4X8MA

Crystal structure of e. coli adenylate kinase y171w mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEWHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 65
structure length 214
sequence length 214
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8mA00
3C8UA 3F3YA 1Z28A 3GLHA 3SDZA 1R8QA 3CNLA 1T6NA 1BH2A 1P9WA 1OXXK 2IYUA 4DLWA 1FPMA 821PA 3SYKA 2VP0A 3LW8A 2O5VA 5KPJA 2GEUA 2A9KA 2QBYB 3K70B 1VTKA 1J99A 2R6CA 2NO6A 2O8EB 1YZLA 1HURA 1GSIA 4W7SA 1ZBDA 2DWOA 4MITA 5JCPA 2Z4RA 2GJ9A 3AV0B 3K09C 4L5BA 3NDPA 2BJWA 1KK0A 1GVNB 2PCJA 3B5JA 3UWKA 1II9A 1QG2A 1F6BA 1N6LA 4Z54A 4X8MA 4ON9A 1FNMA 4XIGS 2R6AA 1GITA 1E9FA 4XTRA 5LB2A 3TMKA 4ZDJA 4TQUS 1P62B 1ZUIA 4PSVA 5KSZA 1W1WA 3ADKA 5BQ5A 3M4YA 3MWYW 3L82B 1SVKA 3V00A 2R44A 4PZYA 4C0HA 2GJKA 4YMWA 1JI0A 4NHOA 4X8LA 4Q4AB 1Z0FA 3FKSD 3FYHA 2PL3A 1OH7A 2X8AA 4DLZA 4JBYA 4A2WA 4C7OA 1IJEA 2CJWB 4CEJA 1ZC4A 2J46A 1Z0AA 2ZU0C 3CR8A 4HI0E 2GILA 2FFHA 5EE9A 3B9PA 2HLDD 1E1RD 3QKRA 4S35A 1OT3A 4A0FA 2WIBA 4ASUD 3H1TA 1SXJE 3GFPA 4LJ9A 2Q3HA 4B3BA 1E9AA 2Q3FA 3U3JA 1X8LA 2D74A 4Q48A 3N2EA 2AXPA 4KAXA 3VX3A 1G21E 5AUQA 4YXWD 3EPJA 2ZIAA 1OV4A 3TW8B 4F91B 4HAZA 4WOPA 1YZTA 4XSHA 4DSUA 3LA6A 3O8CA 2P5SA 4RFSA 1G7RA 2YWGA 2V55B 3PUWA 4IDHA 5DYGA 3DVLA 3GLFA 3ND8A 5FPKA 2JLSA 3KQHA 2OAP1 3B82A 4BFXA 1P9NA 2DB3A 4LV6A 2RGDA 3RHFA 1GM5A 5F2EA 1RZ3A 2H5EA 2P65A 1SVWA 1W4BA 4ITRC 3REGA 1NLYA 4P4UA 2AFHE 1KK3A 4CW7A 3KQNA 2HJGA 2QMHA 3SNHA 2RGEA 2XX3A 3SJCA 1SHKA 1KI2A 3QJYA 3HR7A 2C04A 4D4MA 3U4QB 1HE8B 3ASYA 2XTNA 1KO4A 1NG1A 2ONKA 3T15A 2EWVA 2J0SA 1DEKA 2JLUA 4DCUA 1UM8A 2DR3A 1MRNA 4PC1A 2Z5FA 3HP1A 4RCYA 5FPSA 2CDNA 1E1QA 2ZRIA 4KI0A 3P4XA 4KODA 5H68A 4PR0A 4HDOB 1A1VA 4MDEA 2R6FA 4LI0A 1YHNA 2WMOB 2QN6A 2GCPA 1Q3TA 5TXGA 4M1OA 3CRMA 4Q7KA 1L8QA 1H8HA 4BASA 1VG1A 3WYFA 3I5YA 2ZRPA 3QPWA 4BUJA 1QG4A 4MRPA 5D3QA 3TE6A 4DDWA 1E2GA 4LV8B 1GRRA 2F43A 1CKEA 1R4AA 5CLLA 5A5GA 2YWFA 1WB9A 1NY6A 3U3RA 4P32A 5B57C 2GJAA 4DHEA 1F5NA 2JLVA 1WBBA 3ZH9B 1Q20A 1XRJA 1M1YE 4RKFA 1FX0B 1OLOA 2ZRLA 1SXJD 2RGNC 2VRWA 3EW9A 1AQYA 4PC6A 3W5JA 4DLTA 3B78A 1P72A 3W8RA 1KI3A 1NN1A 3A8TA 1LTQA 1P60A 3I8XA 4ZKEA 5JS8A 1JR3E 4KHZA 5FOVA 1BMFA 2GDJA 2XITA 2EU8A 2WWYA 3LW7A 3HWSA 3TQCA 2F55A 2J1LA 3QF4B 2OBMA 2GK7A 2O8EA 3PENA 4ZI3A 5DISB 1W48A 4EDHA 3AVYA 1N6OA 1U90A 1Z6YA 3FPAA 4DEXA 3ZLJA 1XEWY 2CHVA 4MUAA 5EXSA 4XSGA 4OK3A 4QXAA 4M22A 2OO7A 3THOA 3S1AA 3AVWA 3HU1A 1R7RA 4ZDKA 5J4VA 1T0HB 1E3MA 4HYYA 4KO8A 2GZDA 4PZZA 2OCBA 3CPHA 1DAFA 1OJLA 2A5JA 3AVPA 3B2EA 2OILA 3L0SA 3OZXA 1CF4A 1ZVQA 2IK8A 3PV0A 4LHZA 4AD8A 121PA 1G19A 1IN4A 4IOMA 3FMFA 2R6DA 3UG7A 1EFUA 4O0MA 2DFNA 2GCOA 4MGZR 1YZQA 4EJSC 3AKYA 4FXPA 2FFBA 1YZNA 4A36A 1S8FA 221PA 2DWQA 3CIOA 2FN4A 4PPNA 5HKKD 2WJIA 4ZO4A 4F4CA 2PMKA 5KDOA 4YDSA 3TR5A 1ZCAA 3NXSA 2FGJA 1RRCA 3SU8A 4PPFA 4QGGA 3GJ6A 2WKQA 3JZAA 1YRAA 3O8BA 1NJGA 3LH5A 1XU4A 1KO1A 2RB4A 2BDTA 4V02A 4PXAA 1Z0JA 2ATXA 3THYB 2Z0MA 1RE0A 1JJ7A 2CJWA 1KZ7B 5HZHA 4CEJB 1EFRD 1UBCA 4QRHA 4HB2A 4F38A 2ZETA 4M1KA 2YWEA 1KAOA 3QKSB 5JMTA 3B1ZA 4D81A 1XZQA 2ZI5A 3DMNA 1E2FA 4A6PA 8OHMA 3N70A 4OJQA 5FPTA 1HQYE 2NO9A 5C46F 2BV3A 2NGRA 1H65A 1Y63A 4JBXA 3UIEA 4PANA 2OFWA 2P6NA 1XJCA 4Q03A 3RC8A 5BN3A 3EG5A 1M6NA 2BKUA 4B43A 4E22A 1KY2A 1Y3AA 2FE4A 2I3BA 4L8GA 2GTPA 3PVSA 1QHGA 3BGWA 2JCSA 5AJVB 2A78A 2VF7A 3GJ4A 5SZIA 1A7JA 3OE7D 5TB5A 4IFEA 2VHCA 3BB3A 4N0DA 1GOTA 3GEEA 3T06B 2GCOB 1G17A 3W3ZB 2A30A 1Q3HA 5TY0A 2QBYA 1QHHB 4NYIQ 4BRWA 4EUNA 1Q1QA 2ODEA 1PUIA 2QMEA 4C0QC 4ESVA 2QM7A 3H86A 1KDTA 4D6PA 4RD3A 4OHZA 4PHHA 2F1RA 2BEKA 2WWHA 4AKEA 2JJ2D 4JIMA 4K8OA 1TF2A 3MFYA 2AKYA 1ZC3A 2NO0A 1XD2B 4HB0A 4DXAA 3D7MA 3VTKA 3CM0A 4AYTA 3W6NA 2XGJA 4QHTA 1EXMA 4IHQA 3KKOA 2GBLA 2NTYC 3WNDA 4D0LB 3P1JA 4BE7B 1MR3F 2V6IA 4QJ4A 3VNUA 5EZ5A 3VMFA 2PT5A 2B92A 1EFRA 2FU5C 4FINA 1D2NA 2WTUA 1I4LD 1AS0A 3ADBA 4MGKR 3I61A 3TNFA 1WE2A 2NIPA 4JL5A 4PFSA 3ZD7A 3SBEA 2YINC 4NCKA 5G40A 3EIHA 4XVUA 2ZR9A 1RYFA 2O8CB 1FP6A 2REBA 3E2IA 4PHFA 2UVQA 4HEJA 5CIQA 1E2LA 5JFGA 3W8NA 2XXAB 3K70D 2JASA 1HA3A 4MRVA 2I1QA 1W46A 3I32A 1U0JA 1P73A 4WIAA 2GCNA 2IUUA 2HF9A 2OM2A 1GZSA 1UPTA 1W49A 4BFWA 5GJBA 3H4MA 1MO3A 2QGNA 2F1HA 1B23P 3GEHA 2VA8A 4UNSA 3TUZC 3SQWA 1QDEA 4U02A 3SFZA 3ZQ6A 2IYLD 1X8JA 5CDFA 3T1QA 1IHUA 1S9HA 2C77A 3SYLA 5C18A 4NKRA 2ZVPX 3BB4A 4Q00A 3FHCB 2IHBA 2ODWA 4LYHA 2H18A 2QI9C 1QBKC 1XMIA 3K1JA 3KFXA 2WZQA 3IEUA 2QE7A 1OPXA 1IM2A 4FMDB 1P75A 3ZS9A 1G3UA 2A5YB 1U9IC 3VHLB 3ADDA 4DWJA 4CEIA 4L9WA 4LY6A 2IF0A 2CE7A 3WP1B 2ZS7A 4G0NA 5ANRB 5EP4A 3ZZUA 1IONA 4M1TA 3EC1A 4HAVA 3T1TA 2IYZA 1ZUNB 1W2GA 3QF7A 3RRZA 1R5OA 3Q9LA 4HLUC 1Z0IA 3E5HA 2R2AA 2ATVA 4LZZA 1ESMA 1XP8A 3FMOB 2ZRJA 521PA 3TSZA 1S1CA 1TUIA 1KY3A 1M8PA 3FOZA 1N0UA 1JEEA 4WA7A 4MKFA 5AR1A 3V4FA 4MKGA 2ZUBA 3SR0A 4WAUA 3GLIE 4U7DA 2OBNA 1YQTA 2IC5A 4FCVA 4GP7A 3SHFA 4A82A 2AHOA 4I1VA 3QEJA 5FFMA 4DZZA 4CEHA 3GFTA 5FTNA 5K8IA 4FN5A 1XD9A 3N5CA 1RYHA 1Z0KA 4DCVA 2O8CA 1W0JA 1PUJA 1D6JA 3EAQA 1EX6A 2XJ9A 2D3WA 3QNUA 2IYRA 