4X83A

Crystal structure of dscam1 isoform 7.44, n-terminal four ig domains
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
389
structure length
389
Chain Sequence
b'QKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVNQFYEAEIMTEYVIRGNAAVLKCSIPSFVADFVRVESWIDDEGNVLSFSDNYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSKAPTFATASKISSLLGSSSSDIVLLCQAQAFPVPYTRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Dscam1 homodimerization: Insights into context constraint for protein recognition
pubmed doi rcsb
molecule keywords Down syndrome cell adhesion molecule, isoform 7.44
source organism Drosophila melanogaster
molecule tags Cell adhesion
total genus 87
structure length 389
sequence length 389
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x83A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x83A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x83A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x83A04
2JIXA 4PP1D 2MHAA 2Q7YA 3PHOB 3ARFD 4K23L 2HLAA 3RWEB 4Y5VA 5E95B 2NW2B 1FFQA 3AUVA 1M6OA 1MCOL 1TVHB 5DHYA 4ZTPH 4F7MA 3ROOA 3KGRA 5ALCL 1JHTA 5I1EH 1EHAA 1I1AC 5BMFL 2EH7L 3EFDL 5I9QC 1YNKL 4M7KH 2P24B 1DANT 1DQQA 1GGCH 3FRPA 5FO9A 2OJEB 3S98A 4PJ7B 2CJUH 5F7YC 1BM3L 4EXPX 5K9JL 1CICA 2PO6D 3RQ3A 3VWKA 1T20A 3Q5OA 4IRJD 3BYTA 5DUPL 5GGRA 1BD2A 4GKNA 4C56D 4H1LG 1IAIL 1T1XB 3P9LB 5DJAA 2OZ4H 4HCRL 3NCMA 3HN3A 4GMTH 1PW3A 3LQZA 2DDQH 3C5JB 5DK0B 4JFED 3TYFB 2DF3A 4FQXC 3QA3B 4APQD 4UNVA 3EDFA 3BZEA 3D2UB 2DQDL 2XZCH 5GGSY 4I0PA 5IHZB 4YEEA 3CDGA 1KJ2L 5SWSB 1S9VB 5HYEA 2DL9A 3FQWA 1ZHBB 1KXTB 5I16A 2J6EL 2DQCL 3OXSA 2HVJA 3MR9B 1UGNA 3VXMB 1RJYB 3BIBX 4LK4A 2QQLL 3KR3L 5A16A 1U41A 2X4OA 5T1LA 3TGXA 1YEFL 1A4KA 4HUUB 2R39A 2VDRH 4OJFH 4KMQA 3BKJH 4UV7L 2X4PA 2RGSA 4PTTB 4KKBC 1YY8A 4NO2A 4XWOD 5IVXA 1A6WH 4PJEA 5H94A 3L3JB 3U7YH 4NO0D 1QBBA 4L3CA 1W0WA 3GM8A 3D39A 1F3DJ 1FBIL 3RY5A 3X12A 3U9PL 2R0ZH 4PGEB 3GO1H 1CIUA 2ZKHL 5ESAB 1FV1B 2ADJA 2AK4A 4ZFOA 3HHRB 1U36A 4UT6H 4CUCA 3VGGA 1XIWB 4PRAB 1S7UB 4EN3D 1EIBA 5MERB 2NY1D 1U3ZA 1IGMH 5T1MB 4AL8H 2ICWB 1Z9OA 1N26A 4RFNB 1LQSR 1CR9L 5LWYH 3BP6B 3IJHB 4UIMB 2A6DB 1MI5B 4XP4H 2J7LA 3GHBH 1QUNA 1N6UA 4GFTB 1WCBB 1G7IA 3VRLE 2BFVH 2DQHH 1VACA 1D9KD 2M8XA 4E42A 1MJUL 5I19H 5D71L 4U1MA 4YHIB 4ZSOB 4D9RE 3FMGL 1RHHA 5F6HJ 2YRPA 3LN4B 3BO8B 1P2CB 1ZHLA 5EFIA 4YXHH 2X6MA 3MUHL 4FABL 2CIKA 3O41A 4N8CH 1HIML 3EUUA 3SDDA 5DJZB 1KCSL 1JUFB 1BBJB 1YMME 1GZQA 1HK6A 1IARB 1OP3K 3KPPA 1KIPB 2R4SL 1PJ9A 1I7UA 3CLEH 4IS6B 4YE4H 2IQ9L 1AR1C 4J23A 1KJVA 4KXZI 5SWQB 3GKZA 3V4VL 1A1NB 2L7JA 4GS7C 4U0RB 3TO4A 2VERN 5ACMA 1KB9K 3H9YA 1Z0NA 3GJFK 4GMSH 1UEYA 2NY0D 1U3HC 2O93L 2QKIA 5F7NC 4JFQB 5C6TH 1NFKA 1A9BA 4JRYE 3QZWB 2EDLA 3SGDI 5LXGH 2F19L 4MMXC 3SBWC 3O45A 5J12C 4X7TA 3V7AE 5IMOB 5D2NA 4D9RD 3GSQB 5FM8A 4PJ7F 1RFDL 1F2QA 1CLCA 3LZFL 4QNPE 4KJYA 4YUEH 1LO3H 2Z92B 5FUOH 2PCPA 3MV9A 1WQVT 5IR1B 3KLSA 1JPFA 3IGAA 2CLRB 1E4XI 1F00I 2AGJL 1WIPA 2BP3A 4BZ1L 5E99L 1YMMD 5IW6B 4J4PA 4WU7B 2AJUL 2PKDA 1MQ8A 5KANG 2VXTL 1K5NA 5I30L 4FQCL 3TZVC 2PNDA 3BDBA 3ARTA 3MLRL 2PETA 3P30L 4Z7OF 1KPRA 1NUFA 2P8MB 1AGCA 3MV7A 4MA7L 3UDWA 1IGCH 1HXMB 5DJ0B 4M6NL 3VFWA 3RI5F 1R3JB 2IALB 1G6RL 2HMID 4HWUA 4YHML 4G43B 5AAWA 1JGVH 1CXLA 2XY1A 2Z0BA 4NYLA 3ARSA 2FATH 3Q1SH 4IIQB 3HMWL 1T7XA 1NFDE 1U93B 1U58B 5F70A 1T1WB 4K9EC 1A6TB 4H8WL 5FA4B 3MODL 1WTLA 3FZUC 2F58H 1TVDA 3BPNC 3ZMRA 4OLUH 3FO0L 3VFNA 1KXVC 4M1GH 1MHPL 2V9RA 3SGJC 1YJDH 4KMTL 4AEEA 4Y4FD 4J8RA 2CUMA 2AEPH 5C71A 3QEQA 1CU4L 2AEIT 4HH9A 3S6CA 4YBQC 5DJDB 3MJGX 3QO0B 2AKRA 1UXSB 3L3GB 3P77B 3SQOL 4MA3A 2YD2A 2QHLA 1PSKH 3L1OH 1I8KA 1WJ3A 4HF5H 2CDFA 4YHPB 4UINL 4JFDA 1OW0C 4N0CC 4JPIA 2OYPA 1NFIA 3FHAA 2GJJA 5EOCJ 5IJKA 1A22B 3TBVA 3QHZL 4E0RA 1V8HA 5EU3B 3S35H 2NY4B 3PNWA 4YWGH 1TZGL 2X1QA 4Q6IA 5CMAA 5FYJH 1U8HB 4XCYA 1J0JA 4DVBB 5E70A 4YHKL 2APXA 3U9UB 1W72B 5CSZA 4MHHI 3F7YB 1UA6H 5B38G 2B8OT 3H7BB 2IFFL 2JJSC 1HI6A 2CRYA 2MOVA 3KPSA 3UTZB 5JPMA 3O6ML 1RULH 4RQQB 1MCPH 2AJZB 4PG2A 3FT4A 3FOLB 2GUOA 1U6AL 4EUPB 5I8OL 4M43H 4RGMB 1AGEB 2LTQB 4DCQB 1S7XA 1FAIH 4WU5B 1G7QA 3P4NB 12E8H 3LN5A 4QHLA 3DX6A 3MRBB 4K3EH 2BNUA 1UB5A 3ZKND 2Z93A 3PABA 4YX2H 1F5WA 3IETB 3QEUA 4ZUVB 3C60C 4O9HH 4MQSB 4Z7UE 1EEYA 2PO6B 5GGQL 1T89A 4W70A 1KLFA 5TF0A 2MKLC 2BY2A 1BBDH 5AUMB 2YD9A 2KQMA 4Y1AE 1PYWA 1SJVA 1PG7H 3N1MC 3OXRA 4MD5A 3V5DA 5FK9B 3UTOA 1A5FL 3D3VA 1CBVL 1ZWIA 5IJVA 1WT5C 4R3SA 2I9TA 4HDIA 4XCNA 1CXHA 5E6ID 3QCUH 2HT2D 2RCSH 2ZNWA 2EDEA 1YEDA 1CZ8L 2D0HA 3EOYG 4JFHD 3O4OC 3QDAA 4OZHE 5C09B 1Q1JL 3MRIB 2WUCL 4JHWL 5F9AC 2X4NA 5B3JF 5L6YH 3L9RA 2X9WA 4NJ9L 3QXAA 4ODSH 1CI5A 4LRIC 4CMMB 1K8IA 1VGKA 3L3OA 4FTVA 3OKMA 4NIKB 1Q9KB 1QACA 3JTSB 4XMKL 2VKWA 1MCWW 3N06B 5BVJB 4P5MB 3H6JA 3VXTA 4S1SL 2DN7A 1OT2A 4Y2DA 3MLSL 4JFFA 3RPIA 1CL7I 1DVFA 4Z76A 1BREA 5C0CA 4UILH 5B8CA 5CEZH 3RGVA 3GSNB 5ECJE 2HKHL 4OCWL 4OIBA 4GRWE 3C6LD 4Y1AD 1Z3GH 4ZUTA 3I02B 5JHDE 2QQKL 5KOMC 1G84A 1T2QL 1T7ZA 4LCCC 3SO3C 3E1F1 1JNNL 1OSPL 2BJML 5KVDH 2HKFL 4UOJA 2WUBL 3RDTD 4V2CB 3K80A 3ARGA 4EN3B 4HK0B 