4X88A

E178d selectivity filter mutant of navms voltage-gated pore
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLDSWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
molecule tags Transport protein
source organism Magnetococcus marinus mc-1
publication title Molecular basis of ion permeability in a voltage-gated sodium channel.
pubmed doi rcsb
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4x88A00
4WFGA 3GB7C 1OCZC 4OXSA 4H37A 2YEVA 1G4YB 3T4ZA 4RO2A 3OUFA 3SPGA 1J95A 2K1EA 1XL6A 2Y69C 4MVRA 4TWKA 4XDJA 5EC2C 5KUMA 4GX5A 4R6ZA 1M56C 2QKSA 4LCUC 3STLC 3UM7A 1K4DC 1R3JC 3E83A 4GX1A 4UUJC 4F4LA 4P2ZA 5EC1C 4PA3A 3E86A 2HVJC 3LDDA 1OCCC 4PDMA 4JTDB 3K0DA 1S5HC 4H33A 2EIMC 4I9WA 3IFXA 4XDKA 3LUTB 4MVUA 2WLKA 4LBEC 2P7TC 2ATKC 1K4CC 4HYOA 1M57C 5B1BC 3STZC 2EINC 4G28B 4P30A 2H8PC 3F7YC 3K03A 3TCUA 3SPCA 2Q69A 2NLJC 3ABMC 4DXWA 2A9HA 3FB5C 3K08A 3KG2A 3OUSA 4MVSA 4MVOA 1JVMA 4GX0A 4CBCA 3HPLC 2EIJC 2JK5C 4J9ZB 4PA9A 4MTFA 5CBHA 3SPHA 3IGAC 4R8CA 3BEHA 3RVYA 4GX2A 3ZRSA 2HJFC 4MW3A 5KUKA 2X6BA 3FB8C 4X88A 3VOUA 4PDRA 4RUEA 3ABKC 1KKDA 5J9PC 3T1CA 3TETA 3AG2C 3T4DA 1BL8A 2HVKC 4RAIA 3JYCA 3FB6C 3OR6C 3SYPA 1R3KC 5EBWC 3LDEA 1OCOC 4QNHB 3OR7C 4J9YB 5BZBA 1OCRC 2ITCC 1V55C 2R9RB 3ASOC 2WLJA 3K0GA 3FB7C 3SYQA 3ZJZA 5EBMC 1LNQA 1ZWIC 3ASNC 2DWDC 1R3LC 2HFEC 3E89A 4RUFA 3UKMA 4WFEA 2DYSC 3E8BA 4P9OA 2Q68A 4P9PA 3T2MA 1P7BA 2Q6AA 2HG5C 4WFHA 4XDLA 3AG3C 3RVZA 3AG4C 4MTGA 4JTAB 2Q67A 2KB1A 4MW8A 4WFFA 4X89A 4PDVA 2X6AA 3RW0A 4EKWA 4MVZA 3LDCA 3SYAA 2QTOA 2DWEC 3EFFK 1R3IC 4PA6A 2AHZA 2IH1C 5EK0A 2EILC 2WLLA 3E8GA 3OGCC 4MSWC 2WLIA 4LP8A 3K06A 1V54C 1XL4A 2ITDC 3AG1C 3R65A 3WG7C 5CBGA 5B3SC 5B1AC 3E8FA 3SYOA 4MVQA 3SJQC 1ORQC 4R50A 4ZBMA 2ZXWC 2DYRC 4BW5A 3SPIA 3ABLC 4PA7A 4MS2A 5IY5C 3E8HA 2AHYA 3SYCA 4R7CA 3X2QC 3F7VC 3K04A 3RBZA 2IH3C 2OCCC 2W0FC 2A0LA 4QE7A 2EIKC 4MTOA 4QE9A 2WLHA 3PJSK 4PDLA 3SPJA 3LNMB 2A79B 4X8AA 2WLNA 4HZ3A 5E1AC 4JTCB 4G27B 2WLMA 2WLIB 2ZD9A 5CBFA 2BOCC 1QLEC 2WLLB 2BOBC 4KFMA 4MVMA 5EBLC 3F5WC 4PA4A 2X6CA
chains in the Genus database with same CATH superfamily
2NR5A 2OWOA 4OXSA 5LMUO 2XAFA 3T4ZA 3ZRVA 4N23A 4I4TA 5EC2C 4O4LB 4NTYA 4GX1A 3UT5A 2B1IA 1KKCA 3UO3A 4N21A 4DV1B 3B4SA 5JWPA 1KB9F 2GBOA 3K5MA 4B3MO 1FJGB 1N32O 4QJFB 2IJHA 3ABLB 4HYOA 4A5UB 4O2BA 3P3PA 1Q5OA 1H2MA 2A3QA 1YF2A 2ZNJA 1H2LA 1ROPA 4LWSB 3B77A 4X88A 2N74A 3RN4A 1EBOA 3K57A 4JI8B 4U7NA 1HNZB 3L72H 2UUCB 4WBNB 1PPJH 1SKVA 1SZTA 3FB7C 2XUMA 2IJIA 2KG7B 4HNAA 4PDVA 2X6AA 1S0VA 4AHCA 2GHYA 5JH7A 1PM9A 1SC5B 1TUEB 5IYBO 4B3SB 3D36A 2UXDB 1VQ5V 3OMNB 1V54C 5IJ9A 5B3SC 2AXTZ 4YHHB 4R50A 5IYCO 4BW5A 1NI8A 1N33O 1T5EA 5LHGA 1UFIA 1N36B 4G27B 3I55V 1VQOV 4UXNA 1K8AW 2VRZA 5CA0B 5JQGA 5HFMA 3AG2B 4WFGA 4GKJO 1G4YB 1M9NA 3MDSA 2QSAA 1J95A 4ABMA 2K1EA 3ZCCA 1VQ7V 1IDSA 3STLC 4J41A 4LCUC 4JAAA 4PA3A 1EM1A 4CC6A 3QG5A 1QR8A 3OD4A 4BWAA 1QHTA 4PELA 1I94B 3EXAA 2B9ZA 2UXCB 2IJKA 1XI1A 2BTQB 1FXHA 4JV5B 3OM3B 2QE7G 3LNNA 3L70H 4GX0A 1I7FA 2EIJC 4LFCO 3SPHA 1NKDA 1XNQO 4X62O 3D3IA 5GONA 1K5QA 4DYLA 3DGEA 1YTFD 1R3KC 2UXNA 3B09A 4X66B 5FNVA 2E76B 4DRXB 5J2UB 3MHHC 1NVPB 1QLEB 1R3LC 4B7KA 4LF6O 2QWRB 4LF7B 2LFSA 2ZQMA 3OMIB 4EKWA 3OAAG 4FIPC 1ENVA 4TUYB 5J2TB 4RQFA 3W7SA 5BR8B 2V1DA 4YJ3A 3CCVV 2HKOA 5KA6A 3HKDB 3HKBA 3GWKC 5B1AC 2F43G 1SA0B 3ZMTA 4FLTA 2O57A 4GCZA 1ZUQA 4DV6B 1OCOB 4UCVA 4OX9B 2PYLA 4GYCB 1XQ8A 5KMGA 4IHJB 3RFRA 3K58A 4KFMA 2WA4A 3F5WC 1YIJV 2DYSB 1KBHA 4IGGA 2QKSA 2Y0IA 3ASOB 1F7YA 2ZNIA 5EC1C 2ETNA 3C3TA 5IWAB 2QWQB 3HKCA 1SZXA 4NXNB 4LF5B 4UCUA 3FYIB 5C93A 3W7UA 4LBEC 4K0KO 1B04A 4ZI7B 5IYDO 4JI3O 1N34O 3KZIZ 4B3TB 1L8DA 4UB6Z 2OT5A 4ASUG 2YC0A 1Q3EA 2JK5C 1GK9A 4JI2O 2UUBB 4K35A 3ZRSA 3CCEV 1JFFA 4FLXA 1A32A 2VWJA 5LMNO 1VQ9V 1BZKA 2RNBA 3AG3B 1YTFB 3T1CA 2GUZA 1XHZA 4JI4O 3W7TA 5JCOA 2OIEA 2ZE6A 4E4EA 1V55C 5LOVB 4FM1A 3UKMA 4HAMA 1ZSPA 2Q68A 1M4UA 2RQ6A 4LR3A 4U3FH 5CA1A 1Y76A 3WB0A 3N2KA 1HNXO 4WFFA 2DE0X 4LNUA 5BMVB 3CC2V 4MVZA 3K59A 2WLIA 1AI4A 3A0HZ 5CBGA 4KUMA 3FKSG 2P6JA 3SJCC 4JI5O 1VEWA 4O2AA 1KQSU 4YIOA 3PN1A 4EFBA 1R1BA 2Q0AA 1FFXA 4H0LB 1NH2B 4K8ZA 1H2GA 1BQ0A 5FLXN 2XAJA 2CAZC 3O9OA 2YXLA 5IYZA 1QU7A 3PJSK 5B66Z 3KKYA 2F23A 5KHGA 2LGWA 5B1AB 1QVGU 2M7WA 2CH7B 2BOBC 3K5OA 4MVMA 4F6RB 4PA4A 4JAVA 4H13B 4RO2A 3RYHA 2M6YA 4ZKIA 2F1MA 2Q0OC 3ZMSA 1E1RG 4IL6Z 1BMFG 3BVOA 1WA8B 5DN6G 1FYJA 1XMOB 2UXBB 4H33A 4LF6B 4MVUA 1BS3A 3ETGA 2LJ2A 4TQDA 4DR2B 1JX9A 4YY3B 2JGUA 3FB5C 3FAVA 1TVKA 3KG2A 3RYIA 5FL7G 1JVMA 1Y66A 2G38A 3RYCB 4MTFA 3CMAV 1MNGA 1TVKB 3FAVB 2E3CA 1NJIW 1RM1B 1K9MW 1U96A 4B3TO 5B1NA 3T1YO 1NZ6A 4JZGA 3CXHF 1OCRC 4JF3A 5E79Z 1ZWIC 2PTMA 2QM8A 2E74B 3WFVA 1H8EG 1NTZH 2JEUA 3QNEA 4FK5C 1TGOA 3RYHB 2DWEC 2DOSA 1M93A 1QLNA 1CPYA 1SQVH 1XL4A 2ITDC 1MG1A 3OTFA 4ZHQB 5DM6V 1XMQO 4FVMA 4RWUA 3K9SA 4ZIBA 1KP3A 3CYOA 2ADPA 1DF4A 2ZR3A 1G6UA 1KYOF 3U11A 2W6JG 3DXRA 4ICGA 1FFXB 4X64B 2R9IA 1XNRO 2ZM6B 4PDLA 4X8AA 1SETA 5KHJA 1PP9H 1XNRB 3WB2A 5JJNB 3OEHG 4O4HB 4X1KA 3LSQA 2HHHO 4DR4O 4W4KA 3JSNA 2JIZG 2EZOA 1VMGA 1W2BU 1B3QA 3N2KB 4R6ZA 3U10A 1GN3A 1Y76B 4UUJC 1XOUA 4FM2A 3ABMB 1QNMA 1P84F 5LOVA 1P49A 2HP8A 2Q7HA 1DF5A 1JJ2U 2RMKB 2E5LB 5B1BC 2OTJV 1Q82W 3P30A 3CWBH 1BT8A 1OHHG 3FB8C 1NR1A 5F2VO 4UVBA 3W7WA 4O4IA 2PZSA 3HB3B 4ZI7A 1N8RW 2F66C 4UCSA 4JI7B 3ZJZA 5BR8O 3CX5F 4B08A 1N32B 4P9OA 1N0JA 3JAKB 1F23A 2Q6AA 1Z5WA 3AG4C 4E2LA 1YITV 4UCRA 2EULA 3JSLA 4I5SA 4CH5A 1IBLB 3E8GA 3OGCC 3CRQA 1OCCB 4DR4B 5KMGB 1JCHA 5AG2A 3ASNB 2VWKA 3FFQA 4UVCA 3SJQC 2DQ3A 4X66O 2ZE8A 4PA7A 1MSDA 2V7QG 1W0JG 1H38A 3K04A 2W0FC 2YIBA 4AQYB 4TOIA 1PNKA 3B40A 4NR1A 2Q4PA 1Q6IA 3HKDA 4LFBB 4JPRA 4JI6B 4YJ3B 3MAQA 4JI8O 5IE9A 