4X84A

Crystal structure of ribose-5-phosphate isomerase a from pseudomonas aeruginosa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
224
structure length
224
Chain Sequence
HMNQDQLKQAVAQAAVDHILPHLDSKSIVGVGTGSTANFFIDALARHKAEFDGAVASSEATAKRLKEHGIPVYELNTVSELEFYVDGADESNERLELIKGGGAALTREKIVAAVAKTFICIADASKLVPILGQFPLPVEVIPMARSHVARQLVKLGGDPVYREGVLTDNGNIILDVHNLRIDSPVELEEKINAIVGVVTNGLFAARPADLLLLGTADGVKTLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Ribose-5-phosphate isomerase A from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
molecule keywords Ribose-5-phosphate isomerase A
total genus 77
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4x84A02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x84A01
5IT0A 1YGYA 2RI1A 2WU1A 2QMWA 3DHWC 1FS5A 2FGCA 3BXEA 2J0WA 3DHXA 3LWDA 3OFEA 2QSWA 2RQMA 1Y89A 3CEDA 1HOTA 2BKXA 1LKZA 4L4YA 4L51A 2F1FA 2KO1A 2MDAA 3AB2B 1HORA 1U8SA 3L7OA 3BXHA 4L5JA 1YBAA 3S1TA 4TM8A 1UJ4A 3TUIC 3KV1A 1DEAA 3U7JA 2PA3A 2LVWA 3W7BA 3E7FA 2R5FA 1O8BA 2JOQA 4X84A 2BKVA 3NRBA 2DT9A 2J0XA 4GO5X 5FIIA 3OFFA 2I9SA 1FQOA 1VL1A 1PBTA 2RQKA 3LUYA 4IO1A 2P9EA 1M0SA 4NMLA 3ENQA 3E15A 3HN6A 3EFBA 1FRZA 1LK7A 1UJ6A 3IBWA 3OBIA 1RWUA 4R7TA 3IXQA 1JT9A 1PSDA 2P9CA 4GMKA 1FSFA 2W48A 3MTJA 3DC2A 3BXGA 2LQJA 3DDNA 1SC6A 4OQQA 5JJBA 4M8LA 1CD5A 2P9GA 3CH7A 3EB9A 3TUJC 2CDQA 2O0MA 3NWPA 4L50A 4R9NA 3UW1A 3CSSA 3TX2A 2H9ZA 2F8MA 3NZEA 3AB4B 5HJ5A 4GO7X 3HHEA 3OC6A 3KWMA 2PC6A 2GNPA 4OQPA 2ZHOA 1UJ5A 1FS6A 3LOUA 4LUBA 4GO1A 3BXFA 3ICOA 3ENVA 3OFHA 2QRRA 3P96A 2J0EA 3LHIA 2JHEA 5T41A 2DTJA 1LK5A 4TM7A 3K5PA 4L4ZA 1ZPVA 2RI0A 3ENWA 5IS2A 3MWBA 2QMXA 4PWUA 2OKGA 3OFGA 3AAWB 2RE1A 1XTZA 3N0VA 4L5IA 3TUZC 2NYIA 3O1LA 5IT4A 3MAHA 1Y7PA 1KS2A 1NE7A
chains in the Genus database with same CATH superfamily
2C54A 3GLFE 4D9CA 3OHPA 2EGGA 2F64A 4QIHA 2DNQA 3QT5A 3ZBQA 1V3QE 1KVJA 5GOZA 1GXUA 3GBPA 1NOIA 1VSBA 2KN4A 1G98A 5BN3A 2AIRA 2DJIA 1UMDB 1FBNA 1XDZA 5CDFA 4X91A 1RI2A 3L4BA 1NM5A 2WU4A 1R64A 2IWRA 3D3NA 4OU4A 2PIDA 5K0LA 2CXEA 1BY9A 1FU8A 1SXJB 2W9CB 1UKYA 4Y65A 5A8KA 2PZMA 3KLNA 3M81A 4RU1A 4TUYF 3VI4B 3UB3A 1JDVA 2C99A 1SUAA 2F3PA 2XZLA 2R6DA 5CIQA 5D2CA 3G2XA 1RQPA 2XUGA 1LB1B 4IO9Q 2J5RA 3ZHBA 5EMKA 2CB0A 1DC5A 2Y1LB 4YRBA 4FDMA 2EDAA 4DDKA 4W4TA 3CLUC 1VFJA 4M1QA 1WZCA 5IP5A 3ZBTA 3FI9A 3OY2A 3T1YF 2XMKA 4RHXA 1RAAB 3DNFA 3EIHA 2XF2A 1HUQA 1OJLA 1Y81A 2ZJ0A 4KTTE 4DWVA 1FNBA 1Y7PA 5F1YA 3OOHA 1OC4A 3G0IA 2XCRB 2ZBQA 3PDWA 1BD3A 1VIAA 1C7QA 4TKTA 3QNWA 1FJEB 2CEKA 2JBAB 3DLKA 1U8WA 4DL7A 3TGWA 1PJ7A 2CJQA 4FFVA 3RIHA 2DHAA 2WKPA 3S1TA 3UTDA 4MH8A 3K7RA 1JLEB 4R7GA 5BR8F 1RWOA 4HL9A 1X3SA 2AGOA 3TJRA 1JR6A 5D4NA 4GWGA 1GXSB 4EA6A 4GI3A 4AAYA 3QFRA 3FSEA 4YP3A 2J67A 1OY1A 1FJXA 3MMXA 3L9XA 2EVZA 4KX3A 3NHWA 1GZHB 2VS1A 5KG6A 3LT1A 3ZJVA 2IYUA 3WLPA 2FP3A 5IEJA 3TJMA 4HNTA 4XSHA 4IH7A 4BP3A 2PGIA 2VBWA 3BQ9A 2XVAA 1SIOA 4I9GA 3BIWA 3HCEA 3QMVA 1KYVA 3IKLA 3U4AA 1GUAA 2PL3A 8AT1A 4QDKA 1JZTA 4AM8A 4DXHA 1I3KA 1LWXA 3WYBA 5ICSA 3CLRD 3EPGA 5FBLB 3K6JA 3J7Z5 4AJEA 3RGGA 2QLXA 1Q1KA 4HDMA 2JVJA 1C0TB 2FN7A 2EG1A 3I5BA 1EFVB 2JFOA 3A9CA 3GW8A 5J2TB 5AE1A 3DTTA 2JL1A 2KFNA 2JAUA 2OLEA 4YBZA 1T35A 2MGZB 2I99A 2BKPA 4AJJA 3DFIA 3CW9A 3JSMB 2ZATA 1AT1A 1QIGA 3FN4A 3ROZA 4P3YA 2CHGA 4GVXA 2AUMA 3BXZA 5LQUA 1JH9A 2I6SA 2QR3A 3O3MB 2AHOA 1QUPA 1I80A 2SBTA 8ATCA 4ND2A 2IYNA 3WL3A 1BCSA 4GMFA 1U98A 2PCJA 3RW7A 2AG6A 2Z4PA 2YOHA 1E7WA 1FLAA 2ATEA 5F5LA 4PEVA 2QVCA 4MX8A 1OWMA 4J9QA 1HNWJ 4Q66C 4KGKA 2V6AA 2HW8A 2DUWA 3N53A 1B0ZA 2QYCA 4QTTB 3K72B 2JLFA 2OPRB 4BVKA 4B83A 3GP8A 5BQOA 3N6NA 1TVRB 4Y1RB 4I4BA 4ZQCB 2HFVA 3IUSA 2JRLA 3TZBA 1U24A 3OESA 4G07A 3I5UA 3LQVA 4HHUA 1CJVC 2NO9A 2E87A 1SUFA 2J6SA 1YQXA 3RAFC 3MPOA 5DSXA 4JXJA 2BJWA 1NLMA 5CAAA 2YMPA 3SMVA 4CFZA 1KWKA 3FVQA 4AJ9A 3BMQA 3D8NA 3P2YA 4CDRA 5CLFA 3ZHQA 4M5KA 2XULA 3MC1A 4CMIB 2BEVA 1L1RA 4OHOA 1U0TA 1XX6A 5B55A 1YK0A 3OQNA 3MZIA 1USIA 4RFSB 1VQOS 1FU7A 2O48X 4TYPA 4F2GA 1QIDA 2FQYA 2VUTA 2XB2D 1C3VA 4L6V3 4Z2YA 4XXHA 4TWJA 3EF3A 1HYEA 3JAKB 4UEJA 1ELOA 4RM3A 2UZ4A 4DR4J 1YZQA 2FWJA 2ZJBA 2KT3A 2BKUA 1HD0A 2FWNA 3GEIA 3CC8A 3GWGA 3VR5A 4BTEA 2A1TS 4WX2B 3UC5A 2ZJ8A 3FPCA 2NADA 1ULHA 4INPA 4L8YA 1G8KA 3ER6A 3LA0A 3NG8A 1M3SA 6FD1A 3ZHRA 3Q8LA 1D5CA 2C2ZA 3L7PA 4RJ2A 1DHRA 4GR4A 4BFTA 1AT1B 4TT8A 4K86A 4DMZA 2YBVA 2ORED 3LP1A 2GIRA 2CJBA 1ATIA 3DKPA 1XCGB 4ILMA 1WDWB 1OPIA 2OC4A 3ZQUA 4K1XA 5FHRA 1LV5A 4PIVA 5B36A 2FPIB 2JH3A 3VAHA 4FKMA 2HYIC 3OCYA 4N8OA 3JYTA 3HT0A 1YDLA 1ORRA 4IHQA 5EQTA 1K9VF 4XJSA 4ZU3A 1FPMA 1Y11A 2OUIA 3GX1A 1W5EA 2VUSA 5KTKA 5AXLA 4Q82A 6REQA 2OV2A 3UW1A 5ES4B 4J0IA 3IC5A 5LQJA 2DKNA 2QTLA 4DF3A 4BO5A 2P5YA 4XWTA 4O02B 4XB2A 521PA 1LWCB 2F8TA 4L9AA 4ND4A 1PR0A 4O2LA 1PV4A 3ONVA 5TMBA 4TZ6A 3M8RA 4CG0A 1RUSA 1I7DA 2RBKA 1CBKA 1VFPA 4KPUB 3BMQB 4ZXPA 3LT0A 3R5DA 2ZSHA 3FBFA 4PZDA 2OEKA 1S1WA 3URKA 4LHWA 1CUSA 2QQ0A 1TIKA 1H2BA 2AN5A 4MI9A 3BQNB 3FRZA 2OWDA 2YFKA 3KMSA 2IUTA 1UC4B 4CTKA 4WJZA 1DX4A 4B9LA 1TKCA 2HQCA 4E2YA 1CUWA 3IAUA 3RWBA 2PT0A 3MOIA 3GLHB 2ZYIA 1H6KX 3PQ8A 