4Z1MA 3GJ8A 2FJUA 1Q21A 5FUXA 1JPJA 5FI1B 2XXAA 3VHXA 2R9VA 2BMFA 4LSGA 5H8WA 2IA5A 4PPQA 3NIBA 1VG0B 3AP2A 3CH5A 4LPSA 4UXHA 4WZAE 4DKXA 5FTLA 2W0SA 3U6KA 1NNEA 3U3MA 4LK2A 4M9SA 4Q21A 3CZPA 4LOAA 4UNNA 3Q72A 5CM8B 3MJRA 5JJIA 3PQCA 2GAOA 1WDTA 1KI7A 4JBWA 2GESA 2IT1A 1LV7A 3KUDA 3U4QA 1II8B 2JIZD 3IIKA 1QHIA 3LWNA 3C41J 1NIJA 4Q66C 2IEYA 1N25A 1OW3B 2QPAA 4C0BA 2IS6A 3RYTC 4OHVA 3ZIAA 3UMFA 1NVVQ 5IT5A 2ERYA 4Q4HB 5DI3A 2D7DA 1Z2AA 3TW4A 1N6HA 2W6IA 3EIQA 2WJHA 3RSOA 5HR5A 3GLFB 3JZMA 5BN5A 2QRNA 3TKLA 4AYXA 4TL6A 3CUEF 5ELXA 2XZOA 2XNDD 3CKLA 2W83A 2J0QA 4US2R 2QE7D 2ZE6A 1S3GA 4Q4HA 2OFXA 2B21A 5DI3B 5LD2B 2FFQA 1G8FA 1KNQA 3R8FA 3NBYC 1E1QD 3CRW1 4C0SA 3L2OB 4LJ8A 1CJMA 1YR7A 2BVNA 1GNPA 4DDUA 5KTYA 2VHTA 4I99A 3IGFA 4XVQA 1KDOA 2BMEA 3UATA 3K0EA 1GAJA 1AKYA 3CF0A 4TZ0A 2FSGA 2BKEA 3QEOA 2H1LA 1IXZA 1ZIPA 3U3OA 1N2CE 2ZS8A 4URYR 2ZYUX 4QOSA 3CBQA 3FMIA 1KJZA 1OSNA 1OXSC 2W2XA 1S0UA 1ZYUA 5GVSA 3QKSA 2ZM5A 2LKDA 4GDFA 2JJ8A 3SI7A 2GA8A 3X1XA 1SKYB 4LJYA 2O0JA 4BPBA 1NN0A 4DCSA 1KI1A 3NEJA 5KNBA 5EZ6B 1U99A 2ECKA 4YXWA 1NKTA 2HT6A 2V1XA 3MG9A 4TL9A 4TT3D 3VR2A 2C95A 4B71A 5AUOB 2QL6A 2GK6A 4II7A 5G53C 4Q4JB 3THXB 3I5XA 1MABA 5FL3A 1J70A 3EZ7A 1W4AA 3LRPA 3H84A 4OJKA 2VF8A 3TR0A 2VP6A 4C0AC 3LNCA 4I1SA 2HLDA 5KNCA 3ZZTA 1EFHA 1KI8A 3I92A 3GLGA 3GLIA 1DAGA 1JXOA 4N3NA 4ZIRB 3CZQA 2OESA 3W9YA 5JLJA 2JDID 2ZSEA 4HAYA 1W4CA 1UBFA 2BIFA 1P2UA 3GJXC 1Z8FA 3MLEA 3TGPA 1S96A 3B7GA 2IL1A 4C9BA 2ZXUA 3FKQA 1HH4A 1OXUA 2EQBA 3MUFA 4LGMA 4C30A 1N6PA 2V4ZA 5FL7A 1FL9A 2XZPA 1U0HC 4MKIA 2VO1A 1KSFX 4NMMA 2YOGA 3LD9A 3QENA 1GILA 5EP2A 1XNJA 4R2IA 1JNYA 1UBGA 1VIAA 4LBWA 3KQUA 2BBSA 3B85A 1TPZA 4NH0A 5F3WB 4EJSB 2JAQA 4GMDA 3BFKA 2EFCB 5IDVA 3X1DA 2P6RA 4C2TA 2ANBA 4IFBA 4GNKA 4NTZA 4BFVA 3IPXA 5JSZB 4GZLA 3PUYA 3AKDA 4IXNA 1OHHA 1ZNZA 3TLXA 3QXCA 2AK2A 2IF2A 3FGNA 1GL7A 1F3OA 1Z3IX 3C15C 3GMTA 1R5NA 4DLXA 2AK3A 4B6EA 2V8OA 3K0AA 5GJVC 1IJFA 5DGXA 4DIEA 5DNYB 4B3XA 3THWA 4POAA 1ESNA 2IUTA 2QP4A 4TTRA 4JLDA 3AP1A 5JI2E 1CR2A 3BERA 1K5DA 2G0TA 1OFHA 5H1YA 1SGWA 1VCMA 3P32A 2IS4A 4URUR 2Z83A 3NC1C 1D2MA 2ZR7A 4QGFA 3AM1A 4URVR 2CCJA 2HJVA 4AI6A 4TYWA 2BM1A 1AZSC 2P5TB 4US0R 1U98A 1KK1A 1XXHE 2C96A 3WNBA 2WV9A 4GP6A 4G5OA 2IWHA 4NPHA 1LS6A 1OIWA 4XD7D 3VKWA 4JLAA 1FUKA 1E32A 4PC2A 4PHGA 2V6JA 2G88A 2VSFA 2FEMA 3KQKA 4CGZA 4XH9B 5JHHB 2WKRA 1LF0A 2WJGA 4GL2A 2IYTA 1Z08A 3D6TB 4A15A 3KB1A 3U60B 3Q8XB 2ONJA 5DSZA 4KBGA 4DLSA 1E9CA 4TMXA 5EE5B 2IXEA 2Z43A 1KI4A 1Z47A 1Z07A 4DJTA 4B73A 1XPRA 2WBLC 1SKYE 2R6GA 4OQLA 5J4YA 3W3AA 4D0GA 2Q3MA 1Q1EA 4DVGA 1W44A 1ZNYA 2VP9A 3B13B 4XJXA 1A2BA 1ZM3A 4QBFA 4TLEA 4I1UA 2QSZA 4OI0A 2DY1A 2C98A 4FI3C 3TH5A 2NOAA 3ECCA 2WIAA 2IXGA 2RGXA 1BKDR 1KJYA 1XD8A 4NCIA 1A5TA 1XMJA 1E94E 2RGCA 1DARA 1Z6TA 5DH9A 4HAXA 2QAGC 1U8YA 3Q5EA 5HE8A 4UNRA 2WWXA 2O8FB 1M7BA 2D62A 1IOZA 4Q4AA 4URXR 1VYUA 2BMJA 2CVFA 2QZ4A 4G5RA 1FNNA 3VQTA 3LBIA 1SXJA 1X6VA 3Q85A 1CJVC 1CRQA 4NBSA 2PEZA 1YU9A 2ODBA 2IWRA 1TU3A 4IOKA 5IRCD 4ACBA 3L8ZA 1AK2A 1SVOA 1Z6GA 2VSXA 2J7PA 3DHWC 1IXSB 5D3MB 3DDCA 4C4PA 2WWWA 1CR1A 1YRBA 4EAQA 4P31A 3CO5A 1ONBA 1TEXA 2IW3A 2WMNB 2BBOA 2CLDX 3HPRA 1CLUA 4KITB 1G8GA 3WY9A 2IUSA 4ILEA 2H92A 1N0WA 1I2DA 3AKEA 3GJ5A 1JECA 2AN9A 3RAPR 3I4LA 2CL0X 4OKSA 2RHDA 1R0YA 4DT1B 1MT0A 4G1UC 4PTLA 1Z29A 2CK3A 3CX8A 5C4MA 2QROA 3VR3A 5JHGB 2AWOA 4QBGB 2JDIA 3G5UA 3X1ZA 1OIXA 5J4LA 3UMRA 1E2JA 1TF7A 4GOXA 1W47A 3CWQA 3KKNA 1IXRC 2QEQA 2AD5A 4DLUA 4MYUA 4DUGA 1XDBA 4OQNA 1XPUA 5GJWC 3VR4A 5BWMA 2ZRCA 2GZHA 3IUYA 1ZD8A 2Z6VA 3NBXX 3O47A 3GEIA 3RS7A 2VYFA 4C0KA 2VTKA 1KGDA 1G7CA 1QZXA 4ZCIA 4UQOA 4V03A 1K8RA 2ZRGA 3QKTA 1EESA 5JZVA 2OAQ1 1P4SA 4WVFA 4E09A 4IDNA 3RWMB 4OL0A 1AS2A 4B48A 4OBEA 5B30A 1RIFA 5G3YA 4TQAA 1HT2E 1DG1G 1RJ9B 1U81A 4A92A 1GP2A 2AD1A 4GBMA 1NBME 1LB1B 4IOLA 4RY2A 4E5UA 1H8EA 2YOFA 1WBDA 1FOEB 2FPLA 1DBSA 4HB3A 2GF9A 2PEYA 4IEEA 1Z6XA 2V7QD 4QHSA 1R0XA 1KO8A 3O8DA 3F5FA 4PZLA 1KI6B 5CIWA 3F8TA 1JAHA 4JKIA 1T4GA 2K5UA 4B6FA 3SE0A 3MMPA 1QRAA 1XEWX 4DLRA 1N6IA 3O8RA 4HB4A 3K0SA 3B60A 2JLYA 2HCJB 3B8HA 3EXAA 2YV5A 2HDNB 4Q01A 4P4SA 4Q5IA 2OG2A 2ZYTX 1K6MA 1ELOA 4RZUA 4V0MA 3AVTA 4TT3A 3VR6A 1E2HA 5G41A 3AKCA 1DPFA 1ZU5A 4E03A 3U44A 1VPLA 3IO5A 3DPUA 4EFLA 1ANKA 4W5WA 1VIYA 2OEPA 1GWNA 2WM9B 2B6HA 5EXTA 3BH6A 3I8SA 4V0ME 1ZNWA 4ZCMA 2P67A 4F7WA 2D06A 1TU4A 1NMYA 2CLSA 2MSDB 4IOJA 5HKKA 1M7HA 3M1IA 2QAGA 4D82A 2NG1A 4PSAA 3NKVA 2RHMA 4EPTA 3X2SA 3UKDA 2E87A 1JALA 3ZD6A 2QPOA 2FH5B 4KFRA 1EX7A 4NONA 5M04A 1T3SA 5L3QB 4KXFB 4F4JA 2ERXA 3B1XA 3K9HA 4OI2A 1ZAKA 4FD2A 1UEJA 5E4FA 1KMQA 5FBRB 5C4GB 2HYDA 4EQ6B 2F9MA 2JLQA 3IILA 4PO9A 4HUTA 3IBYA 4QJ3A 1EGAA 2PCLA 3CF2A 2KE5A 3EZ9A 2ZRBA 2Q9CA 3OESA 4Q7LA 1EFTA 1G5PA 1XXHA 3ADCA 1GUAA 3GQBA 4F92B 1KDPA 1CJKC 4LC1A 1G1MA 3GJ3A 1T5IA 3P20A 5BW8A 3IIJA 3M6AA 3BRWD 3ETLA 5A4JA 2CBZA 5C1BA 1YE8A 4NYIR 2F1IA 5FUVA 2XNDA 1NP6A 3K9NA 2Y8EA 4BGDA 4GPTA 4G5GA 5KO2A 5FBWB 2FZ4A 3RDPA 1KOFA 2CLCX 4BZXA 1GKUB 1EWQA 4JMPA 2ZE5A 4FMCF 4GFDA 4B3FX 2XOKA 