4X88A

E178d selectivity filter mutant of navms voltage-gated pore
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLDSWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4x88A00
2YEVA 4P9OA 5IY5C 1M57C 3EFFK 2H8PC 3SYPA 4LCUC 4QE9A 3STZC 3SYOA 4X89A 2HG5C 4GX1A 4DXWA 2WLMA 1V55C 3VOUA 4BW5A 4MVSA 4RO2A 3JYCA 1S5HC 3AG4C 4F4LA 2K1EA 4GX2A 3FB8C 4X8AA 5EC1C 3F7VC 4EKWA 3TCUA 2Q6AA 3ABKC 1OCRC 2WLIA 1OCOC 2X6BA 3F7YC 1ZWIC 2X6CA 3RW0A 3UM7A 4WFGA 3GB7C 1R3IC 3K06A 4H33A 4JTDB 4MW3A 4TWKA 2ITCC 2R9RB 1OCCC 2X6AA 3T2MA 2WLNA 4MW8A 2NLJC 3E83A 4JTCB 4XDKA 5EC2C 5CBGA 3FB7C 4PA9A 4HZ3A 3E89A 2A79B 4ZBMA 2BOCC 4R50A 4GX0A 2AHYA 4PDVA 2HFEC 4PDLA 4R8CA 1G4YB 3ZJZA 4OXSA 2DYRC 4CBCA 2EIKC 1BL8A 5B3SC 2Q68A 4P9PA 3WG7C 3ABLC 4QNHB 3AG3C 4MVUA 3K08A 2QKSA 5BZBA 4MSWC 2ATKC 1R3LC 1LNQA 4LP8A 4MS2A 4GX5A 1ORQC 3HPLC 2EINC 2IH1C 3K03A 3K0DA 1J95A 3ZRSA 4JTAB 2Q67A 2WLLB 4WFHA 2HVKC 3OUFA 2WLJA 3ASOC 2ZD9A 2DWDC 4J9ZB 1R3JC 2WLIB 4R6ZA 4UUJC 3RVYA 3BEHA 3E8FA 1KKDA 1QLEC 3LDEA 5B1AC 5E1AC 3RBZA 3ASNC 3LUTB 3OR7C 4PA3A 4H37A 2EIJC 3SPHA 4HYOA 3PJSK 2A0LA 2WLHA 4PA6A 3OR6C 3E8GA 5KUKA 2OCCC 4WFFA 4P2ZA 4PA4A 2KB1A 4P30A 3FB6C 2BOBC 3IFXA 2EIMC 3AG1C 1JVMA 3F5WC 3LDDA 3LDCA 3OUSA 2P7TC 4MVOA 4WFEA 3SPGA 4MTFA 1V54C 3SYQA 3TETA 2DYSC 4XDLA 5B1BC 2Y69C 3ABMC 4MVZA 1XL4A 5CBFA 4MVRA 1OCZC 2Q69A 4PA7A 4G28B 4RUEA 5KUMA 4I9WA 3R65A 3STLC 2W0FC 1M56C 2ZXWC 1XL6A 1R3KC 4LBEC 5EBWC 3RVZA 4PDMA 4J9YB 3T4ZA 3IGAC 3OGCC 5EBLC 2JK5C 2DWEC 3SJQC 3SYAA 3E8BA 5J9PC 2A9HA 2HJFC 2AHZA 3SPIA 3FB5C 3KG2A 3SPCA 4MTGA 3K0GA 4RUFA 3X2QC 2WLLA 2ITDC 1P7BA 3E86A 4R7CA 4RAIA 4KFMA 4X88A 3T1CA 3E8HA 5EBMC 4XDJA 1K4CC 2EILC 3UKMA 5CBHA 2IH3C 1K4DC 3SYCA 4MVQA 3AG2C 4MVMA 4QE7A 4PDRA 2HVJC 3SPJA 2QTOA 2WLKA 3K04A 3LNMB 4G27B 5EK0A 4MTOA 3T4DA
chains in the Genus database with same CATH superfamily
4JI0O 1Q6IA 1COWG 2H8PC 3CB2A 2F4VB 1XHZA 1QBZA 4GX1A 4HAMA 1V55C 2LFSA 3ZMUA 1RM1C 1MZFA 3RYCA 1H2KA 2W6JG 4IGGA 1YI2V 1BS3A 4TUYA 2ITCC 4JI0B 2YEVB 2B5UA 2YI9A 1OCCC 3JALB 4Z1VA 2OTJV 2HKOA 2XASA 1THZA 1TVKA 3ABKB 4ICGA 4CBCA 5LMUO 1HNXB 4LP8A 3BABA 2IH1C 2OCHA 1FXVA 4ZKIA 2CE4A 1SERA 2HVKC 2WSSG 4TUYB 3ASOC 2ZD9A 1FJGB 2MK3A 5IDJA 4IYHA 1NVPD 3ABLB 1K5QA 4MTXA 2DYRB 3JARA 4OGQB 5IWAB 4K0KB 4PD4F 4DV7O 2Q7HA 4AILC 1QR8A 2AW9A 5EIBD 1JVMA 1WLEA 2B1GA 3I56V 3ZS8C 4KHPO 3TETA 2DYSC 4DV2B 4DV5O 4LF8B 1V55B 1GK9A 4TSFG 2QWQB 3RFRA 3F5TA 1HNXO 3DXRB 1IDSA 4UV8A 3TXSA 1XMOB 4DR4B 2EULA 2AHZA 5DM6V 4JI1B 4RUFA 1P7BA 3E86A 1XBLA 1FYJA 3UT5A 2DMXA 1AJQA 2UUBO 4ABMA 5FLXN 2CTPA 5LGTA 1AROP 1GO3F 4FZ1A 4QGPA 3VQVA 5FNVB 3BY6A 1F23A 4EEQA 2N04A 2YXHA 2UUBB 1CXZB 4O4HA 4MW3A 4TWKA 4TV9A 1H2MA 5LBQA 3BA8A 4I9QA 3WB1A 2DE0X 2NN4A 2HEPA 4HZ3A 1WPXA 1S3JA 2LP7A 5KA6A 5L3FA 3ZMTA 2GV9A 4JI7B 4J42A 2EX3A 2YDEA 1H2NA 3E22A 4W4KA 1FKAO 4UCOA 4FPPA 1OJHA 1R3LC 1ORQC 4O2AA 1N0JA 3CX5F 4U3FH 3A0RA 3CPWU 1MA1A 2EILB 5LMUB 3CEIA 4DW1A 4X66O 3LDEA 1JPXA 3RBZA 3ZRXA 3J7AU 2CTWA 2IU0A 3JD3A 1R6NA 5L3GA 2Q0AA 4P2ZA 2QTSA 1W0KG 1T5EA 5GTHZ 1Y4MA 3F5WC 1EBOA 2Y48A 3FYEB 1KP2A 2ZDIA 3SYQA 5CA0B 4U7NA 1GN2A 2YC0A 4Q20A 1ROPA 2VQFO 4G28B 4WFAV 3CCQV 5KAFZ 1XL6A 4FFBB 1MNGA 5K1XA 4JI1O 3RVZA 4PDMA 3T4ZA 2R9AA 4YJ2A 3W7WA 4BW9A 2P22C 1H2LA 2YSUB 3GWKC 4U7OA 3MD0A 2N05A 3ZMSA 4NTXA 1OCZB 2UXBB 3RN4A 1VARA 4LFAB 2A7WA 2QR4A 3SYCA 1VP7A 1S76D 4QE9A 2OTLV 1SQGA 3K5LA 1OZ0A 3TGUH 1NTKH 4JAAA 1CEZA 1BMFG 2ZXWB 4MVSA 5IYDO 2ODMA 4TV9B 4L8JA 4GUNA 4IHJA 3L9DA 3TCUA 3WB0A 5KHIA 4JTDB 2CH7A 1KUQA 1VQKV 1M4UA 4UCTA 4X62O 4LF4O 2ZR2A 3G6EV 3B40A 2F23A 1VQ4V 3K79A 5KHKA 4DUYO 4TT3G 2D2CB 1PV0A 2DYRC 1IURA 3O9OA 3AG3C 4NXMB 4MSWC 1JMKC 4MS2A 3HPLC 1M56B 3G67A 4QPKA 2OIEA 2WLJA 4UXNA 5H6QA 4J9ZB 5CA1A 1DTOA 4DR3O 3HKBA 1G8MA 1S0VA 2KG7B 2DYSB 5L3BA 2Y69B 3FYIB 5DEDA 2EIJC 2RNBA 3DXRA 1NZ6A 1RPOA 3OR6C 1HR0B 2OCCC 4AQYO 4UB8Z 2H3OA 4JI3O 3K58A 2YIAA 4GZRB 4E2LA 1OV9A 3AG1B 1LR1A 2O57A 5BXZA 3RWRD 5LA6B 2WAMA 3D3IA 4DV0B 5LP6C 1W0JG 1XUQA 5C93A 1VQMV 1TUBB 1N8RW 2QWNB 5H9CA 4NYKA 3OT7A 4ZHQA 3G71V 4LF9B 2EIJB 3SYAA 3KCYA 1K9MW 4UFZA 5DN6G 4FM2A 1G6UA 2CH7B 3ZHRA 4J7KA 1SF9A 4LH7A 4G27B 4YJ2B 3LNMB 4LF9O 4P9OA 4ZI7B 4F6RB 4X89A 3ABTA 5J2TB 3VOUA 3JALA 1S5LZ 1KKCA 3C3SA 5K1PA 4F4LA 4GX2A 2F66C 4EB6B 3CRMA 5CA0A 4AI8A 5LMNO 1N4CA 4X1KB 2CUGA 1GH6A 4PA9A 1WPBA 4DK0A 2HFEC 1FXKC 3SGIA 4X1IA 3ZJZA 5FPOA 1S77D 1H8EG 1LUWA 4CC5A 5D5QA 1NH2B 5L3DA 3ZRVA 3X2QB 2UU9B 4CZZA 2ATKC 1XMOO 1YJ9V 1WP8A 1XOUA 2YUAA 2Y4TA 2Q67A 1PNKA 1JFFB 3ETGA 1XNRO 4HNAA 4FFBA 3J81N 2V1DA 5KLVH 3CMAV 1PD3A 3JD4A 2DQ0A 3P3PA 4UV9A 1V9PA 2FTKA 2XAHA 1TA8A 3FB6C 4FZ0A 3ICXA 4GCZA 4CH4A 3JAMN 4OPHA 2YI8A 1IBMB 1X4TA 1AR4A 1AR5A 2LJ2A 4FVMA 1YTFD 2YXYA 4LBEC 5EBWC 5JCOC 1VF5B 4J9YB 4D7SA 4DYLA 1K7DA 3W7XA 4O4LB 5L3CA 5BY1A 5JJEB 1QVFU 3OE7G 1P84F 1FS0G 3CRRA 4X1YA 5EBMC 1QVGU 4JI4B 1FPOA 4MVQA 4H0LB 1TAEA 1PM9A 3HR0A 4KUMA 2EIMB 1QR9A 4DV7B 3HKDB 1EZJA 3LSQA 4BIZA 3STZC 2L35A 5IJ0B 5J2UB 1EFRG 2OT5A 4A5UB 2PI5A 2BCCH 1GAXA 2A06H 3BCCH 2W0XA 4GLXA 1AI5A 2X6CA 1CPYA 4WFGA 1YHQV 1JQ0A 4DV6B 2W6IG 1SZTA 3Q4HA 2AZ2A 1KMIZ 2X7RB 2YICA 5B1BB 3FD9A 4JI2B 5D5PA 4JI8O 3FAVB 5LP6A 4YY3B 2FL4A 3W7SA 1F4MA 4CS4A 1N33O 3ZRWA 4BR6A 2P5OA 1VQ6V 2RDCA 3WB2A 4FLWA 3ETDA 3ZHTA 4JAVA 4H37A 1NJIW 3T1HO 2A0LA 4EFBA 2KB1A 1Q6UA 1I08A 4B3MO 1YXBA 1TGOA 4B3SB 3B77A 3JCZA 4DR5B 1XNQO 1VQ8V 2Y69C 1XL4A 2VRZA 1PL4A 1RM1B 3UCSC 4DO2A 2LO1A 2XAQA 3W7UA 4DR2B 4JI8B 2JGDA 2JJ1G 3OM3B 2RJZA 3L70H 3A8TA 3G4SV 2BTOA 3TK1A 1VEWA 2DWEC 1Q8IA 1K73W 1AI6A 5J9PC 2QKAA 2EIKB 5KX5A 2UXNA 4GKJB 3ZCCA 4ZOLB 4FLYA 4LC1A 3UKMA 2X0LA 1SRYA 4MVMA 3ZN0A 4PDRA 4MTOA 