4TXNA 2Y67A 1J8FA 4OXRA 3U19A 3TSAA 1QYRA 2GQQA 3AEQA 1KOLA 3MTQA 3UNXA 1S8OA 1BHSA 3CIMA 1YJWS 1H65A 1JEYA 1V45E 1JR2A 1DBVO 4PQUB 3JCZA 4E6PA 3X44A 3ZH2A 2VYND 3SEAA 5L3ZA 3G23A 1CF4A 2J5BA 2QMHA 2GJKA 4ENSA 4ZKAA 2ONCA 5DLQC 5J2UB 3V6KA 1GV0A 1QTNB 1S7GA 1SJRA 2Y1GA 3AINA 2X6QA 3BXXA 3DT8A 3TW0A 1GXSA 2IY5B 3W4JA 3NGSA 2ODNA 3QOYA 2CC2A 3A7DA 2HHJA 3R8YA 4HTIA 4A2PA 2BP7A 2IF0A 3FYDA 5J1NA 5FXMA 2YMQA 2A4KA 4B4WA 4JCCA 1NDUA 2DGVA 3GQCA 1KJWA 4CLLA 4YAIA 5EL0A 2O2ZA 1YR1A 1CIVA 1SC4B 4BV8A 3N79A 5E41A 4JI3J 1XI2A 3ILYA 3R6GB 1UJMA 3WIBA 1YVDA 5F73A 4YJGB 4PYDA 4QUJA 2XW6A 5KOWA 3NT4A 4BHTA 1SQ0A 3FYUB 4UBKA 1EKRA 4PX2A 3VTAA 5JISA 2HUNA 3KJFB 4IDHA 1BJKA 1J5EJ 2QIOA 2W4IA 2JFGA 3HGMA 3II6X 1ZUNB 4NE2A 4QCLA 5C7PA 5CHYA 2IC3A 4D82A 5E33A 2X0FA 2OUKA 2QRRA 4FIDA 4MVWA 5D84A 3C15C 3R3YA 3Q15C 5EIAA 3IHLA 3AU8A 4LDZA 2IHZA 1IK6A 1HBOA 1W0JA 1EQ0A 2FETA 2SICE 1KY5A 1L3KA 2FMIA 1T24A 4E46A 3UYKA 3TFOA 2VQEB 3CJTA 3PGMA 4AMZA 1N6HA 2CK3D 4Q9IA 5TF0A 2L9WA 1Q0PA 4KR6A 1G5PA 4QYZK 2J3MA 1RT2B 2ZW9A 4L75A 1WCIA 3VZBA 2W2NP 3UXHA 1FDIA 5HROB 1QPZA 1WHSA 2ZYTX 5HFJA 1F6WA 4CKYA 5LQKA 3S27A 4FM9A 2BH2A 4L4SA 3OPQA 3QBJA 4CJXA 5IXJA 2P5VA 3REQA 2XE4A 2NV6A 2W2MP 2PLFA 3B53X 1OPZA 1GTG1 3BGVA 1W52X 4QFCA 1FCAA 5RUBA 2ZJZA 4OM7A 3PQ4A 1X8LA 1KQKA 1I6JA 4M5MA 1E79D 1KYXA 3L7NA 2TRSB 4X24A 3AB4B 1NN0A 4CL0A 3IKTA 5JY6A 3TQFA 3ZDYB 4EI8A 1E96A 5IQ6A 2PK3A 1UBJS 3KBBA 5JYBA 2N3OA 1P2DA 3ZOKA 4WQMA 1RT7B 2BZ0A 1S1TB 1GQOA 1IHUA 3DLCA 1PAEX 1BKDR 2AC7A 1BDBA 4GM4A 2BE2A 2Q99A 4QU6A 5CD1A 3EWIA 2DG2A 4HX2A 3KHLA 4YN3B 4WASA 4EQ6B 2QSWA 4CCSA 1XRRA 2XCOA 3WYCA 4A82A 4Y2JA 1T1EA 3FDJA 4PR6A 1W87A 3OT4A 3DAFA 5A7GA 1P8JA 4EY3A 1NNSA 4YEDA 4BWFB 4C11A 4LRUA 2PMDA 2WBLC 2FX5A 4YJGA 2NM0A 1S0OA 4DFKA 3RO7A 3C6BA 2X2EA 1BCRA 3CLTC 3OE7D 3UAOA 4DZZA 1NV8A 3VR4D 1C8BA 3AA8A 1ZUHA 1D2CA 1E2QA 3I62A 4F5WA 1NWHA 3H90A 1N3BA 3FGPA 4YB8A 3AHEA 1WRBA 3S7TA 3VALA 4EL5A 2GZ2A 2NZ2A 1IWBB 1US8B 2FSUA 2PN1A 1E6LA 3WK9A 4AZ0A 1E3LA 1TC1A 1Q1AA 3N8DA 3RTGA 1WPRA 4ZEVA 3MAAA 1EFRA 3KHTA 4JP2A 2V94A 3QX7A 1FYXA 3L4JA 1UXHA 4ALJA 2IP4A 1MWZA 1WSRA 4WDRA 2XWJI 4QARA 2V2QA 1M2OA 2BHTA 3S4YA 1LDGA 4OQNA 2G0NA 2DJ5A 2PMZD 4XGQA 4LNUA 1XK6A 2F7SA 2RJNA 3R6GA 1V8PA 3A36A 1G21E 1JA1A 4UM9B 1QTMA 3NNCA 2DD8S 1WHSB 4W98A 1GNRA 4D9KA 2CXPA 4UMVA 3MJRA 3LUFA 3TLKA 3VCDA 1U11A 3F6CA 3KJFA 2FMHA 4Y9TA 3DOFA 1VL1A 2HA7A 4UCXA 4NOMA 1Z4NA 4I7EA 3HLKA 4M54A 1SCNE 3I34X 3HA3A 1XDWA 1DELA 3ZOZA 3M9WA 1D6JA 1NVMB 5B6JA 2G76A 4DSUA 3R9XA 4CEIA 1SXJA 1MRNA 3G3EA 2W9CA 4TWIA 4IHJB 3LC0A 1XJCA 3OEEA 1FWKA 4ETIA 2J9RA 1OB5A 5C8XA 1L7XA 5B12A 1ZD5A 2QTBA 3VSCA 1U0GA 4GKJF 3BYPA 5ITSA 4GRIA 2QE7D 2DFNA 5WRFA 4C7KA 2R2RA 5DX1A 1CETA 2QIPA 4D4LA 2JS7A 1JZSA 3R7NB 1HR0B 3DHYA 3GLVA 4LF4J 4H4OA 3F1LA 3OPXA 3PO5A 1L8AA 2YDXA 1OFUA 4UTVA 1ISMA 3Q9UA 1TO2E 3KKPA 2Q1SA 2RNEA 3HSYA 3ZN2A 4XD7D 1F2TB 1XTKA 3T0GA 1RAHB 2QJWA 2N4DA 4U9RA 1Z2EA 5EIWA 1EBFA 4A8YA 1YDFA 3JQKA 2VJCA 2R7MA 2OK7A 1C0LA 2GGSA 4QPDA 2NYAA 5H5JA 3PHLA 2I0FA 4OI6A 4EO6A 2AB0A 2CPHA 4Y6OA 5EZYF 2XQVA 2ZE2A 4JV5F 2ZGVA 4WGFA 4UBOA 2FHKA 3VU9B 3EGDB 3LDUA 2Q5QA 3ZNQA 4UC0A 1V8BA 3WQQA 2OENG 3WRXC 4XB6B 1MC1A 1QQ6A 1GCGA 5BQFA 1KP3A 1WUTA 3GLGE 4XWYA 4C7OB 3OFHA 2EJBA 5KU7A 5B58T 2FE1A 3HCNA 1NOKA 2R7VA 1VYUA 3OUZA 2WWVD 2QSUA 4DM7A 1GFWB 4G2NA 3DDKA 1V37A 1IBLB 1JLQB 2YBEA 1E9BA 2JGKA 1MAAA 2JGIA 4M5LA 5KDLA 2O2DA 4BLQA 3MFYA 3FYSA 1MIHA 3W3AD 4AKEA 4E2WA 2FPUA 5ALJA 5H3CA 4FQ5A 3QSGA 2NUAA 3SJ7A 1C8VB 3SXUB 5K8UA 4WLEA 2HSJA 5DV9A 5FAKA 2AG8A 2QUBA 3WC2A 2I1QA 2CNKA 1WNFA 4EP1A 3VSDA 3C15A 3PNKA 1IQZA 1FSGA 2GH1A 3GFVA 3KTQA 1JNXX 2AJTA 3KSBC 1PWEA 4MKXA 3UOWA 4P10A 2V7PA 2Z9BA 1M1YA 2A5JA 4QYSA 2XZDB 2Z2XA 2JATA 2Z30B 2QG6A 3DC2A 4OP3A 5A4FS 2ASEA 3IODA 2YN0A 4UVDA 4M7OA 1NJ1A 3ECSA 1HSZA 2GVZA 3NNAA 5IDVA 2ZXFA 5A4MS 4BBPA 3PPWA 1DLOB 4BRSA 2QTTA 4CCYB 5FPTA 2R8EA 3CZQA 3QU7A 4B81A 1M1NA 3M1AA 4B2IA 3STVA 4MJKA 4OSPA 4RNCA 1GMWA 1F8XA 5U47A 4FILA 2HYIB 5SICE 3IM8A 1Z5GA 1W36C 3AL2A 1XEAA 1REQB 3FNRA 1FMTA 1SBHA 1D1QA 5IT0A 1YU9A 4MW5A 2G82A 5MN6A 2IY8A 3UV7A 5HATA 2XNQA 2GVDC 2OV4A 1M1XB 4NULA 4Y2YA 1HORA 3LQ1A 1UIRA 1L4KA 2E85A 3T41A 2BWJA 4YRTA 3FTDA 1QFYA 2MZRA 4MUFA 1N36B 2IXBA 2FMTA 4OYMA 1GUBA 3G8SA 5IKXA 4XI9A 1RU1A 3PFIA 1YC2A 1RWBA 1P6TA 1IOLA 1NJSA 4G5OA 3GSDA 4B3RF 4H27A 5LSAA 2ERXA 4CMCA 1UOOA 3OE5A 4BLRA 2IJGX 4N01A 1M5VC 4J3FA 1I3LA 2ZUTA 4LF4B 4JI5J 1YU6A 1N6OA 3U3MA 5HZHA 1NVDA 4B8YA 1TK2A 1PJ8A 4PSKA 3DMFA 5LXTF 5FA6A 4X92A 2RG7A 5DIZA 3BB4A 4N82A 5C24B 2ZH6A 2YJ4A 3G8CA 3RBAA 1CY6A 2V5HG 1WXHA 4DE5A 5DGAA 2VSNA 4DWWA 4LX0A 2P1RA 1EXWA 2HLPA 2VDUE 3UN1A 2K06A 5FI5A 4BKRA 3T7SA 3MIIA 4C8LA 1ZM3A 1SOAA 4LZPA 2C5EA 1EETA 4RQUA 2UYOA 2GN1A 1SOUA 5ETOA 4P1ZA 4LSNA 4Z4IA 3EGWA 3VA7A 5AJZA 1KMHB 5FOSA 5K4AA 4EYGA 3O8QB 2ASDA 5E9AA 4LF9B 5BQ3A 1EXDA 3MLAA 5HJEA 1J33A 1YZKA 3DZBA 4I2QB 1XRNA 3C3BA 2G07A 3SZMA 4EIWA 2IE0A 4UMEA 2WJJA 5IEBA 2RHLA 4R8KA 2RB4A 1YIAA 2VEDA 1RLUA 1GIAA 3OAAA 2WOMA 4PFKA 9MHTA 3FDZA 4J4TA 3ZHZA 3SI8A 1F8YA 1EVEA 5ALHA 