2VWEC 2NY1B 3IJSA 3QCVL 1IEAB 1WIOA 1FL6A 1UM4L 3LIZL 5B39G 3U83A 3WKMH 2E9WA 2EZ0D 4X4MA 3V6FB 1EFXD 3LV3A 5BV7L 5BJTB 5IHBA 1QEWB 1ZT1A 35C8L 4QXGL 3P9WB 4X6FA 4CVXB 4AENA 1JHKL 1D9KB 2OMNA 3O3DB 3S3PA 5DMIH 4XPGH 4NCDA 3RY6C 5D7SH 3DI3B 1S9WA 1FYTA 2XWJA 1KB9J 2PYEE 4ONGL 4OD1L 1A2YB 3AXLB 1T5WB 1QR1A 5HYSG 4NQCA 1QQDB 1T03H 3KPNB 4W6YB 5DFVC 1ZHNB 2E27L 4K3DL 2Y07H 4AMKH 4JB9H 5JHDD 2DQIL 2CIIB 1GYAA 1KTDA 1OOAA 3C5ZD 4OTXL 5F7LB 3FT3B 1BFOA 3EOBA 2FEEL 3O11A 3EOTH 1HQ4B 5SWZA 1I9RH 1FVDB 4P3DA 5C3LD 3L7EB 3OG6B 1SMAA 1BAFH 1CS6A 2YC1A 4EI6A 3TNMB 4ERSH 1W2KT 5TQ2L 3OKDA 3UTQB 5BZDA 3BPLB 3QI9C 1AKJD 2N1KA 1XF2B 2FECL 5FCUH 5CKGA 1S7SB 4PLOB 2R23B 4R90H 5DFWH 1FZJA 3BVNB 4XVUC 1MCKA 4C54A 1G7MB 2XI9A 2PYED 3W5MA 1OPGH 2IG2H 4Y4KB 4X5WA 5D7KE 4X6EA 5EBMA 5F1SA 3NFPA 2BX5A 3X3GL 4ETQB 1YMMB 5ACZA 2DQGH 2VUOA 4QHNB 3PV7A 1OL0A 2WBWB 3ULUC 3MNZB 2YUVA 1JNHB 3GMLB 3V7MA 4OZFG 3I6GB 2Z4QA 1BWWA 3CDCA 4AEHH 1MCFA 4JG1H 3KS0H 4JZJB 4OZGE 1EHNA 4OZIA 4PY7A 5C0IA 3EO1B 4JPKL 4DEPC 4DWHA 4LSPL 5DEZA 4ZXBC 4JRYB 5DVOA 3C08H 2F74A 3LKQB 4J7RA 3WE6B 1KEGL 4OF0A 1MCRA 4JDTH 4RISH 1J88A 5AZ2H 1E27B 1U2HA 2DBJA 4D9LL 5D7KD 1P7KA 1LK2B 4LSSL 5C0FA 3HE7D 5ILTL 5EO0B 4F9LA 1MRFH 3UTSA 5I1DB 1UKQA 3L95A 2Q3ZA 5CJ5A 4PJCB 4H25B 1AH1A 3SKOA 4Y4FB 2ICWI 1GSMA 4I48B 3NZ8B 4RFEA 3REWA 3CJJA 3WD5L 5BRZE 2ED9A 4NKMA 3T1WA 2LU4A 2YR3A 4ALAH 2GIYA 2CDEB 1G7HA 3KVQA 2C26A 4FQQB 3RKPA 3HPLB 2YHGA 3NABH 3T4AA 2X1WL 2C7UB 3VFOB 2DYPA 3DX8A 4Y89A 1K2DB 1UJ3A 3QPXL 1HHGB 4IM8A 1NMBH 3ARED 4HZLB 5EOCL 3CUPA 1OCWH 5HPMB 4TNWK 3G5ZB 4R4ND 4I18C 1NFDB 2C4XA 4ELME 5IBUG 3JXAA 3L6FA 1BP3B 4BQ9A 2ESVD 5HI3C 2YXFA 1FFOA 1I9JH 1S7QB 4LRNL 3C6SA 5IV2A 1HEZA 2EDDA 4QRTA 5C8JA 1JZ3A 5FO7B 5M7QA 3DV4B 4RDQF 3DVIA 2H1PL 2R0LL 2C4FU 2SEBA 2CD0A 5HTSA 2XZAL 3TNNA 2D7QA 5JXED 2R4RL 5BRZD 2OMBA 4GKZB 5IIEA 3CFBB 3W0WA 2CLZB 2XOTA 3PV6B 1SYVA 5CBAA 1KCUH 4Q58C 5IEKA 3VG9C 5CZXD 4OD2A 4NRXA 2J88L 4Z7WA 5EWIL 1DQML 1MFNA 2JJWA 2GK2A 2BERA 1G9ML 4H0GA 1MFCL 2PTTA 1BVZA 2PXYC 3RWJA 3MRGB 4HK3J 1BJ1H 3STBA 4OCSL 4Q2ZA 4IDLA 2E7BA 4Q9QL 3HCVA 1FJ1B 1AHWC 4PJDB 3CIQA 5E6IB 3WJLA 4UT7L 2UV3A 2YBRB 4YPJA 3RZWA 3SDXB 3KLAB 5EUOE 4HWNA 4Z0BH 3V6ZA 4PS4L 2V7HA 4MZ3A 4LIQL 2B20A 4UTBH 3QP3A 5E2UH 4FXKA 4K9EL 4KDVA 1R3IH 5GSVB 1HHKB 5GS0C 4FFZH 1SM3H 4PRPD 4MA8L 3RVXC 3U30C 1WBYB 4ISVB 3O8XD 4ETYA 4Z7UB 1NEZG 1ZLSH 3SQBA 2EE6A 3B2VH 5D5MF 3BGFB 5BOPA 5IB3A 4JKPH 3MJ9A 3QIWD 1I7ZB 2EEDA 2W9DH 5T33H 4Y1AB 3C6LB 3MC0A 3W2DH 3WUWB 4ZNCD 2BXZA 2NX5A 1EH9A 4P4KB 1UH3A 5HYFA 3ZT5A 3VWJD 3FT2B 3QUYD 3H7LA 4OCYH 1B6DA 4GRLC 3G5VA 3RDTB 4UV4L 4DGVH 4L8BB 4XWGH 1FZOA 5KJRL 4QY8A 1WIUA 3FO2A 4JDZB 3CSGA 5TE7L 1F02I 1D5ZA 3QUKB 3B5HA 4OZHB 4PJCF 4HFWB 2RBLA 1JRHL 1UWXH 1EFXB 3BKCH 4O02H 2DS4A 5DD5H 4GQPH 4XBPB 4DFIA 4AH2A 5CEZE 5HYIA 4BFIA 1A0QH 4LLWA 4B7IA 2DRUA 4EQ3A 5E1AB 4G5ZL 4MXVE 1QSEE 1VERA 3SKMA 4QXTA 4NZRL 4HKBB 4LF3B 3LQAH 4OSUL 5FYLL 2KQNA 2FX7L 1CXEA 4KQ3L 1CDIA 4JO4H 2UZYB 3TPKA 1YY9D 1BQLL 3GBMH 7FABH 4R4FL 1KEML 1SY6H 4GRWB 3U79A 4XGZA 5IFHH 1L0XA 3RI5K 1NFDF 3MREA 4LAQH 3C5ZB 4OI9A 2PW2A 2WM0A 4ZQKB 2EIZB 3U0PB 3JTTB 3JWOH 4DGYH 3LHPH 2YPLA 2VLKA 1KENH 3BW9B 2BNRE 3FQXB 4MYWB 4KI5C 3KJ6H 5FOJA 4XP9H 1J5OH 4F2MA 1HILB 3QYCA 15C8L 4MAUH 3H3PH 1AIFB 3WFEH 2E9IA 3BI9X 1INDL 1RZKC 1X7QA 1XZ0A 3EYFB 5EZLA 4IOIA 4IOSD 5DFTA 5ICZB 2PW1A 1RZJH 4ENED 5CEZD 1RJLB 3IDJB 3H9SA 3MLWL 1KTRL 3BP7A 4NM4L 4AT6B 4PRBB 3HR6A 1QSED 1R0AL 3QXTA 2JELH 4YC2C 3VMPA 2JB5H 3VFTB 2LAGB 4OCXL 2PYEB 5DD1L 1HYSD 4G6AC 4HKJB 3RNQA 3VJ6A 5HDQL 4ZDHB 5IVNA 4N0YH 2A6KA 3Q2CA 3QAZC 1BD2E 4QRSA 5FF6B 3HZKA 5CSBA 1HHHA 1BJ8A 5SX4I 3U0WL 4Y4HA 4XHQA 4PBXA 2HH0L 1I3UA 3D85D 4LCWA 5FDWB 4KV5E 3EO0A 2BNRD 4Z6AT 4L9LC 5EBWB 4J3TA 2YKLL 1F6LL 1J0KA 2GCYA 5D1ZC 4PJDF 3G5YA 4HLZG 1BQHA 3VGHA 5EU4B 1RZ7L 3SDXF 3M1BA 1UWGL 3UC0H 5D1QA 5CD5D 2JIXD 3ULSA 3TYGL 3VMNA 1GAFH 3IT8D 1N6QL 1A1OA 4OLYL 3MRJA 1ZGLM 1ACYH 2EECA 3HLAA 3H42H 1RZFL 3ZYJA 4OLXL 4YGAB 4OGYH 3PQYA 4TSAL 4XPBH 5I1JH 3QH3A 5SV3A 4IRSC 4WO4C 2R2HB 2CH8A 5IVXE 1XGYH 3H2WA 4PJEE 1A7RL 4XTRD 5CIPA 1S8DB 2EC9U 4NOBA 1CICD 1NCBL 3B3IA 3HE7B 5DMGC 4RAVA 1AGDB 3D39E 5JW4N 5JW4R 1BD2D 5GGTH 3E6HA 3MLTA 1DSFL 5KVGH 3MUGB 4ZS7H 1JPSH 4XHJD 1C12B 3NAAH 2HFGH 4JPVH 5C7XH 1CDGA 1FPTH 4LSQL 3JV6A 3NMEA 4I0PD 3E3QC 4NNYA 4B0MM 4JO1H 5MHSE 3QDJB 3ARYA 1YN6B 1R3KA 4OZHF 3ARZA 2G60L 4HS6A 4JRWA 3GGWB 3QUMA 1MSPA 4QLRA 5ALBH 1A1MA 3WIIL 4UDUA 1PY4A 2CGRH 1H5BB 3V6OC 3FONB 3AS2A 4AIOA 3AREB 1F90H 1U92B 1PD6A 4ZFGL 1GIGL 3D39D 2IWGA 1DL7L 4HEPG 4NGHL 2FJFA 2WWMC 3P3YA 4OI8A 3CC5B 1S78C 3EJYC 1K4CA 4NQXB 3WLWC 4BZYA 4LLQA 2BK8A 5DR5L 4WUKL 3WJJC 2ZCLL 4GRMA 3ARQA 1ZVSA 1S7RB 4U1JA 1EXUA 1NAKH 3DYPA 4B7LA 3WFDL 3G6JA 3T2NH 4S0SD 2R8SL 5JOEA 4G6FD 3CDYA 3TPUB 2GJZA 3ULUL 4CDGC 3UTPE 3EDKA 1F6AB 4M5YH 4WW2B 1TVBB 4KK9C 5L88L 1EPFA 5T3ZH 1HN1A 3MRNA 1MQKL 4X4ZA 4ZTPL 1WFUA 2OI9B 3B5GA 2YPVL 3CMOL 1MHEA 3HZVB 4UNUA 3DRTB 3AAZA 1T21A 3MV9E 3O4LE 5BS0A 3ULVF 5J13B 3RZCA 4LSVH 3VWKC 3O3EB 1KBGL 1T1YA 1KLGB 2BRRL 1IEHA 4WFGD 3OKNA 3DX7B 