2QM8A 2YEVA 2ILMA 4JF3A 1XDCA 3JASA 3T1YB 5H2FZ 4BW5A 2AGAA 3AK3A 3CP1A 2VWKA 5B1NA 1YZBA 1NR7A 4QJFB 5LYJA 3FB8C 1M93A 2F4VO 2HLDG 4LR3A 1OCCB 4F6RA 2YS8A 4N21A 5JH7A 2LW1A 4DR3B 2F93B 3A0HZ 4LWSA 2WLNA 3CC4V 1E1RG 1AP6A 5IE9A 1VQLV 5GONB 4CS3A 1XI1A 3CJHB 4O2AB 3H1KH 3K08A 2WWWA 1EN4A 3FKSG 3E22B 5JVDB 3TXQA 3AG4B 1TUBA 1VF7A 4CS2A 2ZM6O 1W59A 1WAZA 3VQYA 2ZR3A 3CCUV 4QIWF 4JYAO 3SPHA 4KXRA 5LA6A 4WCEV 1AVMA 2BOBC 2UXDO 3ZEDA 3H9VA 4XDLA 5KHGA 1GM7A 1HW7A 4BIUA 4F6EA 3HKBB 3AG7A 5KUMA 3RYFA 3OTOB 2ZXWC 4X1YB 1SKVA 4KL1A 5L3EA 4J80A 3SJQC 2Q0OC 4JYCA 4DR1B 2GUZB 2ZE5A 4MTGA 3P3NA 1QLEB 3N2GB 2Y0PA 3K9AA 4FLVA 4UCUA 4AHCA 5JCOA 1DF4A 4JI5B 3RT3C 4JZ2A 1D5NA 5JQGB 3ASOB 2V7QG 3FFQA 3W7TA 1OCOB 4DR6O 4JV5B 4X20B 2BSKA 2YIBA 4U3JB 5LXTB 3AG2B 1L1FA 3JATA 2KKWA 1Q3EA 2P6JA 5IWAO 5BR8O 2Q6AA 4DV0O 5BR8B 4D6TH 2XOKG 1N32B 1J5EB 2CTRA 2ZNJA 2V4DA 5LGNA 4XDKA 5EC2C 4JTCB 1YIJV 3E2EA 3FB7C 1KU9A 5CMUA 2FYUH 4PDVA 4TQDA 1JFFA 4EFEA 2GBOA 5B3SC 3U0ZA 1PPJH 4QNHB 2JDIG 2CGOA 4MVUA 5BZBA 1IBKO 4FM0A 5IJ9B 4I5SA 3CJHA 3ZRSA 1WB7A 2QEXV 4PI2A 2QKCA 3CCMV 5B1AC 2JGUA 3ASNC 5B66Z 4X1KA 2R70A 1U96A 1MG1A 2QA4V 4I4TA 4JAUA 2LGQA 3APOA 3ETEA 3RYIB 3SJCC 2EZOA 1IVSA 1NKDA 1XMQO 3QF7A 2PYLA 1EN5A 4GYCB 2UXDB 4LNUA 2NR5A 2UXCO 1FXKA 5B1OA 1VQPV 4ZOLA 2FMLA 3VQXA 2EINB 4NTYA 1XHXA 4I50B 1DGSA 1MSDA 4RWUA 4DR4O 3K9SA 1I5XA 4HBNA 1R6KA 3RYHB 3JD1A 2GTSA 3ETQA 2EILC 2IH3C 4QE7A 4YIOA 4CH3A 1BT8A 3T4DA 2PYJA 3EFFK 2M7WA 3D36A 1SQVH 1VMGA 3JAKB 4NXNO 1JX9A 1YJNV 2K1EA 5FNVA 5EC1C 3F7VC 2DN9A 1OCRC 3RW0A 3GVMA 3UM7A 2ZE6A 5EYPA 1BHAA 1NTZH 5A2QN 1H2SB 2GDSA 1VF6C 3DGEA 4O4IA 4DR7O 1E1QG 1SQPH 4R50A 2IJIA 1H38A 4K3AA 3CXCU 1G4YB 1RP3B 4JI6O 5E79Z 1EN6A 2Q8VA 5KHJA 2UXXA 1BQ0A 3JCUZ 1BE3H 1ZTEA 2QWOB 1L0LH 3OTOO 1ZL8B 3OUFA 1XEQA 5HFMA 2WLIB 3B2EE 3EXAA 2XUMA 3JAWA 3LUTB 1Y6XA 5IYZA 4PA4A 1K5SA 3AG1C 4MVOA 4YJ3A 3UO2A 2P7TC 3RGBA 3OEEG 4B08A 4TV8A 4X66B 1V54C 3BFRA 3ML0A 4UVCA 1Y76A 2VWJA 3ZMVA 2LFRA 2ARHA 4ASUG 1M9NA 3KKYA 2IJJA 3IGAC 1WA8B 3CC7V 4YY3O 3J80N 3ABUA 2Z5UA 3WU2Z 4DUYB 1N33B 2WLLA 5LOVB 5H5NA 1FD9A 1SETA 2Y0IA 1ZUQA 1US6A 1AI4A 4BIOA 3K04A 1M1KW 3SYPA 1GMGA 2NNUA 4FLXA 4J11A 1K8AW 1O9HA 3G6BA 1HNWO 4B7KA 4RO2A 1HNWB 4X8AA 3C90A 1HR0O 4EKWA 3JASB 1VQ9V 1ZWIC 4JI3B 3S3XA 4NXNB 1B04A 3T2MA 1XQ8A 1YEWA 1NI8A 4HNAB 1RFYA 2ZKOA 1O9GA 2P4KA 4GKKO 2AHYA 3GWOA 4I55B 2R72A 5LHIA 4J7JA 1IBKB 4J41A 1L0NH 4GKJO 4H13B 1SA0B 1LNQA 2ZQMA 3QO7A 2XNDG 2EJ7A 2ZDIC 2WLLB 1ENVA 2Z3YA 2QJ1A 2PZSA 5E1AC 1AP5A 4HYOA 2QDOA 3NXSA 3PJSK 3B4SA 1KC8W 3BPZA 2OWOA 1BZKA 4UVAA 3ASNB 2OCCB 3E35A 1R1BA 4DV1O 3R65A 2IW5A 5LHHA 1SQQH 2N74A 1Q43A 2P4VA 1SQBH 1FFXA 4G2KA 3S3WA 1KP3A 3HKCB 4DV4B 2K9PA 4FM1A 4JI2O 2HR3A 3VBBA 2UXCB 4O2BA 3HKCA 1JOYA 3E8HA 2XT9A 1FAFA 3P32A 4JI6B 2RCVA 3B8MA 2HG5C 4O4IB 5EZYA 3AG4C 3LNNA 4DV1B 4B3MB 3BHPA 5J2UA 1KD1W 2WLIA 3APQA 4JYYA 4K8XA 4JGSA 4IIJB 3JARB 2KG7A 3D3QA 2F1MA 3QO8A 1HNZO 4K8ZA 1E79G 4GX0A 1Q7YW 4K0KO 1OCRB 5JVDA 5C8YB 2MW2B 3K3WA 3WG7C 2E74B 1M5IA 4NKGB 4UCSA 3H1LH 1L8DA 3L71H 1P7GA 4UCVA 4N23A 4UVBA 4LF6B 1M57B 3MHSC 4WFHA 4DV5B 4LF8O 2Q9LA 4B3RB 2XAFA 1SA0A 4R6ZA 3ZIAG 4FK5C 1B6QA 1AILA 3OR7C 5GTIZ 1QQCA 4KP4A 2DQ3A 4PA6A 1VIBA 4OPAA 1NH2D 4P30A 5LYJB 3IFXA 4LF7B 3LDCA 4AQYB 2Q7GA 3CCRV 3K57A 2RN9A 2P67A 4MTFA 4BWAA 4OX9B 2VS0A 4MVZA 2OYQA 1YVWA 2UXBO 3L75H 3OMAB 3H01A 4FLTA 2JIZG 1NBMG 2YIDA 3M7MX 1D2DA 1WP7A 2IJKA 2DJVA 2PI4A 4B3RO 2LW7A 3FB5C 2Q4PA 3K0GA 1Q81W 5CB4A 3AK2A 4KFMA 5IJ9A 3A2FA 1QHTA 2JEXA 3H1HH 1X59A 4DR7B 1SQFA 2EBOA 4QPJA 4JASA 1AI7A 2WLKA 4PHZA 5C8YA 5IY5C 3EVKA 3IC7A 4LCUC 2E5LB 4FJCC 1RSOB 3D36C 1ZX3A 3JYCA 3M99B 1DF5A 1I94O 3K06A 3CS5A 4Q6GA 1SC5B 3ZMZA 5LOVA 2X6AA 3BRCA 1QNMA 2IM9A 3H1JH 3G80A 4X64O 4R8CA 4X64B 4OXSA 3JAWB 1BL8A 2Q68A 4P9PA 3ABLC 4X62B 4CH6A 4DR1O 4GX5A 1KBHA 2QM4A 4IIJA 4DV6O 3LSUA 1GM9A 1K92A 4WBNA 5BMVA 1Q5OA 3E8FA 1QLEC 1R73A 3CHXA 2Q5ZA 3EHBB 2BE3A 3ZX6A 4O4JB 2BSKB 4DR6B 1WB8A 1Y66A 4FMTA 3OUSA 1SZXA 4C7UA 4WFEA 4O4JA 2E3CA 2RQ6A 1XNRB 1K3EA 4MVRA 3N2GA 3ZHVA 1N34O 2H94A 2YIBD 1Z5VA 5JJNB 1IXMA 2F43G 2AXTZ 3N2KB 2ADPA 1Z2GA 2Z0AA 5EBLC 3U10A 5LHGA 4LF6O 1A32A 3LSSA 3DSQA 1KECA 3K59A 1Y74A 4ZIBA 2M6YA 1RPRA 1WN7A 1S5JA 1J5EO 4DR2O 1VQNV 2LQTA 1K4CC 4RQEA 5CBHA 1DK1A 4DR5O 1Q86W 1N36B 4YHHO 5IYCO 3DTUB 4GT1A 4J10A 4YHHB 2ZIMA 2GSMB 4LWSB 2HJDA 5B1AB 3T1HB 2E5LO 1R3IC 4DUZO 2XAGA 3O65A 4CC6A 1MMMA 4MW8A 3UO3A 3T1YO 2JVDA 4ZBMA 4B7EA 4I4TB 4JYBA 4JI7O 1I7FA 4LFBO 3CRAA 5KX5B 1SS3A 1V54B 3JSNA 4UB6Z 2B9ZA 4NVPA 3H1IH 3JD2A 2EINC 1J95A 2QWRB 3BA9A 4DV4O 2F95B 1R6TA 3OMNB 4UUJC 1NR1A 1KKDA 2E75B 4PA3A 3DC5A 1VF6A 2PTMA 2WLHA 3E8GA 5IT9N 3SR2C 2P06A 3WFVA 4EB6A 3K5OA 3RYCB 1UFIA 1YITV 4FFKA 2GTAA 4ZI7A 1K33A 3VQWA 1AR1B 1MABG 4JYAB 2WA4A 5ITZA 3CCVV 1FJGO 4RUEA 5LXTA 3STLC 5FPRA 1R3KC 4Z2WA 4JV5O 2RMKB 4JZGA 5JQGA 5LL6Y 1GTOA 2HJFC 4NR1A 1ZL8A 3MDSA 3MAQA 3N27A 4ZHQB 1PL0A 3QG5A 4B3SO 1WJZA 1N32O 4TV8B 2LGWA 3SPJA 1JCHA 4IYIA 3K5MA 1YSCA 1AJPA 3RYFB 5IYZB 4FLUA 4DXWA 2QE7G 2CDYA 4I0XA 4DK1A 2EZPA 3ZN1A 4PJ0Z 3M8AA 1OCOC 4WF9V 3GB7C 3ZRWB 1BCCH 1M90W 4MT8A 3JAKA 5IY5B 4LH6A 1MOFA 2A79B 3R66A 4XBFA 2UUAO 4NXMO 4FIPC 1G1XB 2FKXA 4LFBB 3I5DA 1FFXB 3HKEA 3SJBC 2BTQA 2ZE8A 3AK1A 1MSWD 3KCXA 4O4LA 4B3TO 1HP8A 2XTAA 2VQEB 3ABMB 5IJ0A 1IBMO 1ZLZA 1KYOF 3MHHC 1ZSPA 3DC6A 2EIMC 3I55V 3LDDA 1XMQB 2B1IA 3C3TA 2VQEO 2GHYA 3OD4A 4LFCO 2JJ2G 2Q69A 1U97A 2IU3A 1HDJA 1YDXA 2XHBA 5TISZ 3CC2V 1PNLA 2ZT9B 2ZE7A 4TQFA 3D8CA 1FFTB 4X65B 5KMGA 4LNUB 1NQTA 4X65O 3X2QC 1YTFB 2ITDC 4R7CA 4RAIA 3T1CA 1YCIA 4XDJA 1H8HG 2CAZC 1EM1A 1K4DC 1I0HA 1Q90D 1WA8A 1Q6HA 2VQFB 5GW7A 