4X88A

E178d selectivity filter mutant of navms voltage-gated pore
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLDSWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4x88A00
3PJSK 3F5WC 2WLLA 3OR7C 3K04A 3R65A 4GX1A 3IFXA 4RUFA 3E8HA 3SPJA 4J9YB 3E83A 3K0DA 2WLMA 5EBMC 3BEHA 2R9RB 2IH3C 3OGCC 1QLEC 4G27B 5B1AC 2EILC 4PA7A 1R3KC 4GX0A 2WLKA 5EBLC 3HPLC 3LUTB 2HVJC 4GX2A 3RW0A 2DYRC 4MVZA 1J95A 1M57C 4WFEA 3T2MA 4QE9A 3E8BA 3X2QC 2Q6AA 4MVRA 3ZRSA 4H37A 1OCRC 3SPHA 2ZD9A 2AHYA 2HFEC 3AG4C 1K4CC 3ASNC 4EKWA 3E8FA 4QNHB 5B3SC 4HYOA 4P30A 4XDKA 2BOCC 4MW8A 2X6BA 2X6CA 4PDMA 3ABKC 4I9WA 4PDRA 5IY5C 2HG5C 3FB6C 2QTOA 2NLJC 2OCCC 4JTCB 5EBWC 1OCOC 2HJFC 3LDEA 1K4DC 3SPIA 4P9OA 2Q69A 4PA4A 2EIMC 3LNMB 3SYCA 3SYOA 3ZJZA 2P7TC 2ITDC 3FB8C 1V54C 3E89A 4G28B 3T4ZA 2Q68A 4MTOA 5CBHA 2ZXWC 2ITCC 3OR6C 4PDLA 3SYAA 4ZBMA 3STLC 1BL8A 2WLIA 3E86A 4WFHA 2WLNA 2A79B 3F7YC 3SYPA 1R3JC 2WLHA 3AG2C 2ATKC 4PA9A 2A0LA 3LDDA 1S5HC 2DYSC 2X6AA 1R3IC 1G4YB 4XDJA 5EC1C 2JK5C 1JVMA 3KG2A 3LDCA 4HZ3A 4MVQA 4MVMA 4RUEA 4XDLA 3K03A 3RVZA 4BW5A 1P7BA 1V55C 4P9PA 1XL4A 3IGAC 2WLLB 3FB7C 4JTDB 3SPGA 4H33A 1ZWIC 1ORQC 3T4DA 3VOUA 4LBEC 5EK0A 4R8CA 1M56C 4KFMA 2Q67A 3GB7C 4PA6A 4X88A 3JYCA 1LNQA 2BOBC 3E8GA 2IH1C 4WFGA 5B1BC 2A9HA 4R7CA 4MVOA 4LP8A 4RO2A 2EIKC 5BZBA 3K08A 4UUJC 2DWDC 5E1AC 4PA3A 3SJQC 4MS2A 3K0GA 3AG1C 4MSWC 4MVSA 4QE7A 3K06A 4R6ZA 2KB1A 5EC2C 4J9ZB 2DWEC 3UKMA 3ASOC 2WLJA 2H8PC 3FB5C 3TETA 3WG7C 2EIJC 3AG3C 1KKDA 4F4LA 4OXSA 3F7VC 3UM7A 3OUFA 4PDVA 2QKSA 4RAIA 5CBGA 2EINC 3RVYA 4MTFA 1XL6A 4WFFA 4X8AA 2Y69C 4MTGA 3SYQA 3ABMC 4P2ZA 3TCUA 5J9PC 1R3LC 2K1EA 3EFFK 3T1CA 5CBFA 4DXWA 3RBZA 3SPCA 2HVKC 2YEVA 4LCUC 2WLIB 4MW3A 4TWKA 2AHZA 4JTAB 4X89A 3ABLC 3OUSA 5KUKA 4R50A 4CBCA 4MVUA 2W0FC 1OCCC 1OCZC 4GX5A 5KUMA 3STZC
chains in the Genus database with same CATH superfamily
1DF4A 4K3AA 4LH6A 1E1RG 1EN4A 3CXHF 3P30A 2X7RB 4G27B 1FXHA 2XAGA 4U3FH 4PA7A 2P5OA 3LUTB 4WFBV 2HLDG 2QEXV 4X66B 5LMNO 3RYHA 2KG7A 3HB3B 4HAMA 1PM9A 3O65A 3FD9A 2X6BA 3QTCA 3OEHG 4JTCB 1FXKA 4JZ2A 2HJFC 2JGDA 4B3TO 1IBMB 1NZ6A 1ZL8B 4PA4A 2EIMC 2A7WA 2ITDC 4FFKA 3CCVV 3CCQV 3E89A 2Q68A 2DYSB 2EULA 1L0NH 1LR1A 4YHHB 2XASA 4D6TH 2F93B 1AJQA 3J80N 1R3JC 3CJHB 4LF8O 2A06H 2GUZA 4J7KA 1NVPB 3N2GB 2BTOA 2XAHA 2QKCA 4BW5A 1US6A 1QBZA 2WLLB 4N23A 3T4DA 5LXTB 1YI2V 1M56C 5CA1B 1S0VA 1XQ8A 3L70H 2BOBC 4DUZO 3NR7A 2LJ2A 2UUCO 2F43G 1XUQA 5BMVB 1NQTA 5L3GA 3SJQC 3B2EE 3AG1C 5JJJB 1BGYH 4EB6A 2FMLA 2KKWA 2UXNA 3TETA 3DXRB 4FLZA 1B06A 3BCCH 4FM1A 3N27A 2RCVA 3AK1A 3P3PA 1QCEA 2R70A 5FLXN 3RT3C 5H5NA 1H38A 4JI4B 4F6EA 2HVKC 2FKXA 3JALB 4U7NA 4R50A 3HKBB 2LGQA 2CTWA 5AG2A 5B1AB 4B3MO 3ZMVA 3PN1A 5JCOC 3ZMSA 4IT5A 3E83A 2LQTA 2E5LO 5EIBC 1Q90D 5LP6B 4RQFA 2OTJV 2NN4A 1CP9A 4DV2B 3SPHA 4O2BA 4DV4O 4LFCO 3G6BA 1V54B 1DGSA 1JR9A 2E3CA 3ABKC 4NKGB 1IXMA 4YJ3A 4OX9O 1H8EG 4O4JB 4DV0O 3L73H 4CS4A 2V1DA 2D3OW 1PNMA 1H2KA 1K3EA 2PGGA 3OMAB 4YJ2A 2IJKA 4IYIA 1AJPA 1KP2A 1W0KG 5FNVA 3CC4V 3K3WA 1R1BA 2RQ6A 3APQA 3A2FA 2Q9LA 1PNKA 3F7YC 3I55V 1KYOF 1SZXA 4DR7O 3IC7A 4B7EA 4FLWA 3UQ8A 3SR2C 2LGWA 4JTDB 2OT5A 2BSKB 4PA6A 1XILA 2YI9A 3OTOB 1WPBA 5EZYA 2EIKC 3OAAG 4UUJC 5J2UB 3APOA 5E1AC 4MS2A 2UU9O 1M93A 2DWEC 4PHZA 4W4KA 4C7UA 4DV7O 3TJTA 1VQ9V 4DK1A 2P4KA 1VQNV 3ML0A 2XAQA 2HEPA 1TVKA 3ETEA 4JYCA 4MTFA 4UV9A 1KKCA 1Y74B 3ZS8C 5IT9N 3TCUA 2K1EA 3H1IH 4Q20A 5KHHA 3C3SA 1FS0G 2CE4A 4YY3B 1BSMA 3UT5B 5LP6C 3RFRA 4NTWA 4GX5A 4UV8A 1SA0A 3OR7C 2PI5A 1Q6UA 2ZQMA 1NBMG 2Q0OC 3T1YO 3T2MA 1JA8A 4QE9A 2DW4A 1BZKA 4GKKB 1VARA 3H1HH 1JX9A 1M5IA 2AHYA 3M99B 1GN6A 2QR4A 1MZEA 4I50A 4Z2WA 3BY6A 1H2MA 2OCCC 4NYKA 2ZDIC 1OCOC 2XT9A 1FJGB 4I9QA 3WFVA 3LNMB 4FVMA 1EFRG 2PY5A 2ODMA 3OR6C 2ITCC 2BE3A 2UUBB 1B04A 1EZJA 1MSDA 1Q8IA 5D5PA 1GM9A 3QVNA 4DR6O 2X6AA 4XBFA 1SS3A 1KC8W 1V55C 3CEIA 2DN9A 3N2KA 3CRAA 4FLUA 2ZR2A 1N36O 1FYJA 4DR2O 1M4UA 2EIJB 3WG7B 4D7SA 3G80A 4DR1B 3P32A 1W2BU 4LFBO 1MOFA 5JH7B 1VQOV 4TV8B 4DW0A 2EX3A 4ZI7B 1HNXO 2ZT9B 5B1NA 2VQFB 4FZ1A 4F4LA 3D3IA 1OV9A 1SZTA 2ZCEA 2N04A 4DV1B 4J7ZA 1SQQH 1H8HG 4G2KA 1GN4A 1QQCA 1Q82W 3ZMTA 2AXTZ 3JD1A 2AHZA 5GTIZ 1FAFA 1LUVA 3KCXA 3E22B 1AVMA 4FLXA 3DSQA 3PJSK 3F5WC 3CRQA 3CYOA 2R9RB 1HR0B 3TGUH 1SKVA 1VQ5V 2CGOA 1K7DA 4GX2A 2GTAA 4FZ0A 2E75B 4JI6B 5DM6V 1I94O 3A0BZ 2DQ3A 1IBKB 4DV5O 3ASNC 1WN7A 3JD2A 5C8YB 3L72H 2QTOA 2VS0A 2UXCO 2DYRB 3H01A 2P7TC 3FB8C 1NT2B 4LF4B 3Q4HA 1EN6A 4J42A 4B3RO 2Q4PA 1OJHA 3WB2A 1DTOA 2F23A 3M7MX 1J5EO 5LHHA 4O4LB 5J2TA 1S5HC 4PI0A 1JVMA 1VQPV 4AI8A 2GTSA 3K03A 2YUAA 3IGAC 4GCZA 4LBEC 1PD3A 1QR9A 3RYFA 1N4CA 3JARA 1EN5A 4JYAO 3E35A 5KAIZ 2QKAA 3JAKA 1WAZA 4JI7B 1RPRA 1JJ2U 4MSWC 4R6ZA 5L3FA 3K5MA 4GLXA 3K5NA 2QM8A 3FB5C 1NVPD 4QGPA 3EVKA 1KUQA 4DR3O 4DV6O 1VMGA 2L35A 4X8AA 3D36A 4GKJB 1F4NA 2WPDG 2ZE8A 1OCZB 3JATA 4PJ0Z 5H6QA 4NB5A 2KQXA 2QWQB 4K8ZA 4LF9B 1XOUA 3RBZA 2KSDA 2YIDA 4MW3A 4TWKA 1Q43A 2WA4A 2UXDO 2EINB 3LSUA 4PI2A 1D5NA 1QLNA 3ABMB 1SQFA 2UUAO 1FKAO 3FX7A 4TUYB 2VWKA 4LF8B 1VQ6V 1MA1A 1KD1W 4GT1A 1N34B 5B3SB 5EBLC 1CXZB 2HVJC 1SF9A 2XAJA 1GN3A 2DYRC 4WFEA 2JEUA 1R73A 2UUCB 2ILMA 3AEIA 1NS1A 2GDSA 3M8AA 4L8JA 5K1PA 1RM1B 5IY5C 2ZXWB 4LF7B 3THOA 5GTHZ 4ZIBA 2XOKG 4BAYA 4LF6B 1SQVH 4FLTA 1OCRB 1SQXH 1D2DA 2AGAA 4LFAO 3CMEV 1DF5A 2JVDA 5IE9A 2IJHA 1S3JA 4K35A 5IYZA 2WLNA 2H3OA 2QE7G 5LYJA 4HZ3A 3CCJV 4PV1B 5GW7A 4PELA 2HKOA 1BCCH 1YCIA 2ZM6O 4NXNB 1WNSA 1N32O 4CC5A 1LNQA 2CH7B 2R9AA 3HKCA 3JD3A 4LP8A 3ZCCA 3OTFA 2MW2B 3K5OA 1YXBA 2RMKB 1KP3A 1Z5WA 2QWRB 4FLVA 2GSMB 5IYBO 3OFNG 4JZGA 2EINC 3RVYA 1YF2A 1MZFA 1GK9A 3ABMC 1FD9A 1GN2A 4I0XA 3EFFK 2EBOA 1F51A 2JRIA 1TUBA 1K73W 4CBCA 2W0FC 