2VG6A 4ALKA 5J63A 5FP0A 3C8DA 2VPTA 2DR9A 2VBFA 3SQMA 4V38A 5D00A 3NIDB 3SYZA 1BN7A 3DBLB 2OFXA 2GHVC 1U5CA 3TL2A 1QRDA 5LMUF 1GNQA 4DIKA 1ND6A 3PGKA 5GAHI 2V6MA 2QG9A 3KJNA 4L08A 4YALA 3ICLA 1VQ1A 3FWPA 3K9BA 4WZZA 4A8FA 1TL5A 3IIKA 2UDPA 2P6RA 3CJ3A 1GAEO 3Q9NA 3KUHA 3EXHB 2HFUA 5JQGB 5L4LA 4KV7A 1HNIB 3NGUA 3RPEA 1A5TA 2J9XB 3SOZA 4NCNA 4DW8A 4ZCKA 3G5TA 3QFTA 3RUBL 1FKPB 2FJ0A 1ZVJA 2XYGB 1TRKA 1N5DA 2JJMA 1U1CA 3QNMA 1JDTA 1XLTA 3UJAA 5LOVA 1Q11A 3KR1A 1YUMA 1RVDA 4OB7A 4UTNA 3FMIA 4QL3A 2R4UA 3I42A 4KFTA 4EG5A 3UMMA 4R5PB 4N41A 1G17A 2EW2A 2C5HA 3WLOA 5DLEA 1IHDA 2W83A 4M6WA 5EZ6B 2WVCA 2AK3A 4IJQA 3NC4A 2QE5A 3B1KA 4D2IA 4HWTA 2HJRA 2DHSA 3OX2A 3IGVA 4PQRA 2JLVA 5L1KA 1CEQA 4IP0A 1UBSB 3GYNA 2HJSA 1Q5YA 1NE2A 5CX1A 3VU9A 3WZ0A 4O1IA 3DKIA 2W0MA 2W37A 3HHLB 1QNFA 5JZSA 3GYXB 3EW9A 1C4CA 1ABFA 3FOWA 2YOFA 2HRDA 3WC0A 4KRFA 3QRRA 3Q7TA 4GM1A 4WZAE 5DYYA 4FZ5A 3LGHA 3DT9A 2GRAA 3BIFA 1WOYA 3C39A 4ABTA 3NP9A 4Z4FA 4ZCRA 3QQ5A 4MW9A 3D0HE 5E3QA 1X7WA 4RL1A 5B30A 3VXKA 2GD1O 3EASA 3THTA 4JMPA 4PR0A 3FSGD 1ZK1A 3GJQB 1ZI6A 1QX4A 4JV0A 2Q21A 5KTYA 1J9EA 4HUTA 4QVGA 5L6LB 1VMDA 3K17A 2XUAA 1URRA 3RFTA 2IU4A 1E2NA 2H7XA 2V3VA 2B9YA 2W9BB 2DK2A 4NQZA 1T2AA 1WPQA 2FVRA 2NTJA 2B82A 3AYXB 5KVSA 1GOTA 1P4GA 5ALDA 3FG9A 3FZ2A 2YVUA 2KT5A 2HIQA 2C3PA 2ZHAA 3N2KA 4BB5A 2ZBFA 3U3XA 4F85A 3GRZA 3WLAA 1IN8A 5IJ9B 4P7BA 4TU9A 4IG0B 4PBSA 5B3JA 4KV8B 1JVSA 3I2IA 5K8MA 1WDLA 2QNBA 3OI7A 3CZRA 2Q9CA 1A96A 3TOQA 3VMFA 1S3IA 2LE0A 2VWHA 5L7TA 5I6DA 4QOTA 2XMPA 5F7XA 5EWMB 5ALIA 4KHMA 3IAS6 3QWAA 2HW3A 1KQFA 1YE3A 1BJRE 3Q87B 1SPBS 2I2WA 3U7QB 4DLSA 5L3VA 1VSVA 4B3TF 2JEJA 1HNVB 3ENNA 2XAAA 3WSTA 4H7EA 2JJ2D 3Q9SA 1L3UA 4JI0F 1YITS 1VHQA 4LIRA 1JHYA 4S1TA 4IKEA 1ORIA 3A3PA 3Q6NA 3GRRA 1PZFA 2X9GA 3BQ1A 1QANA 3G1TA 2ZJ5A 3PNLA 2GZAA 4MLZA 4WVLA 5D6GA 3VVUA 3EXHA 3OU7A 3VPAA 3WGZA 2ZD1B 2K1RA 2WWFA 3CZAA 4K4WA 1PNTA 4OX8A 4MIYA 4OUDA 3FVYA 1OVMA 3UT5B 4CR8A 3ZV6A 2EFYA 1G8PA 2C7VA 5AI8A 3KHUA 1QJCA 2EFEB 4FI3F 3TOXA 2RKIB 3RAPR 1CZHA 3DLBA 5DGXA 4BX0A 4ZHRB 1T11A 1ESNA 1BWRA 4F0MA 4K6CA 4GLFA 5LM7E 2YC2C 2DTDA 1WZ2A 4LV5B 5A0VA 1GNKA 5DOVA 1WVMA 2LV8A 1BVYF 4G1VA 3PPYA 1QLWA 3Q3CA 3HUFA 2ZRHA 4LXXA 1WB6A 3PYDA 2YNMC 4GF5A 3TEJA 5KNBH 3ZGZA 4EL0A 2B7BB 2XECA 4U2EA 3KLHB 4NECA 2DBYA 4LT6A 1FJ7A 4UXIA 2E6KA 1BEEA 4JB8A 2REOA 2CLEB 4P0PB 2RI1A 3TLMA 3PCTA 5JYCA 5K9ZA 1LFPA 3KZVA 2CCKA 3F46A 3N2EA 1ABEA 1BDHA 5EGSA 3NOCA 4J2HA 1XP5A 2Y1DA 4BTLA 3K7EA 4Z5XA 2ZYVX 1R3UA 4MRPA 4BFUA 3PKIA 3K57A 4N12A 4N5SA 1W94A 2PUCA 5LMNF 4KAIA 3VJKA 2YIMA 4N48A 2CLFB 2AZTA 1O5IA 4LTDA 1XDBA 1E60A 5L1IA 3TAXA 3GRCA 2XOKD 2VDRB 5JCXA 4B9NA 1WU7A 2PFFB 1LWEA 5CB8A 5G3ZA 1GQEA 5D3GA 4ZVTA 4X4RA 4QT4A 4MQMA 1NG9A 2O05A 5K8VA 2K8GA 3FDFA 3GLIA 3S29A 2OGTA 3TNVA 1KARA 3N86A 5F0UA 2FZCA 1GZ7A 4C4WA 4LOIA 5AIBA 4I4LA 4AP9A 4R7ZA 5HGXA 1K5DA 4QU9A 2NUPA 1VG1A 3T7RA 2IM2A 2GAJA 5CYFA 4DLBA 2KTQA 1P2SA 4M5NA 3IO5A 3VZSA 1YB5A 4KQMA 4PC6A 3U9SA 3L6DA 4UQPA 1SIWB 5TT0A 1O94C 2CLKB 1S77D 3H2GA 1M5PC 2HLTA 1LDNA 4MI3A 1UZLA 3HFVA 1GTSA 2NZYA 1EB9A 2H2GA 4L07A 4JUBA 1J09A 4AJ4A 3PENA 2VIIA 2IXEA 3QJLA 3ZU6A 1E0AA 1S6PA 2FLPA 4YMUA 3G2KA 1FESA 4PNEA 3IWXA 4DIMA 4IOCQ 2A9RA 4H4OB 3QPVA 1A9TA 3A26A 3LUHA 4CT4B 3OT9A 1VC5A 3RJ9A 1KDRA 5DBFA 3R7NA 2KHCA 2RGDA 4E51A 2CV1A 4B4UA 3HGTA 3BJZA 1NK4A 4DPUA 2ZIXA 1A8SA 2OLKA 1S1UA 5T3UA 2C57A 1ZC4A 1X1TA 2ZE8A 1Z7GA 4C89A 4M1KA 2BJEA 5AFSA 4WK6A 5KIAA 2BGJA 3R1HA 2IPOB 1D3WA 3I2HA 5D15A 3OE1A 3W64A 5DLFA 2FJWA 4P3XA 4YHBA 4CG2A 3VR2D 2XWYA 2IVFB 1UADA 3HSJA 3PYXA 4S0ZA 2CL0X 3RHSA 1TUIA 4WXWA 1DBDA 1NHUA 3PCOB 5ILGA 4CMIA 1I3OA 2FSVA 4P2BA 2WU0A 4K2XA 3IGFA 3FBCA 2YVKA 4IJ5A 4OGLA 5C1IA 3DTVA 5LLDA 1RA6A 1RIIA 2R9LA 2FX3A 2Y1OA 4RL4A 3WV5A 4JI8F 3X2EA 4KKVA 3RVBA 3UAYA 3RFVA 2W98A 4QSHA 4XYLA 1TU0A 6CHYA 2YNIA 2D1RA 4ZZ3A 3KZ1E 3O03A 4YC7A 4I5EA 4DX7A 1H6DA 1Y8QA 2EG2A 5F5NA 1C7IA 2W4MA 3KAJA 2CJFA 2CFCA 2QUAA 4PO1A 3BB1A 3A04A 4I2PB 2WILA 5HXAA 4C22A 1BS1A 2WTUA 1T5BA 1FDVA 3GPIA 3WDKA 1N0VC 1EU1A 2VJMA 1WVIA 4KMMA 2IIQA 2UUAJ 5P21A 4DSNA 1ISGA 4H4EA 4OQZA 2GFIA 1R6UA 4Q44A 3P6YC 1WJGA 2DBRA 3LLUA 2PD3A 3LBIA 4A9AA 1H2HA 5IH7A 4C01A 1DIRA 4EJ6A 1E1NA 5GADI 4NI2A 1B1AA 2XHCA 1SG0A 2BTEA 3PHIA 3BF4A 1U4BA 1LRLA 4WZAA 3OXLA 1XEXB 2QLFA 5AW9A 2XZDA 1QHSA 4MP6A 3KOZA 2JRSA 2H3EA 4BX9A 5HKKD 3AI7A 3DBOB 5AM2A 5D87A 1DTQA 1UAGA 4QXRA 1U6KA 1DJ0A 1JQ3A 4PLPA 1UXJA 5IC5A 5JW6A 2MHEA 2WNHA 2QP9X 1KC1A 2ZREA 4I4CA 5B57C 5JADA 2KJQA 1J22A 3AF5A 4II7A 1RM0A 2PS0A 5CG2A 4E1AA 1VQNS 5KYWA 3T5JA 1OBHA 2GCOA 3GMSA 1W2HA 3E70C 3GCGA 4DC1A 1JLFB 4D44A 2RRBA 3K9WA 4YR3A 2GVZC 2Y71A 3ZU2A 1Z15A 5DLGA 2E89A 2IQ5A 4ZA1A 2R6FA 4L76A 1DC6A 2V54A 1USUA 4BB9A 3HY4A 1B64A 1YVEI 3SCJE 1VIYA 2IFXA 2E82A 1XEZA 4L74A 3QPDA 3O8OA 1WQ4A 3GGPA 4DANA 4LF7J 4Q1FA 3WHIA 1RBZA 3EPJA 2CZ4A 2MR6A 3FGOA 4ILKA 3S7ZA 4U6NA 2DBZA 3TECE 2VOEA 4IIHA 3B51X 3BSAA 3I12A 3QPCA 1ULTA 1G3OA 5CD4H 3BYZA 3KXLA 3OXGA 3TNLA 4TLBA 2QPLA 2NU8B 2Z2JA 2UYYA 4MJ3A 3G0OA 5K0FA 1RLIA 3ZHCA 3QYAA 5ICMA 4I55A 4AUMA 1RYFA 2IYPA 4KVFA 3DOLB 