1Y67A 4X9QA 3CE2A 3CYOA 1GRJA 4DRXA 3BVOA 4LFCB 2QSAA 1B06A 2X6BA 3P30A 4H33A 4YJ3B 3KZIZ 1BHBA 3JATB 5B5EZ 1F7YA 3BAAA 3E83A 1JR9A 1KB9F 5JWPA 2CK3G 2JGDB 2BTQB 1Y74B 3CRQA 3CD6V 3ZHQA 2ETNA 3ZHUA 3CCLV 3K0DA 3K03A 1CP9A 1Y76B 3AEIA 3BEHA 3HB3B 1HNZB 1AJNA 4RQFA 1NS1A 5KUKA 3SDLA 1Z5WA 3QTCA 3CCEV 3NR7A 5EYPB 1GN4A 1LUVA 4I0XB 2JEUA 3SPGA 1YJWV 1OHHG 1IBLO 2C2AA 5KHHA 1GKFA 2EJRA 2Q7EA 3ZBHA 2AZ0A 3L73H 4PA7A 5LGUA 3FAVA 5LP6B 2W0FC 1M56C 4FLZA 2UU9O 4JI4O 1K97A 3QO5A 3OAAG 4O2BB 2QGNA 3Q4HB 2ADQB 2P90A 1VQOV 4LF5O 3E8BA 2QM7A 1NTMH 4D7TA 1UJWB 3CWBH 4PV1B 1KQSU 4L87A 1UPGA 4DUZB 4X88A 4IL6Z 3OEHG 2CGNA 1W2BU 2DOSA 5ITZB 2HVJC 2QTOA 3FX7A 4LF4B 3CCSV 1IXBA 5EK0A 1M57C 3B8NA 1MZEA 4IHJB 4K35A 4BAYA 4JPRA 3PN1A 3OFNG 4E4EA 2A3QA 1RSOA 2R9IA 3ABKC 1JJ2U 3B09A 3L72H 2ZM6B 3CRCA 5KAIZ 2NLJC 1IZ3A 5CBGA 2Y4UA 1VQ5V 2BOCC 2ZINA 2IJHA 4PDLA 1AB3A 3CXHF 2QWPB 1K34A 5A9GA 1FXKB 3U11A 1DLBA 4J7ZA 4I50A 4JTAB 4I55A 2ZCEA 1B3QA 4DW0A 5HFLA 2DWDC 3RVYA 1R3JC 2G38A 2ZNIA 3THOA 1P49A 1IBLB 4YXWG 2XAJA 3CCJV 3OGIB 3IC9A 2ZIOA 4W4LA 4DRXB 5CA3A 1ZAUA 3QNEA 3RYIA 1SESA 3AG3B 4NTWA 3OW2U 2UUCB 1GN6A 1XREA 1I94B 3ABMC 5CBFA 1N36O 1HWYA 1PNMA 4I9WA 5J2TA 4X20A 1VQ7V 1Q82W 3TJTA 3CSXA 5KMGB 1NT2B 4DV3O 4CH5A 3CMEV 1QCEA 3SPIA 1PP9H 3L74H 3KG2A 3SPCA 2D3OW 3IAYA 2IBZH 2DW4A 3SJAC 3N2KA 2PF4E 5CN0A 3AG2C 2PY5A 4O4HB 4NB5A 1I5YA 2HHHO 3SYOA 4H44B 2WLMA 2UUCO 4Z1MG 4IT5A 1S5HC 2WA3A 5EZYB 3F7YC 1N0NA 4U3JA 2E76B 4JI5O 2R9RB 5AG2A 4TOIA 3K5NA 1H2GA 5B3SB 3E89A 3UT5B 4WBNB 2L6LA 5BMVB 3HKDA 3JD0A 3HKEB 2EIKC 1IX9A 2JS3A 4UCRA 2OIGA 2QKSA 5CA1B 2GUZA 2CTQA 5JJJB 1D5AA 3JSLA 3IJ4A 1N34B 1URFA 3ZHSA 4OX9O 2FB5A 3WG7B 1BGYH 3UQ8A 5H6RA 5EIBC 1JJOA 1JA8A 5GONA 5LMNB 2PGGA 4WFFA 1XNQB 1TUEB 2HP8A 5F2VO 4PELA 4KHPB 1GN3A 1S72V 4DV2O 5FL7G 4LF7O 4YIPA 5JH7B 2HHHB 1GM8A 3QVNA 5B1BC 5KA5A 1BSMA 2KSDA 1YF2A 1PKXA 1SQXH 4B3TB 1OCZC 2KQXA 2PUSA 4WFBV 5DECA 2JS5A 3OMIB 1FXHA 4PI0A 4LFAO 5IYBO 3RYHA 1XILA 2WPDG 3OGCC 3OTFA 1QLNA 5CB4B 2Q73A 2JK5C 1QU7A 1EZVH 2A9HA 1P4RA 1NU1H 1BQZA 3A0BZ 4DV3B 1F4NA 1TVKB 4GKKB 1F51A 4I7ZB 2JRIA 1NVPB 2UUAB 1WNSA 4LF5B 2YXLA 4X1IB
chains in the Genus database with same CATH topology
1YSCA 1M1KW 1EZJA 1COWG 3LSQA 2H8PC 3SYPA 4BIZA 1GMGA 1AJPA 2NNUA 3STZC 4DXWA 1QBZA 2QE7G 4GX1A 1K8AW 4HAMA 1V55C 2LFSA 3ZMUA 1RM1C 1EFRG 2EZPA 2OT5A 4RO2A 3ZN1A 4X8AA 2PI5A 4EKWA 2W6JG 1OCOC 1VQ9V 1ZWIC 1AI5A 2X6CA 1CPYA 4WF9V 1YI2V 4WFGA 3GB7C 3ZRWB 1M90W 2ITCC 1YHQV 4MT8A 2YEVB 2B5UA 1OCCC 5IY5B 1JQ0A 3T2MA 2OTJV 1MOFA 2HKOA 2XASA 2A79B 2W6IG 1THZA 1SZTA 2AHYA 3ABKB 3GWOA 2X7RB 5LHIA 4CBCA 5B1BB 4XBFA 4FIPC 1LNQA 4LP8A 2ZQMA 3QO7A 2XNDG 2IH1C 1FXVA 4ZKIA 3W7SA 1F4MA 2ZDIC 2WLLB 1SERA 1MSWD 2HVKC 2WSSG 3ZRWA 1VQ6V 3ASOC 2ZD9A 1ENVA 2Z3YA 2MK3A 5IDJA 1NVPD 3ABLB 1K5QA 4MTXA 2DYRB 3ETDA 5E1AC 4JAVA 4H37A 1NJIW 4HYOA 3NXSA 2A0LA 3PJSK 3ABMB 2KB1A 1QR8A 3MHHC 1KC8W 2EIMC 1JVMA 3I55V 3LDDA 1WLEA 2B1GA 3I56V 4UVAA 2B1IA 3B77A 3JCZA 3TETA 1VQ8V 2DYSC 2Y69C 3ASNB 2GHYA 2OCCB 1XL4A 3E35A 2JJ2G 1V55B 1GK9A 2Q69A 1RM1B 2IU3A 4DO2A 4TSFG 2XAQA 3W7UA 3R65A 2IW5A 5LHHA 3CC2V 3OM3B 2JJ1G 4UV8A 1PNLA 3G4SV 3TK1A 2DWEC 1K73W 1AI6A 5J9PC 4G2KA 1FFTB 2AHZA 2EIKB 1KP3A 1NQTA 2UXNA 3ZCCA 2HR3A 5DM6V 4RUFA 3X2QC 3VBBA 1YTFB 2ITDC 1P7BA 3E86A 4R7CA 4RAIA 3T1CA 1JOYA 4LC1A 3E8HA 4XDJA 1H8HG 3UKMA 3P32A 1K4DC 2X0LA 1AJQA 1SRYA 4MVMA 3ZN0A 4PDRA 5LGTA 4MTOA 2QM8A 2YEVA 5GW7A 1AROP 1GO3F 4JF3A 3CYOA 3B8MA 2HG5C 4BW5A 3CP1A 3BY6A 5B1NA 1NR7A 1F23A 3AG4C 4QJFB 3FB8C 1KD1W 2WLIA 2X6BA 2HLDG 1OCCB 3P30A 4H33A 4MW3A 4N21A 4TWKA 4JGSA 5LBQA 1BHBA 2WLNA 3E83A 3CC4V 3QO8A 1E1RG 4HZ3A 1VQLV 1WPXA 1S3JA 1E79G 2LP7A 4GX0A 5KA6A 5L3FA 1Q7YW 1OCRB 3ZMTA 2CK3G 3K3WA 3WG7C 3K08A 4FPPA 3CD6V 2WWWA 1R3LC 4N23A 4UVBA 1ORQC 3CCLV 3K0DA 3FKSG 1M57B 3K03A 3MHSC 3A0RA 3CPWU 2EILB 4WFHA 1CP9A 3AG4B 2XAFA 4R6ZA 3AEIA 3BEHA 3HB3B 3ZIAG 3LDEA 1JPXA 4FK5C 3RBZA 3ZRXA 1B6QA 3OR7C 1AJNA 2ZR3A 4KP4A 3CCUV 4QIWF 4RQFA 3SPHA 2IU0A 3JD3A 1R6NA 2DQ3A 4PA6A 5L3GA 5KUKA 4P2ZA 4WCEV 1NH2D 4P30A 1W0KG 2BOBC 3IFXA 3CCEV 1Y4MA 3F5WC 3LDCA 1EBOA 3FYEB 2Y48A 1KP2A 2ZDIA 3CCRV 2JEUA 4MTFA 2P67A 3SPGA 3SYQA 1OHHG 1YJWV 4U7NA 2C2AA 4XDLA 1GKFA 2EJRA 4MVZA 1GM7A 4Q20A 1ROPA 4PA7A 4G28B 4WFAV 5LGUA 3CCQV 4BIUA 5KUMA 2W0FC 1M56C 3OMAB 2ZXWC 1XL6A 3H01A 2JIZG 1K97A 1NBMG 3QO5A 4PDMA 3RVZA 3T4ZA 5L3EA 3OAAG 3W7WA 2P90A 3SJQC 1VQOV 2IJKA 3E8BA 2PI4A 4JYCA 2YSUB 3FB5C 2QM7A 4MTGA 4U7OA 3K0GA 3MD0A 1UJWB 1Q81W 1QLEB 3ZMSA 1OCZB 1KQSU 4L87A 3K9AA 4KFMA 4X88A 2JEXA 3OEHG 1W2BU 1DF4A 3SYCA 2EBOA 4QPJA 4JASA 1AI7A 3ASOB 2HVJC 2V7QG 2QTOA 2WLKA 1S76D 3CCSV 5EK0A 4QE9A 3W7TA 1OCOB 2OTLV 5IY5C 1M57C 1OZ0A 3IC7A 3B8NA 4LCUC 3AG2B 1L1FA 4FJCC 1CEZA 1BMFG 2ZXWB 4MVSA 4BAYA 4JPRA 5IYDO 3OFNG 3JYCA 3M99B 2P6JA 2R9IA 3TCUA 1DF5A 2Q6AA 3ABKC 1JJ2U 2XOKG 3K06A 4JTDB 3ZMZA 2X6AA 1VQKV 5LGNA 4XDKA 5EC2C 2NLJC 4JTCB 1YIJV 3E2EA 2ZR2A 5CBGA 3FB7C 3G6EV 1VQ5V 5CMUA 1VQ4V 2BOCC 3K79A 2IJHA 4PDVA 4PDLA 4TT3G 4R8CA 4OXSA 2DYRC 1BL8A 1K34A 2Q68A 4P9PA 5B3SC 1FXKB 3ABLC 4QNHB 1DLBA 2JDIG 3AG3C 4MVUA 5BZBA 4MSWC 4MS2A 4GX5A 3HPLC 4I5SA 3ZRSA 1M56B 4JTAB 2QEXV 4QPKA 2WLJA 4UXNA 1GM9A 1K92A 5HFLA 2DWDC 4J9ZB 1R3JC 5H6QA 3RVYA 3E8FA 3CCMV 1G8MA 1QLEC 1S0VA 1R73A 5B1AC 2DYSB 3EHBB 5L3BA 2Y69B 3ASNC 3FYIB 2EIJC 1MG1A 1RPOA 3OR6C 2QA4V 2OCCC 4YXWG 2XAJA 4JAUA 3ETEA 3CCJV 2EZOA 1Y66A 5CA3A 4FMTA 4E2LA 3OUSA 1NKDA 3QNEA 3AG1B 1SESA 4WFEA 3AG3B 3OW2U 2WAMA 3D3IA 3ABMC 5CBFA 1K3EA 1HWYA 1W0JG 4MVRA 5C93A 1PNMA 1VQMV 2H94A 4I9WA 1IXMA 2F43G 1VQ7V 1N8RW 1FXKA 5H9CA 5B1OA 1VQPV 2EINB 1Q82W 3G71V 5EBLC 3CMEV 2EIJB 1QCEA 3SYAA 