2B5UA 3DC6A 5KUMA 1Y6XA 2PTMA 3GWKC 3ZHVA 1SESA 2W6JG 4RQEA 1XHZA 5EBMC 4I5SA 2R72A 4O4HA 2YXYA 3A8TA 1RM1C 4UCVA 2Y48A 1Q7YW 3FAVB 2Y4TA 1OCRC 4ZHQB 1KECA 5BXZA 3S3XA 4JV5O 4JI1B 4H13B 1IURA 4UVAA 3AG2B 4G28B 4DR5O 4JI2O 1YZBA 3VQYA 1YHQV 4X1YA 3IAYA 1NU1H 1GO3F 2GV9A 1XBLA 3ZRWA 2Y0IA 4I55B 2CUGA 2YEVB 4UFZA 2WLIA 5JCOA 1R6TA 1I7FA 2WLHA 4CS3A 2UXBB 1G4YB 3P3NA 2JK5C 1I08A 5HFMA 1SQPH 4B3SO 1H2LA 3HKDB 4ASUG 4X64O 4JAUA 5B1BC 1RPOA 1V9PA 5KX5A 2F4VB 2ZNJA 3IC9A 2RJZA 3GWOA 1W0JG 3CJHA 5EC2C 4J9ZB 3H1LH 5H6RA 1FXKB 2E76B 2JGDB 4U3JB 5CA1A 4BIUA 1UFIA 4E2LA 1QHTA 3K57A 3BA9A 3KKYA 1ZLZA 1GTOA 4CS2A 4WF9V 4X20A 2RN9A 1N0NA 3DXRA 2EILB 5LMUB 3G71V 1M57B 3JCZA 3CB2A 1B3QA 3L75H 4FJCC 5KLVH 4LNUA 1QLEC 2ADPA 2WLKA 4YIPA 2F66C 4E4EA 1N36B 1AI6A 1IXBA 1R6NA 4JI5B 3HKBA 4DR2B 1U97A 1L1FA 4EB6B 4MW8A 1U96A 1MABG 1XNQB 3FB6C 5EBWC 5BY1A 1HNZO 1BQZA 1AJNA 5DN6G 5LP6A 3AG4B 1JFFA 4F6RA 2P90A 4ZBMA 3W7UA 3CC2V 1NH2B 3SGIA 3ZMUA 1H2SB 3LDDA 2DYSC 4XDJA 2GHYA 3KG2A 2AZ2A 4KXRA 4TOIA 3FB7C 2CTRA 3W7WA 1ZWIC 3VOUA 5EK0A 1FXVA 4NXMB 4K0KO 1FFXA 3CCRV 5JQGA 2JIZG 3CSXA 3JYCA 4LF5O 1H2GA 2PF4E 3ASOB 3ZHRA 2G38A 2ZDIA 1NTKH 2JJ1G 3MHSC 3JASA 4O2BB 5DECA 2ZE7A 1TA8A 1I94B 1QU7A 2N05A 2QM7A 4OXSA 3F7VC 2N74A 3OEEG 5FPRA 3A0HZ 2VQEO 1N0JA 3JD4A 3ABLB 4X1KB 2UXCB 4TSFG 5CA0B 4P2ZA 3B09A 3T1CA 5CBFA 5FNVB 2HHHO 1Z2GA 3AG3B 4BIOA 1AI5A 2BTQA 4JI8O 1NR1A 4B3RB 4UB6Z 4TQFA 2P06A 1IBLB 3FFQA 4TV9A 3ZN0A 1J5EB 3STZC 1TGOA 2P4VA 2B1GA 4J41A 1LUWA 1X59A 2WLMA 3LSSA 5B1AC 3J7AU 3JD0A 1X4TA 5EZYB 4JASA 4Z1VA 3LSQA 3CC7V 3VBBA 3AG4C 3JAMN 1YDXA 2Q73A 3W7SA 1XHXA 5ITZA 2ZE6A 4P9OA 3FYEB 1M90W 5LGNA 2PYLA 1V54C 5IJ0A 2LW7A 4DV6B 4ZOLB 1KB9F 5H9CA 3WB0A 3HKEA 3CXCU 3RYCA 4AQYO 2IBZH 1XEQA 3UCSC 5JVDA 2M7WA 3CCEV 2ADQB 5LOVA 1IBMO 3LDCA 5B1OA 3RVZA 1SA0B 3O9OA 2UXDB 3BA8A 4YHHO 2Q67A 4I4TB 4YIOA 1JCHA 2A3QA 1JOYA 2XUMA 1GRJA 3CPWU 3OE7G 5K1XA 1EZVH 2WSSG 4IGGA 4I50B 3SJBC 3ZBHA 1WLEA 5KHJA 3AG3C 2VRZA 4RAIA 1S5LZ 3T1HB 2Z3YA 4DRXA 1K92A 1ZUQA 5GONB 5EYPA 1N33O 5JH7A 4U7OA 3L74H 2IW5A 4ZI7A 4LFAB 4UCTA 1WB8A 1BE3H 2PI4A 2CGNA 3N2KB 1K34A 3K0DA 3BEHA 4JI4O 3QNEA 4UXNA 2ZIOA 5DEDA 2ETNA 3CP1A 2Y0PA 2ZM6B 1FFTB 4K8XA 3HPLC 4DK0A 1EBOA 2Y4UA 2WA3A 4JI0O 1XMQO 2QGNA 1BHBA 4IIJA 3CCSV 2F1MA 3E22A 1N8RW 4O4IA 1Q3EA 1MMMA 1BT8A 2BOCC 2UXXA 5JWPA 4O2AB 4CZZA 1K4DC 4DUYO 3TXSA 4BW9A 2O57A 3QO5A 2MK3A 3K58A 5L3CA 1YSCA 2Z5UA 2B9ZA 4CH3A 4JYYA 4NVPA 1XMOO 3E86A 3S3WA 1KU9A 1Q5OA 3ZN1A 3TK1A 2YIAA 2JS3A 4MVQA 2H94A 1O9HA 4IL6Z 2YDEA 1P7BA 1JPXA 3SJCC 4R8CA 5JJEB 5LA6A 1URFA 2YS8A 3JSNA 1UPGA 2YXHA 3K08A 4O4LA 1WB7A 3K0GA 4JPRA 2Q7EA 5B5EZ 1GKFA 3UO2A 2H8PC 3WG7C 2EIJC 4QPJA 4AHCA 3OTOO 1MSWD 1VEWA 4JV5B 5KHGA 3JSLA 3Q4HB 1OCCB 3L9DA 3BPZA 4DR5B 3BABA 4DYLA 5LGTA 1QVFU 4MVUA 1ZAUA 4DV3O 3DTUB 1F23A 2QWOB 4Q6GA 5LMNB 1UJWB 3R65A 4FM2A 2OWOA 2QWPB 4YY3O 4B3TB 4IHJA 3CCLV 4LWSA 3ZRSA 2GBOA 1Y67A 2FTKA 4I9WA 4FLYA 2NLJC 3G4SV 2Q69A 4KUMA 4GKKO 2YICA 4KP4A 2DQ0A 5KMGA 3JATB 1NJIW 2PZSA 3F5TA 5KAFZ 5CB4B 1BS3A 3RYIA 4DUZB 2OYQA 1Y76B 2A79B 1FJGO 1QNMA 1SETA 3ZHTA 4MVMA 4XDLA 1RSOA 1O9GA 2V7QG 3CHXA 4EFEA 2JS5A 2UUBO 1K33A 1WA8B 3HR0A 3QO7A 5IJ9A 4WFGA 2IH1C 3BAAA 4R7CA 3AK3A 3B8MA 4UCSA 1VQLV 4DR4O 2ZINA 1QVGU 1NH2D 2EZOA 3NXSA 2YSUB 3ABUA 2QKSA 1ZX3A 2ZKOA 5JJNB 1Q6IA 1I0HA 4JGSA 4WFAV 1XL6A 2AW9A 2CH7A 4B3MB 5IWAO 3K5LA 1AB3A 4UCUA 2YIBD 4LCUC 2E5LB 5IYZB 4HNAB 5KUKA 4WBNB 1SC5B 3K79A 1OCZC 4DV1O 3ZEDA 1VQKV 4MTXA 3WU2Z 2RNBA 1HNWO 1WP7A 4FFBB 4GX1A 4DV4B 4LFCB 4UCRA 1G1XB 3VQWA 4J80A 3L71H 4OX9B 3HKCB 1IX9A 1R3KC 3UO3A 4DV0B 4K0KB 1L0LH 2P22C 1I5XA 4CH5A 1YVWA 3RWRD 4LF5B 1P49A 3CCUV 1VIBA 2ZD9A 1B6QA 3D3QA 2EIMB 2V4DA 4QNHB 5B3SC 1AR1B 4P30A 1SRYA 5HFLA 1L8DA 2CDYA 3CRMA 2E74B 1HR0O 2JJ2G 3SYCA 4DR7B 2X0LA 3JAWB 1IBKO 4I0XB 2ZXWC 1Y66A 3G67A 4X65O 4ZHQA 1TUBB 1BQ0A 1M56B 2HHHB 5H2FZ 3CD6V 1R3IC 4X1IB 2LP7A 1SERA 2UU9B 3ZMZA 3I56V 2PYJA 4DV7B 4O4HB 1VF7A 1E1QG 1DK1A 2F95B 1XNRO 1WJZA 2EJRA 3G6EV 4UVCA 4I55A 1YJWV 4PA3A 2C2AA 3ZX6A 4H44B 4KHPO 3JCUZ 4W4LA 2JEXA 3FKSG 1MG1A 1ZL8A 4X62O 3RN4A 3HKDA 1ROPA 4JI7O 1NR7A 4X1YB 1AILA 3ZRWB 1IDSA 2K9PA 2WLIB 4LR3A 3I5DA 3RYHB 2KG7B 3MDSA 3CE2A 3T1YB 2QM4A 2OIGA 1ENVA 4AQYB 3N2GA 1I5YA 4GKJO 2WLLA 3CS5A 4U3JA 3OW2U 5LXTA 4RUFA 4JI3O 4ICGA 4LF9O 2HP8A 3J81N 3OM3B 1ZSPA 2D2CB 4CH4A 5KX5B 5BMVA 3RW0A 3ABKB 3MD0A 1E79G 4FM0A 3OT7A 2HFEC 4EKWA 2GUZB 3TXQA 1H2NA 1N34O 3U0ZA 1TAEA 1VQ8V 4DR6B 1VQ7V 3X2QB 1VF5B 1BHAA 1ZTEA 4NTXA 3T4ZA 5BR8O 2ZIMA 4PDLA 3SYAA 3CCMV 1VP7A 1RP3B 1BL8A 3JALA 4LF7O 1AR5A 3AG2C 4X20B 1VF6C 2ATKC 2A0LA 4J11A 4PA9A 1S76D 1N33B 4X9QA 4LF6O 1GH6A 4LFBB 4B7KA 2VWJA 1XL4A 2EIKB 4BIZA 3DC5A 1HNXB 2Q7GA 4KFMA 4X88A 1K5SA 4LNUB 5IDJA 1XDCA 3BFRA 2EJ7A 1EM1A 1PKXA 4JF3A 1OZ0A 1XMQB 4JI0B 3BHPA 2ZNIA 4NXNO 1YTFB 1KKDA 2Q8VA 3K59A 3UM7A 4ABMA 4O4JA 2DJVA 3H1KH 5CBGA 1P84F 1T5EA 4DUYB 2LO1A 1JFFB 3OMNB 2YIBA 4F6RB 1FXKC 4QPKA 4DXWA 4YXWG 4B08A 5C93A 3OMIB 1XMOB 2Y69B 5L3DA 3FYIB 4TT3G 5KHIA 4IYHA 4DV5B 4YJ3B 2BSKA 4EEQA 3IFXA 1FFXB 5JQGB 4UVBA 4X1KA 2CTQA 1AI4A 2HR3A 2EILC 5CA0A 2JDIG 3MHHC 4YJ2B 1M57C 1JQ0A 2OCCB 4JAVA 3X2QC 4DO2A 5J2UA 1OCOB 3R66A 4H37A 2QA4V 2QTSA 1Z5VA 3JASB 5TISZ 1K4CC 3ETQA 3ZRVA 4FIPC 5CMUA 4PDRA 1W59A 3LDEA 1YITV 1YIJV 2DOSA 3ETGA 5LHGA 1F7YA 1Y74A 4HBNA 1HP8A 3B77A 1G6UA 1V55B 4JI1O 5L3EA 4WFHA 5LL6Y 3SYPA 4JYAB 1D5AA 2BTQB 3UT5A 2NNUA 5EC1C 1S5JA 4TV9B 5KA5A 2ZE5A 3CX5F 5F2VO 5CA3A 2CAZC 4DV3B 4H33A 3ABTA 2L6LA 1TVKB 1WPXA 4X66O 2YXLA 4DR3B 4ZOLA 4Z1MG 2UXBO 5BZBA 1K9MW 4BR6A 3KZIZ 3ZHUA 3K06A 3ASOC 1JMKC 5FPOA 2F4VO 5ITZB 1JJOA 4DW1A 2QWNB 4I4TA 1GM8A 2Y69C 