5J2TA 4TUYA 1R73A 2PGGA 3OUFA 2YICA 4B3SO 1R3JC 3ABUA 4JASA 1IURA 2XASA 3G67A 2HVJC 2VQFB 2WWWA 5J2UA 3OE7G 3OT7A 4I9WA 4KP4A 2P7TC 3ZN0A 2PY5A 3T1YB 4GKJB 5HFLA 4K8XA 5GONB 4PV1B 2DQ0A 3ABMC 4DXWA 4PI2A 1GAXA 4CBCA 4YXWG 3JATB 1N4CA 3IGAC 1S5LZ 2QA4V 2CGNA 3M99B 4RUEA 2RCVA 1KKDA 3TETA 3JYCA 3FB6C 1I08A 5EBWC 1K34A 2L35A 3IC7A 3OR7C 4GZRB 3CCMV 4EB6B 4JGSA 3OW2U 4J11A 2ZXWB 1SQGA 1IBMO 3TXSA 1K5SA 1M57B 2A7WA 1ZX3A 3D8CA 3CC7V 2IH1C 5JQGB 2LFRA 4MSWC 5LL6Y 3CXCU 1TA8A 4CH6A 1AB3A 3AG1C 4U3JB 3RT3C 1FPOA 4QPKA 4UCTA 5LGNA 2F4VB 1WB7A 1JR9A 1XUQA 4MS2A 2CTQA 3B8MA 3CRCA 3HKEB 4R7CA 3O65A 3H9VA 4DV4O 4LFCB 5LA6B 2WLHA 3ZIAG 5IJ9B 2P67A 2YUAA 3VQWA 4JI0O 5CBFA 1K73W 4KHPO 1F4NA 3JD0A 1H8HG 5DECA 4ZOLB 5JH7B 1K3EA 5C8YA 2QKCA 3S3XA 1K7DA 4DR5O 1BSMA 2RN9A 3D3QA 1VQPV 3CCJV 1VQ4V 2IU0A 1BGYH 4WBNA 2F93B 4PJ0Z 4NB5A 4Q6GA 1KD1W 5LP6C 1S72V 3VQXA 1N36O 3K03A 4KL1A 3I5DA 2NN4A 4LWSA 1DK1A 4WCEV 4R8CA 1YEWA 4OPHA 2X6BA 1HNXB 3VOUA 2CTWA 2RDCA 1WN7A 2UUCO 4O2BB 3T4DA 4FFBA 3OR6C 4NTWA 1L0NH 3VQVA 3LDEA 4JYYA 5LHHA 4J9YB 5BZBA 3ZHRA 2R9RB 1WAZA 2HR3A 1JOYA 1IXMA 5KAFZ 2QEXV 5EBMC 3CPWU 3K79A 4RUFA 4LF8B 2DMXA 2QJ1A 3BCCH 3UT5B 3E8BA 1Z2GA 1KU9A 1MABG 2H3OA 2OTLV 1Q7YW 2Y69B 1I94O 2R72A 4I7ZB 5JCOC 5B1BB 3G71V 4KHPB 1VQ6V 3BPZA 3R66A 4X1IA 4PA6A 3ICXA 1J5EB 1L1FA 1GKFA 2OCHA 4DV2B 3SYOA 4YJ2B 1GN2A 1XHXA 1HNWO 2ZXWC 2EJRA 1EFRG 2BSKB 2HHHB 5K1XA 5LYJA 5LMUB 1O9HA 2B5UA 4O4JA 5KHKA 4JYCA 2GDSA 4X1YA 3DSQA 4JTCB 1NT2B 2ADQB 3KCXA 5DEDA 3BA9A 4TT3G 5KHHA 1DGSA 1KUQA 4Z1MG 5EYPB 3JALB 1YXBA 4DR1B 3Q4HB 1YDXA 2AW9A 4JI5B 1OCCC 1WP8A 1W59A 3A0BZ 4J10A 3K0DA 2JS5A 1KECA 1NBMG 1SQBH 2CGOA 2HLDG 3STZC 2Z0AA 4TQFA 5JVDB 3ZMVA 2R70A 5LXTA 4LF4O 2LW1A 2FL4A 2UUAO 1MA1A 3AG7A 4IIJA 2D3OW 4CS2A 5KAIZ 1HNWB 1NH2D 2XOKG 1SQFA 2Y4UA 4DV7B 3VBBA 5LXTB 5GTHZ 5J9PC 5LP6B 5JVDA 1NTKH 1BL8A 1JMKC 1OCOC 3QO8A 1GMGA 2PI4A 2FB5A 1YSCA 3BA8A 2JEXA 3ZMUA 1V54B 2WLJA 1COWG 2HFEC 5B5EZ 3Q4HA 2DYSC 1N0NA 4XDLA 2VQEB 4X9QA 5EYPA 1FXKC 4EEQA 4X62B 2WPDG 3RW0A 4NYKA 1ZLZA 2KQXA 1XMOO 2WLLA 1CXZB 2F4VO 2R9AA 4DW1A 1Y6XA 1NQTA 1VQ8V 4UV8A 5CN0A 4I0XB 3SPIA 2P4VA 3P3NA 2CDYA 3E8HA 2Y48A 3X2QC 2BSKA 5H9CA 3RBZA 3LSUA 4MTOA 3EVKA 4YJ2A 3CCUV 2IW5A 3M7MX 1XEQA 2ZD9A 1B06A 3T1HO 4PI0A 2EIMB 1E1QG 3OTOB 3CC4V 2D2CB 1YCIA 2F95B 2FKXA 1XL6A 4TWKA 2PYJA 3UM7A 3UCSC 4JAUA 3CCLV 2EX3A 4JI7O 3LDDA 1BHBA 1R6TA 3JARB 1Q6UA 3ML0A 2W6IG 2ODMA 1YJWV 3APOA 4FFBB 3F7YC 2MW2B 4GKKB 3IJ4A 2K9PA 3K08A 1VF5B 2UXDO 1NR7A 2H94A 5ITZB 2DYRB 2IU3A 3ZEDA 4Z1VA 4TSFG 3B8NA 2FTKA 3D36C 1AR1B 4B7EA 2VS0A 3U0ZA 1QQCA 1HW7A 4DR3B 1THZA 4JI0B 1VQMV 2IM9A 2ZIOA 1RSOB 4WFEA 1OCZB 1P7BA 2BE3A 1AJPA 3VQYA 4QPJA 1FXVA 3LDCA 1KP2A 5C8YB 4IT5A 2QTOA 4ZOLA 2Q8VA 1OZ0A 2Q73A 2YIDA 1CEZA 3K06A 5LGUA 3R65A 3OMAB 5EIBC 1MZFA 2JRIA 2Q7EA 4D7SA 2QM7A 2QWNB 5LA6A 3THOA 2PI5A 4LH7A 1FXKB 3E22B 3HKEA 4GKKO 1GM7A 3W7XA 1OJHA 3CMEV 1EN4A 1R6KA 3ZHVA 2EJ7A 4PHZA 4U3JA 3CCSV 4FLWA 1J5EO 1GN6A 2PUSA 2KKWA 3EHBB 3GB7C 2ILMA 1GM9A 2Y69C 1H2SB 2QDOA 4J7KA 4AILC 4EB6A 4IYHA 4JTDB 4BW9A 1S5HC 4CH4A 3UQ8A 1NVPD 2EIMC 1XMQB 3A0RA 2ATKC 3UO2A 1K4CC 1D2DA 2ZKOA 4DUYB 2H8PC 3J81N 4AQYO 4B3RO 1RP3B 2W0XA 2NLJC 1CP9A 4MVOA 4Q20A 1V55B 4WF9V 4PA9A 3JATA 2P4KA 3BEHA 4NTXA 2HJFC 5KUKA 3ZRWA 2QKAA 2WA3A 2YI9A 3JAWA 2HVKC 2LO1A 2X7RB 3NR7A 5JJJB 1VIBA 5D5PA 5IJ0B 2ZR2A 5H2FZ 3SYQA 4X20A 1ZL8A 2Z3YA 2DWDC 4DR5B 4LFAO 2A06H 4DV5B 4P9PA 1RPRA 1LUVA 4JTAB 1VQKV 3WU2Z 4X64O 4FM0A 2ARHA 4XBFA 4GLXA 2YEVB 5EK0A 3ZHUA 1G8MA 4LP8A 3G80A 1YZBA 2JGDB 2HJDA 1Q43A 1P7GA 1AI5A 3HR0A 1SESA 3SYCA 2ZDIA 1K97A 1YJNV 3QF7A 3LNMB 2IBZH 2ZE5A 4BIZA 3JD4A 5L3DA 2QTSA 3OGIB 1GM8A 1S76D 4LF8O 3SPGA 1ZTEA 4XDJA 5KUMA 1Q6HA 4GX5A 3RGBA 3JCZA 3JAKA 3K5NA 3M8AA 4JI1B 3N2GB 1PNMA 4FZ0A 1LR1A 4DV6O 2EBOA 1EN6A 4UFZA 1JQ0A 5L3GA 4I55B 1BE3H 5KHIA 3IFXA 1RM1C 1Q8IA 1SQQH 1AILA 4O4IB 3X2QB 1VARA 2YDEA 3JD1A 3SPCA 4OGQB 3JCUZ 3AK3A 4CS4A 2WSSG 4PDRA 1NS1A 3ABKC 1DTOA 4DV0O 4TV9B 3RYFA 1SERA 4QNHB 2ITCC 2EIJB 5BXZA 1WB8A 3OEEG 1VF6C 4JYAO 3T2MA 2YS8A 1TUBB 3TK1A 3RVZA 4MTGA 4X65O 3ABTA 3E2EA 3SDLA 3TGUH 2AHZA 4BR6A 4X1KB 4LFBO 2EILC 4YHHO 4O4HA 4YIPA 3WG7C 4FLVA 3APQA 3E8FA 2UUAB 2DYRC 1W0KG 1EZVH 3DXRB 4TV8B 4I50A 3F7VC 1YJ9V 5A2QN 3J7AU 2GTAA 5FPRA 4QE7A 4DR2O 3CD6V 4ZHQA 3BHPA 1K92A 4J80A 5EZYB 1XNQB 2YXHA 1OCZC 4H37A 3CRMA 3DC5A 2Q9LA 4MVRA 1QBZA 1M56C 1YHQV 4WFBV 2ZINA 3E86A 4JYAB 3K9AA 1E79G 3AK2A 5B3SB 2ZE7A 3BRCA 1Y74B 3LUTB 3WB1A 1M57C 1IBLO 3OTOO 4KXRA 4DO2A 2Q69A 3AG1B 3CEIA 4DV1O 2YIAA 3OUSA 2MK3A 3HPLC 3ZRXA 3RYCA 4JV5O 1XBLA 4CH3A 3RYIB 3CP1A 4OPAA 2ZCEA 3AG2C 4MTXA 3CS5A 4F6EA 1G1XB 1Y67A 1SQXH 2EIKB 1URFA 4CZZA 1Y74A 2XT9A 1SRYA 1XDCA 1NU1H 5KA5A 5CMUA 3BFRA 1V9PA 1WA8A 3ASNC 3E89A 2HG5C 3AG3C 2ZDIC 3B2EE 4DR6B 2Q67A 2KB1A 3FYEB 3LSSA 4MW8A 4X89A 1IBKO 1QVFU 4J7ZA 3ZHSA 1IXBA 2Q7GA 1EZJA 3MD0A 2VQEO 3SR2C 4LC1A 5EZYA 4F6RA 2CH7A 4L87A 5LMNB 4FLUA 4FFKA 3P32A 1VQNV 5IYZB 1ORQC 4LH6A 4JI2B 3ZMZA 1BHAA 4DV5O 1WLEA 4YY3O 2IJJA 4I50B 4TV8A 1S77D 2YI8A 2IH3C 4DV0B 1Q81W 3F5TA 4DK0A 1HNZO 4O2AB 3WG7B 1H2NA 1D5NA 2WLIB 1WPXA 4L8JA 1QLEC 1AVMA 3CB2A 3C90A 2JJ1G 5CA3A 2EINB 4LNUB 1WJZA 5BMVA 1HP8A 1MMMA 4DUZB 4D6TH 1Q86W 1TUBA 2QGNA 5B1OA 1JA8A 5CA1B 1BQZA 2P5OA 4B3RB 3CCRV 1H2KA 3G6BA 1IBMB 1UJWB 1F51A 4XDKA 1HR0B 1IBKB 3RYFB 1Z5VA 3CHXA 4FJCC 4DV4B 2DJVA 2GUZB 1GH6A 4X65B 4K0KB 4TV9A 5D5QA 2Y0PA 1AJQA 4I9QA 1JFFB 3AEIA 3FX7A 4MVSA 4BAYA 4J9ZB 1FKAO 3C3SA 3RVYA 4GX2A 4MW3A 4FLZA 4IYIA 1AROP 2L6LA 3NXSA 2FMLA 1OV9A 4I55A 3GWOA 4MT8A 3HKCB 3ASOC 1MZEA 3N2GA 4WFHA 2JJ2G 2VQFO 1U97A 2XNDG 1MOFA 4JI4B 3CSXA 3IC9A 1KC8W 2ZT9B 4DR7B 3SPJA 5E1AC 1OCRB 2B1GA 4IHJA 