3SDDD 3LEVL 4NQSA 3MFFA 3GBNL 1DBAH 4DOHE 5IGXH 2OZ4L 2P7TA 3QNZB 3SHSA 4DN4L 1TTUA 4K7PX 1KT2B 4K3JH 4WGVB 3QFJA 1NCAH 2IBGA 2J3SA 5ESVB 3TO4D 4I3SH 2XKUA 2XXMB 3DRQA 3PDOA 5I66A 3RTQB 4RMUA 3SDYH 2X7LB 4DZBA 1SEQL 2W0LA 1B4JH 3UTPD 2FL5B 5C07A 3KXFA 2BMKB 4U1SA 3QULB 1EJ6A 5CGYC 1U8NB 5CCKL 1CGVA 1EEZA 4LLDB 3VXNB 3WNOA 4XCEB 4U0RC 1XR9A 2AXFB 1RPQA 4F7CB 3MV9D 3O4LD 3VGEA 1A6WL 3HNSH 1HQRA 4NCC2 2VC2H 2VDLL 1E4XL 1C16B 3LRSB 3ELAT 4G3YH 4Y5XA 1A3RH 1IAKA 5KS9B 2EDBA 5EC2B 5EOQL 2R0ZL 2CO6B 3GO1L 5H35B 1ZA6A 1T5XA 3LKNB 1CFTB 4JFYA 3QEQE 4R4BA 5AD0A 3FN9A 1HH6A 4GBXA 3HAEA 4LEOB 1VEPA 2Q8AH 3K4AA 4QO1A 5DVLA 4KKLC 4P49A 3TO2A 5GS1B 4MJ6B 1OGAA 2J8UA 4JFDE 3KAAA 1UQSB 2YK1H 2R1WB 3IF1B 4G7VH 2VTFA 1C5BH 1HSAA 4MDIA 1Y0LB 5LWYL 5J3HC 4HUNB 5HHPA 4M5ZH 3VH8B 3LDBB 5BZWA 1IMHC 2ZSVB 3GHBL 5INCB 3TT1H 1SMOA 1E28A 1AGBB 1F4XH 1FL5A 2DQHL 3V52L 1MJJB 3ILPA 3RVUD 1EHXA 3HG1A 2EC8A 4MJIA 3K8LA 2BVPB 2ICWJ 2Y06H 1KCVL 5I19L 1JN6A 4OUUA 2QQNH 1CFVL 4TULH 3BP4B 1AO7A 4F37F 3OJDA 3ZDYE 2AQ2A 1CK0L 4K7FB 3V5KA 1I8MB 4MSWB 5C0AA 4DN3L 1ITCA 3QEQD 1I7RB 4IIQC 4LOUC 4B50A 4EKXA 4GLRH 2IANB 1J1PH 1NC4A 2BC4A 2DKSA 1I1YB 4NNPH 1H15B 1B9ZA 3B2UC 4JQVC 1IQDA 3RIAK 2XV6B 5IQ9B 1QSEB 3ISWA 3TJHC 1TTFA 2DI9A 4YE4L 3CLEL 3BN3B 2R1XB 5JLZB 4YHOH 3AM8A 4TTGA 2NR6D 2O5XH 4JFDD 3IVKB 3W9DB 3DX9B 2NTSP 1BVKA 3MROB 3FHQA 5DZLA 5HVWA 4WW2F 4F58H 1QBAA 2HVKB 4GMSL 4KK5C 4WFHE 5F88B 4YDJB 3L7FB 4LCYA 5E56A 5GS0L 1TZIB 3RWHA 4I8DA 3AB0C 5F3HB 3HTLX 4LVOC 1ZOXA 1EJOH 4ZOAA 3D85B 4S1DD 3D3VE 5KSVA 3WS3A 2BNRB 2ED7A 1IL1A 3LH2H 2FBOJ 3MJ9H 1HCVA 1LO3L 5FUOL 4WUUB 5F1NB 4X83A 3S4SA 1QO3B 3LPFA 2JIXB 3LMJL 2NY4C 2J4WH 5HGBB 3RHWK 1S7VB 4J4PC 5DHYB 3BRGC 1X6NA 2MJWA 3CXDL 3QQ9D 2B39A 4FTVE 4KHTL 4MNGA 4AG4H 3P4OA 5AYQA 1IJ9A 5C92A 3OHXA 2BOBA 1I8IA 5A2KH 1JGLH 1XR8A 2BVQA 3T1FB 4RGMC 5HVFB 1G7JB 2LTQC 3FTGA 1DE4B 5C0CE 3UEZA 4WFHD 4X8XA 3IDNB 4KY1L 1BD2B 1T7WA 4JFPA 4ZS6D 4OAWA 5DJCB 1W0YT 4BYHA 2WV3A 3D3VD 1FIGH 4Z77A 3LQZB 2QSCL 1FAKT 3BESR 1JGVL 2FATL 4GSDH 5E8NA 4HUXA 4L4VA 4KJWC 2J1KA 3MRCA 4I0PB 1RZ8B 2R0WL 4HXBH 5E8DL 5KS9F 2F58L 2UWEF 1DBMH 4MNQA 3ZYOA 4O4YL 2GAZB 2P42B 1RU9L 1WAAF 2E8ZA 2LV4A 3Q5YA 5JUEL 3S37X 1NDMB 5A1AA 4MJ4A 5DJ2B 5ISZE 5A16B 4FTVD 4XBGB 1MLBB 3I84A 2X4PB 3HMXL 3QIUA 5E5MA 2AEQH 4NO2B 2J8OA 3ES6B 3SKNA 3VRJA 2WQ8A 1HDMB 5IVXB 2BY3A 5F93C 1CL7L 1GZPA 2EE9A 2XZQH 4ZYKB 4JKWA 1PSKL 3L1OL 1DVFD 1RZKL 1FYTE 1VFOA 3WIHL 5C0CD 4OB5L 2O61A 5HJ3B 1WSST 4NZUL 3RGVD 5CHNB 5DF0A 3MGOA 1I1CA 3ZSSA 4KRPD 3U48A 1Q94A 4C55A 5I17A 3OKLA 1OT1A 3L5WA 2ERJC 2HFEB 3GDBA 5E8EA 5C0BE 1XF5A 5JXAL 1QBMH 2NNAA 4YWGL 1I9IL 5FYJL 3WYRA 3BZFA 1QR4A 4ZTOL 1QLEH 4HBCH 4ZAKD 5J57B 5E8OB 3GSWB 4G6FB 2V5MA 4JY4A 2P45B 5JHLH 5IW1B 5DJXB 3LQAC 4WHTA 3S3SA 1ZEAH 3DUSA 4M43L 3NIFF 1G7IB 5TDPA 4EN3C 4KDTC 2HT4D 1FAIL 5D93B 3KYKH 3TF7C 1DBKH 2A77H 1FYTD 4K3EL 4JFOB 2BDNH 2GFBA 1KFAL 1RHHB 5F7MC 3SPVA 1IFHH 3WO4B 5FV1L 4YPGB 4Z5RA 4WRLA 5GISH 3B9AA 4F7EB 4NQCD 4ORGB 3JWOC 1BJ1J 2IC2A 4PFEA 5EFIB 3T09A 2W0FA 2VLRA 3K2MC 3MLYL 3S5LG 4LARL 1D9KC 4POZD 4D0BA 3QWRA 2LE9A 5CIPH 4XZUB 3KPMA 3QT2A 4NP4H 1RIHH 2HG5B 3ARPA 2NY6B 2R2BA 3GKWH 2DL2A 4G6JH 4HWEH 3MLXL 1KIRA 3OR6B 4KK6C 1CLYH 3KWWA 5GGSB 5BQ7B 3KYOA 4OGXH 5T3XE 4FQIH 4OZIE 4EVNA 2QKIB 4PRDA 4KQ4H 1JNLL 4HCRA 1TZHB 3P0GB 4PJAA 3U82B 5ESQB 3SDAB 1KNOA 5L6YL 4HZAA 4O2EB 3KYMB 2X05A 3O45B 3BXNA 1N64H 1KN4H 1UWEL 3IDXH 5F89B 1NL0H 1BMGA 3FQRA 4NKOA 1JYXA 3B8SA 2VABA 3KPQB 2VZOA 4QRPA 1K8DA 3SKJH 4I5BA 1ONQA 3O4LB 1KJ2A 3QUMH 3BPLC 3PIQB 2FHCA 4X80H 2J6EA 3IGAB 3LKOA 3UTSE 3GSVA 2FYYB 3WN5B 5TFSL 43C9A 4CGTA 4DOHB 4KV5F 5BVPH 1QNZL 4OBRA 5EDXA 4JLRA 3M07A 5E9DE 1GGUA 2G9HA 4Y4KC 3QNYA 4NHUA 4QCIA 2DLFH 3O3BB 1QKZH 2CRIA 4WW1A 2IAMB 1YUHB 1NCWH 3ARGC 4TUKL 3IXAA 4HJJH 1ND0A 4OV6F 4NKDA 3HB3D 4XCCH 1IT9L 3H3KA 3EYQC 2RR3A 3MLUL 4EDWH 3FQNB 5I6XB 4UUJA 1ZHKA 2XQYK 4GKSB 4CVUA 5GZND 1MWAB 4KROB 3UBXA 3CMGA 3AY4C 3V4PL 2FIKA 4JZJC 1C1EH 4NYLB 4OLVH 3T77B 3W9EA 1XGRA 3O6LL 2NY3B 2ZUTA 5D7SL 1RIUH 1B88A 3UTSD 1U8PA 3SDCD 4UBDC 1KN2L 4KTEL 3R0MA 1I1FA 3MBED 4JM2D 3H9HB 1A21A 2CXKA 3E2HB 3C9NB 1NUDA 1R5IB 1JV5A 1T66C 4R8WH 3F8UB 3QEQB 5E9DD 4GAYA 3VE0B 2NPLX 1O7VA 5I8EA 4AEIL 3CD4A 2AKRB 1BFTA 3VXSB 4ZFZA 5I1AA 2HJLA 1FNSH 4J3VA 3TM6A 1QFUH 4PP2A 4D0CB 4TQEL 4Z7WE 3TEUA 5EN2A 2DYPD 4NFBA 1A4JB 2EDWA 1ZVYA 1BAFL 2VJXA 4N0FB 2AV7B 5D6DA 3QG7L 4KTDH 3CGTA 4Z7NE 1A8JH 1AI1L 2CXGA 2ZCHL 3PNWB 1BX2B 4MQXC 4Q6IB 4CW1A 3I6KA 5JDSA 4R90L 3CNKA 3H0TB 1R5WB 5CSZB 1CGSL 1T2XA 1KG0A 1DEEA 4H0HB 3DV6A 1DQDL 1F58L 1P69B 1OPGL 2IG2L 5GRVK 2D2OA 5F21B 5FYKH 2OL3B 3VGBA 5HI5C 1S7XB 1G1CA 2DQGL 1G7QB 2XN9B 3MCKA 1PZUB 2JK5A 4WI9A 3MJ7B 1QFWH 2F8OA 3DX6B 4N9OB 5I1KL 2BNUB 4NBYB 5SX5H 3RL2A 1N8ZB 3GI9L 3OKKA 4P2CG 2F8VA 3RWCA 3MLVH 1J7VR 3BAEL 4HUKB 4PG9A 1EEYB 5I1GL 4FFYH 4Y16C 4HPOL 3HAEH 1IGIH 1J0HA 5CJOL 2N7AA 1JWMB 2P49B 4MD0A 4PUBH 3N9GL 3QRFM 4EZMA 4P2OD 1CIDA 4J3OC 3VFUA 1PYWB 4AZ8A 3OXRB 3V5DB 3AVEA 2YZ8A 3D3VB 3SGKA 4W4OC 3BQUA 1UACH 4Q0XH 4FN0A 4PREA 4XCNB 5AZ2L 1D3CA 1UXWA 3U36A 3LVEA 