4MTGA 4OPHA 3SYQA 1FPOA 2UUAB 5IJ0B 1R3LC 2WAMA 1S77D 1AROP 1PPJH 3RGBA 4A5UB 5B66Z 1HWYA 3EXAA 3HKEB 3K9AA 3RYCB 5JVDB 3ABLC 5LOVB 1KQSU 4H0LB 3ZHSA 4L87A 2HJDA 5D5QA 3CMAV 4J9YB 1GM7A 3OGCC 3ASNB 1SQGA 5GONA 2P67A 2IM9A 2OCHA 5IYCO 2Q6AA 1M9NA 5LMUO 1HW7A 2OIEA 4FK5C 4TV8A 3E8FA 4DR4B 2ZR3A 4PDMA 4AILC 1YJ9V 3SPIA 1RFYA 2DMXA 1A32A 4DRXB 4MTOA 5CBHA 1M1KW 4JI5O 4OGQB 5CN0A 3C90A 5EYPB 1K97A 3STLC 5IWAB 1XNQO 1N32B 2QDOA 1IVSA 4O2AA 2XNDG 2YI8A 4P9PA 3C3TA 4NR1A 4KL1A 2R9IA 3E8GA 1HNWB 4DV2O 2AZ0A 1WP8A 1NKDA 5A9GA 2LFRA 4TQDA 4J7JA 4IIJB 4QE7A 1NTZH 2KB1A 4NXMO 4O4IB 5C8YA 4MT8A 5LGUA 3OGIB 1PP9H 5IYDO 1NTMH 4BWAA 2JGUA 3ICXA 3SPCA 4LH7A 4X65B 3SJAC 2Q0AA 1YJNV 1NI8A 1VQMV 5FL7G 1HDJA 2YC0A 3E8HA 3SPJA 5LA6B 2XHBA 3ZHQA 4GX0A 4UB8Z 1CEZA 1J95A 5IY5B 1IBLO 4MVRA 1XNRB 4JI2B 3AK2A 3LNNA 2PUSA 5J2TB 4HYOA 1AI7A 4EFBA 2IU3A 1PL0A 3B8NA 1MNGA 2HG5C 3BRCA 3H9VA 5EIBD 4KHPB 1F4MA 2XTAA 3SYOA 2P6JA 3ZJZA 2NR5A 1S72V 3RYFB 1P4RA 4X62B 1Q6HA 3JARB 2XAFA 4B3SB 2CK3G 3JAKB 2Q5ZA 3IJ4A 4X64B 2W0XA 3K9SA 1TUEB 3H1JH 1OHHG 3CRRA 3U10A 1KBHA 3GVMA 5L3BA 4RUEA 3U11A 4JAAA 1XREA 4TUYA 3SPGA 2IJJA 3A0RA 3WB1A 3MAQA 3GB7C 3D8CA 4IHJB 2A9HA 4JI3B 4FPPA 4RO2A 2LFSA 4LWSB 2B1IA 2DWDC 3OD4A 5CB4A 1Y76A 1GAXA 4QJFB 3SDLA 2WLJA 1COWG 5LBQA 3B4SA 3BVOA 3OUFA 4PDVA 4CC6A 1AR4A 4QIWF 3B40A 2FYUH 1WA8A 5KMGB 2WWWA 2Q7HA 1BMFG 5BR8B 3RYIB 4JTAB 3KCYA 4OPAA 4X89A 3ZRXA 3QO8A 2OTLV 1OCCC 3W7TA 1AP6A 2W6IG 3T1HO 1KMIZ 4J10A 1RSOB 3QG5A 1YTFD 4PD4F 3K04A 2CTPA 1SQBH 4UCOA 4N21A 3ETDA 5IJ9B 2IU0A 2IH3C 1Q81W 1HNZB 4DR1O 2Z0AA 3CRCA 4MVZA 4I7ZB 5LHIA 1DLBA 1YEWA 3E8BA 3EHBB 4HNAA 2VQFO 4WBNA 2QSAA 1QR8A 4WCEV 4XDKA 5LYJB 2X6CA 4FFBA 1AP5A 4GYCB 1R6KA 1GMGA 1Q86W 5KA6A 2FL4A 4NTYA 4JYBA 1CPYA 1PV0A 4D7TA 3QF7A 3VQVA 3ZIAG 2FB5A 1G8MA 5E79Z 3D36C 5KHKA 5B1BB 1IZ3A 1K5QA 1ORQC 3JAWA 1THZA 1Y4MA 4JI6O 4LC1A 4GUNA 4MVOA 4RWUA 2DE0X 2EZPA 1XI1A 2VQEB 4GZRB 3FAVA 2LW1A 5A2QN 4MVSA 4X1IA 3AG7A 3UKMA 4ZKIA 1PL4A 2M6YA 4LF4O 4JI8B 2BCCH 3DGEA 4WFFA 3AG1B 1VF6A 1K8AW 3CWBH 3VQXA 5J9PC 2RDCA 2IJIA 3E2EA 2ARHA 2YEVA 1VQ4V 4FMTA 1PNLA 3OUSA 3W7XA 1P7GA 1QLEB 4CH6A 2QJ1A
chains in the Genus database with same CATH topology
1DF4A 1E1RG 3IFXA 1K34A 3K0DA 3BEHA 3QNEA 4UXNA 4UVBA 1VQ6V 3P30A 1KD1W 2X7RB 4GT1A 1AI4A 2HR3A 1FXHA 2EILC 2XAGA 3CP1A 1FFTB 4G27B 2JDIG 4PA7A 3MHHC 3HPLC 3LUTB 2HVJC 5EBLC 4WFBV 1EBOA 2HLDG 2DYRC 2XAJA 4WFEA 1M57C 2JEUA 2QEXV 1JQ0A 1R73A 2OCCB 4JAVA 3X2QC 4DO2A 1OCOB 1BHBA 4H37A 2QA4V 3CCSV 3AEIA 1K4CC 3HB3B 4HAMA 1N8RW 2BOCC 3ZRVA 2UXXA 2X6BA 4FIPC 5CMUA 1RM1B 4PDRA 5IY5C 4CZZA 2ZXWB 3OEHG 4JTCB 1FXKA 2HJFC 3LDEA 1K4DC 2XOKG 1YIJV 1YITV 4PA4A 2EIMC 4BAYA 3ETGA 2ITDC 5LHGA 3QO5A 1OCRB 3CCVV 3CCQV 2MK3A 3E89A 2Q68A 2DYSB 5L3CA 3B77A 1YSCA 2Z5UA 3CMEV 1DF5A 2XASA 2IJHA 1V55B 5L3EA 1S3JA 3E86A 4WFHA 2WLNA 1AJQA 2QE7G 3SYPA 1R3JC 3ZN1A 3TK1A 2NNUA 5EC1C 1NVPB 4HZ3A 4MVQA 5KA5A 2H94A 2XAHA 4BW5A 5GW7A 1P7BA 3CCJV 1QBZA 2WLLB 5CA3A 4PELA 2HKOA 4N23A 4H33A 3T4DA 1YI2V 1JPXA 3ABTA 4R8CA 1M56C 1WPXA 1S0VA 1LNQA 2BOBC 5B3SB 3JD3A 2F43G 1NQTA 4Z1MG 4LP8A 3ZCCA 5L3GA 5BZBA 3K08A 1K9MW 3SJQC 1KP3A 3K0GA 3AG1C 3K06A 4JPRA 3ASOC 1GKFA 2H8PC 2UXNA 3TETA 3WG7C 2EIJC 2GSMB 4QPJA 5IYBO 1MSWD 3OFNG 2EINC 3RVYA 1QCEA 1GM8A 2Y69C 4MTGA 1GK9A 3SYQA 3ABMC 1OCCB 1R3LC 3EFFK 2WAMA 2EBOA 1F51A 1S77D 1AROP 1H38A 1HWYA 2HVKC 3K9AA 4U7NA 1K73W 3ABLC 5LGTA 4R50A 4CBCA 1QVFU 4MVUA 1KQSU 2W0FC 2B5UA 3DTUB 1F23A 5B1AB 5KUMA 4L87A 3ZMVA 1UJWB 1SESA 3R65A 3CMAV 2W6JG 4RQEA 3ZMSA 4J9YB 3E83A 4I5SA 1GM7A 5EBMC 3OGCC 3ASNB 1RM1C 2P67A 4RQFA 3CCLV 2OTJV 2Y48A 1Q7YW 5IYCO 2Q6AA 1M9NA 1CP9A 3ZRSA 3SPHA 1OCRC 4FK5C 1KECA 2FTKA 3E8FA 2ZR3A 1V54B 4PDMA 3ABKC 4I9WA 1IXMA 2NLJC 1H8EG 1YJ9V 3G4SV 2V1DA 3SPIA 2D3OW 2Q69A 1PNMA 1K3EA 4KUMA 4UVAA 3AG2B 4G28B 3OMAB 4KP4A 4MTOA 5CBHA 1YHQV 1M1KW 2IJKA 2DQ0A 1GO3F 1NJIW 1AJPA 5CN0A 1KP2A 1W0KG 3CC4V 1K97A 3ZRWA 3STLC 3K3WA 2YEVB 2WLIA 2A79B 1PNKA 3F7YC 3I55V 2WLHA 1G4YB 1SETA 2JK5C 3IC7A 4MVMA 4XDLA 2XNDG 2V7QG 4P9PA 4JTDB 2OT5A 5HFMA 1K33A 4PA6A 3QO7A 2R9IA 4ASUG 4JAUA 3E8GA 4WFGA 5B1BC 1RPOA 2IH1C 4R7CA 3B8MA 2EIKC 1NKDA 1VQLV 3OAAG 4UUJC 2LFRA 5E1AC 1QVGU 1NH2D 2EZOA 3GWOA 4MS2A 1W0JG 3NXSA 4QE7A 2KB1A 5EC2C 4J9ZB 2DWEC 2YSUB 5H6RA 1VQ9V 1VQNV 1FXKB 3ABUA 2QKSA 3ML0A 2XAQA 3ETEA 4JYCA 4MT8A 4MTFA 4JGSA 4BIUA 4WFAV 1XL6A 4UV9A 5LGUA 4E2LA 3TCUA 5IYDO 2K1EA 4Q20A 3SPCA 4LCUC 1GTOA 4WF9V 1FS0G 5KUKA 3K79A 1OCZC 4GX5A 2EILB 1YJNV 1VQKV 4MTXA 3G71V 4UV8A 1VQMV 5FL7G 1M57B 3OR7C 4GX1A 2PI5A 3JCZA 3E8HA 3SPJA 4FJCC 2ZQMA 1NBMG 1QLEC 1R3KC 4GX0A 2WLKA 1CEZA 1J95A 1I5XA 3T2MA 4QE9A 5IY5B 2DW4A 4MVRA 1AI6A 3CCUV 2ZD9A 1B6QA 1JX9A 1R6NA 2AHYA 3M99B 2EIMB 4QNHB 5B3SC 4HYOA 1L1FA 1AR1B 4P30A 1SRYA 1AI7A 4MW8A 5HFLA 2IU3A 1PL0A 3B8NA 3BY6A 1MABG 2HG5C 2JJ2G 3FB6C 2OCCC 5EBWC 2ZDIC 1F4MA 1OCOC 3WFVA 3SYOA 2P6JA 1AJNA 3LNMB 3SYCA 3ZJZA 1S72V 5DN6G 2X0LA 1P4RA 3AG4B 1EFRG 2ZXWC 2XAFA 2ITCC 3OR6C 1Y66A 2P90A 4ZBMA 2CK3G 3W7UA 3CC2V 1NH2B 1EZJA 3ZMUA 1TUEB 1M56B 1GM9A 1OHHG 3CD6V 3LDDA 2DYSC 2X6AA 1R3IC 2GHYA 4XDJA 4XBFA 3KG2A 5L3BA 4RUEA 2LP7A 1KC8W 1V55C 1SERA 3FB7C 3SPGA 3W7WA 1ZWIC 3VOUA 2IJJA 5EK0A 3ZMZA 1FXVA 3A0RA 3I56V 3GB7C 3CCRV 2JIZG 2ZR2A 3JYCA 1E1QG 1H2GA 2A9HA 3ASOB 2EJRA 4FPPA 4RO2A 3WG7B 2EIJB 3G6EV 2LFSA 4UVCA 2B1IA 2DWDC 2ZDIA 1YJWV 3P32A 4PA3A 1W2BU 1MOFA 2JJ1G 2C2AA 3MHSC 1VQOV 4QJFB 2JEXA 3FKSG 2WLJA 5B1NA 1COWG 5LBQA 2QM7A 4OXSA 1MG1A 3F7VC 3OEEG 4F4LA 3D3IA 3OUFA 4PDVA 4QIWF 1SZTA 1ROPA 3JD4A 3ABLB 1NR7A 4TSFG 4P2ZA 1H8HG 4G2KA 2WWWA 1BMFG 3T1CA 5CBFA 3AG3B 3ZRWB 1Q82W 3ZMTA 2WLIB 3JD1A 1AI5A 2AHZA 4JTAB 