2N04A 4WFAV 5JJEB 2UXBO 3QTCA 1ZAUA 3CE2A 3ABKB 4GT1A 5FPOA 4CC5A 4DV7O 2OCCC 1YVWA 2EZPA 1GRJA 1VP7A 1SA0A 2BCCH 4QE9A 3L74H 4LF9O 1QCEA 3HKBB 2JGDA 4HZ3A 4DK1A 5L3CA 2WLMA 4K3AA 4J42A 2XHBA 2XAGA 5EBLC 4DUYO 2YEVA 1PL4A 3SGIA 4NXMB 1B6QA 2CUGA 4CS3A 5IT9N 1KMIZ 2AZ2A 4F4LA 1PKXA 2PF4E 2OYQA 3ETQA 4U7OA 2LW7A 2EILB 3CCQV 1ZL8B 1GO3F 2YIBD 1X59A 4X20B 4DRXA 5FNVB 4OX9O 5IJ0A 2WLKA 4BIUA 1AI6A 2EINC 4G28B 1AP5A 4P30A 1IVSA 3JAWB 5H6QA 3L75H 1SS3A 3ETDA 3ZRWB 2UU9B 3CRRA 3DTUB 5CBHA 3QO7A 2BTQA 2JVDA 4RAIA 4FLYA 3SYPA 4DV2O 2JDIG 3E35A 5IWAO 5GW7A 5IDJA 1M56B 3I56V 3K0GA 1I0HA 3JD2A 3L73H 1LNQA 2XAHA 2XTAA 4UVAA 3G4SV 2P22C 5EIBD 1N33B 3KCYA 3ZN1A 3ZHQA 4LF9B 2UUBO 1UPGA 1Q90D 4DR1O 3EFFK 3CRAA 1R3IC 1WPBA 5CA0A 1DLBA 1EN5A 4QGPA 5H5NA 4JI1O 3T1HB 3SJAC 3SJBC 4MVQA 4ZBMA 3K3WA 3ABLC 5IY5C 3AG4B 1WP7A 2ZIMA 3E22A 4H44B 1FXKA 3DC6A 3ETEA 3H01A 2UXCO 2EIKC 3BABA 3J80N 3IAYA 2BOCC 4GUNA 1X4TA 2DN9A 2DW4A 5K1PA 1D5AA 5A9GA 2UXXA 2KG7A 4HNAB 3H1LH 3E83A 4DV3B 1RSOA 4UV9A 5L3FA 4UCOA 5TISZ 4DR7O 4PDMA 2QWOB 3L71H 1F4MA 2YSUB 1FFTB 3N27A 3ZHTA 4Z2WA 2LGQA 2P06A 1GTOA 3L9DA 2LP7A 1K33A 3QVNA 3TCUA 1I5XA 2A9HA 2V4DA 1RPOA 2OIGA 4DW0A 5ITZA 3ZS8C 5LGTA 3A8TA 3RWRD 4J7JA 1PL0A 4LF5O 2Z5UA 3S3WA 4DUZO 3G6EV 3BAAA 1SQPH 2QM4A 2XAQA 2AGAA 3JARA 2P90A 1VF6A 2LQTA 1M1KW 4BIOA 1JPXA 4QIWF 2QR4A 4FPPA 1VQLV 4O4LA 2YXYA 1Y4MA 4I4TB 2WAMA 3SYAA 1IX9A 1LUWA 2CTRA 1HDJA 4FZ1A 1AJNA 2QWPB 4G2KA 2Q5ZA 2RJZA 2AHYA 3JD3A 5CB4A 3JASA 2A0LA 1AR4A 1FD9A 1SF9A 4I0XA 2KSDA 4JI3B 1N34B 3TXQA 5KX5B 2A79B 2WLNA 1VF7A 2CE4A 4JZ2A 4NVPA 3H1HH 2WLLB 3TJTA 5IY5B 1BCCH 1QR9A 4W4LA 2E5LO 4AI8A 1K4DC 2FYUH 4P2ZA 3K5LA 1O9GA 1AP6A 3CJHB 5H6RA 1NTMH 5LHIA 3H1IH 1I5YA 2GV9A 1AI7A 2C2AA 1PNLA 1RFYA 2CK3G 3JAMN 5LP6A 5BY1A 2OCCB 4NXMO 1XILA 3AK1A 3MHSC 1IZ3A 4DR3O 4IIJB 2ZM6O 1FS0G 3OFNG 4EFEA 1M90W 5GTIZ 1P4RA 4DV3O 3QO5A 4B3MB 1FJGO 1JJOA 1XREA 3A2FA 3ZX6A 1FAFA 2JS3A 1PD3A 2HEPA 3CJHA 3H1KH 4LF7O 1AR5A 1S5JA 2NNUA 3FD9A 4JYBA 1US6A 3JALA 2N05A 4UB8Z 1PV0A 3H1JH 2GSMB 2UU9O 4C7UA 1R6NA 1YI2V 2GTSA 5L3EA 1L0LH 1WNSA 4PD4F 4FMTA 5L3BA 4X1YB 5KX5A 4HBNA 1GN4A 2CTPA 5KLVH 4LFAB 4O4JB 4JI6O 2Y4TA 5LYJB 3GVMA 1HR0O 3JASB 2E75B 5CB4B 1HWYA 4DR6O 1MSWD 3ZBHA 1M5IA 1S3JA 2BTOA 4D7TA 5LBQA 1TAEA 3BY6A 4NXNO 4NKGB 4LF4B 4RQEA 2AZ0A 2X0LA 4X1IB 2X6CA
chains in the Genus database with same CATH topology
4OXSA 5CA3A 3CC4V 2JIZG 2XAFA 2EZOA 3T4ZA 3ZRVA 4N23A 2EINB 1W2BU 5EC2C 1XL6A 4TWKA 4R6ZA 3UM7A 1Q86W 4JAUA 5B1OA 4GX1A 4UUJC 3CCLV 3ABMB 2B1IA 3CCRV 3LDDA 1BHBA 4N21A 1UJWB 1F51A 1DF5A 1JJ2U 3ML0A 4XDKA 2W6IG 1YJWV 4QJFB 2IJHA 3ABLB 4HYOA 4FJCC 5B1BC 2OTJV 3F7YC 1Q82W 3P30A 1AJQA 3AEIA 3K08A 4MVSA 4BAYA 1NR7A 2H94A 4J9ZB 1ROPA 1OHHG 3RVYA 4GX2A 2DYRB 4MW3A 3B77A 3FB8C 4X88A 2IU3A 1EBOA 1NR1A 4TSFG 3B8NA 2FTKA 1AR1B 4U7NA 4UVBA 3W7WA 3HB3B 1N8RW 1AROP 3NXSA 1THZA 4MT8A 3GWOA 1VQMV 3ZJZA 3ASOC 1SZTA 3FB7C 4WFEA 1OCZB 4P9OA 1F23A 1P7BA 2IJIA 2Q6AA 4WFHA 2JJ2G 1AJPA 3AG4C 4QPJA 4PDVA 2X6AA 1FXVA 1MOFA 2XNDG 3LDCA 1KP2A 4E2LA 1YITV 2GHYA 2QTOA 1S0VA 5IYBO 1TUEB 3D36A 4I5SA 1OZ0A 1KC8W 1VQ5V 3E8GA 3SPJA 1CEZA 3OGCC 1OCRB 2B1GA 3OMNB 1OCCB 1V54C 3K06A 3OMAB 3R65A 5E1AC 1JCHA 5LGUA 5B3SC 3ASNB 4WFAV 4UVCA 3SJQC 2DQ3A 4R50A 5IYCO 2QM7A 4BW5A 4PA7A 2V7QG 1W0JG 2PI5A 1FXKB 3ABKB 4GT1A 1H38A 3K04A 2W0FC 2OCCC 1GM7A 2EZPA 3W7XA 1PNKA 4QE9A 1QCEA 3CMEV 1R6KA 5LHGA 3CCSV 4HZ3A 4JPRA 4G27B 5L3CA 2WLMA 3I55V 1VQOV 4UXNA 1K8AW 2XAGA 5EBLC 3EHBB 5HFMA 3AG2B 4WFGA 3GB7C 1R73A 2YEVA 1G4YB 1M9NA 3OUFA 1J95A 1GM9A 2K1EA 2Y69C 1B6QA 3ZCCA 1VQ7V 3STLC 4LCUC 1R3JC 3ABUA 4JASA 4F4LA 1PKXA 4PA3A 4U7OA 2XASA 2EILB 1QR8A 2HVJC 3CCQV 1GO3F 2WWWA 4JTDB 3OE7G 1S5HC 1NVPD 2EIMC 4I9WA 1E1QG 4PELA 4KP4A 2WLKA 3A0RA 2P7TC 4BIUA 2ATKC 1AI6A 2IJKA 1K4CC 3ZN0A 2EINC 4G28B 4P30A 2H8PC 5HFLA 5H6QA 1FXHA 3ETDA 3ZRWB 2DQ0A 2NLJC 3OM3B 3ABMC 2QE7G 4DXWA 1CP9A 4MVOA 4Q20A 3DTUB 1V55B 4GX0A 4WF9V 4CBCA 4YXWG 2EIJC 4PA9A 5CBHA 3SPHA 3IGAC 1NKDA 3BEHA 3QO7A 2HJFC 5KUKA 2QA4V 3M99B 3ZRWA 4RUEA 3D3IA 1KKDA 1K5QA 3TETA 2HVKC 3DGEA 3JYCA 4RAIA 3FB6C 3SYPA 1YTFD 1R3KC 2X7RB 5EBWC 2UXNA 1K34A 2JDIG 3E35A 3IC7A 2ZR2A 5GW7A 5IDJA 3OR7C 1M56B 3SYQA 3I56V 3MHHC 3K0GA 3JD2A 1NVPB 1LNQA 2XAHA 1QLEB 2Z3YA 2DWDC 4UVAA 1R3LC 3G4SV 3CCMV 4JGSA 3OW2U 4P9PA 2ZXWB 1RPRA 2LFSA 2ZQMA 3ZN1A 4JTAB 1VQKV 3OMIB 1K5SA 4EKWA 3OAAG 1M57B 4XBFA 2YEVB 3EFFK 4FIPC 1ENVA 1R3IC 3CC7V 4RQFA 2IH1C 5EK0A 3W7SA 1DLBA 2LFRA 4MSWC 2V1DA 3CXCU 1G8MA 4LP8A 3CCVV 3AG1C 2HKOA 5KA6A 5B1AC 2F43G 4MVQA 4QPKA 5LGNA 4ZBMA 3K3WA 3ABLC 3ZMTA 4MS2A 5IY5C 1AI5A 3AG4B 3B8MA 1SESA 4GCZA 3SYCA 4R7CA 1FXKA 2ZDIA 3ETEA 3H01A 2EIKC 1K97A 1OCOB 2WLHA 1YJNV 3ZIAG 3LNMB 4BIZA 2P67A 3JD4A 5CBFA 2BOCC 5L3DA 1K73W 4KFMA 3F5WC 1F4NA 3JD0A 1YIJV 2DYSB 1H8HG 1GM8A 1K3EA 2DW4A 1S76D 3SPGA 4XDJA 5KUMA 2UXXA 4GX5A 2QKSA 3JCZA 1K7DA 3E83A 3ASOB 5EC1C 1PNMA 4UV9A 5L3FA 1VQPV 2EBOA 3CCJV 4PDMA 1VQ4V 1JQ0A 2IU0A 1F4MA 2YSUB 5L3GA 1FFTB 3FYIB 3IFXA 5C93A 3W7UA 1KD1W 4LBEC 1RM1C 1S72V 5IYDO 3X2QB 1GTOA 2LP7A 3K03A 1K33A 3TCUA 3JD1A 3SPCA 1I5XA 2A9HA 2OT5A 1RPOA 4ASUG 2JK5C 1GK9A 4WCEV 4R8CA 3ZRSA 3CCEV 5LGTA 2X6BA 2WSSG 3VOUA 4PDRA 3ABKC 1DTOA 1VQ9V 1PL0A 3AG3B 1YTFB 2Z5UA 3T1CA 3T4DA 3W7TA 3G6EV 3OR6C 3LDEA 1SERA 5LHHA 4QNHB 4J9YB 5BZBA 2XAQA 2R9RB 2ITCC 1V55C 2HR3A 2P90A 1IXMA 1JOYA 2EIJB 1M1KW 2QEXV 5EBMC 3CPWU 3OEEG 3K79A 3UKMA 4RUFA 1JPXA 4HAMA 3E8BA 2Q68A 3T2MA 4QIWF 1MABG 3TK1A 4FPPA 1VQLV 3RVZA 2OTLV 4MTGA 1Y4MA 1Q7YW 2Y69B 4WFFA 3ABTA 3CC2V 2WAMA 4MVZA 3SYAA 3E2EA 5B1BB 3G71V 1VQ6V 4PA6A 2AHZA 2EILC 1L1FA 1GKFA 2WLIA 1AI4A 5CBGA 4KUMA 3FKSG 3WG7C 2P6JA 3E8FA 3SYOA 1AJNA 1KQSU 2ZXWC 