4X8MA

Crystal structure of e. coli adenylate kinase y171w mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEWHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 214
sequence length 214
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8mA00
1SVIA 2C9CA 3UG6A 3LQRA 2FSIA 2QG6A 3QE0A 4TL9A 2JLXA 2CLDX 4DCTA 2Z0MA 4GRAA 4GBMA 5FOSA 1ZYUA 1F3OA 3AP2A 3GLFE 3LBHA 1W44A 1ZAKA 4W5HA 4V0MA 2HXSA 2SHKA 1K5GA 4RD3A 3DZDA 1IN4A 2WICA 4EPVA 4WAUA 1RFLA 2JLRA 4I1VA 4QHSA 4BLTA 4DCVA 1YR7A 4EQ6B 3RSLA 1HA3A 4Q1EA 3QSYA 3TUIC 3SNHA 5IRCD 1L2TA 3U3JA 2H18A 1IQPA 2RCNA 1T5IA 2V6JA 4GP7A 4EPYA 3RRYA 1NIJA 3TK1A 1G6HA 3GQBA 2VL7A 4AIIA 1T0JB 4ASUD 2J7PD 1EX6A 1HT2E 1XF9A 4Z8YA 1IXRC 2GBLA 3CPEA 3UATA 3K0FA 1KI6B 3REGA 1XXHE 5FPTA 1NY6A 3B9QA 4HB2A 4AYXA 1Z0KA 2QTHA 5E95A 3QXHA 3GLFB 2ZRPA 4C7OB 1OYYA 4C4PA 3O8BA 1TF7A 3SEAA 4UQOA 4QC2A 2RGNC 3WP1B 4QXAA 2OILA 2BCJQ 2QP3A 4Q19A 4BZXA 4OHXA 1IN6A 4LYFA 3TSZA 4ILEA 4D80A 2OT3B 3MFYA 4OK5A 3VHLB 1O3YA 2ERYA 3H0KA 2YOHA 4XWAA 4ZCMA 1HQYE 1KDRA 4IEIA 1XD8A 4BGDA 5FL7D 1VCNA 5EXTA 2O8BB 1EFCA 1NLFA 1N5KA 2QAGB 3TKLA 4QHYA 1LB1B 3IPYA 2QA5A 1HE8B 2GTPA 3FMOB 1YKSA 5JZVA 4RD6A 1J7KA 1X6VA 3ZIAA 2AKAB 3SJBA 2DB3A 2VA8A 1W0JA 2WKQA 4LWZA 3R9XA 3LNCA 5K8IA 2OXRA 3X1XA 1KY3A 2HUPA 5FH9A 2ZVQX 2O8CA 3AF1A 2WSSD 2AK3A 4JYCA 5H68A 5CYPA 4Q03A 3CX8A 5LB2A 1ZUHA 3REFA 4A92A 5D3MA 1UDWA 4C0HA 1KI8A 1U81A 3VU9B 2QNRA 4V0NA 4QM6A 1EGAA 4H9GA 4KXFB 3OHMA 2EWVA 1R7RA 1E69A 1U0HC 4ARZA 3THYB 1OIXA 2REXB 2HYIC 1QVAA 4BECA 3N2EA 5KU1A 4KYIB 1P6XA 4BFYA 3HU3A 1XD2A 2F9MA 4V0OA 3KUDA 1YZLA 3MLEA 1FL9A 4K46A 1ZVQA 1TU4A 5DIFA 4BEJA 5BXQC 2O8DB 1XMVA 1TU3A 3V00A 4K8OA 3GPLA 2CL7X 2Q6TA 3PUZA 1W4CA 4QGHA 1C4OA 1II9A 3OIVA 3EPLA 4M0LA 3VHXA 1DO0A 