3BIKA 4HX1B 5KTEL 1MUJB 4XNUH 4PJHF 1G6RA 3NCJH 3ESVF 1IGTB 2X4NB 3N85H 5EZOL 3IDMB 4HWZA 3B9KA 4LLUA 1MIMH 2W60A 3BHBB 1U2CA 1IGFL 3EYVA 4EUPG 4OKDA 1LD9B 1XF4B 4P3WA 3GRWL 5E6IC 1FNGB 1QLRA 4NO3A 2ORBL 2BSED 4ALAL 3RPIB 5D2LA 5C0CB 1KJMB 3W81A 2EXYC 4ZOEA 1AE6L 3NABL 3O3UN 5LAXA 1GGBH 4NZJA 1JHLH 4LDEB 2UVEA 4Y19E 2WLZA 4BH7B 4KRPB 3WS6C 5CZVL 5DHVH 1EZVY 1X5GA 2JJTA 3KJ4B 3OJVC 4JHAH 4NOFA 4ZUTB 3FB8A 1MVUB 3QUZA 4G9FA 2FO4B 4LU5H 3HKFA 1AFVL 3MZGB 5IB5B 4GO6B 1MNUH 3BGFC 2UZXB 2V17L 2YPLE 2VLKE 5F3BA 2VISA 4ZAKB 5TE4H 1JGUH 1OTSD 3V4UH 3C6LC 2XKSA 3TVMA 1ZA3A 4P4KC 3WLBA 4KKNA 1M05A 3PL6A 5ISZB 1E6JL 1JPTH 1MEXH 5D7JA 1J1XH 4K8RH 4X6FB 4I2XE 4U1GC 5IQ7H 5HXMA 4IOFC 4M6OL 1KCLA 1S9WB 1FYTB 1KCUL 4FQHA 1AC0A 4RSVA 1IAMA 3SE9H 1QR1B 4NQEA 3HI5H 1T1ZA 1W72L 2H45A 4JFXB 2E7MA 5BXFA 3HZMA 2VAAA 4MCZA 2Y25A 1J0IA 1HXYB 5C0BB 3GMPB 4OKVA 4HJ0C 1KSRA 1X5YA 5F9OL 4FZEL 1CLZH 3FN0H 2YPLD 2VLKD 3PWJA 3QDGB 4LCWE 5GPRA 3CLFH 4HV8A 1XCQB 3RVWC 1TTGA 3ZDYF 2GEEA 2BRQA 2R56H 3BUYA 4OQ1A 3QEGH 3CXHK 1MHHA 2V2WA 2YC1B 4NO5B 1SJEA 1FNEA 5IROA 4HPYL 4CU8A 1V7NL 2FSEA 1VKXA 1P53A 1INEH 3H9SD 1PDKA 2V9QA 4HEME 4JHBA 1Z5LB 5ADOH 4KPHL 1HE7A 3DO7B 3DYMA 5DT1H 1FZJB 3B5TA 1NGYA 4NJAH 5JZ7C 5ITBH 5I1LB 4LKXA 3BUTA 3RAJH 3OAZK 5IVOA 5J06A 4WFFE 1IC4H 5D8JL 4TSCL 3P40A 1JZ5A 1OTTD 3UYRH 3FB6A 4G8FB 4PJ8B 3SCMA 5ACZB 5C9KA 4Y4HD 5DTFA 1INQA 4OUOA 1IKFH 1TJGH 2W9DL 4X5XB 4J2XA 5F96H 4LCWD 2EDHA 1Q0YL 3HFML 1X5ZA 4NZDA 1BQUA 4XBEH 3QUXB 2I60H 3KDMB 4RDQG 4F33A 4OCYL 3G5XB 3ULVC 3QIBA 5B38A 1QRNE 3EOAA 1DLFL 2GT9B 2UUDH 4TPRH 1JFQL 4FQLL 3GEWB 4RWHA 5EIQA 5AYUL 4OZIB 4X4YA 4HUVB 4L5FH 1MFBL 4LSRH 3WNMA 2W91A 3IRZA 1FFNB 5H2BA 3NA9H 3PQYD 3W11C 3BEVB 4NUJA 3RPKA 1UENA 4ODTH 3O6FC 4EEEA 1A7NL 3SJVB 2ZG3A 4MQTB 5C2BH 1LO2H 1QRKA 4GAJH 4O2FA 4KZDL 4P46A 4WFFD 3MX0A 1LEIA 4DKEH 5C0FB 3LQAL 4M02A 1QBLH 2DWDA 4M61A 2FDBP 4JCMA 1MVFA 2ADIB 4IDJH 3SDCB 4MCYB 1FGNH 1O5DT 2P5EE 3GBML 3MBEB 4JM2B 7FABL 3BT2H 5EO1B 4X98B 1SY6L 5CINH 2VLLB 1CE1H 5E9DB 4RFEB 3REWB 4LKCA 5JA8B 1BF2A 1D5MB 5DRWA 1EGJL 4BKLA 2OS7A 1T83C 5C0GA 3LS4L 5T1DH 1LWRA 3JWOL 5GJSL 1G7HB 1MCOH 4KDWA 1KENL 1MH5B 3EFFB 1DN2A 4R6UA 2V2XA 3G6JE 4U3CA 2BOCA 1PGRB 2EH7H 2IBZX 3E6FB 1I1AA 5CP3A 3H3PL 3ABZA 4HFUL 3WFEL 4LNRA 4NQVA 3LB6C 3I3EA 5GRWA 1JMZA 2J2ZA 5D1XA 1DBBH 2X89A 2IH3A 3TFKC 1DDHB 3NZHL 3BWAA 5AAMA 1ZLWH 1BM3H 5K9JH 1LP9F 4J3XA 3RKDD 4P5KB 2GI7A 4JN2B 3AROA 1A6AA 2JELL 5DUPH 1VFAA 4U2ZA 3MRMB 1IAIH 3L6FB 5HGDA 5EBGA 3PWNA 1AP2A 5MI0B 5JMRA 3UZEA 4OZ4A 1V5JA 4Z0XA 4QRTB 3BPOB 2ICEA 2P4AB 1H5BC 1T04B 4PLJD 1RVFL 4P4RA 4GUPA 4RMRA 2SEBB 3X11A 4PJBE 4N0YL 4WWKB 3P11H 1HNGA 5IIEB 3S9DB 5IM7A 2VZSA 3CFIC 3MNVB 2FGZA 2J6EH 4XXCC 1Z9SA 4XVJH 4OLEA 2DQCH 5DQDL 5LG1A 3QFJE 4DKDC 4U1LB 5IEKB 4TYUA 4Y5YB 2QQLH 3KR3H 2IPUG 1YEIL 4CADB 3O3AA 3MRHB 1YEFH 5D1QC 5DZNA 4UV7H 4XNMA 3T3PF 4X5LA 3UC0L 3IAGC 4TUOB 4O2CA 3FQUA 5ELIA 5IK3B 3RWJB 4P2OB 2FX8L 3U46A 4M93B 4DFHA 3L3DB 1FBIH 4XPBL 1JYNA 3U9PH 3I3BA 1LO5A 3VD9A 2I9LA 2CKBB 4OF7A 2ZKHH 1PKQA 5BS0D 1XGYL 5TH2B 4PB0L 3O6KL 3HCVB 3HS0B 4U1HA 3RVTD 3RZCD 4R0LA 2AS5M 3NN8B 4WW2C 3DOSA 5HYSA 1T2JA 3QJHA 2XG4A 1J86A 1FVEA 2IGFH 2OI9C 3IAPA 4WHCA 5JW3L 2IJ0C 3FO1A 1TCRA 2ADFL 5GGTL 2V7HB 4G8EB 4JY6B 1YQ2A 4KGLA 4NQDB 4WV1B 4FXKB 4ZS7L 3QFJD 5J13C 1BIHA 5CZKA 4JPVL 5DD6B 5C7XL 3CVHB 1JPGA 1OGAE 2JKXA 4OFYA 2J8UE 2YN5A 2OSLA 1NBYB 5C07D 3KXFD 3RBGA 4LGPB 1MJUH 1M7IA 5D71H 3FCTB 1WF5A 4KZEH 1ZS8B 3FMGH 5F7WC 4D8PA 3OSKA 5ALBL 4KKAD 2X9XA 4KVCH 5LKNA 2MSPA 3RTQC 3G5VB 2IH1A 5BW7C 3HG1E 2EXWD 2D7TL 1HIMH 4MJIE 4MB4A 4QY8B 4UB0L 5E0QA 5T5FL 2XA3A 3QJFA 1LE9B 5EPMB 5DUBA 1OM3L 3NFSL 4BK5A 5CGMA 5HGHB 4QWWD 1AO7E 1D5ZB 4MAYB 3QDMA 1KUMA 2HJFB 5DD0L 3DHMA 3V4VH 1WZKA 5C0AE 4NC1E 1S3KL 3LD8B 2WSKA 3FOMA 5JORB 4HGWB 1MCBA 2AI0H 2NW3A 4BFIB 2JLLA 3CFEA 1IRAY 3IKCA 4OZFA 1U3HA 2PUQT 4P9HH 3UPCA 1JVKA 2G5BA 1OGAD 3VCLA 4QHKI 1NAKL 2F19H 3TA3A 5KVEL 3WFCH 3Q3GB 3IS0X 3SBWA 3U6RA 4Y19B 3T0WA 4UU9A 4OGAC 3LZFH 5ENWB 1HOCA 2R0KL 1OAYL 1HHIB 4OV5A 2AP2A 3MREB 1S7WA 3HG1D 1N0XH 1DUZB 4MJID 4BZ1H 2YPLB 2VLKB 3WUWG 5LGJB 5FM4A 4HUMB 1XGPA 4JREB 1EVTC 2AJUH 2A73B 4H20H 1AO7D 3NGBB 4MWFB 1OWRM 5GS3A 4FQJL 5CEYA 5I30H 1DEDA 3MFGB 3CU1A 1KTLA 4I9WE 5C0AD 3TZVA 2FEDD 5EZLB 3IDGB 3MLRH 5D70L 5HYJB 2JB6A 1U95A 4PJIA 5L2JB 5E2VL 4M7LT 3QQNA 5A43C 5K9KB 1DBAL 4UQ3B 4I2XB 2VQ1B 4MA7H 4PV8B 3VI4E 1YDPA 4M6NH 4MNGE 5DI8B 2YUWA 4K3JL 2X4QA 1IGJB 1NCAL 1FHGA 4V1DA 5EO9A 3KLDA 3GMMA 4OLWH 4PLKC 2HLFC 4D2NA 2VXUL 3HMWH 3HR5B 2ZOKA 1UCBL 2EDXA 1UKTA 3K2UL 3HZKB 5FGRA 3N0PB 4H8WH 2HTKC 5IBLC 3MODH 4Y4HB 3DARA 5ICYB 3EO0B 4QF1A 4XP6L 4Z95H 5B22A 5IVZB 1HYSC 1MHPH 1KCRH 3AS1A 4KMTH 3ZTNL 2P43B 3AMKA 3SGJA 2CR3A 5AEAA 4R9HA 4K8RD 1XGUB 2P8LA 2OQJB 4HC1L 2FZ3B 3O9WD 2Z8VC 4NN6B 3M1BB 2JCCA 5T1KB 4I9WD 1ES0B 1NAMB 3PP4L 4G3YL 3DSFL 2GJ6A 2E6PA 1A3RL 3NFNA 3WL9A 4UINH 4J3WA 5C0NC 1OW0A 3MCG1 4GBXC 5HHXH 3DROB 4WHYH 3OPZL 5DK2A 3QHZH 1CGWA 2XPGB 4PV9A 4G8GE 3KPRB 3G04B 3MNWB 1L7IL 1Q9LB 4TN9A 1MJ7L 1J05B 1TZGH 4BELD 1CFNA 1UYWL 2VN7A 4YHKH 3EW3B 