2DYRC 1W0KG 4G2KA 1NH2B 1H2GA 2AHYA 2EJRA 3JD3A 1EFRG 3F7VC 1YJ9V 2A0LA 2XAJA 4QE7A 2B5UA 3CD6V 4JYCA 3PJSK 2A79B 2WLNA 5B1AB 1QVGU 4JTCB 2M7WA 1K92A 2WLLB 2BOBC 4MVMA 4PA4A 4JAVA 4TT3G 1OCZC 5IY5B 4H37A 1QR9A 4RO2A 4MVRA 4Z1MG 4ZKIA 1QBZA 3ZMSA 1M56C 1K4DC 1YHQV 4P2ZA 1E1RG 1BMFG 4WFBV 3E86A 5DN6G 3K9AA 1OCCC 5H6RA 1E79G 5LHIA 5B3SB 3K0DA 1KECA 4H33A 1I5YA 1NBMG 3LUTB 4MVUA 2HLDG 1AI7A 2C2AA 3STZC 1M57C 3ETGA 1PNLA 2CK3G 1JX9A 3ZMVA 2OCCB 4DO2A 2Q69A 3AG1B 3FB5C 3KG2A 2MK3A 3OUSA 5FL7G 1JVMA 2D3OW 1Y66A 3HPLC 3MHSC 3ZRXA 4MTFA 3CMAV 1NH2D 2XOKG 1FS0G 3CP1A 3OFNG 1M90W 1NJIW 3VBBA 5J9PC 1RM1B 1K9MW 1P4RA 3AG2C 4MTXA 1BL8A 3QO5A 2EIKB 5B1NA 1OCOC 3QO8A 1GMGA 2PI4A 4CZZA 1YSCA 1SRYA 1PD3A 2JEXA 1OCRC 5KA5A 5CMUA 1V54B 2WLJA 4JF3A 3ZMUA 3LSQA 1COWG 1ZWIC 3ASNC 2HFEC 3E89A 2QM8A 2DYSC 3WFVA 2NNUA 4JYBA 4XDLA 2HG5C 1H8EG 2JEUA 3AG3C 2ZDIC 3QNEA 1FXKC 2Q67A 2KB1A 2WPDG 3FYEB 3LSSA 4FK5C 4MW8A 4X89A 3RW0A 2GSMB 1QVFU 1EZJA 2DWEC 3MD0A 1QLNA 4LC1A 1CPYA 1R6NA 2WLLA 1YI2V 1XL4A 2ITDC 4L87A 1MG1A 5L3EA 4FMTA 3P32A 5L3BA 5DM6V 1NQTA 1VQNV 1VQ8V 1ORQC 4UV8A 5CN0A 3SPIA 1KP3A 3CYOA 3ZMZA 1BHAA 1WLEA 3E8HA 1DF4A 2Y48A 2IJJA 2ZR3A 3X2QC 5H9CA 1S77D 2W6JG 3RBZA 1HWYA 2IH3C 1MSWD 1S3JA 4MTOA 1Q81W 2R9IA 5LBQA 4PDLA 3BY6A 3CCUV 4X8AA 3WG7B 1SETA 2IW5A 2WLIB 2ZD9A 3OEHG 1WPXA 1QLEC 4RQEA 2X0LA 2EIMB 2JJ1G 2X6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFG A;  3GB7 C;  1OCZ C;  4OXS A;  4H37 A;  2YEV A;  1G4Y B;  3T4Z A;  4RO2 A;  3OUF A;  3SPG A;  1J95 A;  2K1E A;  1XL6 A;  2Y69 C;  4MVR A;  4TWK A;  4XDJ A;  5EC2 C;  5KUM A;  4GX5 A;  4R6Z A;  1M56 C;  2QKS A;  4LCU C;  3STL C;  3UM7 A;  1K4D C;  1R3J C;  3E83 A;  4GX1 A;  4UUJ C;  4F4L A;  4P2Z A;  5EC1 C;  4PA3 A;  3E86 A;  2HVJ C;  3LDD A;  1OCC C;  4PDM A;  4JTD B;  3K0D A;  1S5H C;  4H33 A;  2EIM C;  4I9W A;  3IFX A;  4XDK A;  3LUT B;  4MVU A;  2WLK A;  4LBE C;  2P7T C;  2ATK C;  1K4C C;  4HYO A;  1M57 C;  5B1B C;  3STZ C;  2EIN C;  4G28 B;  4P30 A;  2H8P C;  3F7Y C;  3K03 A;  3TCU A;  3SPC A;  2Q69 A;  2NLJ C;  3ABM C;  4DXW A;  2A9H A;  3FB5 C;  3K08 A;  3KG2 A;  3OUS A;  4MVS A;  4MVO A;  1JVM A;  4GX0 A;  4CBC A;  3HPL C;  2EIJ C;  2JK5 C;  4J9Z B;  4PA9 A;  4MTF A;  5CBH A;  3SPH A;  3IGA C;  4R8C A;  3BEH A;  3RVY A;  4GX2 A;  3ZRS A;  2HJF C;  4MW3 A;  5KUK A;  2X6B A;  3FB8 C;  4X88 A;  3VOU A;  4PDR A;  4RUE A;  3ABK C;  1KKD A;  5J9P C;  3T1C A;  3TET A;  3AG2 C;  3T4D A;  1BL8 A;  2HVK C;  4RAI A;  3JYC A;  3FB6 C;  3OR6 C;  3SYP A;  1R3K C;  5EBW C;  3LDE A;  1OCO C;  4QNH B;  3OR7 C;  4J9Y B;  5BZB A;  1OCR C;  2ITC C;  1V55 C;  2R9R B;  3ASO C;  2WLJ A;  3K0G A;  3FB7 C;  3SYQ A;  3ZJZ A;  5EBM C;  1LNQ A;  1ZWI C;  3ASN C;  2DWD C;  1R3L C;  2HFE C;  3E89 A;  4RUF A;  3UKM A;  4WFE A;  2DYS C;  3E8B A;  4P9O A;  2Q68 A;  4P9P A;  3T2M A;  1P7B A;  2Q6A A;  2HG5 C;  4WFH A;  4XDL A;  3AG3 C;  3RVZ A;  3AG4 C;  4MTG A;  4JTA B;  2Q67 A;  2KB1 A;  4MW8 A;  4WFF A;  4X89 A;  4PDV A;  2X6A A;  3RW0 A;  4EKW A;  4MVZ A;  3LDC A;  3SYA A;  2QTO A;  2DWE C;  3EFF K;  1R3I C;  4PA6 A;  2AHZ A;  2IH1 C;  5EK0 A;  2EIL C;  2WLL A;  3E8G A;  3OGC C;  4MSW C;  2WLI A;  4LP8 A;  3K06 A;  1V54 C;  1XL4 A;  2ITD C;  3AG1 C;  3R65 A;  3WG7 C;  5CBG A;  5B3S C;  5B1A C;  3E8F A;  3SYO A;  4MVQ A;  3SJQ C;  1ORQ C;  4R50 A;  4ZBM A;  2ZXW C;  2DYR C;  4BW5 A;  3SPI A;  3ABL C;  4PA7 A;  4MS2 A;  5IY5 C;  3E8H A;  2AHY A;  3SYC A;  4R7C A;  3X2Q C;  3F7V C;  3K04 A;  3RBZ A;  2IH3 C;  2OCC C;  2W0F C;  2A0L A;  4QE7 A;  2EIK C;  4MTO A;  4QE9 A;  2WLH A;  3PJS K;  4PDL A;  3SPJ A;  3LNM B;  2A79 B;  4X8A A;  2WLN A;  4HZ3 A;  5E1A C;  4JTC B;  4G27 B;  2WLM A;  2WLI B;  2ZD9 A;  5CBF A;  2BOC C;  1QLE C;  2WLL B;  2BOB C;  4KFM A;  4MVM A;  5EBL C;  3F5W C;  4PA4 A;  2X6C A; 
#chains in the Genus database with same CATH topology
 2NR5 A;  2OWO A;  4OXS A;  5LMU O;  2XAF A;  3T4Z A;  3ZRV A;  4N23 A;  4I4T A;  5EC2 C;  4O4L B;  4NTY A;  4GX1 A;  3UT5 A;  2B1I A;  1KKC A;  3UO3 A;  4N21 A;  4DV1 B;  3B4S A;  5JWP A;  1KB9 F;  2GBO A;  3K5M A;  4B3M O;  1FJG B;  1N32 O;  4QJF B;  2IJH A;  3ABL B;  4HYO A;  4A5U B;  4O2B A;  3P3P A;  1Q5O A;  1H2M A;  2A3Q A;  1YF2 A;  2ZNJ A;  1H2L A;  1ROP A;  4LWS B;  3B77 A;  4X88 A;  2N74 A;  3RN4 A;  1EBO A;  3K57 A;  4JI8 B;  4U7N A;  1HNZ B;  3L72 H;  2UUC B;  4WBN B;  1PPJ H;  1SKV A;  1SZT A;  3FB7 C;  2XUM A;  2IJI A;  2KG7 B;  4HNA A;  4PDV A;  2X6A A;  1S0V A;  4AHC A;  2GHY A;  5JH7 A;  1PM9 A;  1SC5 B;  1TUE B;  5IYB O;  4B3S B;  3D36 A;  2UXD B;  1VQ5 V;  3OMN B;  1V54 C;  5IJ9 A;  5B3S C;  2AXT Z;  4YHH B;  4R50 A;  5IYC O;  4BW5 A;  1NI8 A;  1N33 O;  1T5E A;  5LHG A;  1UFI A;  1N36 B;  4G27 B;  3I55 V;  1VQO V;  4UXN A;  1K8A W;  2VRZ A;  5CA0 B;  5JQG A;  5HFM A;  3AG2 B;  4WFG A;  4GKJ O;  1G4Y B;  1M9N A;  3MDS A;  2QSA A;  1J95 A;  4ABM A;  2K1E A;  3ZCC A;  1VQ7 V;  1IDS A;  3STL C;  4J41 A;  4LCU C;  4JAA A;  4PA3 A;  1EM1 A;  4CC6 A;  3QG5 A;  1QR8 A;  3OD4 A;  4BWA A;  1QHT A;  4PEL A;  1I94 B;  3EXA A;  2B9Z A;  2UXC B;  2IJK A;  1XI1 A;  2BTQ B;  1FXH A;  4JV5 B;  3OM3 B;  2QE7 G;  3LNN A;  3L70 H;  4GX0 A;  1I7F A;  2EIJ C;  4LFC O;  3SPH A;  1NKD A;  1XNQ O;  4X62 O;  3D3I A;  5GON A;  1K5Q A;  4DYL A;  3DGE A;  1YTF D;  1R3K C;  2UXN A;  3B09 A;  4X66 B;  5FNV A;  2E76 B;  4DRX B;  5J2U B;  3MHH C;  1NVP B;  1QLE B;  1R3L C;  4B7K A;  4LF6 O;  2QWR B;  4LF7 B;  2LFS A;  2ZQM A;  3OMI B;  4EKW A;  3OAA G;  4FIP C;  1ENV A;  4TUY B;  5J2T B;  4RQF A;  3W7S A;  5BR8 B;  2V1D A;  4YJ3 A;  3CCV V;  2HKO A;  5KA6 