4N0EA 2AX4A 2JLZA 2C5LA 1VHLA 3CPEA 1QHXA 1KAGA 1OXTA 4IXMA 4RZ3A 3N2IA 3CPJB 4DSTA 1ZRHA 2QMUA 5J4HA 4B76A 3KXIA 4NYJR 2JIZA 2D7CA 3THWB 4I81A 1FW6A 4ZKDA 2UZ3A 2CNWA 2G1KA 4AG6A 3PUXA 3QPUA 1XTJA 1E2NA 1PJRA 3AVQA 2PH1A 1C1YA 1BS1A 4FIDA 4TL8A 1G3QA 5FI0B 1V5WA 1U2RA 2C9CA 5KYKA 1RPZA 1UKZA 3EPKA 4LBVA 1KMHA 5LBIA 3NVAA 1JPNA 2A7QA 1GDDA 4LRWA 3GLFE 2XNSA 4HSEA 4M2LA 1E79A 1C4OA 3K9LA 5SZJA 3IQXA 3MJHA 2XB2A 2W0MA 1Z63A 4Z51A 5EXPA 1G18A 2ZRKA 4M4SA 3ZVNA 4WBSA 1Q44A 1DADA 1FQJA 4J0QA 3GJ0A 2H17A 2W2VA 1SVLA 4D0NA 4RSGA 3U61B 4QFMA 1XPOA 3IEVA 4FMCB 1N6KA 4JLPA 4U5XA 1OYYA 3EWAA 3QXJA 4LHXA 5HZKA 2O8BB 3QSYA 4NYMQ 4OK6A 1AKEA 4OHXA 2QM8A 4JLOA 1OH6A 4QL3A 4DEYA 2ZI6A 1D5CA 3AGPA 4UXIA 1P2VA 2Q6TA 4HAUA 3RRMA 2XOKD 4US1R 1R0WA 4PQRA 3B1WA 1A4RA 1IN7A 5EP3A 4CIDA 2NMVA 2OZEA 4LV5B 3PG5A 1NVXQ 2FFAA 3K0FA 3A6PC 1XEXA 3IPYA 2C03A 4L15A 2G0NA 3NWJA 2YHSA 1FQKA 4EFNA 4DRZA 1TL7C 4CF7A 2FDCA 1W7AA 3ZVLA 4AURA 5FOUA 5FBLB 1XJ0A 4I4LA 4X8HA 2W2TA 4DB4A 3VKHA 3K09A 3QXHA 2J9RA 2MSEB 2XZLA 4QBHA 3R9XA 3AUXA 2YVUA 2JJ1D 2EFGA 5D3MA 2QAJA 5CDFE 3AF2A 1GFIA 5AUPB 2GVZC 1G8PA 1ETUA 2VQSA 2PLFA 4EKDA 2IYVA 4V0NA 3EA5A 2J5XA 4URZR 3X1YA 2WPDA 4B3GA 1X3SA 1V43A 2UKDA 4O25A 3PITA 1OHHD 2N46A 4RZXA 3Q7PA 2NO7A 4XTCS 2C2HA 2H7VA 2JJ2A 3AEZA 3QQ5A 5KUTA 4IW3B 1VDZA 3A1SA 2PBRA 3PJRA 3DL0A 2Q9AA 3LXXA 3QY0A 1P6XA 2JLWA 2GXAA 3A4MA 5EE3A 4RCZA 3R8CA 1ZMXA 1S4QA 5FL7D 3REFA 1SXJC 3OE7A 3RABA 2J41A 4S2EA 1GKIA 2ZRHA 3T1OA 3T61A 3EA0A 4A8JB 3B9QA 2A2ZA 2HV8A 2RKOA 2FNAA 1DS6A 3KB2A 2GF0A 1XJQA 3ZVMA 3T35A 2IBMA 4LJ6A 3I62A 1P5ZB 2VPPA 3T5DA 2JLRA 1NKSA 1VYVA 2BBWA 2W6JD 1TMKA 3B1YA 4Y0VA 3RS0A 3TAUA 5B2ZA 5CB8A 2PJZA 2R65A 1UKVY 2YZ2A 1W0KA 1UFQA 4LHYA 2X2EA 4RKEA 2YC2C 4GMXA 3C14C 2QG6A 5FOSA 1E2IA 3A37A 1OIVA 4CT5A 4D26A 2QP9X 1DAEA 1TX4B 2VHUA 3C16C 2DHRA 1E6CA 1AA9A 1E4YA 3DM5A 2XTZA 3QBVA 5JJLA 4FMBB 2WJVA 5SZKB 2IYQA 3KL4A 3IDQA 1E2PA 3OEEA 2QP3A 4D80A 3ICEA 1W5SA 4TZ6A 1TEVA 2G6BA 3E70C 3AF0A 4L4UA 1PLLA 3DMDA 2VHQA 1M2OB 1BO6A 2DYKA 4KVGA 5JI3E 1QVRA 5TVKA 1NF3A 1HT1E 2EYQA 2NZ8A 4JVSB 2H57A 3AH8A 3K9GA 3ASZA 2FGKA 5KU1A 5E3HA 2QT1A 4RD6A 5BXQC 1VCOA 1NMZA 3FE2A 3K0AB 2X2FA 1GNQA 2SHKA 2OBLA 1X8KA 2Q0HA 1Q1BA 3E1SA 3BXZA 3KTAB 1Q57A 5TV2A 1TAGA 2FSHA 3OFND 4I1OA 1JR3D 5GADl 3RC3A 3DO6A 1L4YA 2CCKA 4ABYA 2EYUA 2V54A 4AY2A 4ZDIA 3U7GA 4AC9A 4GT1A 3WBJA 4EJSA 4KCGA 1KHTA 2B7CA 4QJ5A 3KKQA 1N5IA 4JJKA 2FWRA 2ZROA 1PV4A 4M8NE 1XEXB 4H1UA 4Q7MB 3ZVRA 1XTIA 2ZJZA 3K0CC 4LCBA 2YWHA 4MYHA 4A1FA 3Q3JB 3FB4A 1F2UA 4V0LA 1UEIA 4EFMA 5FBVB 4RD2A 4IDOA 4M9QA 1ZP6A 1JB1A 3H2YA 3JVUA 3MRSA 1NSFA 2BCGY 5JWRA 1L7VC 4HZUA 3EC2A 2J7PD 2C9YA 4NZYA 3AVXA 4TMKA 2AWNA 4BLSA 2GXQA 5TDHA 1ZM9A 2O8DB 3OAAD 4LYJA 4WXRA 2QT0A 1D9XA 3TK1A 2ZI9A 4R7ZA 1DELA 2ZR0A 1Z2CA 1M7GA 2FEOA 2JA1A 2QA5A 1Q22A 3GLHE 5EUMA 5FOWA 2JATA 3CRQA 4JZKA 1G8HA 2R62A 2D2FA 2XB4A 4C3ZA 4TYYA 3KKPA 5L3VA 4C2UA 1SZPA 2P0EA 1MABB 2XJ4A 4LBYA 3THXA 2REXB 4GOJA 2ZRAA 2OV2A 4TSFD 1JJVA 1JEDA 2REOA 5SZHB 5EE1A 3DOFA 2QQ0A 3BB1A 2ZU6A 1N6RA 2VL7A 2KBFA 5JRJA 1ZD1A 1VG9B 4OQXA 1E9BA 3D8BA 4TSFA 1NVVR 1B0UA 1US8B 2RGNA 1G291 4LX0A 1W0JD 1CULC 3AVVA 4G3XA 3LXRA 4ACAA 3KJGA 2CL6X 2VIIA 4HDCA 3W6OA 3G0HA 4EPXA 1F60A 3KKMA 1A2KC 1QF9A 4M9ZA 4NCHA 1FTSA 4O3MA 1AGRA 3MCAA 4IEIA 4HLCA 4Q9HA 3TJZA 2NPFA 2WSSD 2AL7A 3IIMA 2ZUCA 2ZSFA 3A1TA 3OAAA 2MMCA 3WHLA 3K0FB 1KKLA 1BYUA 2ZRNA 5JJKA 1FUUA 5GVRA 5L3RA 2F6RA 3ICQB 4A4DA 1XCPA 3SHWA 4DC9A 2H8KA 1RFLA 3T12A 5IF9A 1J8MF 4PQYA 1PLKA 1NVWQ 2ASEA 2W00A 2GBLC 3SS8A 2BM0A 1NN5A 2KJQA 3GJ7A 1UAAA 4UJ3A 5CYOA 3CX7A 2EWWA 4PPGA 1JBKA 5HTKA 4TLDA 2BCJQ 3X1WA 2WWIA 2LCFA 4ARZB 2ZJOA 1MH1A 3L0IB 5TARA 1DAIA 3IQWA 1P7CA 4TMTA 1JQLB 2WOOA 5BYJA 1LVGA 4TLBA 5P21A 3FHTA 1E1RA 5E95A 6Q21A 3FTQA 4IVPA 2HXSA 1WF3A 4L9SA 1RKBA 3PUVA 1RRPA 4AYWA 4RD0A 4AG5A 3MD0A 1W0KD 1HE1C 1Z5ZA 1D2EA 2OHFA 3ZQJA 3C7KA 4KLNA 4R9UC 4KFSA 4ERNA 2W6JA 1T5LA 5DI9A 5FBQB 2KI5A 1XFAA 4OHYA 3BS4A 4TWZA 5CB6A 3WRYC 2G9NA 3MWLA 3AP3A 5A0FA 1E2DA 2A5FA 2ZJ2A 2IYSA 2IX3A 3SJBA 4Z8XA 3R20A 1OH8A 3PCRB 4BLRA 4Z8YA 1G3RA 5JRZA 2IXFA 1AIPA 3BH7A 4FMDF 2ZYWX 1W2HA 3SN6A 1UKYA 1XX6A 2FA9A 3HU2A 4Q1BA 1E4VA 2R8RA 4TN1A 5L8VA 2I4IA 2FZLA 1E2QA 2ZPTX 2J59A 4BWYA 4YMTA 1GTVA 1MKYA 4GRAA 3BH0A 4IDPA 3NTUA 3RS2A 2BOVA 1QHSA 1UDXA 3RSLA 3UANA 3LX8A 3NHAA 3IBGA 4KJZA 1L4UA 4MA4A 3WYAA 1TNDA 4OQMA 5B58C 1T8TA 2IEZA 2OXCA 1HV8A 3Q5DA 1TQ4A 2YOHA 1QHYA 2ZTSA 4ESHA 4LC0A 1UF9A 2ZJBA 4QNMA 4BRUA 4GSYA 4A8JC 4XWKA 2OXRA 1KI9A 2ZJ5A 1ZW6A 4OHWA 5E7IA 2VH5R 2IS1A 4UXJA 1E2MA 2WJJA 2FF7A 1X1RA 5EXXA 2CMKA 3BOSA 3G82C 3ONWA 4QGAA 4P33A 4LJ4A 1FFHA 4BQSA 4JS0A 3LLMA 1TQ6A 4B75A 3DM9B 4LYAA 2EFDB 1ZM2A 3OIYA 4JSTA 4MYCA 2ODNA 5FTMA 1S9DA 2AR7A 3DZ8A 2A3RA 2QY9A 5KSOA 4BECA 3HPQA 2ZVQX 3BD9A 1YJ5A 2D2EA 5FOXA 3MGCA 1AQUA 2OCAA 3FWYA 3MWJA 3ZJYA 421PA 1OKKD 4MRRA 1F2TA 1I4DD 1W36C 4C0LA 3EPHA 2QAGB 4JLJA 2O0KA 3F0TA 3B1VA 4PHTA 4Q1AA 2G3YA 5F98A 3QOFA 1N5LA 3OIUA 1G9XA 3W6PA 3KXLA 3QI2A 1VG8A 4TYNA 3EPLA 