4BLPA 4KI0A 1NN3A 2QP4A 2QRZA 3R7WB 1T5LA 1AZTA 5TMPA 4IHQA 3H2YA 3W6OA 3RRZA 3GCGA 1XU4A 4A36A 1HY3A 2IYUA 2WZQA 3BB3A 4A0HA 3VR1A 1N6KA 1CULC 1JPJA 4O2LA 5FTJA 2WV9A 3CUEF 3E1SA 1DPFA 4HZUB 3V4FA 2FX3A 4GOJA 5LBIA 5JI3E 2QTVB 1CEEA 3IQXA 2IXGA 3FMPB 3W5IA 3AVUA 3AVVA 1P2SA 3PIRA 2P6UA 1W36D 3A8TA 3ZD7A 1P73A 4DEXA 2I4IA 2GAAA 1E0AA 1G16A 2BBWA 2GJAA 3NWJA 4UNQA 3U7GA 4WZ6A 1W1WA 1OH5A 3D7MA 2ZPTX 4OBEA 2IX3A 1E98A 4PO1A 2ZRIA 5HTKA 4B3GA 1XTSA 1XPUA 4IOMA 4QG7A 4R2HA 1Z6AA 3QENA 1J99A 3I5YA 3NBYC 2QM8A 5EE1A 1EWRA 121PA 1OXXK 5FI0B 2Z4RA 4UNRA 2QTFA 4DRZA 2FDCA 3DVLA 4DT1A 1NJFA 2QAGC 2X19A 4TTPA 3L8ZA 1LF0A 3KKOA 2GNOA 5IK2A 4U00A 4HSEA 4EPRA 3GLIB 4BQSA 1YR8A 2QPAA 4NH0A 3WYAA 1FZQA 3QUSA 2JDID 2EQBA 2PMDA 4DUGA 1E1RD 3CNOA 5F9FA 1OKKD 1T4GA 4MKFA 3I1FA 1OH7A 4LPSA 3FHOA 3CRQA 1FW6A 1XTRA 3WP0A 3U7HB 1U2RA 4LBYA 1N6HA 2AFIE 4YC7A 2JASA 2NO7A 3NBFA 4NPHA 4PAOA 3B1YA 2Q21A 3OIUA 2ZRMA 5HE9A 4F92B 2ZJZA 1PVOA 1LF5A 1XJ0A 5JJLA 1IXZA 5L8VA 3ZZTA 2O0HA 4Q7KA 3QVUA 4RCYA 2BBTA 4XWOA 1UKEA 5JRZA 4HB0A 1CF4A 1U8YA 4MGKR 2V7QD 3I73A 3SI7A 1CJUC 5HPYB 5C4GB 4IOLA 1N5IA 1ZBDA 2GKSA 1NY5A 2ZYTX 4OYHA 5CDFA 1GKIA 1DAIA 3BGWA 4B3DA 2QBYB 3L0SA 2G6BA 3TVDA 5HCNA 3IIKA 3DHWC 1FTNA 2CHQA 3O8CA 1KI6A 1KDTA 2Z6VA 3SYNA 4ZPXA 2B8TA 4UXIA 2WMNB 5JECA 1RRFA 2W58A 3B2EA 4HEJA 3AVXA 4WZAE 5JLJA 1ZIOA 1XNJA 3QKUA 1PLLA 2XTZA 3QPWA 3FVQA 1Q1QA 1XCMA 4XSGA 3W90A 4F7WA 1MRSA 1XWIA 2VSOA 1X8JA 1JB1A 1SZPA 4DLYA 1UJ2A 5BN5A 4DLSA 4AC9A 2ZRLA 5CYOA 1U99A 4BUJA 3W5JA 2YOGA 4B74A 3T1OA 3TIFA 2WJVA 2HCBA 2XB4A 2BM1A 3KFXA 1S1CA 3U2QA 4N3NA 3ADCA 1T8TA 5FR1A 1NN1A 1MH1A 3AVYA 3B8HA 3I92A 4BZQA 1UFQA 4LV5B 2NO0A 3ONWA 2O8BA 2OG2A 4Q00A 1OXSC 1D5CA 1QHXA 3GFOA 3KB1A 4Q4LA 2KB0A 4TLAA 3OFNA 4G5OA 