A;  3HKD B;  3HKB A;  3GWK C;  5B1A C;  2F43 G;  1SA0 B;  3ZMT A;  4FLT A;  2O57 A;  4GCZ A;  1ZUQ A;  4DV6 B;  1OCO B;  4UCV A;  4OX9 B;  2PYL A;  4GYC B;  1XQ8 A;  5KMG A;  4IHJ B;  3RFR A;  3K58 A;  4KFM A;  2WA4 A;  3F5W C;  1YIJ V;  2DYS B;  1KBH A;  4IGG A;  2QKS A;  2Y0I A;  3ASO B;  1F7Y A;  2ZNI A;  5EC1 C;  2ETN A;  3C3T A;  5IWA B;  2QWQ B;  3HKC A;  1SZX A;  4NXN B;  4LF5 B;  4UCU A;  3FYI B;  5C93 A;  3W7U A;  4LBE C;  4K0K O;  1B04 A;  4ZI7 B;  5IYD O;  4JI3 O;  1N34 O;  3KZI Z;  4B3T B;  1L8D A;  4UB6 Z;  2OT5 A;  4ASU G;  2YC0 A;  1Q3E A;  2JK5 C;  1GK9 A;  4JI2 O;  2UUB B;  4K35 A;  3ZRS A;  3CCE V;  1JFF A;  4FLX A;  1A32 A;  2VWJ A;  5LMN O;  1VQ9 V;  1BZK A;  2RNB A;  3AG3 B;  1YTF B;  3T1C A;  2GUZ A;  1XHZ A;  4JI4 O;  3W7T A;  5JCO A;  2OIE A;  2ZE6 A;  4E4E A;  1V55 C;  5LOV B;  4FM1 A;  3UKM A;  4HAM A;  1ZSP A;  2Q68 A;  1M4U A;  2RQ6 A;  4LR3 A;  4U3F H;  5CA1 A;  1Y76 A;  3WB0 A;  3N2K A;  1HNX O;  4WFF A;  2DE0 X;  4LNU A;  5BMV B;  3CC2 V;  4MVZ A;  3K59 A;  2WLI A;  1AI4 A;  3A0H Z;  5CBG A;  4KUM A;  3FKS G;  2P6J A;  3SJC C;  4JI5 O;  1VEW A;  4O2A A;  1KQS U;  4YIO A;  3PN1 A;  4EFB A;  1R1B A;  2Q0A A;  1FFX A;  4H0L B;  1NH2 B;  4K8Z A;  1H2G A;  1BQ0 A;  5FLX N;  2XAJ A;  2CAZ C;  3O9O A;  2YXL A;  5IYZ A;  1QU7 A;  3PJS K;  5B66 Z;  3KKY A;  2F23 A;  5KHG A;  2LGW A;  5B1A B;  1QVG U;  2M7W A;  2CH7 B;  2BOB C;  3K5O A;  4MVM A;  4F6R B;  4PA4 A;  4JAV A;  4H13 B;  4RO2 A;  3RYH A;  2M6Y A;  4ZKI A;  2F1M A;  2Q0O C;  3ZMS A;  1E1R G;  4IL6 Z;  1BMF G;  3BVO A;  1WA8 B;  5DN6 G;  1FYJ A;  1XMO B;  2UXB B;  4H33 A;  4LF6 B;  4MVU A;  1BS3 A;  3ETG A;  2LJ2 A;  4TQD A;  4DR2 B;  1JX9 A;  4YY3 B;  2JGU A;  3FB5 C;  3FAV A;  1TVK A;  3KG2 A;  3RYI A;  5FL7 G;  1JVM A;  1Y66 A;  2G38 A;  3RYC B;  4MTF A;  3CMA V;  1MNG A;  1TVK B;  3FAV B;  2E3C A;  1NJI W;  1RM1 B;  1K9M W;  1U96 A;  4B3T O;  5B1N A;  3T1Y O;  1NZ6 A;  4JZG A;  3CXH F;  1OCR C;  4JF3 A;  5E79 Z;  1ZWI C;  2PTM A;  2QM8 A;  2E74 B;  3WFV A;  1H8E G;  1NTZ H;  2JEU A;  3QNE A;  4FK5 C;  1TGO A;  3RYH B;  2DWE C;  2DOS A;  1M93 A;  1QLN A;  1CPY A;  1SQV H;  1XL4 A;  2ITD C;  1MG1 A;  3OTF A;  4ZHQ B;  5DM6 V;  1XMQ O;  4FVM A;  4RWU A;  3K9S A;  4ZIB A;  1KP3 A;  3CYO A;  2ADP A;  1DF4 A;  2ZR3 A;  1G6U A;  1KYO F;  3U11 A;  2W6J G;  3DXR A;  4ICG A;  1FFX B;  4X64 B;  2R9I A;  1XNR O;  2ZM6 B;  4PDL A;  4X8A A;  1SET A;  5KHJ A;  1PP9 H;  1XNR B;  3WB2 A;  5JJN B;  3OEH G;  4O4H B;  4X1K A;  3LSQ A;  2HHH O;  4DR4 O;  4W4K A;  3JSN A;  2JIZ G;  2EZO A;  1VMG A;  1W2B U;  1B3Q A;  3N2K B;  4R6Z A;  3U10 A;  1GN3 A;  1Y76 B;  4UUJ C;  1XOU A;  4FM2 A;  3ABM B;  1QNM A;  1P84 F;  5LOV A;  1P49 A;  2HP8 A;  2Q7H A;  1DF5 A;  1JJ2 U;  2RMK B;  2E5L B;  5B1B C;  2OTJ V;  1Q82 W;  3P30 A;  3CWB H;  1BT8 A;  1OHH G;  3FB8 C;  1NR1 A;  5F2V O;  4UVB A;  3W7W A;  4O4I A;  2PZS A;  3HB3 B;  4ZI7 A;  1N8R W;  2F66 C;  4UCS A;  4JI7 B;  3ZJZ A;  5BR8 O;  3CX5 F;  4B08 A;  1N32 B;  4P9O A;  1N0J A;  3JAK B;  1F23 A;  2Q6A A;  1Z5W A;  3AG4 C;  4E2L A;  1YIT V;  4UCR A;  2EUL A;  3JSL A;  4I5S A;  4CH5 A;  1IBL B;  3E8G A;  3OGC C;  3CRQ A;  1OCC B;  4DR4 B;  5KMG B;  1JCH A;  5AG2 A;  3ASN B;  2VWK A;  3FFQ A;  4UVC A;  3SJQ C;  2DQ3 A;  4X66 O;  2ZE8 A;  4PA7 A;  1MSD A;  2V7Q G;  1W0J G;  1H38 A;  3K04 A;  2W0F C;  2YIB A;  4AQY B;  4TOI A;  1PNK A;  3B40 A;  4NR1 A;  2Q4P A;  1Q6I A;  3HKD A;  4LFB B;  4JPR A;  4JI6 B;  4YJ3 B;  3MAQ A;  4JI8 O;  5IE9 A;  5J2T A;  4TUY A;  1R73 A;  2PGG A;  3OUF A;  2YIC A;  4B3S O;  1R3J C;  3ABU A;  4JAS A;  1IUR A;  2XAS A;  3G67 A;  2HVJ C;  2VQF B;  2WWW A;  5J2U A;  3OE7 G;  3OT7 A;  4I9W A;  4KP4 A;  2P7T C;  3ZN0 A;  2PY5 A;  3T1Y B;  4GKJ B;  5HFL A;  4K8X A;  5GON B;  4PV1 B;  2DQ0 A;  3ABM C;  4DXW A;  4PI2 A;  1GAX A;  4CBC A;  4YXW G;  3JAT B;  1N4C A;  3IGA C;  1S5L Z;  2QA4 V;  2CGN A;  3M99 B;  4RUE A;  2RCV A;  1KKD A;  3TET A;  3JYC A;  3FB6 C;  1I08 A;  5EBW C;  1K34 A;  2L35 A;  3IC7 A;  3OR7 C;  4GZR B;  3CCM V;  4EB6 B;  4JGS A;  3OW2 U;  4J11 A;  2ZXW B;  1SQG A;  1IBM O;  3TXS A;  1K5S A;  1M57 B;  2A7W A;  1ZX3 A;  3D8C A;  3CC7 V;  2IH1 C;  5JQG B;  2LFR A;  4MSW C;  5LL6 Y;  3CXC U;  1TA8 A;  4CH6 A;  1AB3 A;  3AG1 C;  4U3J B;  3RT3 C;  1FPO A;  4QPK A;  4UCT A;  5LGN A;  2F4V B;  1WB7 A;  1JR9 A;  1XUQ A;  4MS2 A;  2CTQ A;  3B8M A;  3CRC A;  3HKE B;  4R7C A;  3O65 A;  3H9V A;  4DV4 O;  4LFC B;  5LA6 B;  2WLH A;  3ZIA G;  5IJ9 B;  2P67 A;  2YUA A;  3VQW A;  4JI0 O;  5CBF A;  1K73 W;  4KHP O;  1F4N A;  3JD0 A;  1H8H G;  5DEC A;  4ZOL B;  5JH7 B;  1K3E A;  5C8Y A;  2QKC A;  3S3X A;  1K7D A;  4DR5 O;  1BSM A;  2RN9 A;  3D3Q A;  1VQP V;  3CCJ V;  1VQ4 V;  2IU0 A;  1BGY H;  4WBN A;  2F93 B;  4PJ0 Z;  4NB5 A;  4Q6G A;  1KD1 W;  5LP6 C;  1S72 V;  3VQX A;  1N36 O;  3K03 A;  4KL1 A;  3I5D A;  2NN4 A;  4LWS A;  1DK1 A;  4WCE V;  4R8C A;  1YEW A;  4OPH A;  2X6B A;  1HNX B;  3VOU A;  2CTW A;  2RDC A;  1WN7 A;  2UUC O;  4O2B B;  3T4D A;  4FFB A;  3OR6 C;  4NTW A;  1L0N H;  3VQV A;  3LDE A;  4JYY A;  5LHH A;  4J9Y B;  5BZB A;  3ZHR A;  2R9R B;  1WAZ A;  2HR3 A;  1JOY A;  1IXM A;  5KAF Z;  2QEX V;  5EBM C;  3CPW U;  3K79 A;  4RUF A;  4LF8 B;  2DMX A;  2QJ1 A;  3BCC H;  3UT5 B;  3E8B A;  1Z2G A;  1KU9 A;  1MAB G;  2H3O A;  2OTL V;  1Q7Y W;  2Y69 B;  1I94 O;  2R72 A;  4I7Z B;  5JCO C;  5B1B B;  3G71 V;  4KHP B;  1VQ6 V;  3BPZ A;  3R66 A;  4X1I A;  4PA6 A;  3ICX A;  1J5E B;  1L1F A;  1GKF A;  2OCH A;  4DV2 B;  3SYO A;  4YJ2 B;  1GN2 A;  1XHX A;  1HNW O;  2ZXW C;  2EJR A;  1EFR