2VP2A 3HYRA 1M74A 3GP8A 1II0A 2WOJA 4HAWA 1K5GA 5CJ2A 3PUZA 4QC2A 1YKSA 1GG2A 4B3DA 4CYMA 1UKEA 1G7SA 4JYCA 5FOTA 1D9ZA 5AUNB 5FPYA 3A4LA 3K0CA 2PZGA 1OH5A 1NRJB 3R7WB 2IYYA 4GI7A 1G41A 2F9LA 5CK5A 3A1UA 1KZGB 4UJ5A 5FPHA 2HXYA 2NO1A 1E79D 3BBPA 4CVNA 4BFZA 2F1JA 2QTHA 5AJWA 3TSOA 2F3TA 3GD7A 4A0GA 1FMJA 2QORA 3KJIA 4LJ5A 3SYNA 1WXQA 2GKSA 4B74A 1T3HA 3WP0A 4IRUB 1L2TA 2JGNA 4JT4A 4K46A 5DYIA 1XMSA 3SZRA 2ORIA 2GAAA 2ZITA 3LO5A 1DE0A 3U7EB 2ZSDA 4PO1A 2GJ8A 3L0OA 2B7BA 3PXGA 4B34A 3PEUA 1CR0A 4CZ2A 2C8VA 2N1BA 1E99A 4YLGA 1JR6A 4ZCLA 3I73A 3OF5A 4IDQA 2O8FA 1CBUA 4YC7A 1BOFA 2WSMA 3V9PA 4ZDWA 3AGQA 5LB4A 3DOEA 4V0KA 4XD7A 5F9FA 3KXKA 2FOLA 1N5JA 1G6OA 1WMSA 1P9RA 1F2TB 1XBTA 3NC0C 4HZUB 2OLJA 2N42A 2NQ2C 3A58B 2ZJYA 4KLZA 4OI1A 5JS7A 3SJZA 4KV9A 4NL4H 4E07A 5HCIA 1F2UB 1R0ZA 1E9DA 1IBRA 1NLZA 2HF8A 4LUCA 4QM6A 2QUZA 1NLFA 4TYQA 1R10A 3AQ4A 3VNVA 4Z1MD 2ZJAA 5BN4A 3WXMA 2JEOA 4Q1CA 5EP1A 2GNOA 2BJVA 3OIVA 5DN6A 4WZ6A 2ZANA 1WA5A 3KUCA 2LKCA 4TYPA 5G3ZA 1CJUC 4BLTA 2AFIE 2CXXA 4KSBA 1VMAA 3EWSA 3TUIC 1WRBA 1Z0DA 1SKQA 4PAQA 1P2SA 2A5GA 4B33A 2BC9A 5HE9A 4DT1A 4DDTA 4BLOA 2HUPA 4BEBA 4NYMR 1KMHB 3VFDA 2FMXA 3ZZ0A 4K81B 1T3LA 3TRFA 2YKGA 2ZSAA 5HPYB 3BAFA 4JVMA 3V4RA 1AGPA 1NJFA 1N6NA 1EK0A 1Z6AA 2FPMA 5LDDC 5EE0A 1ZM4A 3VX4A 3UPUA 3TBKA 3AVOA 1TTTA 5FUWA 3UMSA 1XTQA 4LPKA 4P4SB 4JL8A 3T5GA 1W4RA 1E9EA 2GHIA 2QSYA 5DIFA 3TSWA 1HY3A 2DFKB 2J7KA 4LHWA 3W5IA 3IHWA 1CIPA 2C78A 4Q19A 4B3CA 4NU0A 3J81k 1WCV1 2V3CC 3LY5A 2ZRDA 4Q1EA 4XWAA 1RVDA 2DFTA 1ZUHA 4PC7A 3JVVA 4DSOA 2DBYA 1Z22A 1DAKA 3U2QA 3W90A 3T34A 2GJSA 2QU8A 3EIEA 3LX5A 4FCTA 4R98A 4DIDA 2ORWA 1COWA 5AJYA 3OFNA 2OUKA 2Q9BA 3TQFA 1IAQA 5L3SB 1EG7A 1PZNA 4D25A 4EIWA 3BJIC 4JLBA 1CP2A 3AF1A 2RH5A 4ARZA 2P6UA 2QRZA 2PMDA 4IVQA 2E9SA 4DBLC 3HDTA 5KSYA 2OCPA 1CS4C 1JXMA 3U3KA 4MH0R 2WWFA 4JYBA 4A8JA 2CCGA 3AUYA 3C5HA 2E1RA 1OFIA 1UDWA 4M9XA 4JJZA 1S3SA 1CXZA 4RZ2A 4OK5A 5DO9A 5FTKA 3S1AB 3RNLA 2WHXA 4D4KA 4MDFA 3OEHD 2RGAA 1E69A 2HCBA 2PX0A 1D8TA 1LW7A 3CNNA 3HR8A 3KJHA 3QVUA 3QVVA 4M53A 1RRFA 4M1MA 3WYGA 2OLKA 2RMKA 4DCTA 4M21A 1LFDB 4Q47A 3AB3A 4G5QA 1S2MA 2BWJA 2CL7X 4YDHB 4DUGD 1KNXA 1E2EA 3PR1A 4A0HA 2ZS9A 3CW2A 4R71A 1MO5A 2XAUA 1E0KA 3FHOA 1GRQA 2ZQ5A 3FDIA 2ZREA 4O2LA 2V7QA 2JJ1A 1KTVA 2G83A 1VHTA 4B2PA 3K53A 3TAHA 4YMUA 2ORVA 2CK3D 1Q1ZA 1QHNA 1FX0A 1GRNA 5E7JA 5FTJA 4HUQA 2MMGA 4B47A 1W5TA 1ZCBA 3ZS8A 4NCNA 4M1SA 5UKDA 1XF9A 2FG5A 3I1FA 3U7FB 4B44A 1AN0A 4CT4B 4XWOA 3P27A 4M1YA 4TMVA 1G8YA 1W36B 1A82A 3R7WA 4ZI2A 3UK6A 1SXJB 5J47A 4LDJA 1KSHA 4CRWB 4D2IA 1DG3A 4OQFA 1G4UR 1TQ2A 3SOPA 4EPWA 3EZ2A 4QNRA 2ZI4A 2KB0A 4RFVA 1GNRA 2C99A 2FV8A 3MSXA 1J2JA 1Q0UA 3U7HB 3H0KA 4Q9KA 1XZPA 4AK9A 4AIIA 2PJRA 4NE2A 4H1VA 1RC8A 1PVOA 1YZGA 1DOAA 4RVCA 1MV5A 1YZUA 1T0JB 3FFAA 3CR7A 3EARA 3RRYA 3EZFA 2QTVB 3FFBA 4JT2A 4FWIB 1COWD 1P61B 1SULA 5CM9C 3GLGE 2O8DA 1FZQA 3SJAA 2BBTA 1E2KA 3CRRA 3PEVA 1G5TA 2DWPA 2KWIA 3CLVA 3HU3A 4HLUA 4OYHA 4PO8A 3UG6A 1XD2A 2ZAOA 4EQ6A 1E98A 1KIMA 3NHBA 1QHHA 2IS2A 2GXSA 2BEJA 5K8TA 2F3RA 3SC3A 721PA 2OFOA 5K8LA 1RW4A 2CHGA 5L3SA 3SEAA 3VR5A 2EFHB 4KFTA 5AJXA 1DAMA 3NG1A 1TADA 3DEFA 2VP5A 3R9IA 1ZIOA 1LF5A 2W6ID 4AKHA 2QGZA 1KO7A 4Q1FA 2J0VA 3DZDA 3KTAA 2J45A 1UADA 3AVUA 1E0SA 4W5JA 4N1AA 3UWOA 5CJPA 5IK2D 4CDGA 4LYFA 3BWDD 2VEDA 1TQDA 3BORA 3VU9B 4TLCA 4WZBE 3VR1A 2WSSA 1IN6A 2GETA 4U00A 1LNZA 4M0LA 4Q7JB 3L0PA 3LV8A 2Z4SA 4Q18A 3P26A 1Q12A 2GEDA 1LY1A 2TMKA 1X1SA 4JVNA 3BFXA 1KSJA 4QHYA 1TUEA 4DDVA 3CRVA 3THYA 4KYUA 3VKGA 3BIFA 3SBDA 1NIPA 1GKYA 4YQFA 4WW0A 3RLFA 4QG7A 1OB2A 5AWFC 2XEXA 1YZKA 2FSIA 1Z06A 4IKEA 3VU9A 3U6BA 1SQ5A 5LD2C 3NEYA 3D3QA 1CRPA 3QPVA 1KSGA 3CNOA 3D31A 4URWR 1E0AA 1N3BA 3HJNA 4B35A 4P4TA 2CE2X 4BEJA 4WXPA 1BIFA 1JR3A 3CB4A 5LPNA 1KJWA 4AKGA 4JL6A 3IHLA 4Q9IA 1R8SA 2QQEA 1IQPA 2FSFA 1HYQA 2QPTA 3BC1A 1J90A 5B64A 3NDBB 2IYWA 4TQ9A 3W34A 1NBMA 2WAYA 4TL7A 5IK2A 4B2LA 1C9KA 3CONA 3K8YA 1YR6A 5FH9A 5L3QA 2KBEA 1JAIA 5KNDA 1XCMA 2X77A 3L43A 4Q4LA 4QM7A 1XB2A 3GCGA 1XMVA 2X1VA 1JQJC 2GEVA 2CEAA 1HTWA 4H9GA 1E9RA 4BZPA 3LVQE 3IKJA 4F93B 4KFUA 1UJ2A 1EFCA 3L8YA 1SHZA 4A6XA 2IYXA 1G7TA 2V9PA 4G5SA 2MSCB 1O87A 3KJEA 4Q1DA 5J4KA 1NG9A 1H8HD 1II8A 3AF3A 2H16A 4JLNA 3U44B 2NZJA 2WAXA 3BE4A 2AKAB 4HLQB 1ZM7A 1VECA 3I72A 5FUYA 1VCIA 4XOIA 1CEEA 4UKDA 4TTPA 3GLGB 2CVHA 5AK0A 1XCGB 3QIAA 4GOKA 4Y0AA 1U8ZA 1ZJ6A 2EFEB 4IJMA 3A1VA 4JLMA 4RD1A 5EQTA 3RRNA 2GRJA 2RGGA 4M1WA 2QTFA 4PAMA 4Q4JA 2EW1A 5CITA 5TMPA 1AM4D 2I1VB 3QBTA 1U0LA 1KYIA 1H8ED 5HCNA 1N0VC 2DFLA 3WMGA 2ANCA 3EASA 3QXXA 3TIFA 2DCUA 1MOZA 1IY2A 4OI4A 2WWGA 3SQXA 1GL6A 1T91A 1E9SA 2QENA 4TLAA 2WVJA 2VHJA 4Q9JA 2UZIR 5KSPA 4MYTA 4AWXA 4DLYA 1OKKA 3T1VA 1NVUQ 1HEIA 4QGHA 1ZINA 3QKUA 4BFTA 3R9WA 3ND9A 4HUQB 5JSZA 3QG1A 4EPRA 1HQCA 3EZ6A 1J7KA 2F43B 1IN5A 1KDRA 1GIAA 3NH9A 3OEED 2D4HA 3SFVA 4Q9LA 1IY0A 1DO0A 2P2LA 1OYWA 2ZUDA 4JLKA 4YMVA 1XTSA 1YR8A 3ZGXA 2PT7A 1G20E 2J87A 2ZRFA 3IO3A 4PC3A 2GWHA 2ZJ8A 4KYIB 5GJCA 1DO2A 2WICA 2L0XA 4ASUA 4TTQA 2WPDD 2G1JA 2O0HA 