3MLTB 1P7QB 4BSWA 4R97B 1OF2A 3PJSA 5K9OA 3S88L 2OR7A 4UQ2B 5HDBE 2IFFH 2EKSB 2JJSA 3O6MH 2OLDA 4KK8D 1FSKB 3BN9C 5I8OH 3TWCL 1QRNB 1M71B 5IOPB 1JWSB 1RUAL 4QTHA 3IXTB 3DHJA 2Y06L 5HVHC 2G75B 5DEFA 5DLMH 3VW3L 1JTTA 4ZUWB 3WEXA 5TE6L 4PIRF 5D7LE 5C70A 3BE1L 3GJFA 1LO4H 2K3TA 3KLHD 2ADGA 2Y4SA 4K07A 1SVZA 3C60A 3PWVB 4AY0A 1FN4B 4UDUB 4NFDA 3R1GH 1F11A 3QIUD 5GGQH 4AIZA 3WXVL 1ADQH 2XKNB 4G8GD 1L6ZA 1AQKL 2H2PD 1KGCD 3HI1A 3RJQB 1NEZA 5EC1A 2K9UA 4XH2B 5I74B 4D3CL 1A5FH 4MJ5A 2ZOLB 1VGEL 4OF6A 2P5EB 2FJFB 1BFVH 1WT5A 3PHQB 5D9SA 1OGTB 2DI8A 4MVBC 1OSZB 3MO1B 3CSYB 2C1PA 1K4CB 1M7DA 4OCMC 1T0MA 4S1RH 4L29A 4YHNB 1CZ8H 3OR7B 1XF3A 1LEGB 4ODUA 1ZT4A 1VADB 1FYHB 1Q1JH 3QO1B 3H3BC 1A9EB 1T80A 2F5AL 1R24B 4X7DC 4QT5B 2DI7A 4NJ9H 4ONHB 4HIEA 3G6JB 2VITA 3PGCA 2XTJE 5L2KA 2NXZC 2QLVB 4LRIA 3R4DA 1J87A 1IKNC 4JZNB 4HBQA 2GITA 3BH8A 4XMKH 2GJZB 2J4WL 4TUJB 4KUZL 3WIFA 4PJAE 4WI8A 4X99A 3ULVL 2X2YA 4AG4L 1QFOA 4HUWA 4NZTL 3QWOA 4OCWH 3P0YL 5EG6C 3RU8H 2QQKH 1T2QH 4YO0A 3AGVA 1OSPH 1WV7T 1F3DH 2BJMH 2HKFH 1Q9WA 2WUBH 3QWQB 1B0RA 2IADA 3TBYA 3OKNB 4PJBB 1FRGL 1UM4H 3LIZH 3NH7H 3CFKB 2P7TB 4U1IB 1BQHG 1N2RA 3LPGA 4PJ9B 3WO4C 5F7UA 5EOTB 1MHCA 3ARXA 1UWXK 3QFJB 5C9JA 3FFCE 3BIAX 2XTJD 2HTLC 3X13A 4JGMA 4H5SA 35C8H 4QXGH 3L5JA 3DETC 4LFHD 2DQFA 1JHKH 3UYPA 4FFWC 3IKKA 1LEKB 5I8KL 2DJSA 3RY6A 3HC0A 1N5AB 5IMMA 3AU1A 2NY6C 4OD1H 4ONGH 1A6ZA 2YUXA 2H26A 4PGDA 4CVWA 4LGSB 3ARRA 5CP3H 2E27H 4QHMB 1ZLVH 3V8OA 2DQIH 1J8HA 3FB5A 4AYFA 3KYNA 2XZQL 4KJQC 4NN5B 3SDAC 2ZUWA 3FN3A 4Y5XB 4XNQB 5IESL 2VAJA 4DAGH 2J12B 1P4LA 1RIVL 1UB6B 4R4BB 5DC9B 1MAKA 2ARWA 5GZOC 1JI2A 5IG7B 1TCMA 2N7BA 1S9XA 3RUGE 3MXVL 1ORQB 4EQ2A 5TQ2H 2W59A 3WN5C 3QI9A 1QLEL 4HBCL 1OGAB 4WEUD 3MA7B 3ROLB 1DLHB 1AXSA 2AEWA 3UAJD 4XPAL 2IAMC 1NMAH 1ZEAL 4NKQB 1IM9A 5C0EA 1QSVA 4RNRB 4U7KA 2WZPD 2V7NB 4EI5A 1C5DA 4NHCH 3X3GH 2Q6WB 4MJIB 2Q86A 3S35X 4F7TA 2XWBA 4HMDA 5F7DA 4ODWA 1OAUH 3DO3A 3QHTC 4KROC 1IFHL 2A1WH 5GISL 2Y36H 3DXAE 4R7DB 2ITCA 2JCCF 3V5KB 2EKJA 1ZT7B 4JY5L 4TRPL 1DQJA 3QPQC 1UH4A 4KUCD 2NY3C 4UOW0 4G6MH 5FOBA 5DVNA 3CZFB 4JPKH 1SEBA 1UH2A 3QG6A 4OIIL 4LSPH 5E8PB 4JN1L 1RIHL 4ZXBA 4HXAL 4Y8AA 3E2HC 3GSXA 3O2DL 1KEGH 4RZCA 4HWEL 3TH2T 5KN5B 3MRRA 3I2CL 2HAZA 4YHZL 4HK3N 2H32B 4D9LH 2OZ4A 3MRQB 4YR6B 4LSSH 2DMKA 5ILTH 1EK3A 5EU7E 4WNQB 1N64L 3GMRB 3IDXL 1C5CL 1NL0L 3VH8G 1OARH 5JQHC 3DTXA 4NWUL 1PG7X 2YSSB 4LLVA 3SKJL 5J1SC 4NC2B 2MQ0A 4PD4K 4S2SA 3DXAD 3O9WB 3RX5A 3MMEA 3WD5H 3V6BR 2L0DA 4F7PB 4L4TA 2KZ1B 5CJXC 1IGYA 1WITA 3G6AB 4FG6D 1UM6H 2EE2A 2BSSB 1EEQA 4M6ML 1KELL 5BVPL 1D6EA 4FFVD 1U8LA 2FNBA 1R3LA 4N5UA 5FYJU 2DLFL 4YBLC 3HRPA 2VXQH 5EA0L 1XR8B 5IMLB 2X4UB 4MB5A 4YNYB 2BVQB 4RX4D 1JZ7A 1FDLL 3DIFA 1J0YA 4Y8DC 1QVOA 5J6GA 2GSGA 2WIIB 4HJJL 5D2LE 4XT1C 3FTGB 4EDXA 2WMPA 4AQ1B 5EOCH 3VGFA 4I18A 5DGQA 5GRJL 4E9LA 1WK0A 4LRNH 4KI1A 5JDJA 1Y18B 4Z78A 3OL2A 1RD6A 4V2BA 3BGMB 1MCQA 1FNLA 1TJHL 2H1PH 2R0LH 1FORH 3D9AH 2XZAH 4X6CF 1U8OA 5FXCH 3E0GA 3M17A 5IB1B 3U4AA 4ODHH 3OG4B 1ZSDA 1QLFA 3S36L 2J88H 2NXYB 1WZ1H 1DQMH 5HGGS 1G7LA 1YEEL 2B0SL 1EDQA 1G9MH 1MFCH 1KC5L 5E5MB 1II4E 3VRJB 4Q74A 4TVPH 2HRPL 4G8GB 4J1UB 1GZPB 2MKWA 1FNSL 2PXYA 1MRCH 4N5EC 1I7TB 4OCSH 3Q6FB 3ARDB 4WEMB 5ICXB 4NQEE 1V3JA 3C5SA 1NDGA 4Z7QF 4LBEB 3TP4A 4GG6A 1WFTA 3QUZD 4G9FD 4Q9QH 3F7PC 1MFEL 5E8EB 4KTDL 1QFWM 1AHWA 4UT7H 2A6JB 5CEXA 1YC8A 1YEGH 4PS4H 4Q97A 3KJ4C 3TVMD 4Q9RL 1KPUA 5D7LB 3QISA 4P9HC 3PL6D 3J7HA 4QHKJ 1HH9A 3U2SB 2X09A 5D7JD 5FYKL 4BFGA 5E00A 2WBJD 5GIRB 3QXWA 4ZAKC 2A6IB 3QEHA 4YDIL 3VDAA 3GIZH 3QNXB 3MRFB 1LMKA 3PWPB 4HGMA 3BP5A 3DVGB 4MB3A 4WI7A 4RIRA 4U05A 3MLVL 4Z5RB 5F9JB 4NQED 3PWLB 2R9HC 2VMFA 1OAXH 2OP4H 2W0FB 5DMKA 4P3CL 4GRLA 5C08A 5KJRH 3DGGA 3FB7A 5DZOA 1D5BB 3HPJB 3ALXA 1MJ8H 5DRXA 1CXKA 5DYOB 5TE7H 1MAJA 1TQCB 3KPMB 5F9WB 5KZCD 1S7TA 2YXMA 2H41A 5GGVL 4RAUB 3BQUC 4E41A 1FO0B 2R15A 1AGFA 2R2BB 3B6SA 4Q0XL 2F8XC 2DTML 1CGYA 4RMVA 5FECB 2HN7B 1FVCB 3QQ3B 3KWWB 5HHNA 5TJWK 4XPTL 4G5ZH 2NY2B 4PRDB 2DIJA 3G08A 4NCC1 4NWTH 1FZMB 4NSKB 4I0CC 4G9DB 4NZRH 4LAJH 4OSUH 3NCJL 3WXWL 2COQA 3DVNA 2Y5TA 2FX7H 4I4WB 4KQ3H 3GI8L 5GRYA 4MS8D 3L3HB 5LGHL 1BQLH 1KEMH 1K8DB 1R5VA 1WLHA 2YPKB 3IS1X 2Y5EA 1KJ2B 3GJFH 5DJ8B 4ZD3L 5DVMA 5I8CB 3GSVB 3SCMD 3MUZ1 4N8VA 4NPYA 3RA7L 1JHLL 4LLYB 2JJTC 43CAB 4YDVB 3UJIH 4JHAL 15C8H 3HMXA 2G9HB 4F15C 5KSAC 3QNYB 4NHUB 1CT8B 4FOMA 1INDH 2BNQB 3X14A 4WW1B 2HT3D 1EO5A 3QIBD 3WIHA 3FFCB 3ARBB 3ZZ1A 2D7OA 4PJ8C 4U3HA 3MLWH 2H8PB 3D69A 2PTVA 4NM4H 4UT9L 1R0AH 4JO3L 5TE4L 1JGUL 1RK1A 1LDSA 1AQDA 4LHUA 8FABA 4WDIB 2OR9L 3QUXC 4JR9H 2Y9RT 5DD1H 3GIVA 4YGVA 1MEXL 1JPTL 1UKSA 2XA8L 2M1KA 5HDQH 3W9EB 1J1XL 3MGTB 4QXUL 3SEPA 3BZ4A 4P46D 4X9BA 5IKCB 3G6DL 2ZCKH 3U0WH 5FHAL 3UPRB 3U0TA 3MA9L 2V2TA 1U8PB 3TN0B 4YFEA 3A67L 1OP5K 1TETH 2DTSA 2FJGA 1I1FB 2YKLH 3HI5L 4H1LB 4L9LA 3CFDA 3KPOA 4PRHA 5D1ZA 5FB8B 3MOAL 3OJ2C 2R69H 2CR6A 2K7PA 1UWGH 5GHWH 1IEBB 3TYGH 3VI3E 3CFCL 3RUGB 3HE6C 4JAMA 3HUJA 1CLZL 3FN0L 5C0DA 8CGTA 3WNPA 3K4ZA 1Q0XH 4PD4J 4ONFL 1RZFH 4OLXH 1SBSL 3MBEC 4TSAH 4JM2C 1I1AD 2EYRB 3BDYL 3QEGL 2A74B 