4X89A 1NR1A 3ZRXA 3QO8A 2OTLV 1OCCC 3W7TA 1ENVA 1I5YA 2W6IG 3ZN0A 3STZC 3PJSK 1YTFD 3F5WC 2WLLA 3K04A 2B1GA 3OW2U 4RUFA 3CYOA 2WLMA 4N21A 3ETDA 2R9RB 2IH3C 3OM3B 2IU0A 1Q81W 3LSSA 5B1AC 3JD0A 1VQ5V 1K7DA 4GX2A 3RW0A 4MVZA 3ABKB 1DLBA 4JASA 3MD0A 5LHIA 3E8BA 1E79G 3EHBB 5DM6V 3LSQA 3CC7V 3VBBA 2DQ3A 1QR8A 2HFEC 3AG4C 4EKWA 3ASNC 3JD2A 4WCEV 4XDKA 2X6CA 3W7SA 2QTOA 2DYRB 1VQ8V 3H01A 4P9OA 3FYEB 1M90W 1R6KA 1VQ7V 3X2QB 1GMGA 2P7TC 5LGNA 3FB8C 1Q86W 1BHAA 1V54C 3T4ZA 5KA6A 4JYBA 1CPYA 4PDLA 3SYAA 3CCMV 1BL8A 1DTOA 5H9CA 3ZIAG 3CXCU 1G8MA 5LHHA 2M7WA 3AG2C 3CCEV 2ATKC 4PA9A 2A0LA 1S5HC 1S76D 5B1BB 1JVMA 3LDCA 1VQPV 1K5QA 5B1OA 3K03A 3RVZA 1XL4A 3IGAC 2EIKB 4GCZA 4BIZA 1ORQC 4LBEC 1PD3A 4KFMA 1QR9A 2Q67A 4X88A 1K5SA 1THZA 1Y4MA 5IDJA 4LC1A 1JCHA 1JOYA 3E35A 4MVOA 2EZPA 3CPWU 3OE7G 1RPRA 1JJ2U 4MSWC 4MVSA 4R6ZA 5L3FA 1PKXA 4JF3A 1OZ0A 2WSSG 3UKMA 4ZKIA 2QM8A 1WLEA 1YTFB 3FB5C 1KKDA 3AG3C 1NVPD 3UM7A 4RAIA 5CBGA 3DGEA 4WFFA 2Z3YA 4X8AA 3D36A 1F4NA 3AG1B 1K92A 2WPDG 1K8AW 3OMNB 5J9PC 1OCZB 5H6QA 1FXKC 2IJIA 4QPKA 4DXWA 3RBZA 3E2EA 2YEVA 4U7OA 4MW3A 4TWKA 1VQ4V 4FMTA 1PNLA 2IW5A 4YXWG 3OUSA 2EINB 5C93A 3OMIB 3W7XA 2Y69B 1QLEB 1QLNA 5L3DA 3FYIB 3ABMB 2PI4A 4TT3G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PJS K;  3F5W C;  2WLL A;  3OR7 C;  3K04 A;  3R65 A;  4GX1 A;  3IFX A;  4RUF A;  3E8H A;  3SPJ A;  4J9Y B;  3E83 A;  3K0D A;  2WLM A;  5EBM C;  3BEH A;  2R9R B;  2IH3 C;  3OGC C;  1QLE C;  4G27 B;  5B1A C;  2EIL C;  4PA7 A;  1R3K C;  4GX0 A;  2WLK A;  5EBL C;  3HPL C;  3LUT B;  2HVJ C;  4GX2 A;  3RW0 A;  2DYR C;  4MVZ A;  1J95 A;  1M57 C;  4WFE A;  3T2M A;  4QE9 A;  3E8B A;  3X2Q C;  2Q6A A;  4MVR A;  3ZRS A;  4H37 A;  1OCR C;  3SPH A;  2ZD9 A;  2AHY A;  2HFE C;  3AG4 C;  1K4C C;  3ASN C;  4EKW A;  3E8F A;  4QNH B;  5B3S C;  4HYO A;  4P30 A;  4XDK A;  2BOC C;  4MW8 A;  2X6B A;  2X6C A;  4PDM A;  3ABK C;  4I9W A;  4PDR A;  5IY5 C;  2HG5 C;  3FB6 C;  2QTO A;  2NLJ C;  2OCC C;  4JTC B;  5EBW C;  1OCO C;  2HJF C;  3LDE A;  1K4D C;  3SPI A;  4P9O A;  2Q69 A;  4PA4 A;  2EIM C;  3LNM B;  3SYC A;  3SYO A;  3ZJZ A;  2P7T C;  2ITD C;  3FB8 C;  1V54 C;  3E89 A;  4G28 B;  3T4Z A;  2Q68 A;  4MTO A;  5CBH A;  2ZXW C;  2ITC C;  3OR6 C;  4PDL A;  3SYA A;  4ZBM A;  3STL C;  1BL8 A;  2WLI A;  3E86 A;  4WFH A;  2WLN A;  2A79 B;  3F7Y C;  3SYP A;  1R3J C;  2WLH A;  3AG2 C;  2ATK C;  4PA9 A;  2A0L A;  3LDD A;  1S5H C;  2DYS C;  2X6A A;  1R3I C;  1G4Y B;  4XDJ A;  5EC1 C;  2JK5 C;  1JVM A;  3KG2 A;  3LDC A;  4HZ3 A;  4MVQ A;  4MVM A;  4RUE A;  4XDL A;  3K03 A;  3RVZ A;  4BW5 A;  1P7B A;  1V55 C;  4P9P A;  1XL4 A;  3IGA C;  2WLL B;  3FB7 C;  4JTD B;  3SPG A;  4H33 A;  1ZWI C;  1ORQ C;  3T4D A;  3VOU A;  4LBE C;  5EK0 A;  4R8C A;  1M56 C;  4KFM A;  2Q67 A;  3GB7 C;  4PA6 A;  4X88 A;  3JYC A;  1LNQ A;  2BOB C;  3E8G A;  2IH1 C;  4WFG A;  5B1B C;  2A9H A;  4R7C A;  4MVO A;  4LP8 A;  4RO2 A;  2EIK C;  5BZB A;  3K08 A;  4UUJ C;  2DWD C;  5E1A C;  4PA3 A;  3SJQ C;  4MS2 A;  3K0G A;  3AG1 C;  4MSW C;  4MVS A;  4QE7 A;  3K06 A;  4R6Z A;  2KB1 A;  5EC2 C;  4J9Z B;  2DWE C;  3UKM A;  3ASO C;  2WLJ A;  2H8P C;  3FB5 C;  3TET A;  3WG7 C;  2EIJ C;  3AG3 C;  1KKD A;  4F4L A;  4OXS A;  3F7V C;  3UM7 A;  3OUF A;  4PDV A;  2QKS A;  4RAI A;  5CBG A;  2EIN C;  3RVY A;  4MTF A;  1XL6 A;  4WFF A;  4X8A A;  2Y69 C;  4MTG A;  3SYQ A;  3ABM C;  4P2Z A;  3TCU A;  5J9P C;  1R3L C;  2K1E A;  3EFF K;  3T1C A;  5CBF A;  4DXW A;  3RBZ A;  3SPC A;  2HVK C;  2YEV A;  4LCU C;  2WLI B;  4MW3 A;  4TWK A;  2AHZ A;  4JTA B;  4X89 A;  3ABL C;  3OUS A;  5KUK A;  4R50 A;  4CBC A;  4MVU A;  2W0F C;  1OCC C;  1OCZ C;  4GX5 A;  5KUM A;  3STZ C; 
#chains in the Genus database with same CATH topology
 1DF4 A;  4K3A A;  4LH6 A;  1E1R G;  1EN4 A;  3CXH F;  3P30 A;  2X7R B;  4G27 B;  1FXH A;  2XAG A;  4U3F H;  4PA7 A;  2P5O A;  3LUT B;  4WFB V;  2HLD G;  2QEX V;  4X66 B;  5LMN O;  3RYH A;  2KG7 A;  3HB3 B;  4HAM A;  1PM9 A;  3O65 A;  3FD9 A;  2X6B A;  3QTC A;  3OEH G;  4JTC B;  1FXK A;  4JZ2 A;  2HJF C;  2JGD A;  4B3T O;  1IBM B;  1NZ6 A;  1ZL8 B;  4PA4 A;  2EIM C;  2A7W A;  2ITD C;  4FFK A;  3CCV V;  3CCQ V;  3E89 A;  2Q68 A;  2DYS B;  2EUL A;  1L0N H;  1LR1 A;  4YHH B;  2XAS A;  4D6T H;  2F93 B;  1AJQ A;  3J80 N;  1R3J C;  3CJH B;  4LF8 O;  2A06 H;  2GUZ A;  4J7K A;  1NVP B;  3N2G B;  2BTO A;  2XAH A;  2QKC A;  4BW5 A;  1US6 A;  1QBZ A;  2WLL B;  4N23 A;  3T4D A;  5LXT B;  1YI2 V;  1M56 C;  5CA1 B;  1S0V A;  1XQ8 A;  3L70 H;  2BOB C;  4DUZ O;  3NR7 A;  2LJ2 A;  2UUC O;  2F43 G;  1XUQ A;  5BMV B;  1NQT A;  5L3G A;  3SJQ C;  3B2E E;  3AG1 C;  5JJJ B;  1BGY H;  4EB6 A;  2FML A;  2KKW A;  2UXN A;  3TET A;  3DXR B;  4FLZ A;  1B06 A;  3BCC H;  4FM1 A;  3N27 A;  2RCV A;  3AK1 A;  3P3P A;  1QCE A;  2R70 A;  5FLX N;  3RT3 C;  5H5N A;  1H38 A;  4JI4 B;  4F6E A;  2HVK C;  2FKX A;  3JAL B;  4U7N A;  4R50 A;  3HKB B;  2LGQ A;  2CTW A;  5AG2 A;  5B1A B;  4B3M O;  3ZMV A;  3PN1 A;  5JCO C;  3ZMS A;  4IT5 A;  3E83 A;  2LQT A;  2E5L O;  5EIB C;  1Q90 D;  5LP6 B;  4RQF A;  2OTJ V;  2NN4 A;  1CP9 A;  4DV2 B;  3SPH A;  4O2B A;  4DV4 O;  4LFC O;  3G6B A;  1V54 B;  1DGS A;  1JR9 A;  2E3C A;  3ABK C;  4NKG B;  1IXM A;  4YJ3 A;  4OX9 O;  1H8E G;  4O4J B;  4DV0 O;  3L73 H;  4CS4 A;  2V1D A;  2D3O W;  1PNM A;  1H2K A;  1K3E A;  2PGG A;  3OMA B;  4YJ2 A;  2IJK A;  4IYI A;  1AJP A;  1KP2 A;  1W0K G;  5FNV A;  3CC4 V;  3K3W A;  1R1B A;  2RQ6 A;  3APQ A;  3A2F A;  2Q9L A;  1PNK A;  3F7Y C;  3I55 V;  1KYO F;  1SZX A;  4DR7 O;  3IC7 A;  4B7E A;  4FLW A;  3UQ8 A;  3SR2 C;  2LGW A;  4JTD