5LHGA 3SPIA 3KG2A 1I5XA 3LSSA 3SPCA 2D3OW 1KECA 5DN6G 1K9MW 1R6KA 1RPRA 3JD1A 2DW4A 1VQNV 1K4CC 2EILC 4RQEA 5CBHA 2IH3C 5CN0A 3AG2C 4QE7A 4G27B 3LNMB 3T4DA 4P9OA 3EFFK 1I5YA 2M7WA 3D36A 1Q86W 3SYOA 5IYCO 3DTUB 3ABTA 4X89A 4GT1A 2WLMA 4Z1MG 2GSMB 3VOUA 1S5HC 1JX9A 4F4LA 2K1EA 4GX2A 5B1AB 5EC1C 1YJNV 3F7VC 1OCRC 3F7YC 3RW0A 3UM7A 1R3IC 1BHAA 2R9RB 2XAGA 3DGEA 4MW8A 1H2GA 5B3SB 1E1QG 4PA9A 4ZBMA 3E89A 4R50A 2IJIA 1H38A 4JYBA 2HFEC 1FXKC 3CXCU 1G4YB 3ZJZA 1S77D 3JD0A 1H8EG 2EIKC 1NH2B 5L3DA 1V54B 3ZRVA 2QKSA 3X2QB 4CZZA 2ATKC 2UXXA 1YJ9V 3JD2A 2EINC 1J95A 2Q67A 1PNKA 3ETGA 3OUFA 5HFMA 3OMNB 2WLIB 4UUJC 1NR1A 3WG7B 2V1DA 1KKDA 3LUTB 5H6RA 4PA3A 3CMAV 1PD3A 3JD4A 2DQ0A 4UV9A 2WLHA 2FTKA 3E8GA 4WFFA 2XAHA 1TUEB 4PA4A 3WFVA 4PELA 3FB6C 1K5SA 1YITV 3AG1C 1S72V 4GCZA 5FL7G 4MVOA 2P7TC 3OEEG 1V54C 1GM8A 1K33A 3ML0A 4UVCA 5B1BC 5KA5A 1AR1B 1MABG 3ZMVA 1PKXA 1OCZC 2LFRA 3CCVV 4RUEA 3STLC 4WFBV 1R3KC 4LBEC 5EBWC 1YTFD 4ASUG 1M9NA 3OMIB 4J9YB 1FXHA 2IJJA 5IYBO 3IGAC 2WPDG 1K7DA 3W7XA 3OGCC 1QLNA 3CC7V 2JK5C 3ABUA 2Z5UA 5L3CA 1GTOA 2A9HA 2HJFC 1P4RA 2WLLA 1PL0A 1SETA 1QVFU 3OE7G 1FS0G 1F4NA 5EBMC 1QVGU 1F51A 1NVPB 4MVQA 1AI4A 3SPJA 1JCHA 3K04A 4KUMA 1DTOA 2EIMB 1QR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEV A;  4P9O A;  5IY5 C;  1M57 C;  3EFF K;  2H8P C;  3SYP A;  4LCU C;  4QE9 A;  3STZ C;  3SYO A;  4X89 A;  2HG5 C;  4GX1 A;  4DXW A;  2WLM A;  1V55 C;  3VOU A;  4BW5 A;  4MVS A;  4RO2 A;  3JYC A;  1S5H C;  3AG4 C;  4F4L A;  2K1E A;  4GX2 A;  3FB8 C;  4X8A A;  5EC1 C;  3F7V C;  4EKW A;  3TCU A;  2Q6A A;  3ABK C;  1OCR C;  2WLI A;  1OCO C;  2X6B A;  3F7Y C;  1ZWI C;  2X6C A;  3RW0 A;  3UM7 A;  4WFG A;  3GB7 C;  1R3I C;  3K06 A;  4H33 A;  4JTD B;  4MW3 A;  4TWK A;  2ITC C;  2R9R B;  1OCC C;  2X6A A;  3T2M A;  2WLN A;  4MW8 A;  2NLJ C;  3E83 A;  4JTC B;  4XDK A;  5EC2 C;  5CBG A;  3FB7 C;  4PA9 A;  4HZ3 A;  3E89 A;  2A79 B;  4ZBM A;  2BOC C;  4R50 A;  4GX0 A;  2AHY A;  4PDV A;  2HFE C;  4PDL A;  4R8C A;  1G4Y B;  3ZJZ A;  4OXS A;  2DYR C;  4CBC A;  2EIK C;  1BL8 A;  5B3S C;  2Q68 A;  4P9P A;  3WG7 C;  3ABL C;  4QNH B;  3AG3 C;  4MVU A;  3K08 A;  2QKS A;  5BZB A;  4MSW C;  2ATK C;  1R3L C;  1LNQ A;  4LP8 A;  4MS2 A;  4GX5 A;  1ORQ C;  3HPL C;  2EIN C;  2IH1 C;  3K03 A;  3K0D A;  1J95 A;  3ZRS A;  4JTA B;  2Q67 A;  2WLL B;  4WFH A;  2HVK C;  3OUF A;  2WLJ A;  3ASO C;  2ZD9 A;  2DWD C;  4J9Z B;  1R3J C;  2WLI B;  4R6Z A;  4UUJ C;  3RVY A;  3BEH A;  3E8F A;  1KKD A;  1QLE C;  3LDE A;  5B1A C;  5E1A C;  3RBZ A;  3ASN C;  3LUT B;  3OR7 C;  4PA3 A;  4H37 A;  2EIJ C;  3SPH A;  4HYO A;  3PJS K;  2A0L A;  2WLH A;  4PA6 A;  3OR6 C;  3E8G A;  5KUK A;  2OCC C;  4WFF A;  4P2Z A;  4PA4 A;  2KB1 A;  4P30 A;  3FB6 C;  2BOB C;  3IFX A;  2EIM C;  3AG1 C;  1JVM A;  3F5W C;  3LDD A;  3LDC A;  3OUS A;  2P7T C;  4MVO A;  4WFE A;  3SPG A;  4MTF A;  1V54 C;  3SYQ A;  3TET A;  2DYS C;  4XDL A;  5B1B C;  2Y69 C;  3ABM C;  4MVZ A;  1XL4 A;  5CBF A;  4MVR A;  1OCZ C;  2Q69 A;  4PA7 A;  4G28 B;  4RUE A;  5KUM A;  4I9W A;  3R65 A;  3STL C;  2W0F C;  1M56 C;  2ZXW C;  1XL6 A;  1R3K C;  4LBE C;  5EBW C;  3RVZ A;  4PDM A;  4J9Y B;  3T4Z A;  3IGA C;  3OGC C;  5EBL C;  2JK5 C;  2DWE C;  3SJQ C;  3SYA A;  3E8B A;  5J9P C;  2A9H A;  2HJF C;  2AHZ A;  3SPI A;  3FB5 C;  3KG2 A;  3SPC A;  4MTG A;  3K0G A;  4RUF A;  3X2Q C;  2WLL A;  2ITD C;  1P7B A;  3E86 A;  4R7C A;  4RAI A;  4KFM A;  4X88 A;  3T1C A;  3E8H A;  5EBM C;  4XDJ A;  1K4C C;  2EIL C;  3UKM A;  5CBH A;  2IH3 C;  1K4D C;  3SYC A;  4MVQ A;  3AG2 C;  4MVM A;  4QE7 A;  4PDR A;  2HVJ C;  3SPJ A;  2QTO A;  2WLK A;  3K04 A;  3LNM B;  4G27 B;  5EK0 A;  4MTO A;  3T4D A; 
#chains in the Genus database with same CATH topology
 4JI0 O;  1Q6I A;  1COW G;  2H8P C;  3CB2 A;  2F4V B;  1XHZ A;  1QBZ A;  4GX1 A;  4HAM A;  1V55 C;  2LFS A;  3ZMU A;  1RM1 C;  1MZF A;  3RYC A;  1H2K A;  2W6J G;  4IGG A;  1YI2 V;  1BS3 A;  4TUY A;  2ITC C;  4JI0 B;  2YEV B;  2B5U A;  2YI9 A;  1OCC C;  3JAL B;  4Z1V A;  2OTJ V;  2HKO A;  2XAS A;  1THZ A;  1TVK A;  3ABK B;  4ICG A;  4CBC A;  5LMU O;  1HNX B;  4LP8 A;  3BAB A;  2IH1 C;  2OCH A;  1FXV A;  4ZKI A;  2CE4 A;  1SER A;  2HVK C;  2WSS G;  4TUY B;  3ASO C;  2ZD9 A;  1FJG B;  2MK3 A;  5IDJ A;  4IYH A;  1NVP D;  3ABL B;  1K5Q A;  4MTX A;  2DYR B;  3JAR A;  4OGQ B;  5IWA B;  4K0K B;  4PD4 F;  4DV7 O;  2Q7H A;  4AIL C;  1QR8 A;  2AW9 A;  5EIB D;  1JVM A;  1WLE A;  2B1G A;  3I56 V;  3ZS8 C;  4KHP O;  3TET A;  2DYS C;  4DV2 B;  4DV5 O;  4LF8 B;  1V55 B;  1GK9 A;  4TSF G;  2QWQ B;  3RFR A;  3F5T A;  1HNX O;  3DXR B;  1IDS A;  4UV8 A;  3TXS A;  1XMO B;  4DR4 B;  2EUL A;  2AHZ A;  5DM6 V;  4JI1 B;  4RUF A;  1P7B A;  3E86 A;  1XBL A;  1FYJ A;  3UT5 A;  2DMX A;  1AJQ A;  2UUB O;  4ABM A;  5FLX N;  2CTP A;  5LGT A;  1ARO P;  1GO3 F;  4FZ1 A;  4QGP A;  3VQV A;  5FNV B;  3BY6 A;  1F23 A;  4EEQ A;  2N04 A;  2YXH A;  2UUB B;  1CXZ B;  4O4H A;  4MW3 A;  4TWK A;  4TV9 A;  1H2M A;  5LBQ A;  3BA8 A;  4I9Q A;  3WB1 A;  2DE0 X;  2NN4 A;  2HEP A;  4HZ3 A;  1WPX A;  1S3J A;  2LP7 A;  5KA6 A;  5L3F A;  3ZMT A;  2GV9 A;  4JI7 B;  4J42 A;  2EX3 A;  2YDE A;  1H2N A;  3E22 A;  4W4K A;  1FKA O;  4UCO A;  4FPP A;  1OJH A;  1R3L C;  1ORQ C;  4O2A A;  1N0J A;  3CX5 F;  4U3F H;  3A0R A;  3CPW U;  1MA1 A;  2EIL B;  5LMU B;  3CEI A;  4DW1 A;  4X66 O;  3LDE A;  1JPX A;  3RBZ A;  3ZRX A;  3J7A U;  2CTW A;  2IU0 A;  3JD3 A;  1R6N A;  5L3G A;  2Q0A A;  4P2Z A;  2QTS A;  1W0K G;  1T5E A;  5GTH Z;  1Y4M A;  3F5W C;  1EBO A;  2Y48 A;  3FYE B;  1KP2 A;  2ZDI A;  3SYQ A;  5CA0 B;  4U7N A;  1GN2 