3RWOA 1P3JA 2GVDC 1IN8A 4R2HA 5JWOA 1IY1A 3U5ZB 5FR1A 2J0UA 5JEEA 1LS1A 3TVDA 1Z83A 4DB2A 3CWZA 3BFVA 1YVDA 2WJYA 1KO5A 2DPXA 3FKSA 4MUBA 1G64A 4FCWA 2HT1A 5AJZA 4MGIR 2QNRA 2ZYVX 4AKIA 1E96A 4ZPXA 1MRSA 2FPKA 1AJEA 4KBFA 1P2TA 1FTNA 3LFUA 4DSNA 3LQQA 2VP4A 4RJLA 1OB5A 4NYJQ 3KDSE 1NN3A 3OEHA 3LQRA 2F7SA 2JLXA 1I2MA 2CHQA 1G3IA 4A0RA 2VSOA 4HATA 1CU1A 1SVIA 1SVSA 4HZIA 2G77B 4RFSB 1U94A 1CR4A 4LJAA 5JEDA 3C5CA 5JCZA 3M0EA 2EVWX 4C0JA 4NDZA 2GZAA 1BYIA 2W58A 3ZIAD 1SVMA 2BMDA 3KZ1E 1CTQA 3A4NA 4L16A 4NCJA 3RVBA 5FR2A 4C7OB 1NBMD 1J8YF 4MQBA 1PLJA 1OXVA 5DE3A 1F48A 3LLUA 3QG5A 4YONB 3K70C 3LDAA 3QKRB 3A36A 4IVRA 4PX9A 3RANA 4A2PA 1WQ1R 2IHYA 4LBZA 3UXMA 4BFUA 4KVAA 5J40A 2GXUA 1S1MA 5E7MA 4TMZA 3GPLA 3OIWA 4MRNA 3Q7QA 4QKQA 4DLVA 4A2QA 1T9HA 4MGYR 1FP7A 3HYTA 5DN6D 1NL3A 2XTMA 1UBEA 1O3YA 2X19A 2XSZD 4YMSA 1ZD9A 3RS3A 4BFSA 2FX3A 4G01B 1XEFA 5EJEA 4LHVA 2YNMA 5DLQC 1M34E 1XXHB 2C9OA 3ZYCA 4EPYA 1YR9A 1GL9B 1G16A 5KDDA 1OE0A 1KKMA 4JSYA 4JLVA 1NMXA 1G6HA 2P3SA 5KDLA 4HDQB 3EX7C 2CNWD 3MWKA 3WRXC 1DTSA 4Q02A 2LWIA 3TUJC 4F4IA 4BFYA 3P4YA 2YC4C 1VKJA 4BZQA 5IHPA 3PFIA 3KX2A 3QE0A 2NPIA 4CEIB 3NBFA 2J3EA 3CH4B 1OF1A 2O52A 4GZMA 5DHFA 1VCNA 1QVAA 3WHKA 3PEWA 1DVRA 2J0UB 1U8AA 2ZE8A 3BK7A 3FVQA 3WMEA 2YYZA 1R5BA 2Q21A 3DKPA 1E0JA 1G5RA 3GLHB 5JWHA 4W9MC 1ZU4A 5KPDA 2V1UA 1EWRA 4PAOA 1OFUX 3LBNA 5CLQA 3NH6A 1DAHA 4X8OA 4XVRA 1XTRA 4ZIRA 1NY5A 1XTKA 1OFTA 2HEIA 3GLIB 3LBHA 2PZEA 3A1WA 3WMFA 4EPVA 5DHAA 3I3SR 2XSZA 3CX6A 4O2RA 4P3YA 4BLPA 1RRGA 2YJTD 5F9HA 3KFVA 5BYKA 3QF4A 4HLDA 3VAAA 5H70A 5KHOC 3C4JA 3FMPB 3ZDQA 5KOYA 1FMLA 2WKPA 3LAWA 2BHRA 3B6EA 621PA 1NSTA 3QUSA 4W5HA 3AF4A 2ZE7A 3LVRE 2ZRMA 4V0OA 4KSCA 3OHMA 2OSBA 1BMFD 3NBZC 1G4AE 4FW9A 1CJTC 5CK4A 4FWTA 2B8WA 5K8UA 1AZTA 2AXNA 1HUQA 1US8A 2ZSBA 4BLQA 1VYTA 4UNPA 3RS5A 5EUQB 4JKYA 3WBKA 1U9IA 2QMOA 2VLIA 1KI6A 2OCYC 4CEHB 4MKHA 1NI3A 4A9AA 4RD4A 3CF6R 2OT3B 3QXSA 4KU4A 4LWZA 4NP6A 1R2QA 2ZAMA 2ZI3A 5JECA 2HYIC 3RS4A 4MRSA 2RAPA 4LJ7A 1XWIA 2OE2A 1T8UA 5CYPA 2PZFA 4B2IA 3GFOA 4B32A 4P0TA 1MO6A 5J5CA 2A5DA 4PQFA 1RJ9A 1AS3A 1N5KA 4PSKA 4QBIA 2PLRA 1MO4A 3KQLA 2KSQA 2PX3A 5C2JB 2RGBA 4JVLA 3PIRA 5JBQA 4TMWA 2VBCA 3MAAC 1ODFA 3WNCA 2RCNA 4UNQA 1KK2A 2ZI7A 4D4LA 3PEYA 4D4JA 3TVTA 3DKVA 1TF5A 2B8TA 1WP9A 1X86B 4DCNA 4ZV4A 1W36D 1I4TD 2O8BA 1G3MA 2ZEJA 1R6BX 1ZNXA
chains in the Genus database with same CATH superfamily
3QTTA 3KWLA 2FN8A 3CMMA 3G8AA 3M5DA 3SDZA 1QYVA 3FYDA 1L7BA 3IEIA 5AW6A 1H4QA 1BH2A 2M2IA 3R5FA 5HDQA 4DLAA 2JGRA 3FLMA 3V48A 1OXXK 1V4VA 2F90A 2ISSD 1G0NA 1IXKA 1BE0A 1PS9A 3LW8A 2I34A 3IR6A 2O5VA 4MDHA 4RVSA 2GEUA 3ZDFA 1HE5A 4UOEA 1P7YA 2NO6A 1T5BA 4IH4A 4JELA 5IKPA 2O8EB 1V1MB 3RHTA 5FFNA 1GPNA 3DYIA 2VBIA 4KO2S 4GL4A 8MHTA 3K09C 1JUDA 5DHUA 4WUVA 5JROA 5G1NA 2YZNA 3KTFA 3U7QA 2NSLA 2X5KO 5EWMB 4AX4A 1QG2A 3H3XA 1P0FA 2BW0A 4M9UA 4O5AA 4WOKA 3NJ8A 4XUGB 5DULA 2AMYA 3BWCA 3ZPXA 4B7UA 4R1MA 3U4GA 1GITA 1E9FA 5H80A 3WYBA 4ZDJA 1VM6A 4PSVA 5KSZA 2WQ6A 1ZOSA 3T7JA 3TTTA 4EZEA 2OC4A 4ZMRA 3H1GA 3V34A 4A26A 1Y98A 4JUCA 2P0AA 2N0SA 5JVDA 1CDOA 1W2WB 4RXUA 4X8LA 1JA0A 4NHOA 4EGAA 4Q4AB 5HZGA 2PL3A 3MCVA 3Q3VA 4PWYA 5LWQA 1KZ9A 4JJEA 5AVUA 2NTEA 2IYFA 4UD2A 3N8NA 1IBSA 1TM2A 3DHYA 4H1TA 1ZOPA 1C3VA 1EFVA 4ZRMA 4E94A 2GD2A 2ZU0C 3VPHA 2FEAA 1UMKA 2FFHA 3B9PA 1NI4A 4NRDA 1E1RD 5ES3A 2R1TB 1OT3A 3ZEAA 2FEXA 4A0FA 5AW0A 1KEWA 2PQMA 1SXJE 1DJQA 1ZXBA 1KEEB 4P53A 1E9AA 5CDYA 4A8HA 5C1DA 3U3JA 1NLUA 1PFKA 2D74A 2W6CX 4IJUA 5L4LA 3N2EA 3BTOA 3I64A 2XGMA 2I4LA 4K9RA 1EKXA 4Z99A 4O1MA 3O8CA 1V3UA 4F91B 1CUCA 1K3TA 4WOPA 5KNBD 5CVVA 2XQVA 4RFSA 5F35A 2NUAB 4JOQA 4HAIA 4IDHA 5DYGA 3L77A 3GLFA 3ND8A 5FPKA 3FZYA 4XYEA 4GSKA 4FNMA 1HZZA 4L6IA 1MHPA 5EJMA 4CU2A 4LV6A 5ULLA 1O4VA 2H07A 4H15A 4QXOA 5ER9A 2GJ4A 2BKVA 5IP5A 1K4MA 4ND5A 3CTPA 3T94A 5F2EA 3WLTA 1NYRA 2P65A 2OQVA 3RGWS 2C7RA 1NBIA 3O73A 4ITRC 4OQQA 5AM3A 3V1UA 1U0EA 1UQTA 1CIJA 3UFBA 4G81A 3QLEA 4FOSA 4JI6B 1CY6A 1XI2A 4S12A 1P4RA 3GGDA 3KPYA 4CW7A 1DEXA 3KQNA 1SC6A 2QMHA 3SNHA 1Z4PX 2XX3A 4RE5A 1EB8A 3JQ8B 2VATA 4FFVA 9GPBA 3WFJA 5TQ2B 1YQDA 3NAQA 3O38A 4Y67A 2HREA 4R1TA 1HE8B 3ASYA 1KO4A 1NG1A 4FFLA 3T15A 2J0SA 4NBLA 4XUCA 1DAPA 1DEKA 3IUQA 4DCUA 2DR3A 2D13A 4PC1A 4QDOA 2Y93A 5FPSA 5T4HA 5DGTA 4S04A 4K1LA 4BJ3A 4URFA 3PRYA 2ZRIA 4H7JA 1JU3A 1P31A 3P4XA 4PR0A 1KE2A 1A1VA 1MEOA 1YHNA 3FUTA 1ZLXA 1A71A 1YNOA 1Q3TA 2GCPA 3BG5A 3I34X 3S27A 3VSBA 2YBEA 4MW6A 5A6SA 5HFNA 5REQA 1K4YA 2BDEA 2VWPA 4LRTB 1MP0A 1VG1A 3WYFA 2EGGA 2IKSA 3I5YA 1NXWA 1EINA 4QUKA 3ET4A 5JUWA 4FOLA 3OIGA 5FV7A 1A9OA 1R4AA 3A9WA 5LQDA 2V03A 3UAXA 2YWFA 2WD7A 3TNDA 3Q11A 1WB9A 5ICEA 1NY6A 1FQWA 2IP2A 4P32A 4XPZA 2WG0A 2FR0A 1GO2A 3M4NA 1KQFA 2LCIA 2R1VB 4DHEA 1KFBB 1YB6A 1SY7A 1WB6A 2BFBB 4QJBA 4ALNA 2P91A 1FX0B 3H3FA 2B4TO 4MVWA 4RKFA 3EW9A 1SXJD 3TX2A 4H7EA 3N2YA 2NVOA 3ELUA 3B78A 4N7MA 3UA4A 3IMCA 1KI3A 1O08A 1Y7TA 4AJIA 3GH1A 4NMXB 2PQ6A 1UDBA 2YRXA 3A8TA 3FNIA 3JD1A 3STYA 2QZJA 3EHDA 3W6ZA 3A9SA 4UBKA 5F1KA 1JR3E 3COJA 3BHJA 3O95A 