G;  2BSK B;  2HHH B;  5K1X A;  5LYJ A;  5LMU B;  1O9H A;  2B5U A;  4O4J A;  5KHK A;  4JYC A;  2GDS A;  4X1Y A;  3DSQ A;  4JTC B;  1NT2 B;  2ADQ B;  3KCX A;  5DED A;  3BA9 A;  4TT3 G;  5KHH A;  1DGS A;  1KUQ A;  4Z1M G;  5EYP B;  3JAL B;  1YXB A;  4DR1 B;  3Q4H B;  1YDX A;  2AW9 A;  4JI5 B;  1OCC C;  1WP8 A;  1W59 A;  3A0B Z;  4J10 A;  3K0D A;  2JS5 A;  1KEC A;  1NBM G;  1SQB H;  2CGO A;  2HLD G;  3STZ C;  2Z0A A;  4TQF A;  5JVD B;  3ZMV A;  2R70 A;  5LXT A;  4LF4 O;  2LW1 A;  2FL4 A;  2UUA O;  1MA1 A;  3AG7 A;  4IIJ A;  2D3O W;  4CS2 A;  5KAI Z;  1HNW B;  1NH2 D;  2XOK G;  1SQF A;  2Y4U A;  4DV7 B;  3VBB A;  5LXT B;  5GTH Z;  5J9P C;  5LP6 B;  5JVD A;  1NTK H;  1BL8 A;  1JMK C;  1OCO C;  3QO8 A;  1GMG A;  2PI4 A;  2FB5 A;  1YSC A;  3BA8 A;  2JEX A;  3ZMU A;  1V54 B;  2WLJ A;  1COW G;  2HFE C;  5B5E Z;  3Q4H A;  2DYS C;  1N0N A;  4XDL A;  2VQE B;  4X9Q A;  5EYP A;  1FXK C;  4EEQ A;  4X62 B;  2WPD G;  3RW0 A;  4NYK A;  1ZLZ A;  2KQX A;  1XMO O;  2WLL A;  1CXZ B;  2F4V O;  2R9A A;  4DW1 A;  1Y6X A;  1NQT A;  1VQ8 V;  4UV8 A;  5CN0 A;  4I0X B;  3SPI A;  2P4V A;  3P3N A;  2CDY A;  3E8H A;  2Y48 A;  3X2Q C;  2BSK A;  5H9C A;  3RBZ A;  3LSU A;  4MTO A;  3EVK A;  4YJ2 A;  3CCU V;  2IW5 A;  3M7M X;  1XEQ A;  2ZD9 A;  1B06 A;  3T1H O;  4PI0 A;  2EIM B;  1E1Q G;  3OTO B;  3CC4 V;  2D2C B;  1YCI A;  2F95 B;  2FKX A;  1XL6 A;  4TWK A;  2PYJ A;  3UM7 A;  3UCS C;  4JAU A;  3CCL V;  2EX3 A;  4JI7 O;  3LDD A;  1BHB A;  1R6T A;  3JAR B;  1Q6U A;  3ML0 A;  2W6I G;  2ODM A;  1YJW V;  3APO A;  4FFB B;  3F7Y C;  2MW2 B;  4GKK B;  3IJ4 A;  2K9P A;  3K08 A;  1VF5 B;  2UXD O;  1NR7 A;  2H94 A;  5ITZ B;  2DYR B;  2IU3 A;  3ZED A;  4Z1V A;  4TSF G;  3B8N A;  2FTK A;  3D36 C;  1AR1 B;  4B7E A;  2VS0 A;  3U0Z A;  1QQC A;  1HW7 A;  4DR3 B;  1THZ A;  4JI0 B;  1VQM V;  2IM9 A;  2ZIO A;  1RSO B;  4WFE A;  1OCZ B;  1P7B A;  2BE3 A;  1AJP A;  3VQY A;  4QPJ A;  1FXV A;  3LDC A;  1KP2 A;  5C8Y B;  4IT5 A;  2QTO A;  4ZOL A;  2Q8V A;  1OZ0 A;  2Q73 A;  2YID A;  1CEZ A;  3K06 A;  5LGU A;  3R65 A;  3OMA B;  5EIB C;  1MZF A;  2JRI A;  2Q7E A;  4D7S A;  2QM7 A;  2QWN B;  5LA6 A;  3THO A;  2PI5 A;  4LH7 A;  1FXK B;  3E22 B;  3HKE A;  4GKK O;  1GM7 A;  3W7X A;  1OJH A;  3CME V;  1EN4 A;  1R6K A;  3ZHV A;  2EJ7 A;  4PHZ A;  4U3J A;  3CCS V;  4FLW A;  1J5E O;  1GN6 A;  2PUS A;  2KKW A;  3EHB B;  3GB7 C;  2ILM A;  1GM9 A;  2Y69 C;  1H2S B;  2QDO A;  4J7K A;  4AIL C;  4EB6 A;  4IYH A;  4JTD B;  4BW9 A;  1S5H C;  4CH4 A;  3UQ8 A;  1NVP D;  2EIM C;  1XMQ B;  3A0R A;  2ATK C;  3UO2 A;  1K4C C;  1D2D A;  2ZKO A;  4DUY B;  2H8P C;  3J81 N;  4AQY O;  4B3R O;  1RP3 B;  2W0X A;  2NLJ C;  1CP9 A;  4MVO A;  4Q20 A;  1V55 B;  4WF9 V;  4PA9 A;  3JAT A;  2P4K A;  3BEH A;  4NTX A;  2HJF C;  5KUK A;  3ZRW A;  2QKA A;  2WA3 A;  2YI9 A;  3JAW A;  2HVK C;  2LO1 A;  2X7R B;  3NR7 A;  5JJJ B;  1VIB A;  5D5P A;  5IJ0 B;  2ZR2 A;  5H2F Z;  3SYQ A;  4X20 A;  1ZL8 A;  2Z3Y A;  2DWD C;  4DR5 B;  4LFA O;  2A06 H;  4DV5 B;  4P9P A;  1RPR A;  1LUV A;  4JTA B;  1VQK V;  3WU2 Z;  4X64 O;  4FM0 A;  2ARH A;  4XBF A;  4GLX A;  2YEV B;  5EK0 A;  3ZHU A;  1G8M A;  4LP8 A;  3G80 A;  1YZB A;  2JGD B;  2HJD A;  1Q43 A;  1P7G A;  1AI5 A;  3HR0 A;  1SES A;  3SYC A;  2ZDI A;  1K97 A;  1YJN V;  3QF7 A;  3LNM B;  2IBZ H;  2ZE5 A;  4BIZ A;  3JD4 A;  5L3D A;  2QTS A;  3OGI B;  1GM8 A;  1S76 D;  4LF8 O;  3SPG A;  1ZTE A;  4XDJ A;  5KUM A;  1Q6H A;  4GX5 A;  3RGB A;  3JCZ A;  3JAK A;  3K5N A;  3M8A A;  4JI1 B;  3N2G B;  1PNM A;  4FZ0 A;  1LR1 A;  4DV6 O;  2EBO A;  1EN6 A;  4UFZ A;  1JQ0 A;  5L3G A;  4I55 B;  1BE3 H;  5KHI A;  3IFX A;  1RM1 C;  1Q8I A;  1SQQ H;  1AIL A;  4O4I B;  3X2Q B;  1VAR A;  2YDE A;  3JD1 A;  3SPC A;  4OGQ B;  3JCU Z;  3AK3 A;  4CS4 A;  2WSS G;  4PDR A;  1NS1 A;  3ABK C;  1DTO A;  4DV0 O;  4TV9 B;  3RYF A;  1SER A;  4QNH B;  2ITC C;  2EIJ B;  5BXZ A;  1WB8 A;  3OEE G;  1VF6 C;  4JYA O;  3T2M A;  2YS8 A;  1TUB B;  3TK1 A;  3RVZ A;  4MTG A;  4X65 O;  3ABT A;  3E2E A;  3SDL A;  3TGU H;  2AHZ A;  4BR6 A;  4X1K B;  4LFB O;  2EIL C;  4YHH O;  4O4H A;  4YIP A;  3WG7 C;  4FLV A;  3APQ A;  3E8F A;  2UUA B;  2DYR C;  1W0K G;  1EZV H;  3DXR B;  4TV8 B;  4I50 A;  3F7V C;  1YJ9 V;  5A2Q N;  3J7A U;  2GTA A;  5FPR A;  4QE7 A;  4DR2 O;  3CD6 V;  4ZHQ A;  3BHP A;  1K92 A;  4J80 A;  5EZY B;  1XNQ B;  2YXH A;  1OCZ C;  4H37 A;  3CRM A;  3DC5 A;  2Q9L A;  4MVR A;  1QBZ A;  1M56 C;  1YHQ V;  4WFB V;  2ZIN A;  3E86 A;  4JYA B;  3K9A A;  1E79 G;  3AK2 A;  5B3S B;  2ZE7 A;  3BRC A;  1Y74 B;  3LUT B;  3WB1 A;  1M57 C;  1IBL O;  3OTO O;  4KXR A;  4DO2 A;  2Q69 A;  3AG1 B;  3CEI A;  4DV1 O;  2YIA A;  3OUS A;  2MK3 A;  3HPL C;  3ZRX A;  3RYC A;  4JV5 O;  1XBL A;  4CH3 A;  3RYI B;  3CP1 A;  4OPA A;  2ZCE A;  3AG2 C;  4MTX A;  3CS5 A;  4F6E A;  1G1X B;  1Y67 A;  1SQX H;  2EIK B;  1URF A;  4CZZ A;  1Y74 A;  2XT9 A;  1SRY A;  1XDC A;  1NU1 H;  5KA5 A;  5CMU A;  3BFR A;  1V9P A;  1WA8 A;  3ASN C;  3E89 A;  2HG5 C;  3AG3 C;  2ZDI C;  3B2E E;  4DR6 B;  2Q67 A;  2KB1 A;  3FYE B;  3LSS A;  4MW8 A;  4X89 A;  1IBK O;  1QVF U;  4J7Z A;  3ZHS A;  1IXB A;  2Q7G A;  1EZJ A;  3MD0 A;  2VQE O;  3SR2 C;  4LC1 A;  5EZY A;  4F6R A;  2CH7 A;  4L87 A;  5LMN B;  4FLU A;  4FFK A;  3P32 A;  1VQN V;  5IYZ B;  1ORQ C;  4LH6 A;  4JI2 B;  3ZMZ A;  1BHA A;  4DV5 O;  1WLE A;  4YY3 O;  2IJJ A;  4I50 B;  4TV8 A;  1S77 D;  2YI8 A;  2IH3 C;  4DV0 B;  1Q81 W;  3F5T A;  4DK0 A;  1HNZ O;  4O2A B;  3WG7 B;  1H2N A;  1D5N A;  2WLI B;  1WPX A;  4L8J A;  1QLE C;  1AVM A;  3CB2 A;  3C90 A;  2JJ1 G;  5CA3 A;  2EIN B;  4LNU B;  1WJZ A;  5BMV A;  1HP8 