A;  2YC0 A;  4Q20 A;  1ROP A;  2VQF O;  4G28 B;  4WFA V;  3CCQ V;  5KAF Z;  1XL6 A;  4FFB B;  1MNG A;  5K1X A;  4JI1 O;  3RVZ A;  4PDM A;  3T4Z A;  2R9A A;  4YJ2 A;  3W7W A;  4BW9 A;  2P22 C;  1H2L A;  2YSU B;  3GWK C;  4U7O A;  3MD0 A;  2N05 A;  3ZMS A;  4NTX A;  1OCZ B;  2UXB B;  3RN4 A;  1VAR A;  4LFA B;  2A7W A;  2QR4 A;  3SYC A;  1VP7 A;  1S76 D;  4QE9 A;  2OTL V;  1SQG A;  3K5L A;  1OZ0 A;  3TGU H;  1NTK H;  4JAA A;  1CEZ A;  1BMF G;  2ZXW B;  4MVS A;  5IYD O;  2ODM A;  4TV9 B;  4L8J A;  4GUN A;  4IHJ A;  3L9D A;  3TCU A;  3WB0 A;  5KHI A;  4JTD B;  2CH7 A;  1KUQ A;  1VQK V;  1M4U A;  4UCT A;  4X62 O;  4LF4 O;  2ZR2 A;  3G6E V;  3B40 A;  2F23 A;  1VQ4 V;  3K79 A;  5KHK A;  4DUY O;  4TT3 G;  2D2C B;  1PV0 A;  2DYR C;  1IUR A;  3O9O A;  3AG3 C;  4NXM B;  4MSW C;  1JMK C;  4MS2 A;  3HPL C;  1M56 B;  3G67 A;  4QPK A;  2OIE A;  2WLJ A;  4UXN A;  5H6Q A;  4J9Z B;  5CA1 A;  1DTO A;  4DR3 O;  3HKB A;  1G8M A;  1S0V A;  2KG7 B;  2DYS B;  5L3B A;  2Y69 B;  3FYI B;  5DED A;  2EIJ C;  2RNB A;  3DXR A;  1NZ6 A;  1RPO A;  3OR6 C;  1HR0 B;  2OCC C;  4AQY O;  4UB8 Z;  2H3O A;  4JI3 O;  3K58 A;  2YIA A;  4GZR B;  4E2L A;  1OV9 A;  3AG1 B;  1LR1 A;  2O57 A;  5BXZ A;  3RWR D;  5LA6 B;  2WAM A;  3D3I A;  4DV0 B;  5LP6 C;  1W0J G;  1XUQ A;  5C93 A;  1VQM V;  1TUB B;  1N8R W;  2QWN B;  5H9C A;  4NYK A;  3OT7 A;  4ZHQ A;  3G71 V;  4LF9 B;  2EIJ B;  3SYA A;  3KCY A;  1K9M W;  4UFZ A;  5DN6 G;  4FM2 A;  1G6U A;  2CH7 B;  3ZHR A;  4J7K A;  1SF9 A;  4LH7 A;  4G27 B;  4YJ2 B;  3LNM B;  4LF9 O;  4P9O A;  4ZI7 B;  4F6R B;  4X89 A;  3ABT A;  5J2T B;  3VOU A;  3JAL A;  1S5L Z;  1KKC A;  3C3S A;  5K1P A;  4F4L A;  4GX2 A;  2F66 C;  4EB6 B;  3CRM A;  5CA0 A;  4AI8 A;  5LMN O;  1N4C A;  4X1K B;  2CUG A;  1GH6 A;  4PA9 A;  1WPB A;  4DK0 A;  2HFE C;  1FXK C;  3SGI A;  4X1I A;  3ZJZ A;  5FPO A;  1S77 D;  1H8E G;  1LUW A;  4CC5 A;  5D5Q A;  1NH2 B;  5L3D A;  3ZRV A;  3X2Q B;  2UU9 B;  4CZZ A;  2ATK C;  1XMO O;  1YJ9 V;  1WP8 A;  1XOU A;  2YUA A;  2Y4T A;  2Q67 A;  1PNK A;  1JFF B;  3ETG A;  1XNR O;  4HNA A;  4FFB A;  3J81 N;  2V1D A;  5KLV H;  3CMA V;  1PD3 A;  3JD4 A;  2DQ0 A;  3P3P A;  4UV9 A;  1V9P A;  2FTK A;  2XAH A;  1TA8 A;  3FB6 C;  4FZ0 A;  3ICX A;  4GCZ A;  4CH4 A;  3JAM N;  4OPH A;  2YI8 A;  1IBM B;  1X4T A;  1AR4 A;  1AR5 A;  2LJ2 A;  4FVM A;  1YTF D;  2YXY A;  4LBE C;  5EBW C;  5JCO C;  1VF5 B;  4J9Y B;  4D7S A;  4DYL A;  1K7D A;  3W7X A;  4O4L B;  5L3C A;  5BY1 A;  5JJE B;  1QVF U;  3OE7 G;  1P84 F;  1FS0 G;  3CRR A;  4X1Y A;  5EBM C;  1QVG U;  4JI4 B;  1FPO A;  4MVQ A;  4H0L B;  1TAE A;  1PM9 A;  3HR0 A;  4KUM A;  2EIM B;  1QR9 A;  4DV7 B;  3HKD B;  1EZJ A;  3LSQ A;  4BIZ A;  3STZ C;  2L35 A;  5IJ0 B;  5J2U B;  1EFR G;  2OT5 A;  4A5U B;  2PI5 A;  2BCC H;  1GAX A;  2A06 H;  3BCC H;  2W0X A;  4GLX A;  1AI5 A;  2X6C A;  1CPY A;  4WFG A;  1YHQ V;  1JQ0 A;  4DV6 B;  2W6I G;  1SZT A;  3Q4H A;  2AZ2 A;  1KMI Z;  2X7R B;  2YIC A;  5B1B B;  3FD9 A;  4JI2 B;  5D5P A;  4JI8 O;  3FAV B;  5LP6 A;  4YY3 B;  2FL4 A;  3W7S A;  1F4M A;  4CS4 A;  1N33 O;  3ZRW A;  4BR6 A;  2P5O A;  1VQ6 V;  2RDC A;  3WB2 A;  4FLW A;  3ETD A;  3ZHT A;  4JAV A;  4H37 A;  1NJI W;  3T1H O;  2A0L A;  4EFB A;  2KB1 A;  1Q6U A;  1I08 A;  4B3M O;  1YXB A;  1TGO A;  4B3S B;  3B77 A;  3JCZ A;  4DR5 B;  1XNQ O;  1VQ8 V;  2Y69 C;  1XL4 A;  2VRZ A;  1PL4 A;  1RM1 B;  3UCS C;  4DO2 A;  2LO1 A;  2XAQ A;  3W7U A;  4DR2 B;  4JI8 B;  2JGD A;  2JJ1 G;  3OM3 B;  2RJZ A;  3L70 H;  3A8T A;  3G4S V;  2BTO A;  3TK1 A;  1VEW A;  2DWE C;  1Q8I A;  1K73 W;  1AI6 A;  5J9P C;  2QKA A;  2EIK B;  5KX5 A;  2UXN A;  4GKJ B;  3ZCC A;  4ZOL B;  4FLY A;  4LC1 A;  3UKM A;  2X0L A;  1SRY A;  4MVM A;  3ZN0 A;  4PDR A;  4MTO A;  2QM8 A;  2YEV A;  2ILM A;  4JF3 A;  1XDC A;  3JAS A;  3T1Y B;  5H2F Z;  4BW5 A;  2AGA A;  3AK3 A;  3CP1 A;  2VWK A;  5B1N A;  1YZB A;  1NR7 A;  4QJF B;  5LYJ A;  3FB8 C;  1M93 A;  2F4V O;  2HLD G;  4LR3 A;  1OCC B;  4F6R A;  2YS8 A;  4N21 A;  5JH7 A;  2LW1 A;  4DR3 B;  2F93 B;  3A0H Z;  4LWS A;  2WLN A;  3CC4 V;  1E1R G;  1AP6 A;  5IE9 A;  1VQL V;  5GON B;  4CS3 A;  1XI1 A;  3CJH B;  4O2A B;  3H1K H;  3K08 A;  2WWW A;  1EN4 A;  3FKS G;  3E22 B;  5JVD B;  3TXQ A;  3AG4 B;  1TUB A;  1VF7 A;  4CS2 A;  2ZM6 O;  1W59 A;  1WAZ A;  3VQY A;  2ZR3 A;  3CCU V;  4QIW F;  4JYA O;  3SPH A;  4KXR A;  5LA6 A;  4WCE V;  1AVM A;  2BOB C;  2UXD O;  3ZED A;  3H9V A;  4XDL A;  5KHG A;  1GM7 A;  1HW7 A;  4BIU A;  4F6E A;  3HKB B;  3AG7 A;  5KUM A;  3RYF A;  3OTO B;  2ZXW C;  4X1Y B;  1SKV A;  4KL1 A;  5L3E A;  4J80 A;  3SJQ C;  2Q0O C;  4JYC A;  4DR1 B;  2GUZ B;  2ZE5 A;  4MTG A;  3P3N A;  1QLE B;  3N2G B;  2Y0P A;  3K9A A;  4FLV A;  4UCU A;  4AHC A;  5JCO A;  1DF4 A;  4JI5 B;  3RT3 C;  4JZ2 A;  1D5N A;  5JQG B;  3ASO B;  2V7Q G;  3FFQ A;  3W7T A;  1OCO B;  4DR6 O;  4JV5 B;  4X20 B;  2BSK A;  2YIB A;  4U3J B;  5LXT B;  3AG2 B;  1L1F A;  3JAT A;  2KKW A;  1Q3E A;  2P6J A;  5IWA O;  5BR8 O;  2Q6A A;  4DV0 O;  5BR8 B;  4D6T H;  2XOK G;  1N32 B;  1J5E B;  2CTR A;  2ZNJ A;  2V4D A;  5LGN A;  4XDK A;  5EC2 C;  4JTC B;  1YIJ V;  3E2E A;  3FB7 C;  1KU9 A;  5CMU A;  2FYU H;  4PDV A;  4TQD A;  1JFF A;  4EFE A;  2GBO A;  5B3S C;  3U0Z A;  1PPJ H;  4QNH B;  2JDI G;  2CGO A;  4MVU A;  5BZB A;  1IBK O;  4FM0 A;  5IJ9 B;  4I5S A;  3CJH A;  3ZRS A;  1WB7 A;  2QEX V;  4PI2 A;  2QKC A;  3CCM V;  5B1A C;  2JGU A;  3ASN C;  5B66 Z;  4X1K A;  2R70 A;  1U96 A;  1MG1 A;  2QA4 V;  4I4T A;  4JAU A;  2LGQ A;  3APO A;  3ETE A;  3RYI B;  3SJC C;  2EZO A;  1IVS A;  1NKD A;  1XMQ O;  3QF7 A;  