4YJDA 3S3TA 5AVVA 2C4VA 3AESB 4S3MA 2ZSFA 2OPPB 2IPOA 1HD1A 3EBPA 1LSJA 1LPBB 4JYPA 3FROA 2LECA 3LRTA 2GJAA 2E5WA 4F71A 1NN3A 2FSVC 5C2GA 1FDBA 4M0KA 3KYBA 2UUCF 3A70A 1HL7A 4ZK6A 2D9OA 2HHLA 3O8QA 2HHSA 4EVQA 5ALLA 2VRBA 1UOPA 3NWPA 2JFNA 4L4RA 4MZDA 3AH8A 3EVAA 3GHYA 3WICA 1JLSA 2BGLA 4NYZA 3IP5A 1K98A 4DG1B 1NNUA 3LA8A 1AXEA 2I2AA 3AFGA 2BDTA 1ZOLA 2K3KA 2Q6LA 1IIBA 4IGEA 2PNFA 1EZZB 5EJFA 2CLLB 1I5RA 2DOKA 4A8XA 1YGYA 1GA1A 1W1UA 4QOEA 1OX6A 2VONA 1CUAA 1T4CA 3W9BA 2ONKA 1Z29A 4G84A 2GS8A 1BQXA 2BQ3A 1O94A 3E3LA 3V8PA 3QY9A 6ADHA 2NQ2C 3C1TA 1U80A 4IZHA 3ZZYA 1EESA 4LF9F 4QGHA 2IVMA 3KPYA 3K6SB 4XDHA 1A9QA 4JT8A 4F45A 3KLIA 1JJHA 3V34A 2PUJA 4XX1A 3PXEA 1NRWA 3TZKA 2GB4A 2FUG9 1GH8A 2X1LA 1VHIA 1OB2A 3GVXA 3CLHA 2ZJRQ 5A04A 3Q2KA 2D8AA 4OKNA 2NTEA 3EAFA 1LW2A 4JGBA 2AFIB 4RVOA 4M1ZA 5DNUA 2DR8A 3KSUA 2DR2A 1E5TA 1PTJA 5HZGA 3ESRA 2FSHA 1TEHA 2A0YA 2V98A 2AJFE 3NJRA 4UU7A 1MJFA 3UWPA 3LK7A 3J80A 3K58A 1V96A 4UARA 4M36A 3N59A 1M74A 3CJKB 5FA5A 2R8HA 5IAAA 2ROEA 4YY3J 1N33J 2O0JA 3K70C 1LWNA 3WHKA 1IRIA 4K9NA 2IJFA 4H0CA 3C2PA 1H2VZ 2J3KA 3JD2A 2ET6A 3RVDA 3GUYA 4RNNA 4M89A 3OIWA 5FNVF 5B4TA 3E9RA 3S1SA 1P75A 2ZK7A 4XVQA 1DU4A 2GOYA 3IR6B 1GILA 1WSDA 3JZFA 3ASUA 1U09A 2V5UA 2YNMA 2HVIA 2Y8WA 1H0SA 1JIQA 5EP2A 2RIJA 5DXJA 1U1OA 1SXLA 1RU3A 1WVGA 3HHLA 3E7XA 1HDGO 4AS3A 4DR1J 4HDHA 2EEYA 4GOJA 2YNIB 4TVKA 1UPXA 2OBXA 4IX1A 5FORA 4HDMB 4NPAA 4NJMB 4TV9F 2BELA 4F0HA 2H92A 3HHDA 1OO0B 3MHYA 3C48A 4MS3B 3A1SA 5ULLA 3HKBA 4L4ZA 5FNVB 2J3LA 5F98A 3N58A 1FI4A 4X4NA 2X8JB 4ZYUA 5HK9A 3UZUA 1LGYA 4NA3A 1EVZA 1A4RA 2F1RA 4KE7A 5IC4B 3ORFA 4G1UC 5HAOA 1Y9OA 4N1AA 4IEEA 2VDWA 2YW2A 2DR5A 3FBWA 2KFYA 2FZGA 1N2CE 2W9BA 2J85A 3L7AA 3HR7A 5FWXB 4IFYA 2PRSA 1U9JA 4ZVLA 3DO5A 3PYMA 4JA2A 2B4RO 2GYWA 4IOJA 3TVKA 3EEQA 4DREA 3DOEA 2WYOA 1AZTA 4LXQA 4K4XA 1BC5A 2E1AA 4PX5A 5ETJA 5ITVA 4ZP1A 1N5KA 3LP8A 5KNDA 1DJNA 4RH1A 4WKPA 1ZL2A 3LWZA 2VP5A 3C85A 3MWLA 3RAQA 1LW2B 2NXWA 5JUMA 2RGBA 4I0WB 1YS4A 1DV2A 1U1RA 3CONA 5B1SA 5AXNA 2GCOB 3NGXA 1IM2A 4X8LA 3FCXA 5DHAA 3I31A 2NVUA 1BHNA 2HCJB 2KW5A 1YQUA 3G59A 3DRXA 3CUSA 1S1TA 2CIMA 1V8DA 4DEXA 1YDMA 3OOWA 1R27A 3W5DA 4LSLA 2CSUA 3LF1A 2R66A 2AE1A 1EVYA 5D0RA 4F97A 5SUHA 1X1QA 1P81A 1UQUA 1F0NA 2WG1A 2PPLA 3BKUA 4CH7A 4IHJA 2QZPA 4Z3DA 2C2XA 4S2EA 2G83A 2LU2A 1V1JA 5CA0F 3WSVA 5KT2A 1AJEA 3CC7S 3CT6A 4B6EA 1VJDA 3WGMA 1JJ7A 1V5VA 3ORHA 3GPAA 2O7SA 3TVTA 3ZI4A 3C3MA 3CZ5A 3UWMA 1SKMA 1MJGM 3V9PA 1MV8A 4OK6A 1DBIA 1M2JA 2OAUA 3R3ZA 1B73A 4GPD1 1DIOB 4KFRA 2YWCA 3UDVA 1HMVA 5LJIA 4CTAA 1UPUA 3OQIA 2UVQA 1R15A 4QDUA 5JU6A 1QGDA 1SCUA 3KVNA 3T4XA 3T5CA 1G2EA 2CEAA 1Y1PA 1P9YA 1LDBA 2R47A 2P2CA 1KQPA 2BEFA 2CXTA 1Z4PX 2X5XA 1YQ9A 2FKAA 5AJUA 3NVDA 1KJ9A 3SK0A 4OCZA 1ZOSA 1Q77A 1N7JA 3WSWA 2WMYA 3S2YA 2F1OA 2YV3A 3BEDA 3I52A 4LRDA 4JB8B 2O7VA 4TKVB 3EEBA 4DR1B 4H9GA 5D3MA 1M6NA 4BP1A 4XASA 4HTFB 4Z9BA 2BKLA 3UCGA 2NACA 3CS3A 4NR0A 1DCTA 4LHYA 1IUPA 1TR0A 3ND8A 1QC5A 1IUJA 3KHHA 1BRMA 5ISMA 2NXJA 1YS9A 2HRZA 1RT3B 4MCIA 9ATCA 3A8TA 3TEHB 1FVSA 2RRAA 3DONA 3EEOA 5E5NA 5ETTA 5IKPA 2IHKA 2P5SA 2WUEA 1YX2A 4W92B 5AVWA 4AQYJ 5G0TA 4AMUA 4IHAA 3GGDA 2QPAA 4X54A 3UA3A 4CHTA 5KWJA 4JC5A 1LDEA 3C6XA 3BGLA 3ZI7A 3PC3A 3RIYA 2VHUA 4FLFA 3CJ8A 2VQFF 1MB3A 1D09A 1J5EB 1T34A 4B74A 5HMWA 1Z4JA 1Q14A 2OORA 3STWA 3D4PA 1NVXQ 4J1NA 1X87A 2ZJ2A 1XDUA 1EJBA 3QH4A 1TJ3A 4Q7QA 4ZOBA 5AJHA 2IYVA 1Q7LB 2D74B 5LIRA 1RHRB 3NWBA 4IS2A 2WSCC 3BWYA 3JQ8A 1KAHA 1CRPA 1YJRA 1UT5A 1CUDA 1KYZA 5TS2A 3KT0A 4B6FA 4BNXA 4NMLA 1LK7A 4N6GA 2PQMA 2W9XA 3A1EA 5DDIP 2W48A 2OMKA 5GV8A 4BZZA 3ROMA 1S72S 1W581 2PWZA 3ZQJA 1ZGJA 4R1NA 1JEOA 2AYMA 2FKNA 4L85A 2DHGA 3FTCA 4V0SA 4QPZA 4FF3A 4MRMA 1DTEA 3HSGA 2XS7A 1TFYA 1GRRA 3N76A 1IXYA 1C29B 5KFHA 3V6DB 2G5TA 3VV2B 1SN7A 1JR3D 1Y5MA 1YI0A 3DOKB 3N4WA 3V1UA 4LBWA 4I36A 3VAYA 2A78A 4TMKA 3VTKA 4XGIA 4NZNA 3GRVA 2C8KA 3COZA 1SBYA 2DP4E 3DMTC 3US5A 3D3EA 1DX9A 2BE2B 3LVFO 1Z4LA 5LBTA 1RDRA 1KDNA 3R9IA 1AF4A 1E7YA 1W4ZA 2B3TB 3X1YA 5J4HA 4JX9A 1WXFA 4QOSA 3TOVA 4PNPA 4N7TA 4I46A 1KNZA 3ZUGA 2HHWA 3JQBA 4NK4A 3K4PA 2DRAA 4ZIRB 4JGIA 1DAKA 2ZHBA 3KLOA 1VJRA 2WPNA 4KHZA 3QUTA 2W2LA 3OH8A 1X8DA 3N8KA 5J1TB 3G0DA 4DLWA 2ZP1A 3T1NA 2NSBA 2P75A 2RGEA 2IXGA 2W5UA 3QBVA 1G7CA 3M6LA 3W0LB 2P68A 3COWA 5JWOA 3TG8A 1W1IA 4B35A 3I23A 2VJVA 2IT1A 1S0MA 4NDAA 1V16A 1GFZA 3R9WA 2NPIA 3ZNPA 4QUAA 4TYWA 2GCGA 1V4NA 3BO3A 4XVHA 3EUNA 5KJEA 2WJHA 3F6BX 3M9NB 1CIJA 2FJAB 3FBEA 4HB0A 3EFHA 3PX2A 2D3OR 1LW0B 1CC7A 3O92A 3NPMA 1HOTA 4QSMA 3ADDA 4MB2A 4LRBA 3T1YJ 2VYVD 4JWTA 1BE4A 4UUXA 5LB4A 3Q88A 1VRUA 3HULA 3OZVA 4DFPA 5LIPA 1NDHA 1W8IA 3FVRA 3WJ7A 4LVUA 1G16A 4RFVA 3CNLA 1CUYA 4YI5A 2CBGA 4YFYA 1AQIA 5KX5B 3U7QA 3HCRA 1EXVA 3CTPA 1J00A 3O47A 4RHFA 4NLYA 1ONBA 3FCWA 3VZIA 3LKZA 3TB4A 3COJA 3QELA 4J0CA 4MIAA 2KSQA 2JC1A 1V5FA 4QIVA 1P2UA 4Z0NA 1Q8KA 1Z25A 2PS3A 4YV2A 4ITRC 3CW2A 3NM6B 3WOHA 4QC2A 1YK1A 2IS4A 1ZPVA 3B3FA 4GNKA 2SHKA 4EG7A 4NCXA 4TS9A 2VC0A 2ZD1A 5SZIA 2DEIA 4XDYA 2AJ0A 4YV7A 3FIUA 3WB2A 3KTAA 4ONEA 5L95A 3ITNA 3H2ZA 2B8JA 5LMNJ 5T8KA 4BQQA 