A;  1MMM A;  4DUZ B;  4D6T H;  1Q86 W;  1TUB A;  2QGN A;  5B1O A;  1JA8 A;  5CA1 B;  1BQZ A;  2P5O A;  4B3R B;  3CCR V;  1H2K A;  3G6B A;  1IBM B;  1UJW B;  1F51 A;  4XDK A;  1HR0 B;  1IBK B;  3RYF B;  1Z5V A;  3CHX A;  4FJC C;  4DV4 B;  2DJV A;  2GUZ B;  1GH6 A;  4X65 B;  4K0K B;  4TV9 A;  5D5Q A;  2Y0P A;  1AJQ A;  4I9Q A;  1JFF B;  3AEI A;  3FX7 A;  4MVS A;  4BAY A;  4J9Z B;  1FKA O;  3C3S A;  3RVY A;  4GX2 A;  4MW3 A;  4FLZ A;  4IYI A;  1ARO P;  2L6L A;  3NXS A;  2FML A;  1OV9 A;  4I55 A;  3GWO A;  4MT8 A;  3HKC B;  3ASO C;  1MZE A;  3N2G A;  4WFH A;  2JJ2 G;  2VQF O;  1U97 A;  2XND G;  1MOF A;  4JI4 B;  3CSX A;  3IC9 A;  1KC8 W;  2ZT9 B;  4DR7 B;  3SPJ A;  5E1A C;  1OCR B;  2B1G A;  4IHJ A;  2N04 A;  4WFA V;  5JJE B;  2UXB O;  3QTC A;  1ZAU A;  3CE2 A;  3ABK B;  4GT1 A;  5FPO A;  4CC5 A;  4DV7 O;  2OCC C;  1YVW A;  2EZP A;  1GRJ A;  1VP7 A;  1SA0 A;  2BCC H;  4QE9 A;  3L74 H;  4LF9 O;  1QCE A;  3HKB B;  2JGD A;  4HZ3 A;  4DK1 A;  5L3C A;  2WLM A;  4K3A A;  4J42 A;  2XHB A;  2XAG A;  5EBL C;  4DUY O;  2YEV A;  1PL4 A;  3SGI A;  4NXM B;  1B6Q A;  2CUG A;  4CS3 A;  5IT9 N;  1KMI Z;  2AZ2 A;  4F4L A;  1PKX A;  2PF4 E;  2OYQ A;  3ETQ A;  4U7O A;  2LW7 A;  2EIL B;  3CCQ V;  1ZL8 B;  1GO3 F;  2YIB D;  1X59 A;  4X20 B;  4DRX A;  5FNV B;  4OX9 O;  5IJ0 A;  2WLK A;  4BIU A;  1AI6 A;  2EIN C;  4G28 B;  1AP5 A;  4P30 A;  1IVS A;  3JAW B;  5H6Q A;  3L75 H;  1SS3 A;  3ETD A;  3ZRW B;  2UU9 B;  3CRR A;  3DTU B;  5CBH A;  3QO7 A;  2BTQ A;  2JVD A;  4RAI A;  4FLY A;  3SYP A;  4DV2 O;  2JDI G;  3E35 A;  5IWA O;  5GW7 A;  5IDJ A;  1M56 B;  3I56 V;  3K0G A;  1I0H A;  3JD2 A;  3L73 H;  1LNQ A;  2XAH A;  2XTA A;  4UVA A;  3G4S V;  2P22 C;  5EIB D;  1N33 B;  3KCY A;  3ZN1 A;  3ZHQ A;  4LF9 B;  2UUB O;  1UPG A;  1Q90 D;  4DR1 O;  3EFF K;  3CRA A;  1R3I C;  1WPB A;  5CA0 A;  1DLB A;  1EN5 A;  4QGP A;  5H5N A;  4JI1 O;  3T1H B;  3SJA C;  3SJB C;  4MVQ A;  4ZBM A;  3K3W A;  3ABL C;  5IY5 C;  3AG4 B;  1WP7 A;  2ZIM A;  3E22 A;  4H44 B;  1FXK A;  3DC6 A;  3ETE A;  3H01 A;  2UXC O;  2EIK C;  3BAB A;  3J80 N;  3IAY A;  2BOC C;  4GUN A;  1X4T A;  2DN9 A;  2DW4 A;  5K1P A;  1D5A A;  5A9G A;  2UXX A;  2KG7 A;  4HNA B;  3H1L H;  3E83 A;  4DV3 B;  1RSO A;  4UV9 A;  5L3F A;  4UCO A;  5TIS Z;  4DR7 O;  4PDM A;  2QWO B;  3L71 H;  1F4M A;  2YSU B;  1FFT B;  3N27 A;  3ZHT A;  4Z2W A;  2LGQ A;  2P06 A;  1GTO A;  3L9D A;  2LP7 A;  1K33 A;  3QVN A;  3TCU A;  1I5X A;  2A9H A;  2V4D A;  1RPO A;  2OIG A;  4DW0 A;  5ITZ A;  3ZS8 C;  5LGT A;  3A8T A;  3RWR D;  4J7J A;  1PL0 A;  4LF5 O;  2Z5U A;  3S3W A;  4DUZ O;  3G6E V;  3BAA A;  1SQP H;  2QM4 A;  2XAQ A;  2AGA A;  3JAR A;  2P90 A;  1VF6 A;  2LQT A;  1M1K W;  4BIO A;  1JPX A;  4QIW F;  2QR4 A;  4FPP A;  1VQL V;  4O4L A;  2YXY A;  1Y4M A;  4I4T B;  2WAM A;  3SYA A;  1IX9 A;  1LUW A;  2CTR A;  1HDJ A;  4FZ1 A;  1AJN A;  2QWP B;  4G2K A;  2Q5Z A;  2RJZ A;  2AHY A;  3JD3 A;  5CB4 A;  3JAS A;  2A0L A;  1AR4 A;  1FD9 A;  1SF9 A;  4I0X A;  2KSD A;  4JI3 B;  1N34 B;  3TXQ A;  5KX5 B;  2A79 B;  2WLN A;  1VF7 A;  2CE4 A;  4JZ2 A;  4NVP A;  3H1H H;  2WLL B;  3TJT A;  5IY5 B;  1BCC H;  1QR9 A;  4W4L A;  2E5L O;  4AI8 A;  1K4D C;  2FYU H;  4P2Z A;  3K5L A;  1O9G A;  1AP6 A;  3CJH B;  5H6R A;  1NTM H;  5LHI A;  3H1I H;  1I5Y A;  2GV9 A;  1AI7 A;  2C2A A;  1PNL A;  1RFY A;  2CK3 G;  3JAM N;  5LP6 A;  5BY1 A;  2OCC B;  4NXM O;  1XIL A;  3AK1 A;  3MHS C;  1IZ3 A;  4DR3 O;  4IIJ B;  2ZM6 O;  1FS0 G;  3OFN G;  4EFE A;  1M90 W;  5GTI Z;  1P4R A;  4DV3 O;  3QO5 A;  4B3M B;  1FJG O;  1JJO A;  1XRE A;  3A2F A;  3ZX6 A;  1FAF A;  2JS3 A;  1PD3 A;  2HEP A;  3CJH A;  3H1K H;  4LF7 O;  1AR5 A;  1S5J A;  2NNU A;  3FD9 A;  4JYB A;  1US6 A;  3JAL A;  2N05 A;  4UB8 Z;  1PV0 A;  3H1J H;  2GSM B;  2UU9 O;  4C7U A;  1R6N A;  1YI2 V;  2GTS A;  5L3E A;  1L0L H;  1WNS A;  4PD4 F;  4FMT A;  5L3B A;  4X1Y B;  5KX5 A;  4HBN A;  1GN4 A;  2CTP A;  5KLV H;  4LFA B;  4O4J B;  4JI6 O;  2Y4T A;  5LYJ B;  3GVM A;  1HR0 O;  3JAS B;  2E75 B;  5CB4 B;  1HWY A;  4DR6 O;  1MSW D;  3ZBH A;  1M5I A;  1S3J A;  2BTO A;  4D7T A;  5LBQ A;  1TAE A;  3BY6 A;  4NXN O;  4NKG B;  4LF4 B;  4RQE A;  2AZ0 A;  2X0L A;  4X1I B;  2X6C A; 
#chains in the Genus database with same CATH homology
 4OXS A;  5CA3 A;  3CC4 V;  2JIZ G;  2XAF A;  2EZO A;  3T4Z A;  3ZRV A;  4N23 A;  2EIN B;  1W2B U;  5EC2 C;  1XL6 A;  4TWK A;  4R6Z A;  3UM7 A;  1Q86 W;  4JAU A;  5B1O A;  4GX1 A;  4UUJ C;  3CCL V;  3ABM B;  2B1I A;  3CCR V;  3LDD A;  1BHB A;  4N21 A;  1UJW B;  1F51 A;  1DF5 A;  1JJ2 U;  3ML0 A;  4XDK A;  2W6I G;  1YJW V;  4QJF B;  2IJH A;  3ABL B;  4HYO A;  4FJC C;  5B1B C;  2OTJ V;  3F7Y C;  1Q82 W;  3P30 A;  1AJQ A;  3AEI A;  3K08 A;  4MVS A;  4BAY A;  1NR7 A;  2H94 A;  4J9Z B;  1ROP A;  1OHH G;  3RVY A;  4GX2 A;  2DYR B;  4MW3 A;  3B77 A;  3FB8 C;  4X88 A;  2IU3 A;  1EBO A;  1NR1 A;  4TSF G;  3B8N A;  2FTK A;  1AR1 B;  4U7N A;  4UVB A;  3W7W A;  3HB3 B;  1N8R W;  1ARO P;  3NXS A;  1THZ A;  4MT8 A;  3GWO A;  1VQM V;  3ZJZ A;  3ASO C;  1SZT A;  3FB7 C;  4WFE A;  1OCZ B;  4P9O A;  1F23 A;  1P7B A;  2IJI A;  2Q6A A;  4WFH A;  2JJ2 G;  1AJP A;  3AG4 C;  4QPJ A;  4PDV A;  2X6A A;  1FXV A;  1MOF A;  2XND G;  3LDC A;  1KP2 A;  4E2L A;  1YIT V;  2GHY A;  2QTO A;  1S0V A;  5IYB O;  1TUE B;  3D36 A;  4I5S A;  1OZ0 A;  1KC8 W;  1VQ5 V;  3E8G A;  3SPJ A;  1CEZ A;  3OGC C;  1OCR B;  2B1G A;  3OMN B;  1OCC B;  1V54 C;  3K06 A;  3OMA B;  3R65 A;  5E1A C;  1JCH A;  5LGU A;  5B3S C;  3ASN B;  4WFA V;  4UVC A;  3SJQ C;  2DQ3 A;  4R50 A;  5IYC O;  2QM7 A;  4BW5 A;  4PA7 A;  2V7Q G;  1W0J G;  2PI5 