2PYL A;  1EN5 A;  4GYC B;  2UXD B;  4LNU A;  2NR5 A;  2UXC O;  1FXK A;  5B1O A;  1VQP V;  4ZOL A;  2FML A;  3VQX A;  2EIN B;  4NTY A;  1XHX A;  4I50 B;  1DGS A;  1MSD A;  4RWU A;  4DR4 O;  3K9S A;  1I5X A;  4HBN A;  1R6K A;  3RYH B;  3JD1 A;  2GTS A;  3ETQ A;  2EIL C;  2IH3 C;  4QE7 A;  4YIO A;  4CH3 A;  1BT8 A;  3T4D A;  2PYJ A;  3EFF K;  2M7W A;  3D36 A;  1SQV H;  1VMG A;  3JAK B;  4NXN O;  1JX9 A;  1YJN V;  2K1E A;  5FNV A;  5EC1 C;  3F7V C;  2DN9 A;  1OCR C;  3RW0 A;  3GVM A;  3UM7 A;  2ZE6 A;  5EYP A;  1BHA A;  1NTZ H;  5A2Q N;  1H2S B;  2GDS A;  1VF6 C;  3DGE A;  4O4I A;  4DR7 O;  1E1Q G;  1SQP H;  4R50 A;  2IJI A;  1H38 A;  4K3A A;  3CXC U;  1G4Y B;  1RP3 B;  4JI6 O;  5E79 Z;  1EN6 A;  2Q8V A;  5KHJ A;  2UXX A;  1BQ0 A;  3JCU Z;  1BE3 H;  1ZTE A;  2QWO B;  1L0L H;  3OTO O;  1ZL8 B;  3OUF A;  1XEQ A;  5HFM A;  2WLI B;  3B2E E;  3EXA A;  2XUM A;  3JAW A;  3LUT B;  1Y6X A;  5IYZ A;  4PA4 A;  1K5S A;  3AG1 C;  4MVO A;  4YJ3 A;  3UO2 A;  2P7T C;  3RGB A;  3OEE G;  4B08 A;  4TV8 A;  4X66 B;  1V54 C;  3BFR A;  3ML0 A;  4UVC A;  1Y76 A;  2VWJ A;  3ZMV A;  2LFR A;  2ARH A;  4ASU G;  1M9N A;  3KKY A;  2IJJ A;  3IGA C;  1WA8 B;  3CC7 V;  4YY3 O;  3J80 N;  3ABU A;  2Z5U A;  3WU2 Z;  4DUY B;  1N33 B;  2WLL A;  5LOV B;  5H5N A;  1FD9 A;  1SET A;  2Y0I A;  1ZUQ A;  1US6 A;  1AI4 A;  4BIO A;  3K04 A;  1M1K W;  3SYP A;  1GMG A;  2NNU A;  4FLX A;  4J11 A;  1K8A W;  1O9H A;  3G6B A;  1HNW O;  4B7K A;  4RO2 A;  1HNW B;  4X8A A;  3C90 A;  1HR0 O;  4EKW A;  3JAS B;  1VQ9 V;  1ZWI C;  4JI3 B;  3S3X A;  4NXN B;  1B04 A;  3T2M A;  1XQ8 A;  1YEW A;  1NI8 A;  4HNA B;  1RFY A;  2ZKO A;  1O9G A;  2P4K A;  4GKK O;  2AHY A;  3GWO A;  4I55 B;  2R72 A;  5LHI A;  4J7J A;  1IBK B;  4J41 A;  1L0N H;  4GKJ O;  4H13 B;  1SA0 B;  1LNQ A;  2ZQM A;  3QO7 A;  2XND G;  2EJ7 A;  2ZDI C;  2WLL B;  1ENV A;  2Z3Y A;  2QJ1 A;  2PZS A;  5E1A C;  1AP5 A;  4HYO A;  2QDO A;  3NXS A;  3PJS K;  3B4S A;  1KC8 W;  3BPZ A;  2OWO A;  1BZK A;  4UVA A;  3ASN B;  2OCC B;  3E35 A;  1R1B A;  4DV1 O;  3R65 A;  2IW5 A;  5LHH A;  1SQQ H;  2N74 A;  1Q43 A;  2P4V A;  1SQB H;  1FFX A;  4G2K A;  3S3W A;  1KP3 A;  3HKC B;  4DV4 B;  2K9P A;  4FM1 A;  4JI2 O;  2HR3 A;  3VBB A;  2UXC B;  4O2B A;  3HKC A;  1JOY A;  3E8H A;  2XT9 A;  1FAF A;  3P32 A;  4JI6 B;  2RCV A;  3B8M A;  2HG5 C;  4O4I B;  5EZY A;  3AG4 C;  3LNN A;  4DV1 B;  4B3M B;  3BHP A;  5J2U A;  1KD1 W;  2WLI A;  3APQ A;  4JYY A;  4K8X A;  4JGS A;  4IIJ B;  3JAR B;  2KG7 A;  3D3Q A;  2F1M A;  3QO8 A;  1HNZ O;  4K8Z A;  1E79 G;  4GX0 A;  1Q7Y W;  4K0K O;  1OCR B;  5JVD A;  5C8Y B;  2MW2 B;  3K3W A;  3WG7 C;  2E74 B;  1M5I A;  4NKG B;  4UCS A;  3H1L H;  1L8D A;  3L71 H;  1P7G A;  4UCV A;  4N23 A;  4UVB A;  4LF6 B;  1M57 B;  3MHS C;  4WFH A;  4DV5 B;  4LF8 O;  2Q9L A;  4B3R B;  2XAF A;  1SA0 A;  4R6Z A;  3ZIA G;  4FK5 C;  1B6Q A;  1AIL A;  3OR7 C;  5GTI Z;  1QQC A;  4KP4 A;  2DQ3 A;  4PA6 A;  1VIB A;  4OPA A;  1NH2 D;  4P30 A;  5LYJ B;  3IFX A;  4LF7 B;  3LDC A;  4AQY B;  2Q7G A;  3CCR V;  3K57 A;  2RN9 A;  2P67 A;  4MTF A;  4BWA A;  4OX9 B;  2VS0 A;  4MVZ A;  2OYQ A;  1YVW A;  2UXB O;  3L75 H;  3OMA B;  3H01 A;  4FLT A;  2JIZ G;  1NBM G;  2YID A;  3M7M X;  1D2D A;  1WP7 A;  2IJK A;  2DJV A;  2PI4 A;  4B3R O;  2LW7 A;  3FB5 C;  2Q4P A;  3K0G A;  1Q81 W;  5CB4 A;  3AK2 A;  4KFM A;  5IJ9 A;  3A2F A;  1QHT A;  2JEX A;  3H1H H;  1X59 A;  4DR7 B;  1SQF A;  2EBO A;  4QPJ A;  4JAS A;  1AI7 A;  2WLK A;  4PHZ A;  5C8Y A;  5IY5 C;  3EVK A;  3IC7 A;  4LCU C;  2E5L B;  4FJC C;  1RSO B;  3D36 C;  1ZX3 A;  3JYC A;  3M99 B;  1DF5 A;  1I94 O;  3K06 A;  3CS5 A;  4Q6G A;  1SC5 B;  3ZMZ A;  5LOV A;  2X6A A;  3BRC A;  1QNM A;  2IM9 A;  3H1J H;  3G80 A;  4X64 O;  4R8C A;  4X64 B;  4OXS A;  3JAW B;  1BL8 A;  2Q68 A;  4P9P A;  3ABL C;  4X62 B;  4CH6 A;  4DR1 O;  4GX5 A;  1KBH A;  2QM4 A;  4IIJ A;  4DV6 O;  3LSU A;  1GM9 A;  1K92 A;  4WBN A;  5BMV A;  1Q5O A;  3E8F A;  1QLE C;  1R73 A;  3CHX A;  2Q5Z A;  3EHB B;  2BE3 A;  3ZX6 A;  4O4J B;  2BSK B;  4DR6 B;  1WB8 A;  1Y66 A;  4FMT A;  3OUS A;  1SZX A;  4C7U A;  4WFE A;  4O4J A;  2E3C A;  2RQ6 A;  1XNR B;  1K3E A;  4MVR A;  3N2G A;  3ZHV A;  1N34 O;  2H94 A;  2YIB D;  1Z5V A;  5JJN B;  1IXM A;  2F43 G;  2AXT Z;  3N2K B;  2ADP A;  1Z2G A;  2Z0A A;  5EBL C;  3U10 A;  5LHG A;  4LF6 O;  1A32 A;  3LSS A;  3DSQ A;  1KEC A;  3K59 A;  1Y74 A;  4ZIB A;  2M6Y A;  1RPR A;  1WN7 A;  1S5J A;  1J5E O;  4DR2 O;  1VQN V;  2LQT A;  1K4C C;  4RQE A;  5CBH A;  1DK1 A;  4DR5 O;  1Q86 W;  1N36 B;  4YHH O;  5IYC O;  3DTU B;  4GT1 A;  4J10 A;  4YHH B;  2ZIM A;  2GSM B;  4LWS B;  2HJD A;  5B1A B;  3T1H B;  2E5L O;  1R3I C;  4DUZ O;  2XAG A;  3O65 A;  4CC6 A;  1MMM A;  4MW8 A;  3UO3 A;  3T1Y O;  2JVD A;  4ZBM A;  4B7E A;  4I4T B;  4JYB A;  4JI7 O;  1I7F A;  4LFB O;  3CRA A;  5KX5 B;  1SS3 A;  1V54 B;  3JSN A;  4UB6 Z;  2B9Z A;  4NVP A;  3H1I H;  3JD2 A;  2EIN C;  1J95 A;  2QWR B;  3BA9 A;  4DV4 O;  2F95 B;  1R6T A;  3OMN B;  4UUJ C;  1NR1 A;  1KKD A;  2E75 B;  4PA3 A;  3DC5 A;  1VF6 A;  2PTM A;  2WLH A;  3E8G A;  5IT9 N;  3SR2 C;  2P06 A;  3WFV A;  4EB6 A;  3K5O A;  3RYC B;  1UFI A;  1YIT V;  4FFK A;  2GTA A;  4ZI7 A;  1K33 A;  3VQW A;  1AR1 B;  1MAB G;  4JYA B;  2WA4 A;  5ITZ A;  3CCV V;  1FJG O;  4RUE A;  5LXT A;  3STL C;  5FPR A;  1R3K C;  4Z2W A;  4JV5 O;  2RMK B;  4JZG A;  5JQG A;  5LL6 Y;  1GTO A;  2HJF C;  4NR1 A;  1ZL8 A;  3MDS A;  3MAQ A;  3N27 A;  4ZHQ B;  1PL0 A;  3QG5 A;  4B3S O;  1WJZ A;  1N32 O;  4TV8 B;  2LGW A;  3SPJ A;  1JCH A;  4IYI A;  3K5M A;  1YSC A;  1AJP A;  3RYF B;  