B;  2OT5 A;  2BSK B;  4PA6 A;  1XIL A;  2YI9 A;  3OTO B;  1WPB A;  5EZY A;  2EIK C;  3OAA G;  4UUJ C;  5J2U B;  3APO A;  5E1A C;  4MS2 A;  2UU9 O;  1M93 A;  2DWE C;  4PHZ A;  4W4K A;  4C7U A;  4DV7 O;  3TJT A;  1VQ9 V;  4DK1 A;  2P4K A;  1VQN V;  3ML0 A;  2XAQ A;  2HEP A;  1TVK A;  3ETE A;  4JYC A;  4MTF A;  4UV9 A;  1KKC A;  1Y74 B;  3ZS8 C;  5IT9 N;  3TCU A;  2K1E A;  3H1I H;  4Q20 A;  5KHH A;  3C3S A;  1FS0 G;  2CE4 A;  4YY3 B;  1BSM A;  3UT5 B;  5LP6 C;  3RFR A;  4NTW A;  4GX5 A;  4UV8 A;  1SA0 A;  3OR7 C;  2PI5 A;  1Q6U A;  2ZQM A;  1NBM G;  2Q0O C;  3T1Y O;  3T2M A;  1JA8 A;  4QE9 A;  2DW4 A;  1BZK A;  4GKK B;  1VAR A;  3H1H H;  1JX9 A;  1M5I A;  2AHY A;  3M99 B;  1GN6 A;  2QR4 A;  1MZE A;  4I50 A;  4Z2W A;  3BY6 A;  1H2M A;  2OCC C;  4NYK A;  2ZDI C;  1OCO C;  2XT9 A;  1FJG B;  4I9Q A;  3WFV A;  3LNM B;  4FVM A;  1EFR G;  2PY5 A;  2ODM A;  3OR6 C;  2ITC C;  2BE3 A;  2UUB B;  1B04 A;  1EZJ A;  1MSD A;  1Q8I A;  5D5P A;  1GM9 A;  3QVN A;  4DR6 O;  2X6A A;  4XBF A;  1SS3 A;  1KC8 W;  1V55 C;  3CEI A;  2DN9 A;  3N2K A;  3CRA A;  4FLU A;  2ZR2 A;  1N36 O;  1FYJ A;  4DR2 O;  1M4U A;  2EIJ B;  3WG7 B;  4D7S A;  3G80 A;  4DR1 B;  3P32 A;  1W2B U;  4LFB O;  1MOF A;  5JH7 B;  1VQO V;  4TV8 B;  4DW0 A;  2EX3 A;  4ZI7 B;  1HNX O;  2ZT9 B;  5B1N A;  2VQF B;  4FZ1 A;  4F4L A;  3D3I A;  1OV9 A;  1SZT A;  2ZCE A;  2N04 A;  4DV1 B;  4J7Z A;  1SQQ H;  1H8H G;  4G2K A;  1GN4 A;  1QQC A;  1Q82 W;  3ZMT A;  2AXT Z;  3JD1 A;  2AHZ A;  5GTI Z;  1FAF A;  1LUV A;  3KCX A;  3E22 B;  1AVM A;  4FLX A;  3DSQ A;  3PJS K;  3F5W C;  3CRQ A;  3CYO A;  2R9R B;  1HR0 B;  3TGU H;  1SKV A;  1VQ5 V;  2CGO A;  1K7D A;  4GX2 A;  2GTA A;  4FZ0 A;  2E75 B;  4JI6 B;  5DM6 V;  1I94 O;  3A0B Z;  2DQ3 A;  1IBK B;  4DV5 O;  3ASN C;  1WN7 A;  3JD2 A;  5C8Y B;  3L72 H;  2QTO A;  2VS0 A;  2UXC O;  2DYR B;  3H01 A;  2P7T C;  3FB8 C;  1NT2 B;  4LF4 B;  3Q4H A;  1EN6 A;  4J42 A;  4B3R O;  2Q4P A;  1OJH A;  3WB2 A;  1DTO A;  2F23 A;  3M7M X;  1J5E O;  5LHH A;  4O4L B;  5J2T A;  1S5H C;  4PI0 A;  1JVM A;  1VQP V;  4AI8 A;  2GTS A;  3K03 A;  2YUA A;  3IGA C;  4GCZ A;  4LBE C;  1PD3 A;  1QR9 A;  3RYF A;  1N4C A;  3JAR A;  1EN5 A;  4JYA O;  3E35 A;  5KAI Z;  2QKA A;  3JAK A;  1WAZ A;  4JI7 B;  1RPR A;  1JJ2 U;  4MSW C;  4R6Z A;  5L3F A;  3K5M A;  4GLX A;  3K5N A;  2QM8 A;  3FB5 C;  1NVP D;  4QGP A;  3EVK A;  1KUQ A;  4DR3 O;  4DV6 O;  1VMG A;  2L35 A;  4X8A A;  3D36 A;  4GKJ B;  1F4N A;  2WPD G;  2ZE8 A;  1OCZ B;  3JAT A;  4PJ0 Z;  5H6Q A;  4NB5 A;  2KQX A;  2QWQ B;  4K8Z A;  4LF9 B;  1XOU A;  3RBZ A;  2KSD A;  2YID A;  4MW3 A;  4TWK A;  1Q43 A;  2WA4 A;  2UXD O;  2EIN B;  3LSU A;  4PI2 A;  1D5N A;  1QLN A;  3ABM B;  1SQF A;  2UUA O;  1FKA O;  3FX7 A;  4TUY B;  2VWK A;  4LF8 B;  1VQ6 V;  1MA1 A;  1KD1 W;  4GT1 A;  1N34 B;  5B3S B;  5EBL C;  1CXZ B;  2HVJ C;  1SF9 A;  2XAJ A;  1GN3 A;  2DYR C;  4WFE A;  2JEU A;  1R73 A;  2UUC B;  2ILM A;  3AEI A;  1NS1 A;  2GDS A;  3M8A A;  4L8J A;  5K1P A;  1RM1 B;  5IY5 C;  2ZXW B;  4LF7 B;  3THO A;  5GTH Z;  4ZIB A;  2XOK G;  4BAY A;  4LF6 B;  1SQV H;  4FLT A;  1OCR B;  1SQX H;  1D2D A;  2AGA A;  4LFA O;  3CME V;  1DF5 A;  2JVD A;  5IE9 A;  2IJH A;  1S3J A;  4K35 A;  5IYZ A;  2WLN A;  2H3O A;  2QE7 G;  5LYJ A;  4HZ3 A;  3CCJ V;  4PV1 B;  5GW7 A;  4PEL A;  2HKO A;  1BCC H;  1YCI A;  2ZM6 O;  4NXN B;  1WNS A;  1N32 O;  4CC5 A;  1LNQ A;  2CH7 B;  2R9A A;  3HKC A;  3JD3 A;  4LP8 A;  3ZCC A;  3OTF A;  2MW2 B;  3K5O A;  1YXB A;  2RMK B;  1KP3 A;  1Z5W A;  2QWR B;  4FLV A;  2GSM B;  5IYB O;  3OFN G;  4JZG A;  2EIN C;  3RVY A;  1YF2 A;  1MZF A;  1GK9 A;  3ABM C;  1FD9 A;  1GN2 A;  4I0X A;  3EFF K;  2EBO A;  1F51 A;  2JRI A;  1TUB A;  1K73 W;  4CBC A;  2W0F C;  2B5U A;  3DC6 A;  5KUM A;  1Y6X A;  2PTM A;  3GWK C;  3ZHV A;  1SES A;  2W6J G;  4RQE A;  1XHZ A;  5EBM C;  4I5S A;  2R72 A;  4O4H A;  2YXY A;  3A8T A;  1RM1 C;  4UCV A;  2Y48 A;  1Q7Y W;  3FAV B;  2Y4T A;  1OCR C;  4ZHQ B;  1KEC A;  5BXZ A;  3S3X A;  4JV5 O;  4JI1 B;  4H13 B;  1IUR A;  4UVA A;  3AG2 B;  4G28 B;  4DR5 O;  4JI2 O;  1YZB A;  3VQY A;  1YHQ V;  4X1Y A;  3IAY A;  1NU1 H;  1GO3 F;  2GV9 A;  1XBL A;  3ZRW A;  2Y0I A;  4I55 B;  2CUG A;  2YEV B;  4UFZ A;  2WLI A;  5JCO A;  1R6T A;  1I7F A;  2WLH A;  4CS3 A;  2UXB B;  1G4Y B;  3P3N A;  2JK5 C;  1I08 A;  5HFM A;  1SQP H;  4B3S O;  1H2L A;  3HKD B;  4ASU G;  4X64 O;  4JAU A;  5B1B C;  1RPO A;  1V9P A;  5KX5 A;  2F4V B;  2ZNJ A;  3IC9 A;  2RJZ A;  3GWO A;  1W0J G;  3CJH A;  5EC2 C;  4J9Z B;  3H1L H;  5H6R A;  1FXK B;  2E76 B;  2JGD B;  4U3J B;  5CA1 A;  4BIU A;  1UFI A;  4E2L A;  1QHT A;  3K57 A;  3BA9 A;  3KKY A;  1ZLZ A;  1GTO A;  4CS2 A;  4WF9 V;  4X20 A;  2RN9 A;  1N0N A;  3DXR A;  2EIL B;  5LMU B;  3G71 V;  1M57 B;  3JCZ A;  3CB2 A;  1B3Q A;  3L75 H;  4FJC C;  5KLV H;  4LNU A;  1QLE C;  2ADP A;  2WLK A;  4YIP A;  2F66 C;  4E4E A;  1N36 B;  1AI6 A;  1IXB A;  1R6N A;  4JI5 B;  3HKB A;  4DR2 B;  1U97 A;  1L1F A;  4EB6 B;  4MW8 A;  1U96 A;  1MAB G;  1XNQ B;  3FB6 C;  5EBW C;  5BY1 A;  1HNZ O;  1BQZ A;  1AJN A;  5DN6 G;  5LP6 A;  3AG4 B;  1JFF A;  4F6R A;  2P90 A;  4ZBM A;  3W7U A;  3CC2 V;  1NH2 B;  3SGI A;  3ZMU A;  1H2S B;  3LDD A;  2DYS C;  4XDJ A;  2GHY A;  3KG2 A;  2AZ2 A;  4KXR A;  4TOI A;  3FB7 C;  2CTR A;  3W7W A;  1ZWI C;  3VOU A;  5EK0 A;  1FXV A;  4NXM B;  4K0K O;  1FFX A;  3CCR V;  5JQG A;  2JIZ G;  3CSX A;  3JYC A;  4LF5 O;  1H2G A;  2PF4 E;  3ASO B;  3ZHR A;  2G38 A;  2ZDI A;  1NTK H;  2JJ1 G;  3MHS C;  3JAS A;  4O2B B;  5DEC A;  2ZE7 A;  1TA8 A;  1I94 B;  1QU7 A;  2N05 A;  