3SBDA 4K8RB 3R0QA 1WHTA 3GLJA 4WNAA 5LT5A 2HKEA 4ZIWA 2JHGA 1GZSA 4E5MA 1Y8RA 1DBWA 1CT9A 4AMYA 1KEEB 4XTCS 2VCYA 3IAM6 3AWIA 1TCAA 3GG0A 4Q03A 2GHPA 5BWLA 5AICA 3MA0A 3WGYA 1RAHA 2K4MA 3QATA 2EERA 5G0SA 1JKHA 4LFAJ 1JNYA 2WRMA 2JLWA 4NWIA 2XNKA 2IZ7A 2CFTA 2AYYA 2IBSA 3GH1A 2UUBB 1P44A 4XIYA 3AUYA 5H4HA 4C2TA 4KQ1A 3AOEA 3BH0A 2FMKA 3HP6A 4Q45A 1KDZA 1R3DA 4MQBA 3VNSA 1MUUA 2OO7A 4KRGA 2GO7A 3BF8A 4DMMA 4G1PA 1VLMA 1ZHHA 3IRWP 3OIYA 1UBRS 4EF6A 3LAKA 4QDJA 2IAJA 5DHQA 2GFQA 4QPTA 2H5EA 1WKKA 5CFRA 1NSFA 1T8TA 2NSHA 1NQXA 2UZ0A 2IPNA 1FYVA 1DKLA 3ISTA 1RXOB 1E77A 3FHTA 3I05A 1HRKA 3BGIA 1SXJD 3R20A 5I51A 2RGYA 4QXPA 3H8WA 4CLOB 4S1VA 4XR9A 4J0GA 1FFEA 3SJZA 4AJ1A 4RIHA 5A2QU 3H40A 1YDWA 5A5EA 3JR7A 1A9XB 2F3TA 1L7DA 4NFYA 1GV1A 2BRUC 4UXJA 4BE7B 4ETNA 1RJFA 3N2GA 3EZYA 4K3VA 5EERA 1NBMA 3GROA 4MDYA 2DVIA 2IM3A 4HV4A 1JSXA 2HNDA 4CM6A 4DN6A 4IHKA 3DEZA 3A06A 1P5FA 1V3ZA 1EAMA 2QRNA 4FHDA 5DYIA 2IRWA 4R0EA 2D4HA 4C6SA 1RI1A 2FRDA 3L4BC 1E2DA 4M0DA 5C42B 4LDRA 5IM0B 4EB6A 4ZKEA 2XMCA 3B13B 1IVNA 2QMOA 1HNXJ 3SQOP 2QMUA 1YLXA 1LXNA 1JPVA 3AR4A 5H9FJ 1IBMB 2WG0A 5LZ9A 4ZALA 4EENA 2VXOA 2XOEA 1TFUA 3CJQA 3B36A 1CS0B 3C24A 3WAJA 5DNCA 2I34A 2DY0A 3R77A 1KVRA 3PX0A 4TT3D 2UUPA 4TKUA 4J0JA 2RC5A 5KPDA 1K4MA 3DHNA 3IVCA 1U8SA 1MKYA 3WK5A 2G77B 2HDOA 3PKJA 1C30A 5BW6B 3DYAB 3DWIA 3FRHA 5K2MA 5GINE 4XLZA 1DBQA 4DUZJ 1KO1A 3AB3A 5F3TA 3PW4A 2X1MA 2Q3JA 1H3NA 3TEGA 4TMTA 4X61A 1CC1S 1K1SA 1ZVMA 4F56A 5CT9A 2YHIB 5LDGA 3U6BA 1RTKA 3WKDA 1Z3CA 5CXQA 2PFKA 3KUDA 4XDCA 1HFEL 3H4TA 3AJ8A 1ZXBA 3WJ2A 1KE1A 2V9CA 4ZVOB 1B99A 3KKOA 1ZVVA 1PW5A 1ECPA 3L40A 1RI4A 1AU9A 4X60A 4HVAA 4DHWA 1IJFB 5JUWA 2FYTA 4AKIA 3OSPA 4ZVGA 4XCVA 3PDNA 4HQLA 1C0EA 4I1UA 2QX6A 1ZITA 1OOEA 1XZEA 3TLZA 4CR7A 1Y7LA 1S49A 3DEIA 2D0DA 1E2UA 3BXHA 4BKQA 3MR5A 2WYUA 4COOA 1X92A 4YR0A 5B1EA 5IF9A 5K3EA 2VXYA 2A9QA 4C06A 4YROA 3NIBA 4HLDA 3OURA 2EKPA 1HBNB 1EKXA 4NONA 4AT1A 4RH0A 3DOMB 2I9PA 1DCKA 5SZKB 4UUOA 3OUTA 4PXCA 5EWMA 3QBTA 4BJ5A 2F48A 2I2CA 2XUOA 1XTRA 1PR1A 4X7MA 4OJ3A 3SCIE 1ZYQA 3DRSA 5E1BA 1B70B 4NLOA 3QQCD 4CQ1A 2WAXA 4NU5A 1UWCA 4DS3A 3Q8QB 2V1XA 2H0RA 4H7JA 4RKEA 3FIJA 1UEJA 3IWNC 1JE1A 4UVIA 1Z7YA 4KNWA 1MT0A 1OFVA 1OROA 5KYGA 2J6BA 3PDHA 3B89A 1ZLYA 5K0NA 2IXTA 4X6YA 3GV8B 1RAFB 1F12A 1NCLA 3G7SA 5BSGA 5CLGA 2MSSA 1ULAA 1VKOA 2BKVA 1SJQA 1X2BA 1ZRMA 3LLSA 3V9AA 3JSBA 1WHWA 2SECE 4GP7A 3E7PA 3UVJB 3R6TA 3PKMA 4OL0A 3TGLA 5EVCA 1Z6TA 2NYUA 2XGJA 4FYXB 4I69A 3FQKA 4X4PA 2Z57A 3GVIA 5I42B 1F6TA 3BFJA 4E13A 1VBNA 1S76D 4AD8A 1VTKA 5F77A 3QSYA 2LIPA 3V7UA 8OHMA 5IV3A 2H0QA 3W6ZA 2NREA 4A8JC 4QULA 1VPWA 1KKLA 4OHYA 3CJ5A 3DAOA 4MDHA 1MPTA 2I2YA 5HM6A 1H93A 1BO6A 1MNEA 3IEKA 3MWEB 3UG7A 3HJNA 2OD7A 2O14A 1U1LA 4EHHA 1R4AA 1OFGA 4RK7A 5DW0A 2L08A 2ZH4A 4WXRA 4LRAA 3EARA 2C8VA 2NGRA 3KKQA 1G8MA 4HFMA 4EMDA 3VSEA 1BXRB 3CPEA 3Q2IA 4MRVA 3C6TB 3KLHA 3D4NA 4KXWA 4LSNB 1JIKA 1N2CB 4U5XA 4MVJE 5AK6A 4X4QA 4JV2A 4J2TA 1H4QA 1HHQA 1E4EA 1Z33A 3K15A 1SC9A 4RW6A 2DTXA 4ZPVR 4DV3J 2F9FA 4UUBA 4BMYA 3BSFA 1U90A 3W6OA 5LJ5Y 1KK0A 3HRKA 4PHCA 3AKDA 2MSEB 4DT1A 2WSSD 4R9SA 4ED5A 4TKVA 2NO1A 3ISJA 2VNIA 3BDEA 2G1KA 3UT6A 4DLVA 4AJ2A 1IKXA 1NB7A 3ZNJ1 3BGOS 4ZV7A 4JA0A 3DGPB 3QOWA 1FUIA 1KTQA 1E6EA 5IWCA 3T9CA 3QVGA 4ED0A 5KG2A 2GF0A 3DULA 4UU1A 3KBOA 4HH0A 4X66J 2BEUB 4DLLA 1P8AA 3RB4A 2EX4A 1FXLA 3T1AA 1VQ5S 3F7NA 3FKQA 4UE6A 3NBXX 5JZOA 3RCBA 4BDTA 2H65A 1CWUA 3CIOA 4ZN6A 1R0BG 4C5AA 2G9OA 4BNLA 4AUKA 2HQGA 3VPDA 3RUPA 3OTQA 3A0UA 2LRHA 2IOYA 4D74A 3F96A 5ECDA 4F3TA 1AYEA 3AETB 1JLGA 1L4UA 3GLFB 5KKAA 2R2TA 2O5DA 1YR6A 3ZE6A 1P73A 3T1HB 2LEBA 3IP8A 2I4IA 3KK3B 1S6PB 2KXHA 4FYXA 1PP4A 1O97C 1Z5WA 2C4WA 2DRDA 5AKIA 3TAHA 2WLSA 2VDMB 3OTEA 2W8LA 2QM7A 4G4SO 3W79A 3AJRA 3SC3A 3AEUA 2JGNA 2DGUA 3CVUA 1E2JA 2V7XA 2OZKA 3H2JA 2BFDA 4B5KA 1CR0A 5FBQB 1TCUA 3N9UC 3W62A 5A9RA 1BKYA 5CLIA 2SKEA 1GNSA 4XQ9A 1ZSVA 3PWTA 3O2QB 1PGZA 2VD3A 1V3TA 4KH1B 1IQRA 2EZ8A 2RKOA 2W71A 1L5OA 4F4WA 4M8KA 4NMHA 2GUWA 4FWBA 4WKYA 3F8SA 3FUXA 5DRKA 4YJ2F 4QU8A 2HV8A 1M34A 4MRMB 2E29A 3BIJA 3ZW8A 1U3CA 2PSHA 4HRAA 3PUWA 3TANA 1X3LA 5JCOC 4F3RA 2CFRA 3WB9A 5HPYB 2WZBA 4YUAA 1GL9B 1U28A 2A2ZA 5KNCD 2ONYA 1LTKA 1YASA 4S05A 1IN5A 2B3TA 1C80A 2Z3VA 4BCDA 4EO4A 2PX8A 2WQ7A 2JFVA 1VHJA 1QIKA 1E3EA 2CDRB 4ZWNA 4ER7A 4DG5A 1FUKA 2RRNA 4KHPB 3NNHA 3C14A 3PXDA 3JQEA 2OV3A 3VHQA 1C1DB 5CXSA 1XAGA 2D1SA 1L5MA 3IE0A 1ODIA 3CF4A 1U1GA 2VWPA 5L9XA 5DSTA 2GM4A 4CIAA 4CRJA 1OGIA 2OO5C 2C4KA 4RENA 2AD9A 1NXWA 1QHYA 1CBUA 1ETHA 4YMLA 5J4LA 2XIQA 5HL7Q 5EPUA 1WD5A 3WDMA 1QU3A 3TKAA 3BFVA 1JHRA 3UXYA 4ZZ2A 2H1SA 2YN2A 3FOFC 3UN2A 3GJTA 4C2AA 4IFTA 1F2VA 1IBSA 2VHJA 4ZOLF 3A8EA 3PQDA 4KO8A 4C2UA 3D5MA 3T12A 4Z86A 2W2QA 3QGGA 3A2LA 2PUBA 1AKYA 3HM2A 3DGPA 1T9UA 1CJVA 2GHQA 4XPIB 1NU6A 1EPUA 5B6IA 5D6NA 4BC0A 2LQ8A 3FNQA 4AWBA 5CAEA 1TL7C 3LXRA 3BH6A 3B5IA 4ON9A 1I4TD 1YA8A 2POCA 4H59A 4RZ3A 4OQYA 4A8JB 1EFCA 1IB6A 1WM1A 4RTOA 3WMEA 3NYRA 4DUZF 1SXQA 5IW8A 4YP6A 1EVIA 1U7OA 1Z7WA 4L50A 4IWNA 4I8DA 2VDNB 1T4CB 4PO9A 1FUUA 4MOWA 3GGSA 3T99A 1L5QA 4OQPA 2DEUA 3JQMA 