5DHAA 2H1LA 3ASYA 3W8NA 1XPOA 1TADA 4P31A 4DDWA 3TNFA 4PPGA 4PSKA 4BLQA 2BMEA 1UF9A 3TE6A 4DVGA 4QBGB 2D3WA 1ZNYA 1H8HD 4A8JC 1VKJA 1G4AE 4F4IA 4MDEA 3L43A 4B34A 2IWRA 2GF9A 5P21A 3ICEA 1NVXQ 3FMFA 2LCFA 1GRQA 1NN5A 4LC0A 1KJYA 4MRPA 4HUTA 1U9IC 2CHVA 5KDOA 5JJKA 3K0AA 1UKYA 4NTZA 1E2HA 3MWYW 4DCNA 4ZO4A 2F7SA 4FCVA 1JJ7A 2WWHA 4TT3A 4OHVA 3FHCB 1XDBA 2VEDA 4PHFA 4JMPA 2OCBA 3I32A 3QPVA 5DISB 5EXSA 4D81A 5DN6D 2V8OA 3HYRA 2JJ2A 4B2LA 4JS0A 2E1RA 1P3JA 1Q1EA 1VDZA 2AX4A 3CF2A 1DAHA 2FWRA 1Z3IX 1I4TD 3Q5EA 4WBSA 1WA5A 3KJGA 2HF8A 4D2IA 3LBNA 1E2KA 1KI1A 2O8DA 2QE7D 2FSFA 5CM8B 4CYMA 4CF7A 3FKQA 2DHRA 1OFTA 4TYQA 3QEJA 4Q4JA 4KJZA 2BCGY 4LJ4A 3W3AA 4JL8A 1E9RA 3KJIA 3RANA 3EIHA 1WDTA 1W36B 4OQLA 3KQNA 3GJ3A 3LLMA 1XBTA 3QY0A 1CR2A 3CR7A 5TY0A 4YDHB 1S3SA 4ZKDA 4M4SA 5FBVB 3CIOA 4N1AA 2YKGA 4AURA 4ESVA 1AS3A 3IO3A 3PJRA 3LW7A 3EZ2A 1A1VA 1N6OA 2D06A 3L0OA 4LBWA 2HXYA 5E4FA 3ZDQA 3EXAA 1NMXA 2A5YB 1TF2A 1NG1A 2JAQA 1B23P 1WRBA 4C0KA 4M22A 3AEZA 3AKYA 1G8YA 4HZUA 2Q9BA 4TQUS 5L3QB 1NIPA 2QM7A 1NMYA 1YR6A 2QZ4A 3C5CA 2XEXA 2ZEJA 1GL7A 5AUOB 2UZIR 4FCTA 1U90A 3ZYCA 5JMTA 2IK8A 3T5GA 4AKHA 3HP1A 2AK2A 1MO6A 4TTRA 3B1ZA 4QHTA 1GOTA 2GEVA 4Q47A 5KO2A 3NHAA 3QKRB 2PT7A 1DADA 3UMSA 2R65A 4PPNA 4URYR 5E7JA 3NH9A 1TQ2A 1Z08A 2JCSA 4ACBA 4IXMA 2QN6A 5G53C 4V0ME 1DG1G 1GNQA 4L15A 1BH2A 3H4MA 5AR1A 4ZDIA 5FL3A 4US2R 2P3SA 1ZRHA 4DSNA 2ZU0C 1M7HA 3K09A 1R6BX 4EFMA 1VMAA 2RGDA 2ZRKA 2C98A 3OIYA 4GL2A 1M7GA 2A5GA 3GJ0A 5LPNA 2GXUA 3A1UA 3FFAA 3HPQA 3RRNA 2ZRDA 2WWYA 4GFDA 4X8HA 3GLIA 2PCJA 1US8B 2ZSAA 3RRMA 2FFBA 1T3SA 1KI7A 1UADA 3SHFA 3VQTA 4PZLA 4OL0A 4Q9HA 4D6PA 2ZJ2A 4URWR 2PCLA 4B2IA 1L8QA 3K8YA 1N0WA 3KJEA 4LX0A 4WOPA 1F6BA 4AK9A 3I8XA 4B3BA 1KSGA 2IYVA 2BV3A 1CIPA 3SBEA 