2QM7 A;  4OXS A;  3F7V C;  2N74 A;  3OEE G;  5FPR A;  3A0H Z;  2VQE O;  1N0J A;  3JD4 A;  3ABL B;  4X1K B;  2UXC B;  4TSF G;  5CA0 B;  4P2Z A;  3B09 A;  3T1C A;  5CBF A;  5FNV B;  2HHH O;  1Z2G A;  3AG3 B;  4BIO A;  1AI5 A;  2BTQ A;  4JI8 O;  1NR1 A;  4B3R B;  4UB6 Z;  4TQF A;  2P06 A;  1IBL B;  3FFQ A;  4TV9 A;  3ZN0 A;  1J5E B;  3STZ C;  1TGO A;  2P4V A;  2B1G A;  4J41 A;  1LUW A;  1X59 A;  2WLM A;  3LSS A;  5B1A C;  3J7A U;  3JD0 A;  1X4T A;  5EZY B;  4JAS A;  4Z1V A;  3LSQ A;  3CC7 V;  3VBB A;  3AG4 C;  3JAM N;  1YDX A;  2Q73 A;  3W7S A;  1XHX A;  5ITZ A;  2ZE6 A;  4P9O A;  3FYE B;  1M90 W;  5LGN A;  2PYL A;  1V54 C;  5IJ0 A;  2LW7 A;  4DV6 B;  4ZOL B;  1KB9 F;  5H9C A;  3WB0 A;  3HKE A;  3CXC U;  3RYC A;  4AQY O;  2IBZ H;  1XEQ A;  3UCS C;  5JVD A;  2M7W A;  3CCE V;  2ADQ B;  5LOV A;  1IBM O;  3LDC A;  5B1O A;  3RVZ A;  1SA0 B;  3O9O A;  2UXD B;  3BA8 A;  4YHH O;  2Q67 A;  4I4T B;  4YIO A;  1JCH A;  2A3Q A;  1JOY A;  2XUM A;  1GRJ A;  3CPW U;  3OE7 G;  5K1X A;  1EZV H;  2WSS G;  4IGG A;  4I50 B;  3SJB C;  3ZBH A;  1WLE A;  5KHJ A;  3AG3 C;  2VRZ A;  4RAI A;  1S5L Z;  3T1H B;  2Z3Y A;  4DRX A;  1K92 A;  1ZUQ A;  5GON B;  5EYP A;  1N33 O;  5JH7 A;  4U7O A;  3L74 H;  2IW5 A;  4ZI7 A;  4LFA B;  4UCT A;  1WB8 A;  1BE3 H;  2PI4 A;  2CGN A;  3N2K B;  1K34 A;  3K0D A;  3BEH A;  4JI4 O;  3QNE A;  4UXN A;  2ZIO A;  5DED A;  2ETN A;  3CP1 A;  2Y0P A;  2ZM6 B;  1FFT B;  4K8X A;  3HPL C;  4DK0 A;  1EBO A;  2Y4U A;  2WA3 A;  4JI0 O;  1XMQ O;  2QGN A;  1BHB A;  4IIJ A;  3CCS V;  2F1M A;  3E22 A;  1N8R W;  4O4I A;  1Q3E A;  1MMM A;  1BT8 A;  2BOC C;  2UXX A;  5JWP A;  4O2A B;  4CZZ A;  1K4D C;  4DUY O;  3TXS A;  4BW9 A;  2O57 A;  3QO5 A;  2MK3 A;  3K58 A;  5L3C A;  1YSC A;  2Z5U A;  2B9Z A;  4CH3 A;  4JYY A;  4NVP A;  1XMO O;  3E86 A;  3S3W A;  1KU9 A;  1Q5O A;  3ZN1 A;  3TK1 A;  2YIA A;  2JS3 A;  4MVQ A;  2H94 A;  1O9H A;  4IL6 Z;  2YDE A;  1P7B A;  1JPX A;  3SJC C;  4R8C A;  5JJE B;  5LA6 A;  1URF A;  2YS8 A;  3JSN A;  1UPG A;  2YXH A;  3K08 A;  4O4L A;  1WB7 A;  3K0G A;  4JPR A;  2Q7E A;  5B5E Z;  1GKF A;  3UO2 A;  2H8P C;  3WG7 C;  2EIJ C;  4QPJ A;  4AHC A;  3OTO O;  1MSW D;  1VEW A;  4JV5 B;  5KHG A;  3JSL A;  3Q4H B;  1OCC B;  3L9D A;  3BPZ A;  4DR5 B;  3BAB A;  4DYL A;  5LGT A;  1QVF U;  4MVU A;  1ZAU A;  4DV3 O;  3DTU B;  1F23 A;  2QWO B;  4Q6G A;  5LMN B;  1UJW B;  3R65 A;  4FM2 A;  2OWO A;  2QWP B;  4YY3 O;  4B3T B;  4IHJ A;  3CCL V;  4LWS A;  3ZRS A;  2GBO A;  1Y67 A;  2FTK A;  4I9W A;  4FLY A;  2NLJ C;  3G4S V;  2Q69 A;  4KUM A;  4GKK O;  2YIC A;  4KP4 A;  2DQ0 A;  5KMG A;  3JAT B;  1NJI W;  2PZS A;  3F5T A;  5KAF Z;  5CB4 B;  1BS3 A;  3RYI A;  4DUZ B;  2OYQ A;  1Y76 B;  2A79 B;  1FJG O;  1QNM A;  1SET A;  3ZHT A;  4MVM A;  4XDL A;  1RSO A;  1O9G A;  2V7Q G;  3CHX A;  4EFE A;  2JS5 A;  2UUB O;  1K33 A;  1WA8 B;  3HR0 A;  3QO7 A;  5IJ9 A;  4WFG A;  2IH1 C;  3BAA A;  4R7C A;  3AK3 A;  3B8M A;  4UCS A;  1VQL V;  4DR4 O;  2ZIN A;  1QVG U;  1NH2 D;  2EZO A;  3NXS A;  2YSU B;  3ABU A;  2QKS A;  1ZX3 A;  2ZKO A;  5JJN B;  1Q6I A;  1I0H A;  4JGS A;  4WFA V;  1XL6 A;  2AW9 A;  2CH7 A;  4B3M B;  5IWA O;  3K5L A;  1AB3 A;  4UCU A;  2YIB D;  4LCU C;  2E5L B;  5IYZ B;  4HNA B;  5KUK A;  4WBN B;  1SC5 B;  3K79 A;  1OCZ C;  4DV1 O;  3ZED A;  1VQK V;  4MTX A;  3WU2 Z;  2RNB A;  1HNW O;  1WP7 A;  4FFB B;  4GX1 A;  4DV4 B;  4LFC B;  4UCR A;  1G1X B;  3VQW A;  4J80 A;  3L71 H;  4OX9 B;  3HKC B;  1IX9 A;  1R3K C;  3UO3 A;  4DV0 B;  4K0K B;  1L0L H;  2P22 C;  1I5X A;  4CH5 A;  1YVW A;  3RWR D;  4LF5 B;  1P49 A;  3CCU V;  1VIB A;  2ZD9 A;  1B6Q A;  3D3Q A;  2EIM B;  2V4D A;  4QNH B;  5B3S C;  1AR1 B;  4P30 A;  1SRY A;  5HFL A;  1L8D A;  2CDY A;  3CRM A;  2E74 B;  1HR0 O;  2JJ2 G;  3SYC A;  4DR7 B;  2X0L A;  3JAW B;  1IBK O;  4I0X B;  2ZXW C;  1Y66 A;  3G67 A;  4X65 O;  4ZHQ A;  1TUB B;  1BQ0 A;  1M56 B;  2HHH B;  5H2F Z;  3CD6 V;  1R3I C;  4X1I B;  2LP7 A;  1SER A;  2UU9 B;  3ZMZ A;  3I56 V;  2PYJ A;  4DV7 B;  4O4H B;  1VF7 A;  1E1Q G;  1DK1 A;  2F95 B;  1XNR O;  1WJZ A;  2EJR A;  3G6E V;  4UVC A;  4I55 A;  1YJW V;  4PA3 A;  2C2A A;  3ZX6 A;  4H44 B;  4KHP O;  3JCU Z;  4W4L A;  2JEX A;  3FKS G;  1MG1 A;  1ZL8 A;  4X62 O;  3RN4 A;  3HKD A;  1ROP A;  4JI7 O;  1NR7 A;  4X1Y B;  1AIL A;  3ZRW B;  1IDS A;  2K9P A;  2WLI B;  4LR3 A;  3I5D A;  3RYH B;  2KG7 B;  3MDS A;  3CE2 A;  3T1Y B;  2QM4 A;  2OIG A;  1ENV A;  4AQY B;  3N2G A;  1I5Y A;  4GKJ O;  2WLL A;  3CS5 A;  4U3J A;  3OW2 U;  5LXT A;  4RUF A;  4JI3 O;  4ICG A;  4LF9 O;  2HP8 A;  3J81 N;  3OM3 B;  1ZSP A;  2D2C B;  4CH4 A;  5KX5 B;  5BMV A;  3RW0 A;  3ABK B;  3MD0 A;  1E79 G;  4FM0 A;  3OT7 A;  2HFE C;  4EKW A;  2GUZ B;  3TXQ A;  1H2N A;  1N34 O;  3U0Z A;  1TAE A;  1VQ8 V;  4DR6 B;  1VQ7 V;  3X2Q B;  1VF5 B;  1BHA A;  1ZTE A;  4NTX A;  3T4Z A;  5BR8 O;  2ZIM A;  4PDL A;  3SYA A;  3CCM V;  1VP7 A;  1RP3 B;  1BL8 A;  3JAL A;  4LF7 O;  1AR5 A;  3AG2 C;  4X20 B;  1VF6 C;  2ATK C;  2A0L A;  4J11 A;  4PA9 A;  1S76 D;  1N33 B;  4X9Q A;  4LF6 O;  1GH6 A;  4LFB B;  4B7K A;  2VWJ A;  1XL4 A;  2EIK B;  4BIZ A;  3DC5 A;  1HNX B;  2Q7G A;  4KFM A;  4X88 A;  1K5S A;  4LNU B;  5IDJ A;  1XDC A;  3BFR A;  2EJ7 A;  1EM1 A;  1PKX A;  4JF3 A;  1OZ0 A;  1XMQ B;  4JI0 B;  3BHP A;  2ZNI A;  4NXN O;  1YTF B;  1KKD A;  2Q8V A;  3K59 A;  3UM7 A;  4ABM A;  4O4J A;  2DJV A;  3H1K H;  5CBG A;  1P84 F;  1T5E A;  4DUY B;  2LO1 A;  1JFF B;  3OMN B;  2YIB A;  4F6R B;  1FXK C;  4QPK A;  4DXW A;  4YXW G;  4B08 A;  5C93 A;  3OMI B;  1XMO B;  2Y69 B;  5L3D A;  3FYI B;  4TT3 G;  5KHI A;  