3ZKWA 5JVDA 4DPWA 1VM6A 5KX5A 3QI7A 3L8ZA 2CQIA 1KFEB 1ODFA 2XSJB 4TQUS 2G13A 4GMDA 1PAUA 1GGMA 3P19A 3N8GA 5L8VA 4MDEA 1T05B 4R84A 2LWIA 4M0PA 1NVEA 2ZOFA 3ILHA 3HK2A 4IIJB 4WOKA 4F6LA 1LTHR 5G02A 5DB4A 3MJSA 1SXGA 4NYIQ 3NXZA 4G5GA 3QP9A 2QVGA 4B73A 1B0PA 2XUZA 4EJMA 2HO4A 4C14A 3PRVA 3BIXA 1IFXA 1L5VA 2ZT6A 2R5FA 1ZOIA 3SPXA 1EUQA 4B3TJ 4JUIA 2UU9B 2YPZA 4QWEA 1JBEA 3WBFA 2ZRKA 2F00A 4CM3A 4EHBA 2CQBA 3KB1A 5SYMA 4B0OA 2QI9C 4CETA 3G4SS 3L8GA 4IDEA 3W8EA 3QT6A 3DMRA 1X80A 4CFSA 4PSCA 2B5OA 2JK0A 1XHLA 4PIMA 2B6HA 1YSJA 1USKA 5KG5A 3D3KA 4ZQBA 3RR7A 3GP5A 1YJ5A 3ZDRA 4NZZA 3WNQA 2VBYA 1Z0AA 4QUGA 1JJ2R 1M2KA 3U40A 5CCXA 2A9FA 1SKBA 4NMMA 3AYZB 4PTLA 1RWNA 1X5TA 1KMCA 2QX0A 3FNBA 4KVZA 4G8CA 2CPEA 4G25A 4B44A 1EDZA 3DTVB 2LNDA 1B0UA 2OHGA 2ZWVA 3F47A 4DPKA 3GFYA 4POAA 1Q6YA 2PKYX 1JDSA 1LWEB 3L6OO 1IAQA 3IR5B 5I9LA 4ECYA 3KEGA 2ACMA 1QOZA 3E7WA 3OTBA 1XFDA 5B2ZA 1OI7A 4JI1J 2HDNB 3N28A 1YRQA 4O2BA 2GVNA 3NRJA 5TF4A 1RQ0A 1R8AA 2JCSA 1VYVA 5B08A 2FY1A 3T1VA 4RTKA 4BX8A 5G4DA 3PE6A 2A9KA 2XR1A 4I6GA 1QIEA 1SQFA 2OEJA 2P90A 4C6HA 4H4MB 3BJRA 1Z2NX 3U1BA 3ZTTA 2I9KA 2OP1A 4JELA 3MM8B 1N8NA 2HF8A 3DMNA 4LCBA 3TW4A 3W66A 2QL9A 5KFGA 1BVRA 5IFKA 4BO9A 3NU1A 4P73A 4NLLA 1SG9A 3FWZA 1PC5A 1OX5A 4L72B 2CGEA 3SFGA 2OAEA 4QATA 4PZUA 2FG7C 3WMGA 4NFLA 2BGWA 1IQTA 3VF0B 4EUHA 4M5GA 4KAJA 1OBOA 2ZVSA 3R4VA 5HROA 4DQPA 2PEYA 5CVCA 3HFRA 2ERYA 5ARBA 4DL5A 4N9WA 1MHTA 2I4RA 2PZ8A 4M2LA 2BW0A 2VG5A 1CSEE 2A5LA 1K8RA 3EFOB 2G1DA 3OCVA 1GTZA 3BH6B 3X1MA 3V2HA 3OLQA 1JLKA 3VVCA 4HKTA 1F06A 1MZVA 3B1ZA 3RUFA 4NLWA 1E2KA 4KOAA 2X3GA 2IOHA 1VFNA 1QAOA 3ZKAA 2ZKIA 1CY0A 1JAHA 5BUSA 1DG9A 3WKCA 4GQBA 5B7GA 2DO0A 4PGAA 2AOWA 3EPKA 4QDTA 2XV1A 4RLSA 5GONB 3V4SA 2YPYA 4EI9A 4RD4A 1ZC3A 4OFXA 5LKAA 1F9EB 4FJ2A 1W9MA 1TQHA 3OA2A 5CH7B 3VJRA 4ES1A 1GAQA 2BGIA 1N8TA 4IS3A 1N0HA 1I24A 3FWHA 4RA6B 3C1UA 5A9TA 2XB4A 4MA0A 2IHBA 2QVYX 1RI5A 4CTMA 2QS9A 2HWKA 3DE6X 3RR8A 3IQGX 4ARUA 5BN1A 3DUFA 2ZM6F 1HI0P 3TZLA 2R8OA 2NSDA 4LJYA 3LWDA 3Q8KA 1Z28A 5C8YF 1LUAA 4Q4HB 3AWDA 4BE4A 3RG2A 2BRLA 1H6BA 3FMPB 3LYUA 1G1XA 1T9KA 3HHNB 2W93A 1WKLA 4FPXA 3F9CA 2O9JA 3W3SA 3TL3A 4E70A 2YNFA 4AC9A 1R1DA 4A8HA 3TPZA 4ZI7A 3NUGA 4EUSA 4ADSG 3EHDA 1ORHA 1JFFB 4NS4A 2CCGA 4YUDA 4RC9A 4UBIA 4F3YA 1X7YB 4YMTA 2IVYA 1WG1A 1Z6QA 1FXWA 4P33A 4GEKA 2WOOA 4P4TA 2FNAA 4AT1B 3KPVA 3OVAA 4PYKA 3W3AA 1BMTA 4R71A 2PX2A 1B16A 4DSEA 1JFVA 2X7XA 1MPXA 4M99A 2OSQA 4RMNA 5G0RB 3GJ0A 4D96A 5D5PA 1NH7A 2C83A 1RHUA 1QZ3A 1REVB 2KJVA 2EPIA 3ENZA 1AZSB 2H7CA 3X2SA 2IIHA 5ELMA 5B1YA 2CFIA 4LFBF 3I87A 1NC1A 1X4GA 4RXTA 2WVAA 3TTXA 4P5EA 2EZTA 1B3BA 4YV1A 3AY0A 4OZ1A 5FI3A 4LVNP 1QHEA 4OHZA 1ZHOA 1IHXA 4TY9A 1GNVA 4B80A 4XEHA 4HT3B 3HN6A 221PA 2ZKUA 1AB5A 3UWSA 2RONA 4F1KA 3ZEAA 2CLMB 3C16A 3HNOA 2GBFA 3OBIA 3ZTWA 1N34B 4DUYF 2X0KA 4GUAA 4TWZA 3O4FA 3BAZA 5FV4A 3E8SA 3GXBA 4DQVA 2XYGA 3ZZOA 3CBGA 1F2DA 3UO8B 5KTRA 4HQKA 4MYDA 3RAXA 3RKSA 4H7PA 1T5SA 1ZCJA 4D41A 3VJLA 3SVLA 4DR5B 4OGWA 4JLMA 1M5KC 5GZ6A 4W9NA 1PYOA 2C4MA 3O4RA 3RG8A 5HS6A 1U48A 3V4OA 2IL1A 2V34A 4DR2F 3DUFB 4JU9A 2VPWA 1WUKS 4MTPA 3JS5A 1K06A 1L5SA 2BT4A 3I82A 4PRKA 1CDEA 2IHUA 5LNK1 1EBBA 1SUQB 1E7SA 5FO1A 4JOUA 3PUKA 4AX4A 3NKLA 2W01A 1JEEA 2X15A 4U8HA 1CE8A 1US8A 3SJAA 4DBVO 3K89A 5HG0A 3NFRA 2Q3DA 4OQDA 3F3KA 3ZJ5A 2F6RA 1GFIA 1Y8CA 4QEDA 2VQFJ 1SOVA 3DDUA 4IMJB 3IQDB 2WABA 4DHEA 1OW3B 1ZA1B 4G1QB 4R8UA 4UTRA 1XMVA 1ST2A 1S9DA 4HQFA 1VXRA 3VBEA 3U1NA 3PV8A 1AHIA 1WULS 3UMBA 3DC7A 2J6TA 4JXKA 2X2PA 3CJ2A 2MLZA 1G1AA 3MJCA 2ZE5A 1IATA 3UCFA 4PQAA 3NAZA 1V71A 3HB9A 2HSEB 3QE0A 1UDAA 1VOMA 3M3PA 5DTRA 5CDYA 2BMFA 4J9VA 1LF0A 2RI6A 2A0WA 3EGVA 5HF9A 2M8DB 4O3MA 3LZDA 1PBUA 5AHRA 4WW0A 2MLYA 4FNHA 4HACA 3CCQS 2Z2LA 3NT2A 3EM1A 3SAJA 1P2VA 2YC4C 2NTNA 4OYWA 2MQOA 1JPNA 3NV9A 2ZNYA 2PRKA 4QUHA 1K0FA 1RISA 5E95A 5EWJB 1JFSA 1TECE 3AETA 3F9RA 1SKAA 2IOFA 1HZZA 2F3QA 3K5OA 3PA6A 2VRCD 1RRVA 1TD1A 2XSFA 5G0UA 2BFOA 5TT1A 3IA2A 2Z2ZA 1NJYA 2VOJA 4J9PA 1E6YB 1AKVA 1MB4A 3VR3A 4K8OA 3N3BC 3QFCA 5JAPA 2OH2A 4GNRA 2WA2A 3BWBA 2IDZA 3W63A 2RDIA 5LSRA 2MKYA 4ZK2A 4CI9A 4CM8A 4HBZA 3RC7A 4DV5F 4OK3A 1ZAKA 1P74A 1SUQA 4U7FA 4ENVA 3D2CA 2ZC4A 1TK9A 4TMZA 2Y0EA 3ZTYA 1G21B 5GAHU 1OIXA 1EUZA 2R2GA 2X40A 3TN7A 4ZU1X 2SNIE 2AV6A 3PJDA 4OVKA 4RZSA 1F5NA 3FR8A 3ETGA 3CGIA 3IUPA 3V4IA 5E2BA 4JBXA 4MFBA 3JWIA 3HBJA 3LCRA 2XMAA 1S4QA 4B9VA 3GIJA 2OCYC 4GOLD 1C2PA 1RT1B 2GTPA 2I4LA 1JLCB 1S1MA 1Y00A 4U2GA 2HEGA 3F71A 3IXQA 4JJ4A 4Z2AA 3AR8A 3ZDFA 2IITA 2NT4A 3RRNA 5K1ZA 1FP1D 1EHIA 1Y37A 3H99A 4WF9Q 1DOAA 5DLPA 3HYTA 1N33F 5BMOA 2QTGA 2GHWA 4ZVOA 4MP8A 2WHEA 5DDOC 2GZHA 1J25A 4HR7A 4M8NE 3MZ0A 4EBDA 2QQ5A 4I1TA 4OYYA 4CFYA 1RWMA 2ISCA 3HMQA 4KHRA 2JPDA 3PFCA 4DB2A 1YULA 1PNRA 2CXOA 4TSKA 5KDOA 1HWIA 2EXUA 1NDKA 2XLIA 2WBRA 3ONFA 4EY8A 1UC8A 4F9TA 3WMRA 2CXNA 4WOBA 1S4FA 4KTQA 1I1QB 3IMCA 3K70B 1VJ5A 2CHUA 1PG0A 2EK1A 3UD4P 1EFDN 5DZSA 2QR5A 1U31A 3AIKA 3E2IA 1BW9A 2NLOA 3JB9k 3NKVA 1Y98A 2OM2A 2MHNA 2AFIE 1K0TA 1GLGA 1C1CA 1RM5A 3HD2A 4X65F 1ZD4A 2QBYB 3I61A 1M1HA 4LSWA 2MXYA 2DNLA 2HV9A 