2IHYA 3QF4A 3T15A 5IK2D 2WWIA 2HYDA 2RHDA 1IOZA 1T91A 1ZCAA 4PHHA 4WXRA 4ASUA 2G1JA 1CKEA 3BH7A 4AD8A 4A0FA 3MMPA 3RHFA 5KYKA 4BE7B 2ZYUX 1OV4A 1P72A 2EU8A 2XTNA 2CLSA 4GSYA 3RC3A 4DUGD 3B13B 1W0KA 4G3XA 2OUKA 2WVJA 3BJIC 1KTVA 4LI0A 5JWRA 4RSGA 1VHTA 4JKIA 2IYWA 3PUYA 1Z6XA 1YR9A 4L4UA 4U5XA 1Q3HA 2VHJA 1EK0A 1II8B 3AVWA 1XRJA 3K0FB 1E2EA 2ZJYA 3IEVA 4JKYA 3LWNA 1GVNB 2YVUA 3ZVRA 1TTTA 2F43B 3AUYA 3WMGA 3U6KA 3WRXC 4W7SA 1NJGA 1QHGA 3BORA 4TYNA 2DYKA 3B6EA 2OBMA 3G82C 3RS3A 5JHGB 3TR0A 1TQ4A 2R62A 4IDOA 3IIJA 1SVOA 1Z0DA 3B78A 3QKTA 1XMIA 1GRNA 4EFLA 5EE3A 3AVPA 4PANA 4BRWA 4DEYA 1KKMA 2DBYA 1Z0AA 5KSYA 1R0XA 3ECCA 3U7EB 3CX6A 2IYXA 2QAJA 1E79A 3BIFA 4L8GA 3GEEA 3WRYC 1CU1A 4Q1AA 5BN3A 5IDVA 1E99A 2VP6A 3THXB 1XD9A 2BC9A 5TVKA 4B3CA 4URVR 4C0LA 1GFIA 2ZI3A 1MKYA 2ZUBA 2H17A 5B64A 2FPMA 4QGGA 4OJQA 2ZROA 1Z6GA 2ORIA 4WVFA 3W34A 3ND9A 1Z28A 2YNMA 3PV0A 3KB2A 2ODEA 2V55B 1JXMA 4B3XA 1M74A 4CZ2A 1R0YA 3HU1A 4WA7A 5UKDA 3VR6A 3MWLA 1P5ZB 3TW8B 2WTUA 4YLGA 3SBDA 5D3MB 4RD0A 2OAQ1 5EP4A 3SDZA 1ZJ6A 3BERA 4QBIA 4DIDA 2ODWA 3ZVLA 4NCNA 2QT0A 2EFHB 3SJCA 4BFWA 5JEEA 2GCPA 4Q9IA 4B71A 3RS4A 1ZM4A 4A2QA 3OFND 4HLDA 2CXXA 1JPNA 4DBLC 1NN0A 3NDBB 3SQWA 3B82A 1EFRA 1KY2A 3FGNA 4JLOA 4AYTA 1XD2B 1QG4A 2YYZA 3WHKA 5BQ5A 4PAMA 5AJVB 2ZYVX 2G88A 3TSOA 2FFHA 2MMCA 1QG2A 1JNYA 3U3MA 2Q9CA 3E5HA 4R9UC 2WWGA 4MRVA 3ICQB 2F3TA 1JEEA 1W2HA 4FW9A 4A2WA 1E2JA 2P65A 2J0UB 4O0MA 2IYYA 3IBYA 5AUQA 1GNPA 2XZPA 3OIWA 3TQFA 1D9XA 1LVGA 1TPZA 1NKTA 2GEDA 3A4NA 3SOPA 4U7DA 5EP3A 2IWHA 2DFLA 5JJIA 4AKIA 3UPUA 2YV5A 4M21A 2NQ2C 4QNMA 2GBLC 4Q1FA 3TUJC 2A5FA 3DDCA 1L4UA 2JA1A 4H1VA 1VG9B 1QZXA 2RHMA 1G5TA 1VIAA 2XOKD 3IILA 4US0R 5FI1B 3CO5A 3BE4A 5KSZA 1M8PA 1DVRA 2BM0A 4UJ3A 2WAXA 3SR0A 3UXMA 1IJEA 