2ATPA 2MWCA 4IRSA 4WO4A 5IFJB 1X6LA 3FAWA 4P5TB 2NZ9C 3LPWA 2I26N 1RV6X 2HJKB 4A6YB 3PHOA 3ZLQC 1NCBH 1QA9A 3RWEA 1PEZA 5ADOL 4U1NA 1TVHA 3VFPB 2ATKB 1DSFH 5ITBL 4OM0L 3VXQB 2P24A 1PKQE 3DV6B 5MEQB 1MCJA 1L9NA 3DXAB 5MEPB 4Z7VB 1AD9A 2EIEA 3OTTA 4NQTA 4FQXD 4PJ7A 3MBXL 4LSQH 1G7PA 4KAQH 4K71B 1JZ8A 3NCFB 4RGNB 3OGOE 1CQKA 4LP5A 5HHOE 1JJUA 3P9LA 5F96L 2VDPL 4XMPL 5MI0C 2G60H 4XBEL 2I60L 3OKKB 3TCXA 3BPOC 3C5JA 4QGTA 3TYFA 3QA3A 2LFGA 4WWKC 2XT1B 3D2UA 2EC9T 4TPRL 5L0QC 3V6OA 4KKBD 1TPXC 1Q8MA 3F7QA 4ZFGH 5SWSA 1ZHBA 2XRAL 5JPNA 3DMMC 5FKAB 3IFOB 4HLZH 3QCTL 3NA9L 3MR9A 4R2GC 4Y5YC 1PQZB 1DL7H 3VXMA 1RJYA 2GTWB 4F3FB 2ZG2A 2BSTA 4MX7B 4NGHH 4ZO9A 4HUUA 4X7CC 1XF1A 2KBGA 5FM5O 4PTTA 3U36B 2V5RA 4C56E 4P2OC 1OAZH 5DR5H 2QEJA 1TENA 4WUKH 3L3JA 3QFDB 2ZCLH 4M93C 5DRZB 3QDME 3S5LA 3WJJA 2PYFB 3WFDH 4JZOA 5HHOD 3PP3K 5ANME 1FGVL 2QSQA 2R8SH 1CE1L 5KSBE 5ESAA 2H2SC 4H0IA 1FV1A 5EORL 1T6VN 1B0GB 1IVLA 1MWAL 4N1CA 4NO3B 4WFEE 5T1DL 5L88H 4OFYD 4PRAA 1S7UA 1MQKH 2H9GB 3UBXG 4M00A 5MERA 4RRPG 2B1HH 2QSVA 2YPVH 3IDYB 5T1MA 2ICWA 5FGCE 5B4MC 3CMOH 4WV1C 2DQTL 1I3VA 4PR5B 3BP6A 3IJHA 1YYLL 1NBZB 4UIMA 5D1XC 3QUZB 1DBBL 1MI5A 2I5YL 2DLIA 3MRKA 4OF3A 4LEXL 1KBGH 4G80B 1BZ7A 1A14H 2BRRH 5JIHA 4LSUL 2E8YA 5F1OB 3LEVH 3GBNH 4E5XB 4YXKL 4DN4H 3QDMD 4KXZH 4YHIA 4ZSOA 2F54E 5CLTA 1AR1D 3TVMB 1X5FA 2C1OB 3WLBB 4P23C 1M05B 3LN4A 1IBGH 3TV3L 1P2CA 4PJXE 4PJIE 1PKOA 5D7JB 4HHAB 5E2JA 1SEQH 3P11L 2WBJB 1BBJA 1JGEB 1U3HD 3ZDXE 3GM0A 4WFED 1GC1H 4MAYC 1KIPA 3SGDH 4XVJL 2VXVL 4IS6A 5CCKH 4FQHB 1ED3A 4V1DE 5SWQA 5F1IB 5I0DA 4BFBD 3MYJB 4TNWF 1A1NA 1MY7A 5TGBB 3LD8C 4NQEB 2B4CH 4QRRA 1BZ9B 4K94H 2H6PB 3R8QA 5BXFB 3KHOA 4LIQE 5FA3B 1CFSB 3UO1L 3NCYS 2VDLH 3KPLB 3T3ME 1E4XH 3GB7B 4JFQA 4BH8A 4KI5F 1YPZE 4QHUB 2OL3L 2RAMA 2CSPA 5IMOA 2VSDA 4D94A 5EOQH 4Z7VF 5K59E 3BUYB 4KFZC 4L3EA 2F54D 4R0LC 1CGTA 1MHHB 3TBTA 2Z92A 3TZVD 1X5XA 3MJ8B 5EIIB 2IGFL 2W07A 3ECBB 3O81A 1H3UA 4BQCA 4IEFB 4JREC 4NKIH 5IW6A 2D31B 2BZDA 3NGBC 4WU7A 4JO2L 3VD4A 4ZPVB 2C3VA 4V1DD 4DGIL 2VDOL 3V9FA 4ODVL 1MRDH 3ZYIA 5TPWL 2AJSH 1QSFB 2CMRL 4UIKH 3V52H 2P8MA 2F5BL 3WBDA 3CVIL 1KCVH 1A6UH 2QBWA 5DTFB 4KZEL 2VDNH 1EAPA 1AXIB 1CFVH 3FZUD 4JANB 3WHXA 2IALA 3GRWA 3N1GC 5C3TA 1CK0H 1URLA 2Z31B 4KVCL 4G43A 4DN3H 5A3IC 3QIBB 5B38B 1DUYB 2I25N 5FYLE 3EOAB 3HUJF 4K3HA 4IIQA 4OCNC 5FUCE 4RBPK 1U93A 1U58A 1PX4A 1T1WA 5ERWB 5HD8C 4JQVA 1A6TA 5FA4A 2ZSWB 2RFXA 1WWBX 2DM7A 2GJ6D 2QTEA 3T4YB 2WP3O 4MXWL 4O00A 1HCFX 4N0CD 1KIQB 3GBLA 4HAFA 4CBPA 4M7LL 3PGFL 4NN6C 4LSDA 2AI0L 5DJDA 3QO0A 5GS0H 4P9HL 4DZ8B 1UVQB 3L3GA 2DJ4A 3P77A 3L3KB 1D5IH 3TA3C 3WFCL 4YHPA 4U7MA 5B21A 3VD5A 1T3FB 5DURB 4P99A 5JOFB 3WMSA 4LPCA 5EU3A 3LMJH 5DRWB 4YXLH 1WUNT 4WHYG 4M3KB 5FYLD 1N0XL 1F3JA 5HHQB 5FO8B 1U8HA 3ZTJH 3UJTL 2VB5A 4R97C 3CXDH 4H20L 3U9UA 1G9MC 1W72A 5HI4C 5DJYA 3DLQR 2O5YL 4KHTH 1X4ZA 5I9QB 3H7BA 1NGZA 2JJUA 1P4BL 1RJCA 4XCFH 3R06B 5ID0B 4RQQA 2ITDB 2AJZA 3BWAB 2Z91A 3C60D 4URTB 4ODXB 3FOLA 4EUPA 1RURL 4C59B 3MTRA 4O51B 1AGEA 1TLKA 3RIFK 4KY1H 2AJVL 4DCQA 1R3HB 1NCCL 4WU5A 4LNVA 3P4NA 2OTUA 3DSNA 3WUZA 5HGDB 1QHOA 3MRBA 3PWNB 1BGXH 3CH8A 3GMOB 3D6GA 5DDHA 3F12B 4OLWL 4OZ4B 2QSCH 1T22A 3IETA 4ZUVA 3WDHA 1JYWA 3QDHA 3T8XB 3FAXA 4U1KB 4FQXB 1UT9A 4KVNL 4B53A 4GUPB 4PJFB 4NUGL 1HINH 2R0WH 2QADC 2VWEE 3AC0A 5E8DH 5DSCB 5AUMA 4Q7DA 5FM5M 1NC2A 4O4YH 5I74C 5DWUH 1RU9H 4MXQD 4Z95L 1H0DB 5JUEH 1Z9LA 5FK9A 4DKFH 1KCRL 5EBLA 5B39B 4X6BB 5DUMH 1BZQK 4BSVB 5FKPB 1KB5B 1JWUB 4BQ8A 3MV8B 3HMXH 4GW5B 32C2B 3U7AA 5E94B 5DS8B 1CL7H 4O2CB 5IBTL 3WIHH 3D87B 1RZKH 3GSUB 4OB5H 1DJSA 5C09A 3MRIA 4NZUH 2X4TB 5CWSB 4XPFH 2AQ1A 3MGAA 1LO5B 5HHXL 3KPTA 4L8SB 1VEOA 1X5AA 1J8HE 1PKQB 1Q9KA 3JTSA 3ZL4H 4FP8H 1OLZA 2HFTA 4P5MA 5D72L 5JXAH 1RZIB 5DC0A 5DQJB 2DQEL 1PY9A 4F8QA 5HYSB 1I9IH 2P46B 1X5KA 3LY6A 4ZTOH 1H3VA 1A6PA 1NJ9B 2ARJA 5T3XL 4XP5H 3RP1A 1WEJL 5HHOB 2X10A 2UZIH 3NACL 4U3XA 3I02A 1WWWX 4HKXB 3EGSB 3F7VB 1A64A 3JVGC 4JFHE 5F7HA 3ARFB 2AQ3A 3JWDH 1UFUA 3WDIA 4ZOBA 1MCHA 4EN3A 4HK0A 4KDTA 5DLML 1I3RB 1IEAA 4FQPA 2YD8A 5D6CA 1D5XB 3RWFB 4PJ9C 1ZKAA 1UZ8B 2ZUQB 1SY6A 4RWYL 2BSRB 1KFAH 4PTUB 3V6FA 1WFNA 3SY0B 1H3PH 2DOCA 1LO4L 1K4DA 1YEJL 3U4BH 4DK6A 1EGJA 6CGTA 1J9CT 1QEWA 3R1GL 5DFVD 3MLYH 1J8HD 1S5HA 2PR4H 3OKYA 1ADQL 3QQ4B 4IRJB 4LARH 4ZUUB 4NC0B 5CJ8A 3QJFB 1D9KA 3O3DA 4C56B 3JV5A 2DMBA 3OJMB 3ULUE 1W0VB 1A2YA 3AXLA 4JFEB 3WDJA 3MOBH 1T5WA 5C6WH 1QQDA 4APQB 2AJ3B 3KPNA 5CUSL 4P9ML 1BFVL 5ANMB 4D9QD 3MLXH 1ZHNA 5KSBB 2CIIA 4S1RL 1YMHB 3CFEB 4OZFB 1JNLH 3MOQA 3FT3A 4CRPA 1CF8L 3WKNA 4MD4B 5D7IE 1UWEH 4EOWH 1HQ4A 5J12B 3OAUH 4XVUD 4U31A 1FVDA 3Q6GL 3L3IB 4MDJA 2VL5B 1IM9D 3MPCA 3TNMA 4CN1A 5I18L 3UTQA 1FG9C 1S7WB 4NO0B 4K3GA 5DEGB 1XF2A 2KH2B 4R96B 4FRWA 5TFSH 3RWGB 2VSCA 3INUL 1YN7B 1V7ML 2R23A 4QEGA 1OAQL 3M45A 3BVNA 4YZFF 1QNZH 4JQXC 3RU8L 1G7MA 2F54B 3ULUD 3G9AB 5CEYB 3GUTB 4PJFF 4Y4KA 4YQXL 1VPOL 1GVIA 4P2RA 4RFOL 4TUKH 4L4TE 3TBSA 4PJXB 2X70B 4DUWA 5CJQH 1FE8H 2F53A 1IT9H 3NH7L 4POUB 5L8KB 4QHNA 2CK0L 1GCFA 3MLUH 1LHZA 1TMCB 4CDHA 5E2WH 3MNZA 1ZANH 4WI2A 3GMMB 3GMLA 3OKOA 