3L4BC 1FMFA 1E3IA 3IQIX 3PHIA 4EG1A 2FW8A 2Z56A 2WWYA 1QKJA 5A6SB 1SIUA 1KS2A 3QUCA 1JKXA 1L4LA 4G67A 4I55F 3TQCA 2HLNA 1BMDA 5FA8A 1QGUA 1KJIA 1NDQA 1H1TA 4E32A 4JBHA 1N6OA 1LDBA 1U90A 1G8JA 5C3MA 4DEXA 1J0AA 2BEUA 4FR5A 5C5IA 3MZ0A 4MUAA 1TPYA 2W6OA 4PG4A 1VGVA 4DCCA 1Z73A 3RKSA 3B2QA 5TQ2A 4NENA 2BFWA 8AT1A 1ZH6A 3UGQA 2WA1A 1RWWA 3ZWDA 4ZDKA 1VMKA 4HC4A 4KO8A 5BOVA 3V2HA 4EO7A 4YRJA 1M5RA 1ZH4A 4MR8A 2BSAA 3B1FA 2J67A 4ND7A 3ROQA 1OJLA 5EQJB 1H2XA 5AW3A 5LMUB 4ND8A 3AL0C 3EVEA 5LXTF 4F2HA 3ORFA 1IFXA 2EL7A 3PV0A 5EMHA 4AJ2A 5EFZA 4AD8A 2CKMA 1TE2A 1J00A 4IOMA 5DP1A 1LV8A 1JYFA 1Q91A 3FMFA 3GJTA 1EFUA 5L4NA 1FX1A 1W19A 2PAAA 4LDPA 3WGKA 1DDIA 5LOVF 3AKYA 2NUAA 4HT3B 3MT0A 2OENG 4CCAA 1FXWF 3RAGA 4DJDC 3WYDA 5I4IA 4Q9DA 3D8NA 1QQ6A 4QASA 2JFXA 1PJZA 2VP3A 2YJ3A 4K9DA 4LNHA 4YT4A 4F4CA 5FX2A 4AN1A 4MI3A 3H04A 1RQNA 1AB6A 4AVYA 2P0YA 3VISA 3EZGA 3ROGA 2IOFK 4QGGA 5TF4A 3S44A 3JZAA 2G9VA 2Z08A 1KO1A 2BDTA 2E3JA 2R68A 4V02A 1KZHA 1Z0JA 2ATXA 3ROKA 5HUHA 2Z0MA 1F38A 4CEJB 1J1ZA 1KZ7B 2BP7B 4OFZA 1SUDA 1DJMA 2D5LA 3QM1A 3MT7A 2O07A 4MV4A 4ZTBA 1BHQ1 4AF7A 5L7WA 1LSUA 2R8PA 3N2GB 5ALFA 5KVAA 1G21A 2WJ3A 2ARKA 2I2BA 3B1ZA 3WE7A 2ZI5A 3DMNA 3FGZA 3L7CA 3OQNA 1QG6A 3FJ1A 4J43A 1M2JA 1TYZA 5JAZA 3ZWKA 3PLAE 2NGRA 3GNSA 1H65A 2XUJA 4C6HA 4A5OA 2V7WA 3IT2A 4HGNA 2XYPA 3NBQA 4Y9UA 3ANYB 1ZX1A 2DQKA 1DUVG 5DFAA 4QTYA 4ZJZA 4UAVA 1KY2A 1Y3AA 4BO3A 4E22A 4LF4B 4L8GA 2GTPA 3R44A 4XZ3A 1WUKS 1F17A 4RK4A 1UBUS 2NUPB 3NONA 4CMKA 4Y8VA 5CFQA 2A78A 4EB8A 4NK4A 2VF7A 1DL5A 4G0OA 4ND2A 3G0CA 3VJRA 4B17A 3ZJVA 2IEIA 1KH1A 4LEIA 5B53A 2ZSJA 2VHCA 3E3MA 3BB3A 3ILSA 5JPCA 1XMOB 3HP4A 3S8MA 3TIXB 3AF6A 5A0VA 3SIRA 2P9TA 2H08A 3D64A 2A30A 1Q3HA 4NYIQ 4BRWA 3GEGA 1IHOA 4ALLA 4U7HA 1EVQA 4HEA1 2QL9A 4ESVA 3O3CA 2A1UA 4UDXX 2QM7A 3H86A 4RD3A 2FZKA 4BVKA 4LXIA 4XPIA 5K3FB 1BNCA 4PZAA 4H7HA 3D6AA 2JJ2D 4K8OA 1TF2A 1SKUA 2R7LA 3MFYA 1GPLA 2J5QA 2PM8A 1ZC3A 3QVMA 3MD9A 3KBOA 4G1BA 4RS3A 4NFHA 4XVCA 4QEKA 5G0WA 1FFWA 3M6LA 4WOBA 1SA0B 2IPAB 3MTGA 5HIJA 3CM0A 1EWKA 3W6NA 2FPOA 4FT2A 2PVSA 3INRA 4QHTA 4ZO9A 3PFCA 4BU0A 2P7IA 1UH5A 2W48A 1SD1A 3DGFC 3KKOA 2K4MA 5IUKC 1F2VA 2NU8A 1GPDG 4MUMA 3P1JA 2EFJA 4M1ZA 2DSNA 5A3VA 3NUQA 3VMFA 1OD6A 2PT5A 4ZI7B 4FB5A 5LZ4A 2WTUA 1GQSA 1SQ0A 2Q5LA 4ARIA 3H8SA 2XGOA 3BCRA 3TNFA 1WEHA 2NIPA 3I01A 4PFSA 4ZQBA 2EC5A 3I12A 3EIHA 1M73E 1RYFA 5ALZA 4D0RA 4D9FA 1NFRA 5I51A 2I78A 2CDAA 4YN3A 2UVQA 5CIQA 1E2LA 3RB8A 2XXAB 1HA3A 2FPXA 1W46A 3HKDB 4DSUA 3NHYA 2IUUA 3VJKA 3T5TA 1PEAA 4GF5A 4UEQA 1B00A 4UVHA 1D5WA 4XIFA 5JW6A 5D00A 4CN9A 5E4TA 1CEXA 1XQXA 3OZAA 4L50A 3AHCA 3ZC3A 1GZSA 3F4LA 4YIKA 1V5GA 2MTBA 1CY7A 2QGNA 4MJ3A 2VJQA 3EDYA 3L06A 5TEWA 3RREA 1C7JA 2H59A 4ZZ1A 5HNKA 1Q50A 1QDEA 4KR2A 3ZQ6A 3Q3EA 4WDQA 5AHOA 2CXQA 1OBOA 3NGLA 1ZUNA 4DCGA 1Z33A 5EOVA 3EY4A 5D5QA 5EJIA 1XZMA 5GPBA 4D98A 3FCSB 1P3Y1 1I0LA 2RGYA 3GOHA 1KXJA 3L49A 5C8YA 3UOWA 2ZYRA 2HRDA 5DTQA 3SYLA 2X9NA 3QYFA 5C18A 1NR7A 4Z9BA 4C7VA 3BB4A 3ET5A 3G13A 3FHCB 4Q00A 3ML1A 3AXSA 5DCYA 4Y3UA 5DW0A 1IAVA 4URVR 2H18A 4KR3A 3AI1A 4EY8A 1CX9B 2NUBA 1RI5A 3KFXA 2WZQA 2SKEA 1SC9A 2DU8A 4QVIA 3G9UA 3HWWA 3N8IA 4GOOD 2QE7A 4OIMA 1LBTA 5FULA 1OX5A 1PL0A 3GXBA 3G2IA 4R9RA 3MPOA 1PK7A 1HE4A 2IP1A 1T43A 2BE9A 4FP9A 1I3OA 2IF0A 1GSAA 1ORDA 2DF8A 2LGJA 3FUUA 4GVPA 4JQZA 4S2UA 3WP1B 2NQTA 1IONA 5EEGA 5L7YA 3HCAA 4ROSA 2PYDA 5FQOA 4HAVA 5IC4A 3T1TA 4NBRA 3QF7A 3H8WA 4MZXA 4TRJA 3L9WA 1R5OA 4OM8A 4UM5A 3HCWA 1HDZA 4C08A 2R2AA 4ETWA 5DLPA 1ZNQO 4GLOA 4FE7A 4KTVE 3FMOB 3L18A 3S68A 521PA 3TSZA 1A8PA 4ZAYA 1S1CA 1XJ5A 4RTMA 3MGAA 4WA7A 5AR1A 2G8LA 3O2QB 2NSJA 3IRUA 2IV2X 3V8MA 2WHQA 4MKGA 3QTLA 4U7DA 2JI4A 3DEKA 3PWTA 4RJTA 1MD9A 4A91A 4P6VF 4PFKA 4RSRA 4O1HA 5K8IA 2B78A 1XVUA 2JGAA 3SEZA 2WU1A 1UFRA 3EVGA 1EHYA 5EGSA 3L1UA 3DKIA 3NRJA 4EG6A 1W0JA 1G8AA 1PUJA 3EAQA 2BYTA 1ZUD1 2OZLA 4RHUA 1EX6A 3ROPA 4INOA 1TTQB 2AMJA 2IYRA 3GJ8A 3MEQA 4TVKA 4F96A 4C5CA 5CA0F 1Q21A 4OYYA 2EG5A 1JPJA 1ARZA 1DMSA 5G4KA 2PU7A 2FCRA 2O2DA 2VT6A 3VHXA 5BWBA 2OHVA 1YZ3A 4NV3A 2X8JB 1ISSA 3NHJA 1URPA 3IMEA 5BO5A 1JLHA 1H0HA 4LSGA 3RJ9A 1GGVA 2H1HA 3EVZA 3OFSA 1Q0QA 5C0OE 1FFEA 3H2SA 1VG0B 4IS2A 1Z8NA 1MB9A 3CH5A 3JAWA 2J4CA 3JU3A 1V37A 5JMPA 4LK2A 4LFCB 3HKEA 2KX7A 4JJIA 3L02A 4UNNA 3R7BA 1V8OA 5E3IA 4ZI7A 5ILOA 2GAOA 2IX9A 2CC2A 3IQEA 4BGEA 1KI7A 3S7TA 4CIYA 4YCCA 4K3UA 1YRQA 2GESA 4KRXA 3TCNA 1LV7A 1HYHA 1FFBA 4ABTA 4RLSA 2G5CA 1V4BA 4KN8A 5JDCC 4BQQA 3L6DA 1OI3A 4Q66C 1OW3B 4BLWA 1V47A 4CMJA 5K05A 3IH5A 4NJMA 2P2CA 1EHCA 2P6MA 2IS6A 1XNHA 2G08A 1NVVQ 1XU7A 2O23A 2VDNB 4OM7A 5HIIA 1HQKA 1IB0A 1S4MA 4Q4HB 3T4PA 3S2IA 2F2TA 3KD2A 3L4BA 3E9CA 2O20A 2WIFA 3BKWA 1SHTX 3F1KA 4JA2A 4KH0A 4V3BA 2NN3C 4J76A 4M7WA 1JHQA 3SD7A 1E7QA 1ISRA 2JEZA 5TQ0B 2WJHA 4WASA 4MUJA 5JSUA 2IXDA 1UM9B 2JIDA 2WT4A 2ISQA 5ELXA 2YYYA 4AYXA 2PLNA 3CKLA 1Z4OA 4OHKA 4Z4HA 1DFIA 2RBEA 2A94A 3SGLA 1MTOA 1S3GA 3GX1A 4Q4HA 3C6ZA 4E70A 2NZXA 3R7NA 2BFFA 3AJ8A 5ENDA 5FHRA 5LD2B 2JKYA 3VC1A 4RMGA 3S2EA 4BV8A 5IT4A 3R8FA 