4LSGA 4TMTA 3K0CA 5DE3A 2ZI7A 4LJAA 4UNPA 3SU8A 3FDIA 1SHZA 2HJGA 2OFWA 2G0TA 3HJNA 3A37A 1NLYA 4LPKA 1N6NA 5HE8A 1GILA 1XB2A 1S96A 2I3BA 3LFUA 4PR0A 3QVVA 4Q1DA 3VX4A 2AXNA 4DSUA 2WSMA 1AS0A 1G8FA 1NL3A 4JJKA 1AJEA 4NHOA 4A6XA 4XD7A 4MRNA 4YMTA 4IDNA 4M1YA 3QKRA 2ODBA 2VLIA 3UKDA 1IBRA 5EXPA 1U94A 2ZETA 1A4RA 3BB1A 1MV5A 2F1RA 1FUKA 3F3YA 1P7CA 4IDQA 1G41A 1OKKA 5DGXA 5AWFC 4JLDA 1OF1A 4TZ6A 1KYIA 1I2MA 4NCHA 2DWQA 1KK1A 2WBLC 4ZV4A 4MKIA 2P5TB 1MO4A 2WWFA 3NHBA 3Q85A 3GP8A 1RYHA 4JBXA 4P33A 3RNLA 5BN4A 1ZU4A 1E2NA 1II0A 4E07A 4NDZA 4V0LA 3CZPA 2ATXA 5CDFE 4M9ZA 2J0QA 1US8A 1AM4D 2HLDA 2R8RA 3DKVA 1I4DD 2ATVA 3GJ8A 1XCPA 2O8FA 1VCOA 3T1QA 2ZSBA 3EIEA 3IBGA 4FMDF 3VR2A 1MO5A 2V7QA 3AKDA 4P0TA 4BFVA 5CLLA 4DLRA 2HEIA 2XZLA 4BFTA 3K9LA 2D7CA 4C0SA 2GETA 2WJJA 5FTKA 1J70A 5JI2E 1F60A 2J1LA 3LX8A 1JEDA 1Q57A 5DNYB 1YZKA 1EWQA 4X8OA 5CIQA 1H8EA 4B73A 3U44A 1SVSA 1N0UA 1XJQA 1W48A 2IF0A 3K1JA 4QL3A 4A9AA 3ZVNA 1S2MA 4OI1A 1DAMA 1XEFA 4PHGA 4IOJA 1X8KA 3OZXA 4G5QA 3MJHA 2ASEA 1A5TA 1P9RA 1W2GA 5SZKB 1II8A 2GZDA 2G1KA 3K0SA 3SN6A 4KVGA 4XWKA 1YRBA 1UM8A 2OFOA 3CF6R 1E2PA 1KZ7B 2F43A 2B92A 1CR0A 1F5NA 1W0KD 2R6FA 3P1JA 2Z83A 3VKHA 2PL3A 2ZS9A 4HLUA 2CK3A 1YJ5A 4RCZA 4CVNA 4JIMA 1PUIA 2C8VA 4XOIA 1IM2A 1Z0JA 3AM1A 2J3EA 3QXCA 2FPLA 1KKLA 1N25A 2YWEA 3WNBA 1G6OA 4NBSA 4QGAA 5E7IA 721PA 4JLAA 4TLBA 3WBJA 2C95A 4A0GA 3OEHD 4LUCA 2J59A 4PX9A 4NYIR 2IXFA 4W9MC 4I4LA 3B1VA 1SVMA 3I61A 5C4MA 1EFTA 5B30A 2ZR0A 2RB4A 2XGJA 4BRUA 1H8HA 1KSFX 1ZM2A 3CNNA 5JBQA 3QG1A 1RRCA 3THXA 4DB2A 1LTQA 1NVVR 4AYWA 5SZHB 3TAHA 5GJCA 1G8GA 1CR4A 1KIMA 3PEVA 4EFNA 3A1VA 2VBCA 2AD5A 4IW3B 4TQ9A 5FUVA 1E79D 4RD2A 3AUXA 4WW0A 3RLFA 3AGQA 2HCJB 4I1OA 1JQJC 3EA5A 2AFHE 1X3SA 2IA5A 3FE2A 5C1BA 4Q02A 