUD 2Z91A 5EBLB 1MOEA 4FQXD 1B6UA 2ARJA 3SO5A 3SDCC 3QHZH 3C5ZA 4KRNA 4JY6B 2YEZB 1IBGL 5AEAA 4UOJA 5ESQB 1S8DB 4Y4KB 5D71H 2V2XA 3KPSA 2QSQA 3V0VB 4G6KL 5IHBA 3KYNB 4FQCH 4RZCB 5SWQA 4JJ5A 1SEBA 4JFYA 2CDEA 1IEAA 2EE6A 4ETQB 4K23H 4MWFB 1UWXH 3S36L 1KJ2L 3FN9A 2HT2D 4P2QB 4Y19E 3WIHL 4MNGE 3S9DB 3M17A 1N8ZB 2BNRE 1H8SA 4PGDA 4ZSOE 5IM7B 5C0DB 3PP3K 5DVNA 1I9JH 3RKDD 1F11B 1LO4H 2HN7B 4HXBH 4YDKL 2RGSA 3LKOA 4DWHA 4P2RA 1RU9H 3BT2L 5E8DL 1FG9C 4NQSA 1CT8B 5GGSY 5C0AD 4CVZB 15C8H 2B2XH 2P49B 4NFDA 1RUQL 3HE7D 3VCLB 4YHIB 1YMMA 3ARFA 1CLZL 4KVCL 3MBEA 1YJDL 1RIHH 2NLJA 3B6SB 1DLHA 3MV7A 3MTRA 5IHUL 1JZ2A 3FZUC 2AXFB 4PB9H 1ZMYA 4LPVA 5L2KA 2QR0B 3L3OA 1Z3GH 1CF8H 5GPRA 1VFBA 3IKKA 4FRWA 2J6EA 3QXAA 3G5XA 3VXSA 1B0RA 3ZHKA 1R6VA 2QJDA 2ITDA 4ZTPH 1RHFA 4X8JB 1DQMH 2NY7L 3QUZA 3RPIA 3T0VA 4O4YH 3KLAB 4N90D 4MCZB 4P4RB 1JE6A 4I3SL 5TE7H 4WU7A 4F7EA 1LDPH 4J3SA 1M7IA 4F3FB 1J0IA 1MJ8L 4L4TB 4R96A 3SDXA 2CO6B 5C6PB 1AGEA 4PRNB 5D6DA 1JPFB 1F90L 1W0WB 5IEHB 5EOQL 12E8H 4HUUB 1LQSR 3V6ZB 1I9JL 1ND0A 3NFNA 3ZL4H 3PL6C 5ILTH 1VENA 2VXTH 3PWVA 5DUBB 5HI4C 4P3CH 1ZVYA 1KN2H 4MD5B 3KPTA 5DJAB 1RU9L 5EIIB 1CXIA 2V5SA 3HB3D 5DGRA 3RWEB 2NY1C 2CKBA 3MJ6A 1ZSDA 2Z93A 3RA7L 4U1KB 4UZGA 2YUWA 5JA8B 3OKEA 1X4ZA 1CWVA 5T3ZH 4EDXB 1W2KT 4XPGH 2GSIB 5HHMD 5JUEH 3FQWB 1ZGLB 4YAQB 1CG9B 1CYGA 3Q6GL 1H0DA 1HNFA 4PB9L 5HD8D 3PDOB 3UDWC 1FVEB 4NNPH 4QHKJ 1Z3GL 2AK4B 4PRAA 3AC0A 3MLYH 1CF8L 4XX1G 1MRDH 3EUUA 1KEMH 3FFDB 3S96A 1X5XA 1ACZA 4ZTPL 4BSWB 1DQML 1IGFH 3ESVF 3GGWA 3K80A 2JK5A 5B38B 1YN6B 1IAIM 4JY5L 2YUZA 2Z31B 1DJSA 5DRWA 5TE7L 1EGJH 2XNAB 2PF6A 4O02H 4QOKA 5ELIA 3EYFA 1LDPL 3Q6FA 3WD5H 1UXSB 4YHZH 2X4QA 3UYOD 3S3SA 4XCCH 4HW6A 5E4EC 3KPRB 3RVTC 3ULVH 12E8L 1NJ9B 3P0VL 5CJXA 2FX9H 1U42A 5ILTL 2VXTL 4P3CL 5CJ8A 5K9OA 1FYTA 1KN2L 5KBNC 4X5XB 3ARDA 3QFJB 4YLQT 3BVNB 3N0PB 4P46C 2FLBT 2DJ4A 3B2VH 3PJSB 1ZANH 