3NBYC 4KJXA 4D0SA 4MWCA 1F7UA 1E1QD 4C0SA 4DA7A 1L4NA 1CJMA 2IVFA 1YR7A 5JNRA 1GNPA 4DDUA 2HDHA 5KTYA 4XVQA 1WDWB 3CN9A 1KDOA 4J4HA 4W7IA 3VKUA 5AH0A 4KQJA 1BMTA 5AKGA 3HMKA 1GAJA 6ADHA 4S1NA 1Y4AE 5I4BA 3L6CA 4RMHA 1MPTA 2D7JA 1TA0A 1CUIA 1WXHA 4PLCA 3LHKA 4LTNA 1RM3A 2AUMA 1N2SA 2FY8A 2ZS8A 4GNRA 2XAAA 2XWBF 3AI2A 2Y0DA 1IVNA 1NRIA 3PCXA 2H0QA 3AI3A 1RJEA 2W2XA 2YRFA 2YV2A 2TMDA 4WDRA 5JNVA 5JSHA 5FBHA 3TZQA 3AR8A 2J31A 3QKSA 3OCVA 2ZM5A 1PT5A 1G60A 4GDFA 1JJBA 3ENNA 3DC2A 4QU0A 3X1XA 2PGLA 3AT1A 3KS9A 1DRUA 3NYWA 4X41A 1OGIA 3QOYA 4A10A 3JWPA 5A9RA 4B7ZA 2QG9A 3VU3A 5ES4B 1UPFA 5KNBA 1RI3A 4K6HA 4RDHA 5BQ3A 3OCJA 4L5JA 2VTBB 1NKTA 3EQ9A 2V1XA 4I9NA 4TL9A 4TT3D 1M10A 2C31A 2WAOA 2PRJA 3EGOA 4II7A 3O8LA 2AG1A 4OHRA 4A6EA 1KPHA 5FWYA 5KWSA 4C03A 2AI2A 1YS1X 3H84A 3LOUA 4OJKA 3PL1A 1EUCA 4PG6A 3O7WA 3LNCA 1EDEA 3GRCA 1JXAA 4G97A 4K6OA 4RXMA 1O94C 3GLIA 5ALIA 5MN5A 1Z4NA 3EJ6A 4NATA 3O94A 4QTUB 1F12A 4HF7A 5JLJA 1UMCB 1MVNA 1T8WA 1E5TA 1C7IA 3N59A 1MAVA 3N8KA 4PICA 3GVXA 2WUGA 1O0BA 3LKZA 5C4IA 3VVCA 2NU9A 1KTIA 4EYKA 1Z8FA 3MLEA 3TGPA 3KYBA 3NM4A 4ZXFA 2Z9BA 4C9BA 4EH1A 5C8VA 4UPDA 5LVAA 3ELWA 2EQBA 5G1OA 4C30A 2QLMA 1N6PA 4Q05A 3ZE6A 1FL9A 2YMMA 4NE7A 4ZA2A 4BNUA 4D8UA 1K63A 2Q5HA 3PYMA 2QAIA 1BHO1 2AXQA 2WUVA 2X1HA 4XB2A 3UXHA 2YOGA 2JAUA 2PO7A 1TM1E 3IELA 4R2IA 1E92A 3TJRA 4ATNA 4HWPA 2I4RA 2QLNA 2BBSA 4R3UC 3J81A 1TPZA 3Q7TA 4AQ7A 5F3WB 1YJ8A 2CUNA 3QFHA 3X1DA 1YBFA 2X0NA 3BFKA 5IDVA 2P6RA 4IFBA 1KIFA 3EGWA 2VDWB 4MI6A 2FWBA 2WLSA 2ADMA 3CSSA 4DFDA 5JSZB 1WABA 4ZYXA 5K01A 4HPWA 1HMPA 1ZNZA 3TLXA 4MP6A 1WVIA 2R1VA 1VMIA 2WF8A 2IF2A 1HTBA 5FPPA 2H7XA 4PWZA 3DB1A 4I55B 1Z3IX 3C15C 3DMGA 4M0EA 2V0CA 1J24A 3T7AA 1AHPA 3HDHA 1RADA 3F6PA 4U2KA 4MICA 1UC8A 2V8OA 3E7XA 4OJTA 4IPTA 1IJFA 3VU1A 2Z30A 4GBGA 2IPLA 2O19A 1QVZA 4B3XA 4OSOA 1C3JA 5KC9A 4N8EA 4HQRA 1ESNA 3T3HA 1JMVA 2OORA 2QP4A 3AP1A 1P7PA 3QWHA 3BERA 3DVQX 4FYPA 3EAFA 5K6AC 3P32A 3I4FA 4URUR 4YP0A 3A27A 4QGFA 1ORTA 3NHZA 4U3JB 1Y5IA 4DY4A 2BM1A 2C5SA 2P5TB 1HDYA 3WWZA 4NEGA 3MWDA 1CRZA 1YCDA 1Z5UA 3AY3A 4GP6A 4MUGA 2HA3A 1LS6A 3AUAA 1DXYA 4XD7D 3TCKA 4JBNA 3TNYA 4DUPA 4JLAA 1FUKA 4C7JA 4MPRA 3V8QA 2PUDA 2NX2A 1C2YA 1VJCA 2B20A 1RMQA 2VSFA 3TF5A 3FG9A 3AJDA 3UMMA 5CB0A 4WHMA 4TVSA 1Z08A 5B1EA 1AMNA 4Z9XA 3KB1A 1E7WA 4JP5A 2AUNA 4V38A 3EVNA 5TIIA 4QX6A 5I9SA 2ONJA 1G20B 3CCCA 4KBGA 1JPVA 2MWMA 1JEAA 2Z43A 1KI4A 3O5AA 4MV8A 5JAIA 1Z47A 3D4BA 3CISA 3DTVD 1PFVA 5E9AA 4XQ0A 2C3UA 1OWMA 1SKYE 5J4HA 1DHTA 2P9GA 2EGUA 4OQLA 4D0GA 1BW9A 1AF4A 4ZT5A 4JA0A 1W44A 4PIMA 5A62A 1PR5A 1A2BA 1FNDA 4XW2A 4IIHA 1GL3A 1ZM3A 2R25B 5DBOA 4I1UA 1MQ8B 5EERA 2J3MA 3OSZA 4P4NA 3NNNA 1CZRA 4HVLA 3T4EA 2WIAA 1FUYB 1XD8A 3JQFC 1NJ1A 1A5TA 3AHDA 1RFGE 5K0EA 4G8CA 2RGCA 4HAXA 4AWAA 2QAGC 3P8ZA 1RRKA 4YAUA 3RTCA 2WWXA 2OB1A 3TRIA 1M7BA 1H1DA 1Z12A 2D62A 3PFGA 4RQBA 5K3SA 2DQZA 1KDVA 1ZK3A 4DR3B 2O2SA 1WOYA 2WFLA 4ROTA 2CVFA 1J0BA 4X97A 4NBNA 1OTHA 1RWMA 1O5TA 2WUWE 3PF9A 5GAJA 1XA3A 1W1UA 3MS4A 5A4IS 5BNTA 3LBIA 1K2VN 1YBMA 4DADA 3N0TA 4YCSA 1YU9A 4IM7A 1ECBA 1FDOA 1AK2A 4I55A 1GXSA 3WLFA 1HRKA 2I54A 4QG3A 2MYNA 1HYEA 1K8XB 2P62A 2Z2XA 2WWWA 4PG5A 1H4SA 3C3JA 3FTDA 2EZUA 4MWTA 1PF7E 4TS3A 2W4IA 4BNTA 5E8JA 3CO5A 1TZBA 4L8YA 4XM0A 4N8DA 1TEXA 2E4ZA 4CKBB 2CLDX 5BSHA 4LRXA 1CJSA 3HBFA 4DMHA 3M81A 3SX2A 3UC9A 1GU7A 4CM1A 2H92A 4KACA 2Q7DA 3AKEA 3IP9A 3JQFA 3RTAA 1J22A 2Q4BA 3I4LA 4KK3A 2RHDA 1R0YA 4MPJA 4YP1A 2CK3A 3L07A 4CKXA 2X5NA 4JP8A 5JHGB 1D2HA 1JSZA 2JAWA 3ESQA 1NVTA 1R64A 1HI9A 3CN7A 3G5UA 1E3TA 1MX5A 4KGZA 5TT0A 5IDWA 3UMRA 5U4XA 1DBWA 1W47A 2W2OA 5IM4A 3CWQA 3KKNA 1T6YA 2OZPA 1TO2E 1D1TA 2BGIA 4ETIA 5LOVA 2DUWA 1VJDA 2FK8A 2QM0A 4GICA 4OQNA 3JAKA 2RK4A 4GXQA 2WJ6A 4CI9A 1XPUA 2DQYA 4LQDA 3ZR4B 4FQ8A 4WEQA 2I8LA 3EVAA 3NBXX 2AF3C 3GEIA 2Z8YA 3OC0A 4QO8A 3R0QA 2L2QA 4H3SA 5D84A 4FNAA 1KGDA 4ZCIA 3MWGA 1BXRA 5KJEA 3FB1A 4K0RA 4DQDA 4M1QA 2HH9A 1IATA 2XWPA 3ONNA 1MX9A 3FYUA 4WK2B 2EV9A 3L46A 1N2JA 1UMCA 1REQA 3MF4A 3ZHOA 4Q39A 3HVIA 2RAUA 2XD9A 2PH5A 4IDNA 4YBRA 2PLWA 4B48A 4XVHA 1VZ2A 5HBGA 4OBEA 4QQFA 3M5PA 2GA9A 1GPMA 1HT2E 1WD5A 2QG4A 3E8XA 4IHJF 4A92A 5KJ6A 1Y8QA 3C5VA 1QH8A 4Y2JA 3MJDA 4D9GA 5E1BA 1LB1B 5ADHA 2HRCA 4RY2A 4DTCA 1H8EA 3VPAA 2I55A 3CINA 3DP9A 1JSXA 4QHSA 4ENQA 1R0XA 2GEKA 3F5FA 3UO8B 1SK8A 3F8TA 3NOVA 3I2JA 3WNVA 2PRYA 3FGOA 3OBBA 5KNCH 2K5UA 4B6FA 2HTFA 3GJZA 4F5YA 1I1NA 5DWQA 4DLRA 1VB5A 5FWNA 4HB4A 1GTJ1 3B60A 3EXAA 3B8HA 2YV5A 1XTTA 2PWAA 4KE9A 4P4SA 3HK2A 2R7MA 5JJBA 1K6MA 4MS3B 1Y1RA 3U81A 4U8HA 1DGQA 4UMVA 4G0QA 4BGVA 2C5GA 5JE8A 4DCJA 3AKCA 1DPFA 4IHKA 1SUFA 2X0KA 3V2GA 1RM5A 3P9PA 3FR7A 2DPMA 3IO5A 3IAUA 4I5EA 4QAQA 3TZHA 5JXHA 1U5CA 3HS3A 1U0FA 4RZSA 4WLNA 2FPPB 1WKCA 3NANA 1NW6A 2LR0A 3E1GA 1NMYA 1NJ2A 4M0UA 4IOJA 4YLYA 5HKKA 2EJCA 2C0PA 2GN2A 3LK7A 3U0VA 2NG1A 1VL6A 3KUKA 2FMHA 1I4WA 2JGMA 2Q5OA 3WSVA 4WNYA 3PQ3A 1APBA 1EX7A 2IPXA 2Q6OA 5C51B 2HM7A 4KQ2A 4RF4A 4D8YA 3K9HA 2PX8A 1FJHA 3TZLA 1KZ1A 4OI2A 4DPLA 4P2GA 4MPPA 5AOCA 5EWJB 1T3GA 4EQ6B 