4IYH A;  4DV5 B;  4YJ3 B;  2BSK A;  4EEQ A;  3IFX A;  1FFX B;  5JQG B;  4UVB A;  4X1K A;  2CTQ A;  1AI4 A;  2HR3 A;  2EIL C;  5CA0 A;  2JDI G;  3MHH C;  4YJ2 B;  1M57 C;  1JQ0 A;  2OCC B;  4JAV A;  3X2Q C;  4DO2 A;  5J2U A;  1OCO B;  3R66 A;  4H37 A;  2QA4 V;  2QTS A;  1Z5V A;  3JAS B;  5TIS Z;  1K4C C;  3ETQ A;  3ZRV A;  4FIP C;  5CMU A;  4PDR A;  1W59 A;  3LDE A;  1YIT V;  1YIJ V;  2DOS A;  3ETG A;  5LHG A;  1F7Y A;  1Y74 A;  4HBN A;  1HP8 A;  3B77 A;  1G6U A;  1V55 B;  4JI1 O;  5L3E A;  4WFH A;  5LL6 Y;  3SYP A;  4JYA B;  1D5A A;  2BTQ B;  3UT5 A;  2NNU A;  5EC1 C;  1S5J A;  4TV9 B;  5KA5 A;  2ZE5 A;  3CX5 F;  5F2V O;  5CA3 A;  2CAZ C;  4DV3 B;  4H33 A;  3ABT A;  2L6L A;  1TVK B;  1WPX A;  4X66 O;  2YXL A;  4DR3 B;  4ZOL A;  4Z1M G;  2UXB O;  5BZB A;  1K9M W;  4BR6 A;  3KZI Z;  3ZHU A;  3K06 A;  3ASO C;  1JMK C;  5FPO A;  2F4V O;  5ITZ B;  1JJO A;  4DW1 A;  2QWN B;  4I4T A;  1GM8 A;  2Y69 C;  4MTG A;  4OPH A;  3SYQ A;  1FPO A;  2UUA B;  5IJ0 B;  1R3L C;  2WAM A;  1S77 D;  1ARO P;  1PPJ H;  3RGB A;  4A5U B;  5B66 Z;  1HWY A;  3EXA A;  3HKE B;  3K9A A;  3RYC B;  5JVD B;  3ABL C;  5LOV B;  1KQS U;  4H0L B;  3ZHS A;  4L87 A;  2HJD A;  5D5Q A;  3CMA V;  4J9Y B;  1GM7 A;  3OGC C;  3ASN B;  1SQG A;  5GON A;  2P67 A;  2IM9 A;  2OCH A;  5IYC O;  2Q6A A;  1M9N A;  5LMU O;  1HW7 A;  2OIE A;  4FK5 C;  4TV8 A;  3E8F A;  4DR4 B;  2ZR3 A;  4PDM A;  4AIL C;  1YJ9 V;  3SPI A;  1RFY A;  2DMX A;  1A32 A;  4DRX B;  4MTO A;  5CBH A;  1M1K W;  4JI5 O;  4OGQ B;  5CN0 A;  3C90 A;  5EYP B;  1K97 A;  3STL C;  5IWA B;  1XNQ O;  1N32 B;  2QDO A;  1IVS A;  4O2A A;  2XND G;  2YI8 A;  4P9P A;  3C3T A;  4NR1 A;  4KL1 A;  2R9I A;  3E8G A;  1HNW B;  4DV2 O;  2AZ0 A;  1WP8 A;  1NKD A;  5A9G A;  2LFR A;  4TQD A;  4J7J A;  4IIJ B;  4QE7 A;  1NTZ H;  2KB1 A;  4NXM O;  4O4I B;  5C8Y A;  4MT8 A;  5LGU A;  3OGI B;  1PP9 H;  5IYD O;  1NTM H;  4BWA A;  2JGU A;  3ICX A;  3SPC A;  4LH7 A;  4X65 B;  3SJA C;  2Q0A A;  1YJN V;  1NI8 A;  1VQM V;  5FL7 G;  1HDJ A;  2YC0 A;  3E8H A;  3SPJ A;  5LA6 B;  2XHB A;  3ZHQ A;  4GX0 A;  4UB8 Z;  1CEZ A;  1J95 A;  5IY5 B;  1IBL O;  4MVR A;  1XNR B;  4JI2 B;  3AK2 A;  3LNN A;  2PUS A;  5J2T B;  4HYO A;  1AI7 A;  4EFB A;  2IU3 A;  1PL0 A;  3B8N A;  1MNG A;  2HG5 C;  3BRC A;  3H9V A;  5EIB D;  4KHP B;  1F4M A;  2XTA A;  3SYO A;  2P6J A;  3ZJZ A;  2NR5 A;  1S72 V;  3RYF B;  1P4R A;  4X62 B;  1Q6H A;  3JAR B;  2XAF A;  4B3S B;  2CK3 G;  3JAK B;  2Q5Z A;  3IJ4 A;  4X64 B;  2W0X A;  3K9S A;  1TUE B;  3H1J H;  1OHH G;  3CRR A;  3U10 A;  1KBH A;  3GVM A;  5L3B A;  4RUE A;  3U11 A;  4JAA A;  1XRE A;  4TUY A;  3SPG A;  2IJJ A;  3A0R A;  3WB1 A;  3MAQ A;  3GB7 C;  3D8C A;  4IHJ B;  2A9H A;  4JI3 B;  4FPP A;  4RO2 A;  2LFS A;  4LWS B;  2B1I A;  2DWD C;  3OD4 A;  5CB4 A;  1Y76 A;  1GAX A;  4QJF B;  3SDL A;  2WLJ A;  1COW G;  5LBQ A;  3B4S A;  3BVO A;  3OUF A;  4PDV A;  4CC6 A;  1AR4 A;  4QIW F;  3B40 A;  2FYU H;  1WA8 A;  5KMG B;  2WWW A;  2Q7H A;  1BMF G;  5BR8 B;  3RYI B;  4JTA B;  3KCY A;  4OPA A;  4X89 A;  3ZRX A;  3QO8 A;  2OTL V;  1OCC C;  3W7T A;  1AP6 A;  2W6I G;  3T1H O;  1KMI Z;  4J10 A;  1RSO B;  3QG5 A;  1YTF D;  4PD4 F;  3K04 A;  2CTP A;  1SQB H;  4UCO A;  4N21 A;  3ETD A;  5IJ9 B;  2IU0 A;  2IH3 C;  1Q81 W;  1HNZ B;  4DR1 O;  2Z0A A;  3CRC A;  4MVZ A;  4I7Z B;  5LHI A;  1DLB A;  1YEW A;  3E8B A;  3EHB B;  4HNA A;  2VQF O;  4WBN A;  2QSA A;  1QR8 A;  4WCE V;  4XDK A;  5LYJ B;  2X6C A;  4FFB A;  1AP5 A;  4GYC B;  1R6K A;  1GMG A;  1Q86 W;  5KA6 A;  2FL4 A;  4NTY A;  4JYB A;  1CPY A;  1PV0 A;  4D7T A;  3QF7 A;  3VQV A;  3ZIA G;  2FB5 A;  1G8M A;  5E79 Z;  3D36 C;  5KHK A;  5B1B B;  1IZ3 A;  1K5Q A;  1ORQ C;  3JAW A;  1THZ A;  1Y4M A;  4JI6 O;  4LC1 A;  4GUN A;  4MVO A;  4RWU A;  2DE0 X;  2EZP A;  1XI1 A;  2VQE B;  4GZR B;  3FAV A;  2LW1 A;  5A2Q N;  4MVS A;  4X1I A;  3AG7 A;  3UKM A;  4ZKI A;  1PL4 A;  2M6Y A;  4LF4 O;  4JI8 B;  2BCC H;  3DGE A;  4WFF A;  3AG1 B;  1VF6 A;  1K8A W;  3CWB H;  3VQX A;  5J9P C;  2RDC A;  2IJI A;  3E2E A;  2ARH A;  2YEV A;  1VQ4 V;  4FMT A;  1PNL A;  3OUS A;  3W7X A;  1P7G A;  1QLE B;  4CH6 A;  2QJ1 A; 
#chains in the Genus database with same CATH homology
 1DF4 A;  1E1R G;  3IFX A;  1K34 A;  3K0D A;  3BEH A;  3QNE A;  4UXN A;  4UVB A;  1VQ6 V;  3P30 A;  1KD1 W;  2X7R B;  4GT1 A;  1AI4 A;  2HR3 A;  1FXH A;  2EIL C;  2XAG A;  3CP1 A;  1FFT B;  4G27 B;  2JDI G;  4PA7 A;  3MHH C;  3HPL C;  3LUT B;  2HVJ C;  5EBL C;  4WFB V;  1EBO A;  2HLD G;  2DYR C;  2XAJ A;  4WFE A;  1M57 C;  2JEU A;  2QEX V;  1JQ0 A;  1R73 A;  2OCC B;  4JAV A;  3X2Q C;  4DO2 A;  1OCO B;  1BHB A;  4H37 A;  2QA4 V;  3CCS V;  3AEI A;  1K4C C;  3HB3 B;  4HAM A;  1N8R W;  2BOC C;  3ZRV A;  2UXX A;  2X6B A;  4FIP C;  5CMU A;  1RM1 B;  4PDR A;  5IY5 C;  4CZZ A;  2ZXW B;  3OEH G;  4JTC B;  1FXK A;  2HJF C;  3LDE A;  1K4D C;  2XOK G;  1YIJ V;  1YIT V;  4PA4 A;  2EIM C;  4BAY A;  3ETG A;  2ITD C;  5LHG A;  3QO5 A;  1OCR B;  3CCV V;  3CCQ V;  2MK3 A;  3E89 A;  2Q68 A;  2DYS B;  5L3C A;  3B77 A;  1YSC A;  2Z5U A;  3CME V;  1DF5 A;  2XAS A;  2IJH A;  1V55 B;  5L3E A;  1S3J A;  3E86 A;  4WFH A;  2WLN A;  1AJQ A;  2QE7 G;  3SYP A;  1R3J C;  3ZN1 A;  3TK1 A;  2NNU A;  5EC1 C;  1NVP B;  4HZ3 A;  4MVQ A;  5KA5 A;  2H94 A;  2XAH A;  4BW5 A;  5GW7 A;  1P7B A;  3CCJ V;  1QBZ A;  2WLL B;  5CA3 A;  4PEL A;  2HKO A;  4N23 A;  4H33 A;  3T4D A;  1YI2 V;  1JPX A;  3ABT A;  4R8C A;  1M56 C;  1WPX A;  1S0V A;  1LNQ A;  2BOB C;  5B3S B;  3JD3 A;  2F43 G;  1NQT A;  4Z1M G;  4LP8 A;  3ZCC A;  5L3G A;  5BZB A;  3K08 A;  1K9M W;  