A;  1FXK B;  3ABK B;  4GT1 A;  1H38 A;  3K04 A;  2W0F C;  2OCC C;  1GM7 A;  2EZP A;  3W7X A;  1PNK A;  4QE9 A;  1QCE A;  3CME V;  1R6K A;  5LHG A;  3CCS V;  4HZ3 A;  4JPR A;  4G27 B;  5L3C A;  2WLM A;  3I55 V;  1VQO V;  4UXN A;  1K8A W;  2XAG A;  5EBL C;  3EHB B;  5HFM A;  3AG2 B;  4WFG A;  3GB7 C;  1R73 A;  2YEV A;  1G4Y B;  1M9N A;  3OUF A;  1J95 A;  1GM9 A;  2K1E A;  2Y69 C;  1B6Q A;  3ZCC A;  1VQ7 V;  3STL C;  4LCU C;  1R3J C;  3ABU A;  4JAS A;  4F4L A;  1PKX A;  4PA3 A;  4U7O A;  2XAS A;  2EIL B;  1QR8 A;  2HVJ C;  3CCQ V;  1GO3 F;  2WWW A;  4JTD B;  3OE7 G;  1S5H C;  1NVP D;  2EIM C;  4I9W A;  1E1Q G;  4PEL A;  4KP4 A;  2WLK A;  3A0R A;  2P7T C;  4BIU A;  2ATK C;  1AI6 A;  2IJK A;  1K4C C;  3ZN0 A;  2EIN C;  4G28 B;  4P30 A;  2H8P C;  5HFL A;  5H6Q A;  1FXH A;  3ETD A;  3ZRW B;  2DQ0 A;  2NLJ C;  3OM3 B;  3ABM C;  2QE7 G;  4DXW A;  1CP9 A;  4MVO A;  4Q20 A;  3DTU B;  1V55 B;  4GX0 A;  4WF9 V;  4CBC A;  4YXW G;  2EIJ C;  4PA9 A;  5CBH A;  3SPH A;  3IGA C;  1NKD A;  3BEH A;  3QO7 A;  2HJF C;  5KUK A;  2QA4 V;  3M99 B;  3ZRW A;  4RUE A;  3D3I A;  1KKD A;  1K5Q A;  3TET A;  2HVK C;  3DGE A;  3JYC A;  4RAI A;  3FB6 C;  3SYP A;  1YTF D;  1R3K C;  2X7R B;  5EBW C;  2UXN A;  1K34 A;  2JDI G;  3E35 A;  3IC7 A;  2ZR2 A;  5GW7 A;  5IDJ A;  3OR7 C;  1M56 B;  3SYQ A;  3I56 V;  3MHH C;  3K0G A;  3JD2 A;  1NVP B;  1LNQ A;  2XAH A;  1QLE B;  2Z3Y A;  2DWD C;  4UVA A;  1R3L C;  3G4S V;  3CCM V;  4JGS A;  3OW2 U;  4P9P A;  2ZXW B;  1RPR A;  2LFS A;  2ZQM A;  3ZN1 A;  4JTA B;  1VQK V;  3OMI B;  1K5S A;  4EKW A;  3OAA G;  1M57 B;  4XBF A;  2YEV B;  3EFF K;  4FIP C;  1ENV A;  1R3I C;  3CC7 V;  4RQF A;  2IH1 C;  5EK0 A;  3W7S A;  1DLB A;  2LFR A;  4MSW C;  2V1D A;  3CXC U;  1G8M A;  4LP8 A;  3CCV V;  3AG1 C;  2HKO A;  5KA6 A;  5B1A C;  2F43 G;  4MVQ A;  4QPK A;  5LGN A;  4ZBM A;  3K3W A;  3ABL C;  3ZMT A;  4MS2 A;  5IY5 C;  1AI5 A;  3AG4 B;  3B8M A;  1SES A;  4GCZ A;  3SYC A;  4R7C A;  1FXK A;  2ZDI A;  3ETE A;  3H01 A;  2EIK C;  1K97 A;  1OCO B;  2WLH A;  1YJN V;  3ZIA G;  3LNM B;  4BIZ A;  2P67 A;  3JD4 A;  5CBF A;  2BOC C;  5L3D A;  1K73 W;  4KFM A;  3F5W C;  1F4N A;  3JD0 A;  1YIJ V;  2DYS B;  1H8H G;  1GM8 A;  1K3E A;  2DW4 A;  1S76 D;  3SPG A;  4XDJ A;  5KUM A;  2UXX A;  4GX5 A;  2QKS A;  3JCZ A;  1K7D A;  3E83 A;  3ASO B;  5EC1 C;  1PNM A;  4UV9 A;  5L3F A;  1VQP V;  2EBO A;  3CCJ V;  4PDM A;  1VQ4 V;  1JQ0 A;  2IU0 A;  1F4M A;  2YSU B;  5L3G A;  1FFT B;  3FYI B;  3IFX A;  5C93 A;  3W7U A;  1KD1 W;  4LBE C;  1RM1 C;  1S72 V;  5IYD O;  3X2Q B;  1GTO A;  2LP7 A;  3K03 A;  1K33 A;  3TCU A;  3JD1 A;  3SPC A;  1I5X A;  2A9H A;  2OT5 A;  1RPO A;  4ASU G;  2JK5 C;  1GK9 A;  4WCE V;  4R8C A;  3ZRS A;  3CCE V;  5LGT A;  2X6B A;  2WSS G;  3VOU A;  4PDR A;  3ABK C;  1DTO A;  1VQ9 V;  1PL0 A;  3AG3 B;  1YTF B;  2Z5U A;  3T1C A;  3T4D A;  3W7T A;  3G6E V;  3OR6 C;  3LDE A;  1SER A;  5LHH A;  4QNH B;  4J9Y B;  5BZB A;  2XAQ A;  2R9R B;  2ITC C;  1V55 C;  2HR3 A;  2P90 A;  1IXM A;  1JOY A;  2EIJ B;  1M1K W;  2QEX V;  5EBM C;  3CPW U;  3OEE G;  3K79 A;  3UKM A;  4RUF A;  1JPX A;  4HAM A;  3E8B A;  2Q68 A;  3T2M A;  4QIW F;  1MAB G;  3TK1 A;  4FPP A;  1VQL V;  3RVZ A;  2OTL V;  4MTG A;  1Y4M A;  1Q7Y W;  2Y69 B;  4WFF A;  3ABT A;  3CC2 V;  2WAM A;  4MVZ A;  3SYA A;  3E2E A;  5B1B B;  3G71 V;  1VQ6 V;  4PA6 A;  2AHZ A;  2EIL C;  1L1F A;  1GKF A;  2WLI A;  1AI4 A;  5CBG A;  4KUM A;  3FKS G;  3WG7 C;  2P6J A;  3E8F A;  3SYO A;  1AJN A;  1KQS U;  2ZXW C;  2DYR C;  1W0K G;  4G2K A;  1NH2 B;  1H2G A;  2AHY A;  2EJR A;  3JD3 A;  1EFR G;  3F7V C;  1YJ9 V;  2A0L A;  2XAJ A;  4QE7 A;  2B5U A;  3CD6 V;  4JYC A;  3PJS K;  2A79 B;  2WLN A;  5B1A B;  1QVG U;  4JTC B;  2M7W A;  1K92 A;  2WLL B;  2BOB C;  4MVM A;  4PA4 A;  4JAV A;  4TT3 G;  1OCZ C;  5IY5 B;  4H37 A;  1QR9 A;  4RO2 A;  4MVR A;  4Z1M G;  4ZKI A;  1QBZ A;  3ZMS A;  1M56 C;  1K4D C;  1YHQ V;  4P2Z A;  1E1R G;  1BMF G;  4WFB V;  3E86 A;  5DN6 G;  3K9A A;  1OCC C;  5H6R A;  1E79 G;  5LHI A;  5B3S B;  3K0D A;  1KEC A;  4H33 A;  1I5Y A;  1NBM G;  3LUT B;  4MVU A;  2HLD G;  1AI7 A;  2C2A A;  3STZ C;  1M57 C;  3ETG A;  1PNL A;  2CK3 G;  1JX9 A;  3ZMV A;  2OCC B;  4DO2 A;  2Q69 A;  3AG1 B;  3FB5 C;  3KG2 A;  2MK3 A;  3OUS A;  5FL7 G;  1JVM A;  2D3O W;  1Y66 A;  3HPL C;  3MHS C;  3ZRX A;  4MTF A;  3CMA V;  1NH2 D;  2XOK G;  1FS0 G;  3CP1 A;  3OFN G;  1M90 W;  1NJI W;  3VBB A;  5J9P C;  1RM1 B;  1K9M W;  1P4R A;  3AG2 C;  4MTX A;  1BL8 A;  3QO5 A;  2EIK B;  5B1N A;  1OCO C;  3QO8 A;  1GMG A;  2PI4 A;  4CZZ A;  1YSC A;  1SRY A;  1PD3 A;  2JEX A;  1OCR C;  5KA5 A;  5CMU A;  1V54 B;  2WLJ A;  4JF3 A;  3ZMU A;  3LSQ A;  1COW G;  1ZWI C;  3ASN C;  2HFE C;  3E89 A;  2QM8 A;  2DYS C;  3WFV A;  2NNU A;  4JYB A;  4XDL A;  2HG5 C;  1H8E G;  2JEU A;  3AG3 C;  2ZDI C;  3QNE A;  1FXK C;  2Q67 A;  2KB1 A;  2WPD G;  3FYE B;  3LSS A;  4FK5 C;  4MW8 A;  4X89 A;  3RW0 A;  2GSM B;  1QVF U;  1EZJ A;  2DWE C;  3MD0 A;  1QLN A;  4LC1 A;  1CPY A;  1R6N A;  2WLL A;  1YI2 V;  1XL4 A;  2ITD C;  4L87 A;  1MG1 A;  5L3E A;  4FMT A;  3P32 A;  5L3B A;  5DM6 V;  1NQT A;  1VQN V;  1VQ8 V;  1ORQ C;  4UV8 A;  5CN0 A;  3SPI A;  1KP3 A;  3CYO A;  3ZMZ A;  1BHA A;  1WLE A;  3E8H A;  1DF4 A;  2Y48 A;  2IJJ A;  2ZR3 A;  3X2Q C;  5H9C A;  1S77 D;  2W6J G;  3RBZ A;  1HWY A;  2IH3 C;  1MSW D;  1S3J A;  4MTO A;  1Q81 W;  2R9I A;  5LBQ A;  4PDL A;  3BY6 A;  3CCU V;  4X8A A;  3WG7 B;  1SET A;  2IW5 A;  2WLI B;  2ZD9 A;  3OEH G;  1WPX A;  1QLE C;  4RQE A;  2X0L A;  2EIM B;  2JJ1 G;  2X6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...