1CE6B 3V4PH 3I6GA 3AY4A 3P4LA 2ZUVA 2VDKL 2CKBL 5A2FA 4W6XB 4HT1L 4JZJA 3O6LH 4KMLB 4PLNC 5GGTA 5CD3A 3OMZA 1L4IA 3EO1A 5D5MA 1MCDA 1JNJA 5I0ZA 4JRYA 1YPZB 3TT3H 1H3XA 3T2QA 4QF1B 1KN2H 4KTEH 4ZPTB 3LKQA 3WE6A 5IBUB 4Q6YA 3DURB 1HYRC 4AEIH 4DUXA 1LK2A 4L4TD 3P9MA 2MPAH 3CVHL 2WANA 1FL3B 5I1DA 3PE9A 4DAGL 4TQEH 3I75B 4PJCA 4H25A 4Y4FA 3CZJA 5CKAA 4I48A 3O9WC 5CJBA 2FCBA 5MENE 2EDNA 4DW2L 1ZLWK 2NY0B 1N59B 3ET9F 4PV9B 2IPKA 3QG7H 1X5LA 4YLQT 1U0QA 5HYQB 1AI1H 2ZCHH 3FO9B 3ZKXB 4YHLL 2CDEA 1F4WL 3MCLL 4FQQA 1YEKL 3HPLA 3VFOA 1CGSH 1NGWB 2IMMA 3NIDE 5K9OB 5HI3D 4GG6E 1DQDH 1F58H 1NMAL 3HNVL 1K2DA 3WHE0 1HHGA 4EI5C 4AM0B 2Q20A 3HRZB 4NHCL 4QTIL 1K6QL 2YD7A 4HZLA 5F8RC 1KF9B 5HPMA 3G5ZA 4QOKE 1NFDA 3X17A 2YRZA 5DRNB 4HJGA 5DEFB 1OAUL 4XX1G 4Z8FH 5I1KH 2A1WL 1S7QA 2Y36L 1Y6NR 3GI9H 5KSBF 1Z2KA 2D03L 2ADGB 4G42B 5EU5B 3BAEH 4LL9A 4L8DA 5FO7A 3C60B 3TC9A 3DV4A 5I1GH 4PJGE 4G6ML 2Q76B 3ZSTA 5MEND 4HPOH 4Y16A 5CJOH 4GKZA 3CFBA 2PXYD 3N9GH 1MELA 2CLZA 1P1ZA 4HIIB 1NEZB 3PV6A 2NYYC 3OZ9H 3RNKA 1WISA 1ORSB 4MJ5B 2NXYC 4LQFH 4M4PA 5C0JA 4D0DB 3MACH 4W4OA 1GOHA 1MLCA 3I9GH 5C08E 1JMXA 2DM4A 4ELKB 1BJMA 4OCRH 1SVCP 2C1PB 3C8HA 3UTTE 1T0MB 5KTEH 4M48H 1BLNA 1JIBA 5MEOA 1XF3B 2ESVE 2NZIA 2B2XL 4YAQB 3MRGA 1PZ5B 3O4OB 2VZVA 3ARDC 4KRNA 4QOKD 5EZOH 4E41E 1C08A 4XC3L 1OARL 2ZP0T 2VYRE 4HIEB 3RIAF 1IGFH 4QYOB 1Z6JT 3GRWH 1GC1C 4PJXF 1FJ1A 5GS0D 4PJDA 3MXWH 5E6IA 3RVXD 2ORBH 1WVZA 2I07B 2OJZH 1GGIL 2YBRA 3SDXA 3VFRB 3ZDXF 1F6FB 3T65A 4WWID 1UM6L 3NCEB 3WO3B 3ARVA 4LCUB 2B4CC 1AE6H 5HDOA 4K94C 5EZJA 4HUWB 5CZVH 4HC1A 5CS7A 3S7GA 3WS6A 2VXQL 5I15L 5GSVA 5KSUA 1HHKA 1EHLL 1FFPB 4LCCB 1AFVH 1WBYA 3RX7A 5IB2B 1Q9WB 4ISVA 5C08D 2Q87A 5IEHB 3NTCH 3TBYB 2V17H 3FRUB 3T3MF 3TCLB 1BOYA 1J10A 3UTTD 1YPZF 3GK8H 5KOVC 1VESA 3JV4B 1KCKA 1NAML 3PXHA 3VFGH 1I7ZA 3F7RA 3RHWF 2A83B 4Y1AA 1MHCB 3C6LA 4E41D 3WUWA 4P4KA 1L7TL 2EYTB 1AR2A 3C2AL 3FT2A 1E6JH 2WP3T 3BEWB 1JZ2A 1FORL 3D9AL 4L8BA 2YWZA 5GJTH 2V5SA 4JDZA 4K2UH 1TQCC 1GRWA 3BSZH 1N3NB 2V6HA 4M6OH 4ODHL 3QUKA 5F9WC 1ZGLB 4LLAA 4OZHA 4NFCA 4HFWA 1CFBA 3RWDB 4PRPE 1EFXA 5HHVL 3VFSB 1A6ZB 3D0VA 5DQ9A 1WZ1L 5D96C 4PY8I 2FH6A 1W72H 5J11B 1XGTA 5FYJE 3VRLF 2NY2C 4TVPL 3T0EC 5E1AA 3B83A 1MRCL 2H3NB 1PVHA 2P48B 4FZEH 5F9OH 4EUPH 4HKBA 3K3QA 1I85C 3Q5TA 4LF3A 4MZ2A 2LU7A 2APWA 5FHBL 4BJLA 4PRHE 2AV1B 1YYML 4YHYC 4X4XA 4HPYH 3EDJA 1NGQL 1V7NH 2CDGB 4KKCD 3C5ZA 4ZQKA 2EIZA 3U0PA 3JTTA 1YEGL 4KPHH 2Y6SD 4TSBL 3BW9A 3FQXA 4I1NB 3TIEB 1PLGL 1NANH 1HILA 1AIFA 1AXSB 2EO1A 1U8JA 3ARBC 3EYFA 4G6AD 2R1YB 5D8JH 5ICZA 5GRZA 4TSCH 2YA0A 5FYJD 1RJLA 4GAGH 3IDJA 5J7CC 5KVMC 5J0BA 1U8MA 5SX4H 3GIZL 5CAYB 5EUKB 4PRBA 1OQOA 4ODWB 1MCNA 4XXDB 3ZDZE 1BWMA 3S96B 4YIQB 1Q0YH 2FGWH 3HFMH 1K9TA 2QSTA 4X7EC 4QNPF 2ITCB 4P2QA 4PRHD 1OAXL 4PJ7E 2OP4L 4HKJA 4WVRA 2HA1A 5D1ZD 2BHUA 1DLFH 4X0KB 5FOBB 3E3QE 5H37H 4HULB 1JFQH 4DTGH 2VDML 4FQLH 5AYUH 1MJ8L 1WZMA 5FF6A 2GY7B 2X4RA 3TN0C 3QG6B 1MFBH 1DQTA 3IDUA 5FDWA 4GJTB 5AZEH 1U91B 1N5YL 5EBWA 3D0LA 5D7IB 4JCLA 3GSNH 3VXUE 2UYLA 4NRYB 2PTUA 4IRSD 4WO4D 1A7NH 3O6FA 2HFFA 3MRRB 4KRLB 1QG3A 5EU4A 3V6OE 3D25A 5HPOA 4KZDH 5SWSE 4NWTL 3KNBB 4Z7OE 1A7PL 4XNXH 5E7FA 4HMEA 4L1DA 5DMGD 1RJZB 1NUNB 5J89A 4X6DE 3VXME 1CG9A 1V3LA 2V5YA 4PBWD 3BPCB 5C0RL 5IHUL 2R2HA 5JHDB 4P5TC 2OK0L 4UDTA 5GSRB 1EGJH 1S8DA 2FWOB 3LS4H 2BVOB 3GSOA 1T83A 5GJSH 3HE7A 3K4DA 1IGYB 1U8QB 1AGDA 4MJ2A 3TIDB 3ZE1E 5EB9A 3W5NA 4XB7A 2NMSA 3K1KC 3UJIL 4IJ3B 5I73B 2FD6L 4BQBA 4OQTL 1UCTA 1LK3H 4HFUH 4PYGA 1MAML 1TQBB 3STZB 2EH8L 1C12A 4HS3B 3IFNL 3NZHH 4JGUA 3VXUD 5J6GB 3ZO0A 3D2UD 2E6JA 2GSGB 4K71C 4OFDA 1AKJB 5ETUB 3QDJA 2NTFB 4R7NA 2GQHA 4RGNC 5SWSD 3TH3T 1OTUD 4I18B 4Z9KB 5J6HB 4C57C 1NANI 5FYKU 1K3IA 4JR9L 3VXMD 2NLJB 4JJ5B 1MI5E 5GXBB 3MUJA 4ZFFA 1RVFH 4FXGB 1H5BA 1A02N 2WWMD 5CP7B 1U8OB 3AREA 1S78D 2A0LC 3EJYD 1U92A 2ZCKL 3NCYP 5M95B 3E8UL 1Y6KR 3M17B 4DJMA 1X3DA 4ZSOE 1LE5A 4N0RA 1TETL 1NMCC 4XXCA 2DLHA 1KJ3L 4OF5A 5DQDH 3JWDC 5A2JH 3HNTH 1YEIH 3F5WB 3HC4L 3LSOB 3REVB 5LGKA 2R69L 3F6LA 5GHWL 3NIGE 3VXRA 5MENB 4NQXA 3DYOA 2EDOA 4O5LL 5L9DL 2PXYB 3PGDB 4KK9D 1Q0XL 2FX8H 3S97C 4CVZA 1S7RA 1E6OL 5GQBA 1JK8B 1LNUB 3HC3L 3C5SB 3BYYA 3QXDB 4NBZB 4QRRE 1J8KA 4Z7UF 4XAWH 1NGPL 3TPUA 5DVKA 1RUPH 4PB0H 3O6KH 1MI5D 4CNIB 2XYCA 5H8DA 1AHWB 4HKZB 1SJHA 3VWKD 4WJ5B 4WW2A 4PRNB 4YDKL 3O2WL 3FQTB 2BHYA 3A6CH 3VFMB 3IDYC 2FJHB 3BKYL 5JW3H 3FFDB 2YD4A 2ADFH 3QHFL 3O2DA 4QOKB 2FR4B 2R2EB 4W6WB 3ZT6A 3HZVA 2GHWB 4L3EE 4PGCB 3DRTA 4MQ7B 4PB9L 1KPUB 2AK4E 3ZHKA 4GOSA 2W65B 2ZG1A 1WC7A 3CH1A 1IQWH 5IFAL 3O3EA 3VD7A 1KLGA 4KAQL 3W39B 4ZNEA 3OB0K 4PJGB 1RUKL 5FEBA 5I76B 4OZGB 2BVUA 3QEHB 1MY5A 3BP5B 4KJPC 5B3JE 5D7IF 5CGYD 3WFHB 4A2LA 5CBEA 2D7MA 2AXHA 1T7VA 5ESVA 4R26L 5T1LD 2G2RB 4QRRD 1ZE3C 3GJEB 3RTQA 3V0WL 4C83B 2D7TH 4UB0H 5BW7A 1A7BA 5T5FH 3UTTB 3D1MC 2FL5A 3SE8H 1DN0B 2BMKA 1OM3H 3NFSH 2ESVB 3VGAB 1U8NA 1T4KB 5IT2L 2A38A 5DD0H 2XTLA 4GRWF 3VXNA 2AK1L 3QRGH 4XCEA 1CD1B 1S3KH 4L3ED 3D18B 4WFGE 1P9MC 4XNYH 1DFBH 2AXFA 4F57H 2AK4D 5J1AB 4F7CA 5HHNB 4ZUSB 4JEGB 2OR8A 2Q8BL 5BRZB 1OAZL 5JIPA 1C16A 