3SJQ C;  1KP3 A;  3K0G A;  3AG1 C;  3K06 A;  4JPR A;  3ASO C;  1GKF A;  2H8P C;  2UXN A;  3TET A;  3WG7 C;  2EIJ C;  2GSM B;  4QPJ A;  5IYB O;  1MSW D;  3OFN G;  2EIN C;  3RVY A;  1QCE A;  1GM8 A;  2Y69 C;  4MTG A;  1GK9 A;  3SYQ A;  3ABM C;  1OCC B;  1R3L C;  3EFF K;  2WAM A;  2EBO A;  1F51 A;  1S77 D;  1ARO P;  1H38 A;  1HWY A;  2HVK C;  3K9A A;  4U7N A;  1K73 W;  3ABL C;  5LGT A;  4R50 A;  4CBC A;  1QVF U;  4MVU A;  1KQS U;  2W0F C;  2B5U A;  3DTU B;  1F23 A;  5B1A B;  5KUM A;  4L87 A;  3ZMV A;  1UJW B;  1SES A;  3R65 A;  3CMA V;  2W6J G;  4RQE A;  3ZMS A;  4J9Y B;  3E83 A;  4I5S A;  1GM7 A;  5EBM C;  3OGC C;  3ASN B;  1RM1 C;  2P67 A;  4RQF A;  3CCL V;  2OTJ V;  2Y48 A;  1Q7Y W;  5IYC O;  2Q6A A;  1M9N A;  1CP9 A;  3ZRS A;  3SPH A;  1OCR C;  4FK5 C;  1KEC A;  2FTK A;  3E8F A;  2ZR3 A;  1V54 B;  4PDM A;  3ABK C;  4I9W A;  1IXM A;  2NLJ C;  1H8E G;  1YJ9 V;  3G4S V;  2V1D A;  3SPI A;  2D3O W;  2Q69 A;  1PNM A;  1K3E A;  4KUM A;  4UVA A;  3AG2 B;  4G28 B;  3OMA B;  4KP4 A;  4MTO A;  5CBH A;  1YHQ V;  1M1K W;  2IJK A;  2DQ0 A;  1GO3 F;  1NJI W;  1AJP A;  5CN0 A;  1KP2 A;  1W0K G;  3CC4 V;  1K97 A;  3ZRW A;  3STL C;  3K3W A;  2YEV B;  2WLI A;  2A79 B;  1PNK A;  3F7Y C;  3I55 V;  2WLH A;  1G4Y B;  1SET A;  2JK5 C;  3IC7 A;  4MVM A;  4XDL A;  2XND G;  2V7Q G;  4P9P A;  4JTD B;  2OT5 A;  5HFM A;  1K33 A;  4PA6 A;  3QO7 A;  2R9I A;  4ASU G;  4JAU A;  3E8G A;  4WFG A;  5B1B C;  1RPO A;  2IH1 C;  4R7C A;  3B8M A;  2EIK C;  1NKD A;  1VQL V;  3OAA G;  4UUJ C;  2LFR A;  5E1A C;  1QVG U;  1NH2 D;  2EZO A;  3GWO A;  4MS2 A;  1W0J G;  3NXS A;  4QE7 A;  2KB1 A;  5EC2 C;  4J9Z B;  2DWE C;  2YSU B;  5H6R A;  1VQ9 V;  1VQN V;  1FXK B;  3ABU A;  2QKS A;  3ML0 A;  2XAQ A;  3ETE A;  4JYC A;  4MT8 A;  4MTF A;  4JGS A;  4BIU A;  4WFA V;  1XL6 A;  4UV9 A;  5LGU A;  4E2L A;  3TCU A;  5IYD O;  2K1E A;  4Q20 A;  3SPC A;  4LCU C;  1GTO A;  4WF9 V;  1FS0 G;  5KUK A;  3K79 A;  1OCZ C;  4GX5 A;  2EIL B;  1YJN V;  1VQK V;  4MTX A;  3G71 V;  4UV8 A;  1VQM V;  5FL7 G;  1M57 B;  3OR7 C;  4GX1 A;  2PI5 A;  3JCZ A;  3E8H A;  3SPJ A;  4FJC C;  2ZQM A;  1NBM G;  1QLE C;  1R3K C;  4GX0 A;  2WLK A;  1CEZ A;  1J95 A;  1I5X A;  3T2M A;  4QE9 A;  5IY5 B;  2DW4 A;  4MVR A;  1AI6 A;  3CCU V;  2ZD9 A;  1B6Q A;  1JX9 A;  1R6N A;  2AHY A;  3M99 B;  2EIM B;  4QNH B;  5B3S C;  4HYO A;  1L1F A;  1AR1 B;  4P30 A;  1SRY A;  1AI7 A;  4MW8 A;  5HFL A;  2IU3 A;  1PL0 A;  3B8N A;  3BY6 A;  1MAB G;  2HG5 C;  2JJ2 G;  3FB6 C;  2OCC C;  5EBW C;  2ZDI C;  1F4M A;  1OCO C;  3WFV A;  3SYO A;  2P6J A;  1AJN A;  3LNM B;  3SYC A;  3ZJZ A;  1S72 V;  5DN6 G;  2X0L A;  1P4R A;  3AG4 B;  1EFR G;  2ZXW C;  2XAF A;  2ITC C;  3OR6 C;  1Y66 A;  2P90 A;  4ZBM A;  2CK3 G;  3W7U A;  3CC2 V;  1NH2 B;  1EZJ A;  3ZMU A;  1TUE B;  1M56 B;  1GM9 A;  1OHH G;  3CD6 V;  3LDD A;  2DYS C;  2X6A A;  1R3I C;  2GHY A;  4XDJ A;  4XBF A;  3KG2 A;  5L3B A;  4RUE A;  2LP7 A;  1KC8 W;  1V55 C;  1SER A;  3FB7 C;  3SPG A;  3W7W A;  1ZWI C;  3VOU A;  2IJJ A;  5EK0 A;  3ZMZ A;  1FXV A;  3A0R A;  3I56 V;  3GB7 C;  3CCR V;  2JIZ G;  2ZR2 A;  3JYC A;  1E1Q G;  1H2G A;  2A9H A;  3ASO B;  2EJR A;  4FPP A;  4RO2 A;  3WG7 B;  2EIJ B;  3G6E V;  2LFS A;  4UVC A;  2B1I A;  2DWD C;  2ZDI A;  1YJW V;  3P32 A;  4PA3 A;  1W2B U;  1MOF A;  2JJ1 G;  2C2A A;  3MHS C;  1VQO V;  4QJF B;  2JEX A;  3FKS G;  2WLJ A;  5B1N A;  1COW G;  5LBQ A;  2QM7 A;  4OXS A;  1MG1 A;  3F7V C;  3OEE G;  4F4L A;  3D3I A;  3OUF A;  4PDV A;  4QIW F;  1SZT A;  1ROP A;  3JD4 A;  3ABL B;  1NR7 A;  4TSF G;  4P2Z A;  1H8H G;  4G2K A;  2WWW A;  1BMF G;  3T1C A;  5CBF A;  3AG3 B;  3ZRW B;  1Q82 W;  3ZMT A;  2WLI B;  3JD1 A;  1AI5 A;  2AHZ A;  4JTA B;  4X89 A;  1NR1 A;  3ZRX A;  3QO8 A;  2OTL V;  1OCC C;  3W7T A;  1ENV A;  1I5Y A;  2W6I G;  3ZN0 A;  3STZ C;  3PJS K;  1YTF D;  3F5W C;  2WLL A;  3K04 A;  2B1G A;  3OW2 U;  4RUF A;  3CYO A;  2WLM A;  4N21 A;  3ETD A;  2R9R B;  2IH3 C;  3OM3 B;  2IU0 A;  1Q81 W;  3LSS A;  5B1A C;  3JD0 A;  1VQ5 V;  1K7D A;  4GX2 A;  3RW0 A;  4MVZ A;  3ABK B;  1DLB A;  4JAS A;  3MD0 A;  5LHI A;  3E8B A;  1E79 G;  3EHB B;  5DM6 V;  3LSQ A;  3CC7 V;  3VBB A;  2DQ3 A;  1QR8 A;  2HFE C;  3AG4 C;  4EKW A;  3ASN C;  3JD2 A;  4WCE V;  4XDK A;  2X6C A;  3W7S A;  2QTO A;  2DYR B;  1VQ8 V;  3H01 A;  4P9O A;  3FYE B;  1M90 W;  1R6K A;  1VQ7 V;  3X2Q B;  1GMG A;  2P7T C;  5LGN A;  3FB8 C;  1Q86 W;  1BHA A;  1V54 C;  3T4Z A;  5KA6 A;  4JYB A;  1CPY A;  4PDL A;  3SYA A;  3CCM V;  1BL8 A;  1DTO A;  5H9C A;  3ZIA G;  3CXC U;  1G8M A;  5LHH A;  2M7W A;  3AG2 C;  3CCE V;  2ATK C;  4PA9 A;  2A0L A;  1S5H C;  1S76 D;  5B1B B;  1JVM A;  3LDC A;  1VQP V;  1K5Q A;  5B1O A;  3K03 A;  3RVZ A;  1XL4 A;  3IGA C;  2EIK B;  4GCZ A;  4BIZ A;  1ORQ C;  4LBE C;  1PD3 A;  4KFM A;  1QR9 A;  2Q67 A;  4X88 A;  1K5S A;  1THZ A;  1Y4M A;  5IDJ A;  4LC1 A;  1JCH A;  1JOY A;  3E35 A;  4MVO A;  2EZP A;  3CPW U;  3OE7 G;  1RPR A;  1JJ2 U;  4MSW C;  4MVS A;  4R6Z A;  5L3F A;  1PKX A;  4JF3 A;  1OZ0 A;  2WSS G;  3UKM A;  4ZKI A;  2QM8 A;  1WLE A;  1YTF B;  3FB5 C;  1KKD A;  3AG3 C;  1NVP D;  3UM7 A;  4RAI A;  5CBG A;  3DGE A;  4WFF A;  2Z3Y A;  4X8A A;  3D36 A;  1F4N A;  3AG1 B;  1K92 A;  2WPD G;  1K8A W;  3OMN B;  5J9P C;  1OCZ B;  5H6Q A;  1FXK C;  2IJI A;  4QPK A;  4DXW A;  3RBZ A;  3E2E A;  2YEV A;  4U7O A;  4MW3 A;  4TWK A;  1VQ4 V;  4FMT A;  1PNL A;  2IW5 A;  4YXW G;  3OUS A;  2EIN B;  5C93 A;  3OMI B;  3W7X A;  2Y69 B;  1QLE B;  1QLN A;  5L3D A;  3FYI B;  3ABM B;  2PI4 A;  4TT3 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...