2QTZA 4TQGA 5C2JB 4PF1A 1DRKA 2YV2A 3C45A 3K5WA 4TXLA 2QR2A 4RDIA 1VC6A 1FQJA 5K8JB 5DJ5A 4KFSA 1RABA 5LBIA 3M5CA 3U3DA 4A8JA 5AIAA 4D6YA 3ZCRA 4KQZA 1XMXA 4ZPXA 1R4MB 1I2AA 3R5JB 4R1QA 1XQWA 2YX1A 1VBYA 5NLLA 1N2HA 3HSZA 4F1JA 4ZPTR 2J5AA 3KTAB 3OSNA 3GY0A 3QYJA 3CB2A 4HQOA 3NIFB 3F5MA 3P45B 5EE3A 2XTJP 3CURA 4WNAB 3UN5A 4DV7F 3LUCA 3K32A 5IM0A 1RT1A 1ONSA 1RWWA 2PUEA 3OL6A 2DFVA 4IGAA 4ETXA 1R0XA 4M86A 2UUBJ 1ZTTA 1M54A 1F2HA 2JJ4D 1MAWA 2H9YA 3ZY5A 5KJFA 3ILLA 4PFSA 3VYVA 4OX6A 3A9SA 1P1IA 3OVSA 1Z6AA 4BVLA 2CF5A 2CXSA 2WVBA 3D4BA 1S6QA 3LCMA 1MH1A 3SX4A 1LC3A 3RFCA 2ALYB 4LWQA 2UXCF 3O94A 1OIWA 2P9YA 2DHXA 4V1CB 4P4SA 1BLUA 1X9GA 3ZK7A 3AB8A 3QYYA 3U1VA 2I3DA 2P11A 4F4JA 4JJEA 4A4JA 1Q16B 5C52B 4Z0HO 2R8ZA 2HLDD 4RV4A 4J9OA 3AL3A 4BFZA 2Z4SA 4LF9J 3HJBA 4HFRA 3HYLA 3UWKA 4OXXA 3MMAA 4XAKA 1K8QA 3LFTA 1PJ2A 2R4TA 3I3SR 3WP0A 4G5SA 3DRPA 4J0FA 4LNUB 2UZ1B 4FHFA 3KCNA 5FA8A 1S1CA 3LUKA 3VH3A 3OJEA 3NOOA 3Q8VA 4JOSA 3H5YA 5FL3A 2QLTA 3VISA 4JLDA 4EYQA 1E6CA 5CDGA 5CVVA 4EYKA 1MFPA 4B9SA 4V3BA 5BSTA 1QE3A 2CFSA 2CNWA 2QSFA 4W8OA 3PI7A 2DZDA 4N7BA 2WKSA 4HDGA 4Q7AA 5JCJA 3EVEA 4GBMA 5I47A 1JPJA 1CQNA 1I1OA 1JVNA 3BN4A 1QSYA 4NCKA 2QRVB 3U1MA 3OBBA 3Q85A 1UVMA 2TECE 4H6XA 4MQ4A 3TA0A 4NP6A 3DWGA 2YNGA 2CY0A 3N5KA 3KJHA 4X64J 1W9HA 2D0OB 4YP7A 1N5IA 3FFIB 4KWIA 3GLFA 4ARSA 2OGSA 3TOCA 1T95A 2GGPA 2RVJA 3AI1A 1Y3JA 3AOBA 3FMOB 4QYIA 1WPGA 4UNPA 3K5HA 4ISBA 3WGLA 3BHNA 2AQKA 2BY4A 3SQWA 1NBAA 3E4CA 4KO1S 2VG5B 2PDAA 1P62B 4LR9A 2QB5A 2P8SA 4CQMB 3VGSA 2VDQB 1MHPA 2XGPA 1F5SA 4DC0A 3FWNA 3PK0A 4X4TA 4C97A 1JTFA 1MJNA 9ABPA 1T26A 4JAVC 3NHSA 1QR2A 4R1TA 1HT1E 1K44A 2Q3FA 2LUOA 1M2EA 4B0PA 3AC0A 2OMEA 3VR3D 1EP4B 3KK2A 5I4CA 5MGBA 1VQSA 3O6QA 3G89A 3BSWA 3QLVC 1E1MA 1NFQA 2V2ZA 1YA4A 2IH5A 4UCFA 4RKFA 1XR6A 4BECA 2WIAA 1A82A 2BKEA 3CRQA 3EIOA 3EOAI 1YQEA 3MERA 2IS6A 4DU7A 5KFPA 2UZIR 4U5QA 1GRVA 2C94A 4DDVA 4U2FA 1QG0A 4OAQA 3QZUA 3L02A 3NR2A 3BMCB 4L22A 4INAA 4MAKA 3WFZA 2JLYA 3V8EA 3CUUA 5F5XA 4FMCB 1W0CA 1OXVA 3FW1A 4JBWA 2GJFA 2IA5A 5ALQA 5BWNA 1VSUA 3D4LA 1YR2A 2QA4S 4GC9A 2G1PA 3X3HA 5MAOA 4D7AA 1UZNA 2OHFA 4LXTA 1XLWA 4BQIA 3D1LA 4G86A 4JX8A 2EYQA 3TZYA 1F60A 2PWBA 5JO9A 5I5GA 1UWLA 2VPZB 1OU0A 1BG6A 2FFHA 1HBJA 1BXRA 3A9TA 5HR5A 3I0SB 1C1HA 5AW7A 2FPRA 2WTEA 4IV5A 3UG6A 3ZD6A 4MKIA 3WQHA 4X95A 4LOKA 3A6DA 2GN0A 1S97A 2VPPA 1JKXA 1GRQA 3MWKA 4JT9A 3FDIA 1D4AA 4QO7A 2OCLA 1TUVA 5CU7A 2ECKA 5B0DA 1UFKA 1K7FB 1TGYA 4HDNA 2M1XA 3OJWA 2XCPA 3IBFB 2WU3A 3U37A 4I3HA 4NCGA 2VA2A 2ZBRA 4KV8A 3ZJUA 1II8A 3ZD8A 1MVLA 2QTVB 3HVKA 4DLEA 2KI2A 4E94A 3HZEA 1VRUB 4EPVA 5C5CA 4TKZA 4KDEA 4B9EA 4HYKA 1YKGA 5L1LA 4GGOA 1JG2A 3R74A 3DHXA 4L4UA 2O3QA 4RYDA 4JT2A 3OLXA 3CE8A 4K9DA 2GNKA 1BX0A 4M0EA 4B6RA 5H0IA 2Z5FA 2AF3C 4MPJA 1J2JA 2WSBA 1GQSA 3RV3A 2UVVA 3J81k 4G81A 5ECWA 3ONDA 1C4XA 4EG3A 2B4OA 1Q0ZA 4RM2A 4HNAB 5FKJA 3M5PA 3V5NA 1B15A 1QYDA 3DCNA 1N8SA 4C4ZA 2IUYA 4WMLA 4X62F 1NF8A 4WBFA 3THPA 2WT8A 3FFTA 3BT7A 8ABPA 3F73A 3AVXA 2W2LD 4RWEA 5CCMA 2IW3A 3LX8A 4FTWA 3RAEC 5D78A 4E07A 1FS6A 4WU3A 4MUHA 1GSOA 3L93A 1G9TA 3GEPA 5A2QA 5JXJA 3GE9A 3D9QX 5DU2A 4O6VA 1QGZA 3JQPA 5AK0A 3D6FA 2GMJA 4QOGA 3GDWA 3MM4A 3EAQA 3I72A 1LWFA 5JVDF 4FR5A 1B7FA 2NO5A 1BDIA 3BL8A 1QGOA 3IEIA 4LXIA 4DV3B 5KDDA 2WTAA 3UB4A 4XM0A 3KNAA 3K8VA 1E5LA 1UBGA 3MGKA 4WKCA 2B21A 4FSXA 3CXUA 4DV6F 1GD1O 4WCVA 3ZNOA 1NKVA 3N2NA 2WKWA 5LN1A 3GR6A 3USCS 2VP3A 5IFLA 3EWAA 4X1IA 1D07A 4A1FA 1N75A 1GADO 5IX8A 4XD7A 2MQLA 5TPWA 2HZCA 3WX4A 2R4QA 4BBAA 5J2NA 5B0CA 1ZD8A 2Y0BB 2H11A 4ANDA 3R0IA 3PTZA 4HVLA 2IYSA 4KQIA 3X1LB 2P5TB 4ASUD 3COVA 1UOQA 3PXBA 1NKEA 4Z1MA 3ESDA 5KSPA 2I6GA 1OI2A 5AOAA 1NQAO 4FB4A 5DNDA 4ZVPA 3E8XA 1KJQA 3HFGA 1F60B 4ZLPA 4O4IB 2M9KA 3RDPA 5HZKA 1KZ9A 4DABA 3K0HA 3KKLA 3P2OA 1EP3B 2FQ1A 5LVAA 4IH1A 1R0ZA 3OJSA 1KY3A 1PL8A 3CEJA 4L5YA 4U67Q 4RS3A 2GQ2A 2CXHA 3T9BA 4MUIA 4RD1A 3ABIA 2GMLA 4MMXB 2I4OA 5KYUB 4AXIA 3N74A 2QMUB 3B12A 4AF7A 3U31A 1OASA 4EI2A 1YQWA 2IM0A 5KT3A 1LBTA 5CT5A 2YIVX 3WNVA 4F12A 3GLIE 3PCRB 1XCJA 4O4GB 3AXMA 4NA1A 1L7RA 5M2QA 1EQ2A 2ISQA 1U0JA 1Q0UA 2DECA 5H16A 4XJXA 4XQCA 3RSLA 3QEJA 5ALYA 2XMTA 1PFQA 2YR0A 1M66A 4LRQA 1VE5A 4HNRA 4IQMA 1EM8B 1N92A 4UM9D 2Q49A 5LR6A 1RBQA 1FTRA 5ECYA 5HKOA 4CMJA 3DL0A 1EDBA 2VNHA 4L7VA 5JI2E 1SPXA 3CEDA 3ND7A 4JFAA 1P9QC 1FXWF 4PHTA 4V2UA 2ATIA 1X1RA 3Q3EA 3HF5A 1TLLA 2H1RA 4PO8A 2AOTB 3K4HA 4BQEA 3NOVA 3EXEB 4G0QA 4OZJA 5MN4A 3I0RB 1FTGA 4P8RA 1TVKA 2JH8A 3BRQA 2VUGA 1X70A 3PUIA 4N40A 3I04M 3VC1A 3V4RA 1SV5B 2ACYA 5HP4A 3NANA 2DX7A 3IEUA 3R0XA 3VTIA 4RFSA 3ZWPA 3OTOB 4IO0A 3I56S 3BK7A 2NZJA 3ON5A 4U7TB 2QLWA 3HSSA 4QODA 5JS7A 5B7NA 3RVLA 2XMVA 3EC7A 1NUPA 1FD8A 5CPBA 3QLVA 1H9BA 4HF7A 3W90A 2B37A 2J0QA 5JR3A 2QX9A 1EXNA 4F06A 4V03A 2G17A 4GKKJ 2RAPA 4ZVPB 4XSVA 3W5XA 2K6GA 5A7HA 3FY4A 3ZWOA 5LU9A 4DA6A 1HBNA 5SYNA 1M73E 1V9CA 5HVGA 5DLYA 3LUAA 4RGYA 1RWMB 4KODA 5AJ3J 2EQ5A 2ATCB 3UWOA 1QRAA 1E4EB 1ES9A 1UUFA 3NT5A 5KFMA 1IEVA 2NWQA 3SZ3A 4NE9A 4TTJA 3MHPA 1L5ZA 5FTWA 4P93A 3ZQ4A 1T15A 3NDBB 4I50F 1OYYA 4OKIA 2WF6A 3UTCA 1ISRA 