4YWGH 1HXMB 2J12B 3C8DA 2BHUA 2AKRB 1JWMB 4XB7A 1MEXH 4MXQC 4S1DC 5T3ZL 4QRRD 4XP4L 5JUEL 4NKOB 2ZUQB 2RJMA 5FO8B 1E6OH 1ADQA 4KKCC 4QTHB 5CSGA 3TH4T 3P4LA 5I1GH 1FJ1B 2X2YA 4U1GC 4PJ8B 3O41A 3NABH 4RX4D 1KEML 3ZDZF 5I66A 1D9KB 1KGCE 2NY2B 3NAAH 1BQHA 2APVA 3HUJF 4WEBH 1IGFL 3ECBB 2R9HD 2J8UE 4PJ9D 5CSZB 3G5YA 2X40A 2Z91B 4OFVA 4JRWA 3G04A 3E8UH 1EGJL 4O02L 3EOTH 4K7PX 3C5ZB 4GAYB 3WD5L 2F53A 5JOPE 4YHZL 1ITBB 4U6XA 4BH8A 3C87A 4PJIA 2V2XB 4KROD 3ULVL 5T5NF 5IBUG 1ZVSA 4JR9H 1BHGA 1TQBC 1SJEB 2YS4A 4DUWA 3TF7C 4PLNC 4JJ5B 5DR5L 3NA9H 4ZFZA 4M9PA 1I8LA 3IDYC 1W72A 4K2UH 1H3PH 3SQOH 1H3TA 5F6HJ 4G6JH 3TBYB 2AAVA 4D0DA 4TUOA 4OB5H 4JKPH 3GRWH 4PJ7E 1WV7T 2FWOA 5EUOB 4LK4A 3ZDXF 1SYVB 3VI4E 1Q38A 2ATKA 2ZUSA 5HGBB 3MRNA 4NQSB 3OPZL 1ONQA 2BNQB 3UAJD 5CSBA 5I1GL 1V5JA 1C16A 4WI8A 2NY0D 4WU5B 1FZOA 3NABL 1R24A 1YMMB 1AGBB 2QQLL 3CH8A 3EDJA 3MROB 5LKNA 5GS1A 5B4MD 1JP5A 4WEBL 3R8QA 2YPLD 2X4TA 4M7JL 4XXCC 1IQDA 4IRSD 3ILPA 4PJXE 4DQOL 2F19L 4L3AA 5HPOA 4PUBL 2WQRA 3GM8A 2VXUH 4N8CH 1MJUL 1XR8B 4H0HB 1TXKA 2R0LL 3RPIB 5D7SH 2JELL 2F8VA 1U95B 1JF5A 4JFZH 1QQDA 5HY9A 5CLWA 2Z8WC 4JR9L 3KPQB 1QHPA 1I1YA 2VMFA 5DJCA 5KAQF 4PJEE 4F7EB 3IS0X 3QJFB 3EO0A 4ZPVA 4LGSB 4R3SA 1H3PL 4G6JL 1G7HA 2VZ1A 3EYOB 1FZKB 4OB5L 4JKPL 1JGUH 5EU6E 3BZ4A 3GRWL 4HUKB 4ZMAT 5EB9A 1MH5A 2BSRA 1FVDA 1IGJB 1WIOA 3B5TA 3NCYP 2I60H 3OB0K 1K5NA 1ZLUH 3C9NA 3DXAB 3BGAA 3B4NA 2PO6D 3TA3D 5FKPA 4X6CE 4J12A 3GMRA 5BO1H 1QFPA 1QSED 1P1ZA 1CIDA 5EU4B 3SDCD 5D2LA 5FEBA 4PTTB 2BVQB 4KI5C 4NC0B 4WTXA 1H5BB 3OJMB 5EWIL 4WWID 4OGAD 1RJYA 5I1JL 1U3HC 4FFZL 2A77H 4N8CL 4ZYKB 2OQJB 1Y18A 1M71B 4WJ5B 5FYKH 3U6RB 2B0SH 1DUZA 3RVVC 3JTSB 4OQTA 5I8EB 3RWGA 1R0AL 1WTLA 3G5ZA 5D7SL 3WHXB 5FYJL 2GAZB 1UH4A 1JK8B 5IVXF 2E27H 3I3EA 2MQCA 2HRPH 3U4EA 4QOKB 1C7TA 1DLFL 1ODAA 2I9LA 1FNGA 1CVSC 1SEQL 2CKNA 2Q86B 4LEOA 2FBJL 2PR4H 1EUTA 5J4MA 1KYOJ