5IYZ B;  4FLU A;  4DXW A;  2QE7 G;  2CDY A;  4I0X A;  4DK1 A;  2EZP A;  3ZN1 A;  4PJ0 Z;  3M8A A;  1OCO C;  4WF9 V;  3GB7 C;  3ZRW B;  1BCC H;  1M90 W;  4MT8 A;  3JAK A;  5IY5 B;  4LH6 A;  1MOF A;  2A79 B;  3R66 A;  4XBF A;  2UUA O;  4NXM O;  4FIP C;  1G1X B;  2FKX A;  4LFB B;  3I5D A;  1FFX B;  3HKE A;  3SJB C;  2BTQ A;  2ZE8 A;  3AK1 A;  1MSW D;  3KCX A;  4O4L A;  4B3T O;  1HP8 A;  2XTA A;  2VQE B;  3ABM B;  5IJ0 A;  1IBM O;  1ZLZ A;  1KYO F;  3MHH C;  1ZSP A;  3DC6 A;  2EIM C;  3I55 V;  3LDD A;  1XMQ B;  2B1I A;  3C3T A;  2VQE O;  2GHY A;  3OD4 A;  4LFC O;  2JJ2 G;  2Q69 A;  1U97 A;  2IU3 A;  1HDJ A;  1YDX A;  2XHB A;  5TIS Z;  3CC2 V;  1PNL A;  2ZT9 B;  2ZE7 A;  4TQF A;  3D8C A;  1FFT B;  4X65 B;  5KMG A;  4LNU B;  1NQT A;  4X65 O;  3X2Q C;  1YTF B;  2ITD C;  4R7C A;  4RAI A;  3T1C A;  1YCI A;  4XDJ A;  1H8H G;  2CAZ C;  1EM1 A;  1K4D C;  1I0H A;  1Q90 D;  1WA8 A;  1Q6H A;  2VQF B;  5GW7 A;  1Y67 A;  4X9Q A;  3CE2 A;  3CYO A;  1GRJ A;  4DRX A;  3BVO A;  4LFC B;  2QSA A;  1B06 A;  2X6B A;  3P30 A;  4H33 A;  4YJ3 B;  3KZI Z;  1BHB A;  3JAT B;  5B5E Z;  1F7Y A;  3BAA A;  3E83 A;  1JR9 A;  1KB9 F;  5JWP A;  2CK3 G;  2JGD B;  2BTQ B;  1Y74 B;  3CRQ A;  3CD6 V;  3ZHQ A;  2ETN A;  3ZHU A;  3CCL V;  3K0D A;  3K03 A;  1CP9 A;  1Y76 B;  3AEI A;  3BEH A;  3HB3 B;  1HNZ B;  1AJN A;  4RQF A;  1NS1 A;  5KUK A;  3SDL A;  1Z5W A;  3QTC A;  3CCE V;  3NR7 A;  5EYP B;  1GN4 A;  1LUV A;  4I0X B;  2JEU A;  3SPG A;  1YJW V;  1OHH G;  1IBL O;  2C2A A;  5KHH A;  1GKF A;  2EJR A;  2Q7E A;  3ZBH A;  2AZ0 A;  3L73 H;  4PA7 A;  5LGU A;  3FAV A;  5LP6 B;  2W0F C;  1M56 C;  4FLZ A;  2UU9 O;  4JI4 O;  1K97 A;  3QO5 A;  3OAA G;  4O2B B;  2QGN A;  3Q4H B;  2ADQ B;  2P90 A;  1VQO V;  4LF5 O;  3E8B A;  2QM7 A;  1NTM H;  4D7T A;  1UJW B;  3CWB H;  4PV1 B;  1KQS U;  4L87 A;  1UPG A;  4DUZ B;  4X88 A;  4IL6 Z;  3OEH G;  2CGN A;  1W2B U;  2DOS A;  5ITZ B;  2HVJ C;  2QTO A;  3FX7 A;  4LF4 B;  3CCS V;  1IXB A;  5EK0 A;  1M57 C;  3B8N A;  1MZE A;  4IHJ B;  4K35 A;  4BAY A;  4JPR A;  3PN1 A;  3OFN G;  4E4E A;  2A3Q A;  1RSO A;  2R9I A;  3ABK C;  1JJ2 U;  3B09 A;  3L72 H;  2ZM6 B;  3CRC A;  5KAI Z;  2NLJ C;  1IZ3 A;  5CBG A;  2Y4U A;  1VQ5 V;  2BOC C;  2ZIN A;  2IJH A;  4PDL A;  1AB3 A;  3CXH F;  2QWP B;  1K34 A;  5A9G A;  1FXK B;  3U11 A;  1DLB A;  4J7Z A;  4I50 A;  4JTA B;  4I55 A;  2ZCE A;  1B3Q A;  4DW0 A;  5HFL A;  2DWD C;  3RVY A;  1R3J C;  2G38 A;  2ZNI A;  3THO A;  1P49 A;  1IBL B;  4YXW G;  2XAJ A;  3CCJ V;  3OGI B;  3IC9 A;  2ZIO A;  4W4L A;  4DRX B;  5CA3 A;  1ZAU A;  3QNE A;  3RYI A;  1SES A;  3AG3 B;  4NTW A;  3OW2 U;  2UUC B;  1GN6 A;  1XRE A;  1I94 B;  3ABM C;  5CBF A;  1N36 O;  1HWY A;  1PNM A;  4I9W A;  5J2T A;  4X20 A;  1VQ7 V;  1Q82 W;  3TJT A;  3CSX A;  5KMG B;  1NT2 B;  4DV3 O;  4CH5 A;  3CME V;  1QCE A;  3SPI A;  1PP9 H;  3L74 H;  3KG2 A;  3SPC A;  2D3O W;  3IAY A;  2IBZ H;  2DW4 A;  3SJA C;  3N2K A;  2PF4 E;  5CN0 A;  3AG2 C;  2PY5 A;  4O4H B;  4NB5 A;  1I5Y A;  2HHH O;  3SYO A;  4H44 B;  2WLM A;  2UUC O;  4Z1M G;  4IT5 A;  1S5H C;  2WA3 A;  5EZY B;  3F7Y C;  1N0N A;  4U3J A;  2E76 B;  4JI5 O;  2R9R B;  5AG2 A;  4TOI A;  3K5N A;  1H2G A;  5B3S B;  3E89 A;  3UT5 B;  4WBN B;  2L6L A;  5BMV B;  3HKD A;  3JD0 A;  3HKE B;  2EIK C;  1IX9 A;  2JS3 A;  4UCR A;  2OIG A;  2QKS A;  5CA1 B;  2GUZ A;  2CTQ A;  5JJJ B;  1D5A A;  3JSL A;  3IJ4 A;  1N34 B;  1URF A;  3ZHS A;  4OX9 O;  2FB5 A;  3WG7 B;  1BGY H;  3UQ8 A;  5H6R A;  5EIB C;  1JJO A;  1JA8 A;  5GON A;  5LMN B;  2PGG A;  4WFF A;  1XNQ B;  1TUE B;  2HP8 A;  5F2V O;  4PEL A;  4KHP B;  1GN3 A;  1S72 V;  4DV2 O;  5FL7 G;  4LF7 O;  4YIP A;  5JH7 B;  2HHH B;  1GM8 A;  3QVN A;  5B1B C;  5KA5 A;  1BSM A;  2KSD A;  1YF2 A;  1PKX A;  1SQX H;  4B3T B;  1OCZ C;  2KQX A;  2PUS A;  4WFB V;  5DEC A;  2JS5 A;  3OMI B;  1FXH A;  4PI0 A;  4LFA O;  5IYB O;  3RYH A;  1XIL A;  2WPD G;  3OGC C;  3OTF A;  1QLN A;  5CB4 B;  2Q73 A;  2JK5 C;  1QU7 A;  1EZV H;  2A9H A;  1P4R A;  1NU1 H;  1BQZ A;  3A0B Z;  4DV3 B;  1F4N A;  1TVK B;  4GKK B;  1F51 A;  4I7Z B;  2JRI A;  1NVP B;  2UUA B;  1WNS A;  4LF5 B;  2YXL A;  4X1I B; 
#chains in the Genus database with same CATH homology
 1YSC A;  1M1K W;  1EZJ A;  1COW G;  3LSQ A;  2H8P C;  3SYP A;  4BIZ A;  1GMG A;  1AJP A;  2NNU A;  3STZ C;  4DXW A;  1QBZ A;  2QE7 G;  4GX1 A;  1K8A W;  4HAM A;  1V55 C;  2LFS A;  3ZMU A;  1RM1 C;  1EFR G;  2EZP A;  2OT5 A;  4RO2 A;  3ZN1 A;  4X8A A;  2PI5 A;  4EKW A;  2W6J G;  1OCO C;  1VQ9 V;  1ZWI C;  1AI5 A;  2X6C A;  1CPY A;  4WF9 V;  1YI2 V;  4WFG A;  3GB7 C;  3ZRW B;  1M90 W;  2ITC C;  1YHQ V;  4MT8 A;  2YEV B;  2B5U A;  1OCC C;  5IY5 B;  1JQ0 A;  3T2M A;  2OTJ V;  1MOF A;  2HKO A;  2XAS A;  2A79 B;  2W6I G;  1THZ A;  1SZT A;  2AHY A;  3ABK B;  3GWO A;  2X7R B;  5LHI A;  4CBC A;  5B1B B;  4XBF A;  4FIP C;  1LNQ A;  4LP8 A;  2ZQM A;  3QO7 A;  2XND G;  2IH1 C;  1FXV A;  4ZKI A;  3W7S A;  1F4M A;  2ZDI C;  2WLL B;  1SER A;  1MSW D;  2HVK C;  2WSS G;  3ZRW A;  1VQ6 V;  3ASO C;  2ZD9 A;  1ENV A;  2Z3Y A;  2MK3 A;  5IDJ A;  1NVP D;  3ABL B;  1K5Q A;  4MTX A;  2DYR B;  3ETD A;  5E1A C;  4JAV A;  4H37 A;  1NJI W;  4HYO A;  3NXS A;  2A0L A;  3PJS K;  3ABM B;  2KB1 A;  1QR8 A;  3MHH C;  1KC8 W;  2EIM C;  1JVM A;  3I55 V;  3LDD A;  1WLE A;  2B1G A;  3I56 V;  4UVA A;  2B1I A;  3B77 A;  3JCZ A;  3TET A;  1VQ8 V;  2DYS C;  2Y69 C;  3ASN B;  2GHY A;  2OCC B;  1XL4 A;  3E35 A;  2JJ2 G;  1V55 B;  1GK9 A;  2Q69 A;  1RM1 B;  2IU3 A;  4DO2 A;  4TSF G;  2XAQ A;  3W7U A;  3R65 A;  2IW5 A;  5LHH A;  3CC2 V;  3OM3 B;  2JJ1 