3LRSA 4KKLD 3IFPB 5GGVY 5KW9L 5KVEH 5KS9A 4NT6B 5I1CH 5EC2A 4BFEA 1JRHI 2UWEA 5H35A 1FCCA 3LKNA 1CFTA 1WAAA 3O0RL 5J3HD 3GHEH 4ZO6A 2UVFA 1S9YB 4LEOA 2B1AH 1E4KC 2R0KH 1XIWC 1OAYH 2DQUH 1I8LC 3T0BA 5DJ6B 3BISA 5KG9B 4N9GB 4MJ6A 2B1HL 2GK0B 1VFUA 4RFNC 3VFVB 1UQSA 5D2NE 3IF1A 4ELMB 1CGXA 1G1YA 3K81A 1Y0LA 1AC6A 3T0AA 4FQJH 4WCYL 3VH8A 3X14B 2ZSVA 5INCA 3TBWB 1A14L 5D70H 3MZTA 4L3AA 2WAHA 4O58L 1AGBA 4LOUD 5E2VH 1MJJA 3M8OL 2EDTA 2ICES 1CVSC 5JR1H 1I4FB 5IMKB 3RJDA 3B2UD 3V5HB 3SE3C 4BK4A 3TJHD 1KULA 1RK1B 4YC2B 1AQDB 3BP4A 2YMXH 3NA4A 1TNMA 2Z31C 4K7FA 4PRPB 1IBGL 2OTWA 1BVLB 1I8MA 4MSWA 1WBZA 3O8XB 1I7RA 4NN7B 2IANA 3C8KB 2ZUUA 2VXUH 3MV7E 2APFA 1I1YA 4I0KA 1UCBH 1H15A 3K2UH 1GC1L 1YNTB 2VIRB 4GW4B 1QSEA 3QIWB 2R1XA 5JLZA 2VDQL 3BZDA 3LKPB 2DICA 4TNVK 3IVKA 4XP6H 2FJGB 3W9DA 3DX9A 3T0VA 1TJIH 3MROA 2EDFA 2B4CL 3VWJB 3ZTNH 2K7QA 3QUYB 3CFDB 4XVSH 2EYSB 4K94L 4HC1H 4OLZL 2HVKA 3MRLA 2XWTA 3EJZD 3L7FA 2NY4D 1Q72H 1ETZA 1TZIA 1K3ZA 3PP4H 4JAMB 5C0DB 5EUOB 3DSFH 4EBQL 3D85A 4J4PD 4IRZH 1X4XA 4M03A 4JM4L 4DKAA 3OPZH 1U8KB 4WO4B 2XICA 4MHHG 4WUUA 5F1NA 2NY7L 4OZGF 1L7IH 5MP6H 3CX2A 1MJ7H 4H26A 1WBXB 2PN5A 1QA9B 1S7VA 5C09E 2K1MA 5HGBA 4U1NB 3MV7D 4K7PL 4NKIL 1UYWH 1XCTB 1RAMA 3S88H 2WINB 1TITA 2YRLA 4Q9BA 1MOEA 1MRDL 3ZTJG 2DIBA 4LSTH 1NLBL 1AD9B 2AJSL 4Y7MA 3T1FA 1FO0L 5I71B 1FIEA 4NDMB 4UIKL 1CFQB 1G7JA 3TWCH 1DE4A 1G7PB 2X4SA 5A2IH 3IDNA 4KJWD 1RUAH 3IJYB 3DUUA 3V0VA 1A6UL 4OIAA 2VE6B 2VDNL 3VW3H 3LEXB 4GQ9L 2E3VA 5AWNL 1NC2D 5DJCA 5TE6H 2YEZB 1XGQB 3KPSE 4QXWA 3VDCA 1NH6A 3VRIB 3BE1H 1QYGL 4QRUA 3MRDA 4FMFA 3VXUB 5KVFH 1WFOA 4I13B 4GRWH 2QR0B 2G5RA 3VDBA 1XH3B 3WXVH 1RZ8A 1IAOB 3OKEA 1N4XL 4G8IA 1P84K 1AQKH 5DHVA 5JPNB 3R0NA 1VFBA 5C09D 3RVVC 5DMJB 2GAZA 2XACC 4D3CH 1NDMA 1QTYT 4X6DB 5DJ2A 2BSTB 1VGEH 4JDVA 4XBGA 1MLBA 4N8VG 1FZKB 1ZLUK 3LOWA 3ES6A 1HDMA 1S5IH 2GSIB 2VKXA 1D5IL 3RL1B 4ZYKA 3IU4H 4S1QL 4U49A 1I3GH 4ELMF 3S5LB 5DO2C 4HIXL 1H8SA 5HJ3A 2WLYA 5CHNA 2F5AH 2BCKA 2XNAB 4L8SC 2VXSH 4JZOB 2WWKO 1U3JA 3KPSD 1JZ6A 3LCYA 1IKNA 1F4YL 2HFEA 2P44B 4YXLL 2MHAB 2Q7YB 4KUZH 4LHUG 2HLAB 4Y5VB 1M6OB 3ULVH 4PY8J 4F7MB 3ROOB 1JHTB 1ZVHA 4IBLT 4DQOL 3ALPA 5E8OA 4NZTH 4ESKA 3PDDA 3P0YH 4XCFL 2A2QT 1DQQB 3GSWA 4MNHA 5FO9B 2IBBA 2X9YA 2NY5C 5IW1A 5DJXA 4PP1C 3ZE0E 3MRKB 3ARFC 4JFFE 1AD0A 1BZ7B 1CICB 3VWKB 1T20B 1FRGH 5GGRB 4GKNB 4PYHA 2ZUQC 5DJAB 4PGBA 3TESA 4JFOA 1XMWA 1BGXL 2OCFD 4YPGA 1OB1A 4F7EA 4ORGA 4P2RE 1W8NA 4ODBD 3S3JA 2Y7QA 2PO6C 3BZEB 3THMH 1CDYA 4IRJC 2F53E 4KK6D 3EJJX 3MV01 1HINL 4LVNB 4JKKA 3MSPA 5EUOF 3CDGB 3FQWB 5I16B 5I8KH 4U6YA 4A6YL 4X4ME 3RWIA 4XZUA 1CCZA 4XNZB 5DWUL 3LAFA 3OXSB 2VL4A 2HVJB 4DKFL 1ED3B 1G0YR 1M4KA 3B9DA 2HG5A 4APQC 5DUML 2GKIA 2X4OB 5T1LB 1H8NA 1A4KB 3NVQA 4QRRB 2X5PA 3OR6A 1YY8B 1XEDA 5GGSA 4JPWL 5BQ7A 4PJEB 4Y2DD 1MF2L 4JFFD 5H94B 5D5ME 1TZHA 4BH8B 4L3CB 3B43A 1W0WB 5ESQA 3SDAA 4HIHA 3VMOA 5IESH 3D39B 4XPFL 1EV2E 4O2EA 3KYMA 3ZDZF 3X12B 4NQCE 5F89A 3JV0A 1FLRL 3F6IA 4HG4K 1CDBA 1RIVH 4LVHB 1H8OA 4L3EB 3C8DA 1A3LH 3KPQA 3ZL4L 2ADJB 4KU1A 1RUQL 2AK4B 4XWOC 3TBTB 4Y4KD 4ZFOB 4M8VA 4FP8L 1NBQA 3HI6L 5L7XH 3O4LA 4P2RD 4FXLA 3MXVH 3PIQA 3EDEA 4G6KL 3ARGD 2F53D 1L6XA 1CD9B 2FYYA 3WN5A 3A0OA 5TF1L 4XP5L 5SWZE 4PJHA 3EYQD 4PJCE 2QHRL 3SE4C 2UZIL 6FABH 4U7SA 2C3VB 4XPAH 3O3BA 4K55A 2CPCA 5E08L 2IAMA 3JWDL 1RK0A 1YUHA 3VXPA 2AJYH 4MXVF 2AJXH 2NY1C 1VACB 1AXTL 4E42B 3C2SA 1PG7W 3MRPA 4BZ2L 3S37L 4U2YA 4U1MB 5DD3H 1EAPB 3FQNA 4X6DF 2E5EA 4GKSA 4JRYD 3WHXB 1H3PL 1YQVL 3EYSL 5K33A 1MWAA 3U4BL 4UBDD 4WEBL 4GW1A 1ZHLB 3KHQA 4JY5H 4TRPH 3OAZH 1G0DA 2CIKB 3O41B 1T66D 2MMXA 1D6VL 3T77A 1QSZA 2PR4L 3SDDB 2V5TA 1VB9A 1GZQB 2AAVA 3VG0L 1JTPA 3KPPB 3ZE1F 5J1TC 1I7UB 4P0DA 5I1HL 2RFXB 4OIIH 1WICA 1KJVB 4TTDD 3CK0L 3RBSA 4H88L 4JN1H 4HXAH 5SWZD 3MOBL 3O2DH 2DD8L 3H9HA 3TO4B 5T3ZE 3C9NA 1R5IA 1DP0A 3I2CH 3VE0A 5B3NA 4YHZH 2EIBA 2Z8RA 2FX9L 3VXSA 5IB4A 1A9BB 2HWZH 3AB0B 3OAYK 4MQXD 3U4EA 4LVOB 4HH8A 4X7TB 1C5CH 4EOWL 4NM8L 4D0CA 3OAUL 5D2NB 4WENB 2MCPL 1A4JA 4NWUH 4GAFB 4I3GA 4KJYB 3GNML 4HMCA 2PCPB 2NY0C 1MCSA 3MV9B 2E9BA 4N0FA 2AV7A 1JPFB 3ZKXC 2VZ1A 5F1KC 2PF6A 3OQ3B 1CQYA 3EO9H 1F3JB 1BX2A 3PXJA 5HI5D 5CJXA 3ZKSD 1YECL 4M6MH 1KELH 3H0TA 1R5WA 3U1SL 5DJYB 4LQ1A 1K5NB 1NGZB 5EA0H 4PJDE 1NPUA 1FDLH 3NIGF 2Z91B 5T3ZD 5LQBL 1EZVX 3SDXE 2MFNA 5CJQL 1J11A 1FE8L 1KPRB 5FUCC 2OL3A 4BSJA 4Y16D 4M4RA 1AGCB 1FG2A 3MV7B 5ITFA 2WBKA 2XN9A 3FL7A 1V05A 2OTUB 3WNNA 3BKML 3MJ7A 5GRJH 3VFWB 5I1IL 5E2WL 5GGUA 3N1PC 1ZANL 4RRPA 1N8ZA 1JZ4A 5DDHB 4LASH 1T22B 3I6LE 7CGTA 5IVXF 1P84J 4PJEF 1TJHH 2EIDA 3QZWG 4BM7A 2E7HA 2VUYA 3HZYA 1JWMA 1BEYH 1F4HA 5F9DC 4M8QA 2HMIC 1FNHA 3TT3L 1NC2B 5F44A 3VFNB 1X9QA 4W4NA 3NOIA 5EBLB 4U33A 3S36H 1PAMA 4J8RB 2FB4L 4J12A 1YEEH 2B0SH 1FC1A 3B9VA 5DMYA 4HH9B 1KC5H 5TDOA 1REIA 3W0WE 4HX1A 2HRPH 4MA3B 1MUJA 1I8KB 2MPAL 2CDFB 4MXQC 1Z9MA 1IGTA 2EXYD 4JFDB 1A7OH 3IDMA 4Y4FC 4JPIB 1EVUA 2DQJH 3BHBA 2Y23A 1NFIB 1MCWM 2P47B 5HY9A 1KIUA 1LD9A 1XF4A 2YD1A 3TBVB 4IMLA 4M6AA 4E0RB 1FNGA 1MFEH 2MTPA 4X9HA 4XB8A 3I6LD 2ERJB 1VFMA 5TQ0H 4YDLB 4X7SH 2HYMA 3TH4T 5CMAB