5FF9A 1U9CA 2F9MA 1TIPA 5SYMA 3TQSA 1EGAA 3CUSA 3UHJA 1U7DA 2KE5A 4NJMB 4EJ0A 2YR0A 2ZRBA 1ZHHA 1G5PA 1RKXA 1XQVA 1KDYA 1P7VA 3GP5A 2MYPA 2O3JA 4B0PA 3L7DA 2B7LA 4EUSA 1G1MA 1T5IA 1E4EA 3OP1A 3HMQA 4K86A 4LXYA 4CKZA 3IIJA 3M6AA 4NARA 1TAUA 1E7MA 4CMBA 2CBZA 4BTLA 4NYIR 2GRUA 2VAMA 3TAXA 2ILTA 1ZLYA 2JRLA 3DZHA 1PT7A 1Z3CA 2BHTA 3BL5A 5AK4A 3TOXA 1V16B 4PTZA 4G5GA 5FBWB 3UEOA 2CLCX 1O94A 2X9QA 4JMPA 4GX5A 3ICWA 4YRZA 4GFDA 1N8NA 6AT1A 5TPZA 4B3FX 4DE5A 4M89A 2JLZA 2C5LA 1F4PA 1VHLA 4Y9TA 1ISHA 5CNKA 1GKLA 3FA2A 3DEHA 3IOCA 3N2IA 4OB6A 3VYTB 3TS1A 1ZRHA 4BVFA 4RDCA 3GU3A 4WNCA 4R1QA 1BU8A 2O1SA 4ZQHA 1FLAA 3P0JA 3JWEA 2JIZA 1KHHA 1EGMB 3C3WA 4PSUA 3THWB 3R9XB 4WJKB 5GQSA 5JO0A 4CM8A 4ZKDA 3CZ4A 2UZ3A 1YRHA 2G1KA 4MUHA 1XP5A 4C43A 1IY9A 1PJRA 3ZV5A 1FXSA 1VPVA 1BS1A 3ZOKA 3E3AA 4NDAA 3EZNA 4Q3KA 2C9CA 1U2RA 3HJCA 1C4KA 3WADA 4DA9A 3EPPA 3I23A 4DMUB 5KYKA 2XADA 3CKMA 3GLFE 3IQHX 2AMFA 3MJTA 1HMYA 4HSEA 4OY3A 4EVSA 3K9LA 2PY6A 3IQXA 4OP1A 2W0MA 2QW0X 2AQKA 2WNHA 2K2WA 2NU6A 3O92A 421PA 1CP3A 1YOVA 1NAIA 2GARA 4HZGA 3W4IA 3X43A 4GUDA 3E22B 4YROA 1NR1A 4O4JF 3WA6A 1NAHA 1R4MB 1TECE 1H2HA 3MT9A 3O8QB 4KC0A 4D41A 2RE8A 4RTSA 5JBNA 1RU3A 3OQMA 5JMOA 4EOGA 1JP7A 3MBOA 3MGGA 1ZCZA 3DDNA 3WLHA 3GRZA 3U61B 1WQ4A 4HEHA 3WGHA 1TTHA 4JLPA 4U5XA 3REQB 2UZ4A 3EWAA 2QTVA 1AE1A 4M0MA 4FMPA 2O8BB 2WUDA 1V9CA 3QSYA 4MW7A 2R84A 4NYMQ 2VHXA 1Y4UA 4IFTA 4DEYA 5KHAA 2O48X 2KQUA 4XASA 1Q7GA 3PP8A 1G9TA 5DT9A 5CNIA 3PPIA 4PQRA 4D6XA 2BSQA 2XUIA 2NU6B 3B1WA 3R23A 1Q74A 1W6UA 3IOYA 3CUKA 1J49A 2OZEA 2PX5A 3NQ41 4BQIA 1IIRA 6REQB 3PG5A 4D45A 1XEXA 2X9LA 2FMFA 4X3CA 5I9LA 5JD6A 5K0GA 1NVEA 1QGAA 1M0WA 4L15A 3UJ9A 2M9MA 4JR2A 1G8SA 1DKOA 3UCXA 3UT5A 3TKAA 1RRVA 1SUWA 1RQ2A 4H6WA 1FTGA 4RIHA 5JSYA 1OOEA 1W7AA 1IJKA 4PS0A 5FOUA 5BWNA 4X8HA 4FZ3A 3QPDA 5B6PA 4DB4A 3PFBA 4PNHA 3VKHA 3FPKA 2J9RA 3GMDA 5CVTA 4H27A 3KKEA 4PQEA 1AUPA 2JJ1D 5CDFE 4Y9RA 1BEEA 1KAEA 5AUPB 3QWBA 1G8PA 1ETUA 2VQSA 2PLFA 4N3CA 4EKDA 5B6JA 2UXDB 4URZR 3GMSA 4M60A 3X1YA 1K9SA 4HX9A 4QDKA 1VLQA 1O95A 4D74A 3BTVA 4RZXA 1Y80A 3L6RA 3Q7PA 9LDBA 4KRYA 4PCAA 2WMDA 5B55A 2IOHA 2AV6A 1KETA 2KMLA 4B5LA 2C1EA 4UTZA 4X45A 3LP8A 3I1JA 2P75A 3F9IA 5B1DA 1HDOA 3QY0A 3QP9A 5I47A 4EHFA 3ZW9A 2JLWA 3A4MA 3HXKA 5ECDA 3PNQA 1D2GA 5I3CA 1XAHA 1L1RA 1EU1A 1P18A 3U4HA 4WFIA 2W98A 3LKDA 4XFJA 1Q83A 3LQFA 2QPLA 5DN9A 5BMOA 2WTNA 3LQ1A 4S2EA 3T1OA 2UYCA 1HBJA 2QVXX 3EGEA 1K6XA 1Y6GA 3HKBB 3FWZA 4JI3B 2HV8A 7REQB 2FNAA 3VR4D 3KB2A 2YVLA 2EJVA 3FNBA 3T35A 2B9EA 4ED9A 3EEOA 2HU7A 1L7XA 4HGQA 3E5RA 5B2ZA 1H2RS 1QFJA 4P38A 3I42A 3FBTA 4WLOA 4N9QA 1ZKMA 1IQ0A 2WUEA 2YC2C 4GMXA 3ZNOA 2QG6A 3GFSA 3N3AC 1N2ZA 3BRSA 1NWCA 2I3DA 2X7HA 2ID8A 4IIJB 4GOMD 4MA0A 4UPEA 1SUCA 4OLJA 4C87A 1DAEA 2PG3A 2M6KA 2JANA 3L7MA 1OWOA 3M5CA 2QJOA 3C16C 3PD7A 3IJEB 1BVUA 1ZVKA 2PSSA 1AA9A 1E4YA 1H2ZA 1THTA 3DM5A 4CQMD 2ZTVA 1ZN8A 3QBVA 3WAJA 2WJVA 2PR7A 1PZMA 3N7TA 5LLTA 3IAEA 3ZXSA 1AKNA 1LDMA 1B73A 1A98A 3OEEA 1SU6A 2QP3A 1NONA 1IN1A 4TZ6A 1U8EA 2ZWOA 2AE1A 3E70C 3AF0A 3CUUA 4G86A 2Q3DA 3CRZA 2H52A 3PC7A 4AG3A 1ZHOA 2WU0A 5ESWA 3EF1A 3NT5A 1A3CA 1HT1E 5MN6A 1VI6A 2PFGA 1YB5A 4PLFA 4DV7B 3K9GA 3ASZA 2FGKA 1VLJA 2C84A 1PJQA 3LO8A 1GFSA 3O4FA 4QYMA 1N4AA 3RSHA 3T38A 5E3HA 5HIKA 5BXQC 5K4AA 1U6KA 3FE2A 4CR6A 3N2GA 2X2FA 1GNQA 2JFQA 3C6QA 4X00A 2SHKA 1KDZA 3WLJA 3A04A 2BFEB 3E1SA 5JADA 3MCUA 4CKYA 2K6GA 3L7OA 1D0SA 3OBIA 3OFND 4W8HA 1IOWA 2QTMA 3W2EA 2Z09A 1MOSA 2JD0A 3NHUA 2EYUA 2V54A 5JCXA 3PBKA 3U7GA 1PEKE 2QSJA 1Q7CA 3DWGA 3BHNA 2PRIA 2DPGA 1HKUA 1X94A 3KSDO 4GT1A 1R50A 4BUCA 1QC5A 1UJMA 3OJXA 3V4LA 3TLKA 1PFYA 2KYRA 1N5IA 3QWAA 4PZ0A 4M8NE 4HS4A 1DT5A 5D86A 3WGUA 4OIFA 3DXXA 2DGDA 3D0RA 1T0IA 1I7QB 1L3CA 2IY7A 4LCBA 2FW7A 1YASA 4B83A 4A1FA 3T0FA 3X2EA 5FBVB 4H77A 4IDOA 4M9QA 5IH3A 1JB1A 3ZHTA 3IKMB 2WJWA 3F5QA 5GWXA 4BN5A 1NSFA 1LQTA 2BCGY 3ZZMA 1BN6A 3P96A 4HZUA 1R8YA 3JSAA 1EVKA 1PGNA 3JXEA 4NZYA 3JS5A 4W7HA 5D2CA 2BISA 3KZKA 2WZBA 3M6IA 3UAGA 3ANLA 4UHHA 2QRMA 4YO7A 4H4CA 2PRZA 3ORQA 4RPGA 4BO2A 1CEYA 4DBVO 3KKLA 2PXHA 1JHMA 2RH8A 4FGJA 2A9VA 4WXRA 5JD4A 1WXWA 1D9XA 4K03A 3O4GA 3I83A 5FTLA 4E46A 1OAKA 1V7PC 3AB8A 3Q98A 3QVJA 3ZIDA 1SKMA 1M7GA 1BDMA 1L4KA 5AKHA 3N05A 1IUOA 1RYZA 3QE3A 1P1JA 3CRQA 3OHPA 1KR5A 2R62A 1CUXA 1UXKA 3IVRA 4C3ZA 2GBIA 3PC3A 4QRIA 3V4PB 3L8DA 2P0EA 3SBXA 5I6DA 1G63A 3H17A 3RTBA 4LBYA 3WV4A 3KOOA 4LYGA 3EGIA 4PSDA 3RTDA 1C9JA 3W7VA 1BDIA 2ZK7A 4ZMBA 3B38A 1J07A 1JEDA 5AT1A 5SZHB 1P1CA 1PR1A 3CHYA 5EE1A 2QQ0A 2DE0X 1JL3A 1AD2A 1EVEA 1A5BB 1CZLA 2I1WA 1L7QA 1U7WA 3IDSA 1ZGJA 2RGNA 1B0UA 1ZVVA 3C3KA 1UMDB 3JR3A 3QMWA 1GYRA 4UUAA 1IOLA 5IAOA 4W5RA 2BFBA 4IILA 1N8TA 2Z1MA 4ENVA 3W6OA 1F60A 3N0RA 1T8RA 1PSZA 4OLBA 1VHQA 2RH9B 2H4JA 1K66A 1N5DA 3KG2A 1EK2A 1NP7A 5LR6A 4IEIA 1NASA 1XRQA 1RQ7A 2FUNB 5SYNA 3S3TA 3WWYA 3BE5A 4S1OA 2NPFA 1RZRA 2WSSD 5DK6A 3FDXA 4QFCA 3HUUA 1EPUA 4MO9A 4DAOA 1U1FA 5FA6A 4DIMA 2MMCA 2MU1A 3C3BA 2ZRNA 4AS3A 4PCLA 2YWJA 5HF8A 1FUUA 2ZATA 3P0IA 4NECA 3ICQB 4A4DA 4YUWA