G;  4UV8 A;  1PNL A;  3G4S V;  3TK1 A;  2DWE C;  1K73 W;  1AI6 A;  5J9P C;  4G2K A;  1FFT B;  2AHZ A;  2EIK B;  1KP3 A;  1NQT A;  2UXN A;  3ZCC A;  2HR3 A;  5DM6 V;  4RUF A;  3X2Q C;  3VBB A;  1YTF B;  2ITD C;  1P7B A;  3E86 A;  4R7C A;  4RAI A;  3T1C A;  1JOY A;  4LC1 A;  3E8H A;  4XDJ A;  1H8H G;  3UKM A;  3P32 A;  1K4D C;  2X0L A;  1AJQ A;  1SRY A;  4MVM A;  3ZN0 A;  4PDR A;  5LGT A;  4MTO A;  2QM8 A;  2YEV A;  5GW7 A;  1ARO P;  1GO3 F;  4JF3 A;  3CYO A;  3B8M A;  2HG5 C;  4BW5 A;  3CP1 A;  3BY6 A;  5B1N A;  1NR7 A;  1F23 A;  3AG4 C;  4QJF B;  3FB8 C;  1KD1 W;  2WLI A;  2X6B A;  2HLD G;  1OCC B;  3P30 A;  4H33 A;  4MW3 A;  4N21 A;  4TWK A;  4JGS A;  5LBQ A;  1BHB A;  2WLN A;  3E83 A;  3CC4 V;  3QO8 A;  1E1R G;  4HZ3 A;  1VQL V;  1WPX A;  1S3J A;  1E79 G;  2LP7 A;  4GX0 A;  5KA6 A;  5L3F A;  1Q7Y W;  1OCR B;  3ZMT A;  2CK3 G;  3K3W A;  3WG7 C;  3K08 A;  4FPP A;  3CD6 V;  2WWW A;  1R3L C;  4N23 A;  4UVB A;  1ORQ C;  3CCL V;  3K0D A;  3FKS G;  1M57 B;  3K03 A;  3MHS C;  3A0R A;  3CPW U;  2EIL B;  4WFH A;  1CP9 A;  3AG4 B;  2XAF A;  4R6Z A;  3AEI A;  3BEH A;  3HB3 B;  3ZIA G;  3LDE A;  1JPX A;  4FK5 C;  3RBZ A;  3ZRX A;  1B6Q A;  3OR7 C;  1AJN A;  2ZR3 A;  4KP4 A;  3CCU V;  4QIW F;  4RQF A;  3SPH A;  2IU0 A;  3JD3 A;  1R6N A;  2DQ3 A;  4PA6 A;  5L3G A;  5KUK A;  4P2Z A;  4WCE V;  1NH2 D;  4P30 A;  1W0K G;  2BOB C;  3IFX A;  3CCE V;  1Y4M A;  3F5W C;  3LDC A;  1EBO A;  3FYE B;  2Y48 A;  1KP2 A;  2ZDI A;  3CCR V;  2JEU A;  4MTF A;  2P67 A;  3SPG A;  3SYQ A;  1OHH G;  1YJW V;  4U7N A;  2C2A A;  4XDL A;  1GKF A;  2EJR A;  4MVZ A;  1GM7 A;  4Q20 A;  1ROP A;  4PA7 A;  4G28 B;  4WFA V;  5LGU A;  3CCQ V;  4BIU A;  5KUM A;  2W0F C;  1M56 C;  3OMA B;  2ZXW C;  1XL6 A;  3H01 A;  2JIZ G;  1K97 A;  1NBM G;  3QO5 A;  4PDM A;  3RVZ A;  3T4Z A;  5L3E A;  3OAA G;  3W7W A;  2P90 A;  3SJQ C;  1VQO V;  2IJK A;  3E8B A;  2PI4 A;  4JYC A;  2YSU B;  3FB5 C;  2QM7 A;  4MTG A;  4U7O A;  3K0G A;  3MD0 A;  1UJW B;  1Q81 W;  1QLE B;  3ZMS A;  1OCZ B;  1KQS U;  4L87 A;  3K9A A;  4KFM A;  4X88 A;  2JEX A;  3OEH G;  1W2B U;  1DF4 A;  3SYC A;  2EBO A;  4QPJ A;  4JAS A;  1AI7 A;  3ASO B;  2HVJ C;  2V7Q G;  2QTO A;  2WLK A;  1S76 D;  3CCS V;  5EK0 A;  4QE9 A;  3W7T A;  1OCO B;  2OTL V;  5IY5 C;  1M57 C;  1OZ0 A;  3IC7 A;  3B8N A;  4LCU C;  3AG2 B;  1L1F A;  4FJC C;  1CEZ A;  1BMF G;  2ZXW B;  4MVS A;  4BAY A;  4JPR A;  5IYD O;  3OFN G;  3JYC A;  3M99 B;  2P6J A;  2R9I A;  3TCU A;  1DF5 A;  2Q6A A;  3ABK C;  1JJ2 U;  2XOK G;  3K06 A;  4JTD B;  3ZMZ A;  2X6A A;  1VQK V;  5LGN A;  4XDK A;  5EC2 C;  2NLJ C;  4JTC B;  1YIJ V;  3E2E A;  2ZR2 A;  5CBG A;  3FB7 C;  3G6E V;  1VQ5 V;  5CMU A;  1VQ4 V;  2BOC C;  3K79 A;  2IJH A;  4PDV A;  4PDL A;  4TT3 G;  4R8C A;  4OXS A;  2DYR C;  1BL8 A;  1K34 A;  2Q68 A;  4P9P A;  5B3S C;  1FXK B;  3ABL C;  4QNH B;  1DLB A;  2JDI G;  3AG3 C;  4MVU A;  5BZB A;  4MSW C;  4MS2 A;  4GX5 A;  3HPL C;  4I5S A;  3ZRS A;  1M56 B;  4JTA B;  2QEX V;  4QPK A;  2WLJ A;  4UXN A;  1GM9 A;  1K92 A;  5HFL A;  2DWD C;  4J9Z B;  1R3J C;  5H6Q A;  3RVY A;  3E8F A;  3CCM V;  1G8M A;  1QLE C;  1S0V A;  1R73 A;  5B1A C;  2DYS B;  3EHB B;  5L3B A;  2Y69 B;  3ASN C;  3FYI B;  2EIJ C;  1MG1 A;  1RPO A;  3OR6 C;  2QA4 V;  2OCC C;  4YXW G;  2XAJ A;  4JAU A;  3ETE A;  3CCJ V;  2EZO A;  1Y66 A;  5CA3 A;  4FMT A;  4E2L A;  3OUS A;  1NKD A;  3QNE A;  3AG1 B;  1SES A;  4WFE A;  3AG3 B;  3OW2 U;  2WAM A;  3D3I A;  3ABM C;  5CBF A;  1K3E A;  1HWY A;  1W0J G;  4MVR A;  5C93 A;  1PNM A;  1VQM V;  2H94 A;  4I9W A;  1IXM A;  2F43 G;  1VQ7 V;  1N8R W;  1FXK A;  5H9C A;  5B1O A;  1VQP V;  2EIN B;  1Q82 W;  3G71 V;  5EBL C;  3CME V;  2EIJ B;  1QCE A;  3SYA A;  5LHG A;  3SPI A;  3KG2 A;  1I5X A;  3LSS A;  3SPC A;  2D3O W;  1KEC A;  5DN6 G;  1K9M W;  1R6K A;  1RPR A;  3JD1 A;  2DW4 A;  1VQN V;  1K4C C;  2EIL C;  4RQE A;  5CBH A;  2IH3 C;  5CN0 A;  3AG2 C;  4QE7 A;  4G27 B;  3LNM B;  3T4D A;  4P9O A;  3EFF K;  1I5Y A;  2M7W A;  3D36 A;  1Q86 W;  3SYO A;  5IYC O;  3DTU B;  3ABT A;  4X89 A;  4GT1 A;  2WLM A;  4Z1M G;  2GSM B;  3VOU A;  1S5H C;  1JX9 A;  4F4L A;  2K1E A;  4GX2 A;  5B1A B;  5EC1 C;  1YJN V;  3F7V C;  1OCR C;  3F7Y C;  3RW0 A;  3UM7 A;  1R3I C;  1BHA A;  2R9R B;  2XAG A;  3DGE A;  4MW8 A;  1H2G A;  5B3S B;  1E1Q G;  4PA9 A;  4ZBM A;  3E89 A;  4R50 A;  2IJI A;  1H38 A;  4JYB A;  2HFE C;  1FXK C;  3CXC U;  1G4Y B;  3ZJZ A;  1S77 D;  3JD0 A;  1H8E G;  2EIK C;  1NH2 B;  5L3D A;  1V54 B;  3ZRV A;  2QKS A;  3X2Q B;  4CZZ A;  2ATK C;  2UXX A;  1YJ9 V;  3JD2 A;  2EIN C;  1J95 A;  2Q67 A;  1PNK A;  3ETG A;  3OUF A;  5HFM A;  3OMN B;  2WLI B;  4UUJ C;  1NR1 A;  3WG7 B;  2V1D A;  1KKD A;  3LUT B;  5H6R A;  4PA3 A;  3CMA V;  1PD3 A;  3JD4 A;  2DQ0 A;  4UV9 A;  2WLH A;  2FTK A;  3E8G A;  4WFF A;  2XAH A;  1TUE B;  4PA4 A;  3WFV A;  4PEL A;  3FB6 C;  1K5S A;  1YIT V;  3AG1 C;  1S72 V;  4GCZ A;  5FL7 G;  4MVO A;  2P7T C;  3OEE G;  1V54 C;  1GM8 A;  1K33 A;  3ML0 A;  4UVC A;  5B1B C;  5KA5 A;  1AR1 B;  1MAB G;  3ZMV A;  1PKX A;  1OCZ C;  2LFR A;  3CCV V;  4RUE A;  3STL C;  4WFB V;  1R3K C;  4LBE C;  5EBW C;  1YTF D;  4ASU G;  1M9N A;  3OMI B;  4J9Y B;  1FXH A;  2IJJ A;  5IYB O;  3IGA C;  2WPD G;  1K7D A;  3W7X A;  3OGC C;  1QLN A;  3CC7 V;  2JK5 C;  3ABU A;  2Z5U A;  5L3C A;  1GTO A;  2A9H A;  2HJF C;  1P4R A;  2WLL A;  1PL0 A;  1SET A;  1QVF U;  3OE7 G;  1FS0 G;  1F4N A;  5EBM C;  1QVG U;  1F51 A;  1NVP B;  4MVQ A;  1AI4 A;  3SPJ A;  1JCH A;  3K04 A;  4KUM A;  1DTO A;  2EIM B;  1QR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...