1AUDA 1YVFA 2IELA 2HDWA 4ED2A 1DLJA 4K28A 2BANB 1QC5B 3JWPA 3L6CA 2V50A 3D02A 2BZ2A 4DG1A 2C5SA 5I4MA 3GNLA 1GCAA 4ECXA 1SVMA 3QVVA 2RH4A 4OM8A 3G2NA 5BYSA 5KOHB 1KRHA 4IXDA 2B2XA 1AGPA 1CR2A 1FZQA 2FA9A 2YWDA 4CYUA 2Q5LA 3T3FA 1HW9A 1HNVA 2X22A 5T41A 3L7JA 4ARZA 3PFKA 2XO6A 4WV3A 1COWD 4CQNA 2XSJA 1LJ8A 3WFIA 4MINA 2NYHA 1RLDA 4P0QB 2ZJPQ 3MILA 2QYOA 1BDJA 5DIFA 1IN0A 1RAGA 1IWOA 3IIMA 3GHHA 1X1SA 3HXMA 4X66B 5EE9A 1PX2A 3R5JA 5HM8A 4JUDX 4CQJA 1GT6A 3GJ6A 1G3MA 4OD0A 1XWWA 4IIYA 5JXSA 5I7VA 2R6GA 2RMLA 4O63O 5K3AA 3HO1A 2F9LA 3NC0C 4BJ3A 1PO6A 4I19A 5B2EA 3ZW7A 4GX2A 3W78A 2PQ6A 3U80A 5GVQA 4LE1A 2EJTA 5FLXA 2R96A 2ZI7A 2GO9A 3OQPA 4AG5A 2B9EA 4J2OA 4RAQA 1QD1A 3GR1A 3B6EA 4ZMSA 3E0QA 2RKBA 2HVHA 3T9AA 2AYGA 2I6XA 3CWZA 3RS9A 3EYAA 4TMYA 4FGJA 3GI1A 3KXKA 2OPPA 3R3VA 2DHDA 1IDN1 2WYHA 4D25A 2E4AA 1IN1A 3IR6A 5JDIC 1DRZA 1Z4OA 4NENB 3SEOA 2WB1D 3BDPA 4BFXA 4G8DA 1O58A 5FPSA 5DT9A 4G56A 4ER6A 4YCAA 4GYYA 1WTBA 5E3HA 2BH9A 1K27A 3RU9A 1ML3A 2YZNA 1B2RA 3G8AA 4XE5A 4BMSA 1B3TA 1U0LA 5KVCA 2WINI 1AVTA 1FXRA 3H0PA 4Z53A 1PJ5A 1XKTA 3NOXA 2PUAA 4PPNA 4MAAA 4O3RA 2Q9UA 1YOVA 3GJ5A 3MGGA 2XTZA 5M2PA 3CXRA 2GYUA 1NRJB 3QTTA 5DG8A 3WAGA 1EB0A 2PA8D 3E5HA 4D0SA 4QOHA 1XZMA 3FCYA 5CLLA 1GPYA 4LJ8A 1SUWA 3GRYA 4MR8A 2NVWA 2N42A 2FZGB 4TLEA 2WTBA 2WCXA 1AQ6A 1GZ6A 5E0OA 2XS2A 3HHLC 1SBRA 3BE6A 4TS4A 1JTVA 3VPHA 2GD0A 3I37X 2WD8A 5DM2A 1KR5A 4J9RA 3K09A 1WPXA 3BWMA 1QH1B 3CIFA 3F3YA 4XUCA 3NS5A 4BNMA 2XWSA 1ZGHA 2GV1A 5H80A 3JW8A 5ALNA 1SBTA 2FPHX 5CBPA 4JQZA 4JIGA 1J6UA 1V11A 2H08A 2PGOA 3NHYA 3ZO7A 5C5EA 1RPTA 2H5IA 4BFWA 1IWGA 1CRQA 3UQYS 2MU1A 1KVKA 3VZHA 3D4OA 1TELA 4YPVA 4D98A 3IR7A 4PBTA 3X1XA 3O9VA 5AM5A 2WIKA 5IZ4A 4N5HX 1PR2A 4CQMA 5COBA 3EIEA 5TMEA 3BKXA 2GEVA 2QTFA 3SEZA 1E20A 1GLVA 2HMTA 5D6OA 1I0ZA 2V58A 3RSHA 4E14A 4FN5A 5IZHA 1VBMA 4RF3A 3LSTA 1QF9A 4XAQA 3GT7A 4DB4A 1F0XA 2GZ3A 1ZZFA 4O4HF 4UUAA 2E5LF 3DKDA 4LQLA 3KLBA 3ZWXA 1R8JA 2ALZA 1UWBB 4HSEA 3RYFA 4JUCA 3OEED 4WKNA 4OLFA 5K14B 4CHGA 4W8HA 3MCAA 2ZJ6A 4X1OA 3T0FA 3ZQ6A 3ZZUA 5FWNA 2V7VA 1Y8QB 1PFWA 3PW2A 3C3EA 2VJLA 2PZEA 1CX9B 5KOIA 1HMVB 1QBKC 3EIQA 1E9DA 1Y8RB 2C78A 2C98A 3WGTA 4BHQA 4FSDA 4HFNA 2E5JA 3ORQA 2XNHA 4QHSA 4D5GA 4LF5J 2EAUA 2VPIA 5JZ9A 4BMNA 5HA5A 3QWHA 3KJZA 4HAWA 5H9WA 3I9JA 1JLAA 6AT1B 5DDRC 2PZBA 1ZSNA 1P80A 5DO9A 3RJMB 1V48A 2DC1A 2Q66A 4ZEOA 1T8UA 2L69A 4KWCA 2DWUA 4L8WB 5B53A 3ILOA 3LY8A 5AW0A 2IYFA 2D2IA 4M5JA 2DYAA 3H1EA 2EFCB 1A3CA 1QXSA 3ZCSA 4K0RA 1KDVA 4W6ZA 1CG6A 3HSKA 3EMDA 3VVMA 2R8GA 4PGHA 2VAPA 1YL5A 3HCDA 721PA 5ARDA 5CAEB 5F41A 4L51A 2QZJA 1Q4RA 5KFLA 2FR8A 1T1SA 2YWGA 1F5CA 4LF7F 4Y28C 4E5UA 3CX4A 1N9GA 4NLPA 4J1TA 4I9UA 2UUAB 2AVNA 5IWAB 3O91A 1M5TA 2DFLA 4AZWA 3G5UA 4I6WA 1M8PA 2BR4A 5JNLA 4P80A 4CM0A 1A69A 1PFVA 1U8FO 4C8KA 2Q1TA 1Z8HA 3FM9A 4QU0A 2J09A 2J1LA 2CNOA 3M1LA 2IBOA 4UDYX 2EFPA 1J0XO 2UV8A 2FLKA 1CS4B 1BDMA 3A1NA 1JH8A 3Q98A 3MK31 2AMVA 1C1BA 1GG8A 3CPWR 3CTRA 5CFOA 2HZAA 3ELUA 1VG8A 2GNPA 5CJPA 5FYQA 4PICA 3SHOA 4USIA 1UDCA 3GEBA 3MM8A 2VLBA 3MWJA 1BA3A 3OZIA 2VYVA 4Q9LA 2DEJA 2QMXA 1KDYA 4G1BA 2BJHA 1JU3A 8RUCA 3O1LA 4Q4AA 1JXQA 3FK4A 1CJTB 1GGVA 3FZQA 4CVNA 3W1WA 1K3FA 3EY4A 2BHRA 2ZI5A 1S79A 2ZSIA 3OR1B 1DUIA 3SHTA 3D31A 1G5RA 4BNZA 1WBDA 3H2BA 3EMTA 1APBA 1GGFA 4YRCA 2Z9CA 3EVNA 3THXB 5LXYA 5HWSA 2CHEA 4DDHA 5AJ3F 2FZWA 1Z4IA 2ZWOA 3VNVA 3V5RA 4TMXA 4Q48A 4REMA 4J0HA 3OZTA 1F5BA 1BE0A 3KM0A 3FPAA 2R11A 1TUGB 5K03A 4R8UB 3PXAA 3TOZA 4Q0MA 2C1ZA 3DOKA 4HDKA 3I0ZA 1UA0A 1ITPA 2Y6UA 1NMZA 4UQGA 4ZA2A 4MO2A 5K05A 2PUDA 4DRXB 1PT8A 1UZHA 4DSTA 1RAEA 2BSQA 3WYEA 1Q16A 2GJ8A 2FHMA 2RHGB 1LBQA 1N7GA 4HY3A 4F1WA 2GNAA 4D6XA 3HJVA 5K8TA 3G8DA 4A48A 3VYUB 3MM7B 2A9VA 4O2BB 1MDBA 4P98A 5CA5A 3OTGA 4YUXA 4A8OA 1LS1A 2H54B 1ID8A 1N25A 3PQFA 1DQ8A 4F4FA 2NR0A 1UT8A 4LWOA 1GY8A 2GM3A 3CF0A 1V5WA 4EUKA 2G1UA 1TZKA 3SCKE 3GOQA 1OZHA 4XIJA 1E59A 2BHLA 5DM0A 3EFBA 1SUCA 3G2PA 1ZR2A 1CUFA 3WAKA 3KDPA 3RB0A 2Z2KA 4F6RB 4C7QA 2CQCA 3TLCA 4NNOA 1VISA 1IULA 3Q7PA 1U45A 4M9RA 3JD3A 2N82B 1ZJZA 2GK6A 3R5HA 2P6PA 2ZBDA 3KHKA 2CQ4A 1FDDA 5JSHA 3QVSA 3PNIA 5ADUS 4W7IA 3R3JA 4A5SA 1Q20A 3U56A 1P0IA 3QPAA 4DGQA 3NHKA 3AF2A 3MWGA 5E3RA 5CGQB 5IYZA 1M1NB 3EZXA 3KLEA 2HQ3A 1ZQ1A 3FCSB 1Y9EA 2IKSA 3K0JA 3UQSA 4C8YA 5L9AA 4J37A 1W35A 1RHUB 1REVA 3S1LA 4YDHB 1O4VA 1LS6A 5LJ3Y 2MDAA 1R12A 3DDOA 1EFHA 2QSYA 3MT9A 1GKYA 1N1MA 4J9MA 1IN6A 1FNCA 5P8WA 1UAWA 5AKKA 5B3KA 3HA2A 3E01B 3DXZA 5CLHA 3H4DA 1RABB 4LMAA 2ZE7A 4ALIA 4ID5A 4KGXB 4DIEA 1FLDA 3BBFA 2HK7A 2XHZA 3PJ9A 2ZIGA 1RAOA 3GZNA 4YRLA 1SXJC 1U1FA 3D81A 4F9GA 4XUGB 4F04B 1F2UA 5JTTA 4K46A 1IZZA 3CLTD 1BFKA 1IXRC 2MCFA 4LVNA 1XK8A 1C4WA 3EGIA 4BVJA 4QUBA 1EVKA 1B8UA 1UQRA 1YB4A 3VKFA 3OZWA 3N2LA 3AP2A 4G0YA 1T13A 2WHXA 1QSLA 3WWZA 1N0WA 1HDIA 4USHA 2JK1A 3B2QA 5FWDA 5JXHA 1U7UA 3ICWA 4R69A 1MMFB 3FPSA 2XGOA 1OWXA 1KEEA 1QDUA 3RBDA 2F5GA 3H3FA 1WOMA 5T6BA 1FVXA 2YCLA 1JFFA 1TM7E 3B70A 3RUAA 1UAAA 1U3TA 1JLAB 1PNOA 1QWSA 4MJXA 3OEWA 1M2GA 1E94E 4IFYB 4D3YA 1ZO8A 2QP4A 3Q0IA 4GC6A 3LIIA 3PD0A 1RRMA 3T5TA 3FTQA 3SHQA 1KJZA 2X4DA