5EP2A 3DEFA 2FNAA 4MGYR 4HB3A 1WXQA 2AL7A 5DN6A 2B21A 2QUZA 3BOSA 1DAKA 2ZSDA 2C77A 1QF9A 2FPKA 3MSXA 3MUFA 4JSTA 3KQUA 3K0AB 2Q3HA 5KDLA 3C15C 4LV8B 3D31A 1G9XA 2FFAA 3HR8A 1W49A 3IHLA 4C3ZA 1VIYA 2QE7A 3NC0C 3CH4B 4MRSA 5EE0A 4QKQA 2ZUCA 2X1VA 4NL4H 1DOAA 1E9CA 1NP6A 3C8UA 3CB4A 5J47A 4DLXA 4GOKA 3NBZC 1G64A 4PAQA 4IDHA 5ELXA 1IHUA 3PUWA 1EFHA 3B85A 2EFDB 2D7DA 2FG5A 3QI2A 3R20A 2R9VA 4Q4JB 4DLZA 1GP2A 2OFXA 4P4TA 2GJ9A 2GESA 4OK3A 3SE0A 1EFRD 2J0UA 2BKEA 2VF7A 3DZ8A 2NTYC 1W5SA 1GIAA 4E03A 1G7RA 4C2TA 3TVTA 4PC7A 1XEWX 4OQFA 3QQ5A 1VECA 1KZGB 3RC8A 2ZRGA 4V02A 2WIBA 1KDOA 4ZDWA 3FYHA 4ZIRA 5A0FA 4YMVA 3SYKA 2GZHA 4LYJA 5AK0A 1D9ZA 3EZ9A 3WYFA 2P0EA 1J8MF 3O8RA 5BW8A 3GLIE 3DKPA 4XVRA 1E2IA 4PPFA 2FV8A 3TW4A 5J4VA 3U7FB 2GVDC 2DWOA 2W2XA 1EESA 1QBKC 2IUSA 1JI0A 1OFUX 1OB5A 4P4SB 1TMKA 2QPOA 1N6IA 2IYSA 1OPXA 4G1UC 4Q7LA 4NP6A 4JBWA 4V0KA 4F4JA 3P26A 1ZNWA 2YC2C 3BH6A 1C9KA 2W6JD 5FUXA 3EZFA 2V1XA 3AF2A 1G20E 2ZREA 3TMKA 1PZNA 4A2PA 2ZRFA 2W00A 1HTWA 4MUAA 3A4MA 4B6EA 3FOZA 2YJTD 2FN4A 2CVHA 4EKDA 4PO8A 2CL6X 4FCWA 1OHHA 1SVKA 3AVTA 4MRRA 1LFDB 1IY0A 4Q1CA 2UKDA 3P20A 5B2ZA 3A36A 4FINA 3R8CA 2QGNA 5JSZA 3KKPA 4XD7D 2NO9A 2GDJA 4LJ7A 2AN9A 2GXSA 1VHLA 5LB4A 1ZD1A 2BHRA 4A0RA 4EPXA 1ESNA 5FOVA 2RGEA 4NYMR 3VR5A 3GJ4A 5JWOA 1MR3F 4Q18A 3QXXA 3KXLA 2KE5A 3GFTA 3HU2A 3IGFA 4DHEA 3BFVA 3QF4B 1CP2A 4BLOA 4ZDKA 2NMVA 2P2LA 4L16A 3VNVA 2JATA 2PLRA 3S1AA 4JVNA 2VSXA 3LAWA 3QF7A 4HAWA 1KMHB 2CCGA 5EXXA 3WY9A 3BFXA 3ZS8A 3PVSA 821PA 5DH9A 4QNRA 1E6CA 3ZLJA 3RS2A 1T3HA 1Q0UA 2J0SA 1DAFA 3EPJA 2HLDD 3CRMA 1E32A 3SYLA 2XB2A 3EPKA 2CE7A 1YZNA 1FMJA 1N6PA 2PT5A 4XVUA 1IN7A 1HE1C 1F2TA 2V54A 1NVWQ 4D25A 1I4LD 3ZJYA 4NYIQ 4HAUA 3UMRA 4M9XA 3I3SR 1R8QA 4CW7A 2DWPA 3I8SA 1FQKA 1H8ED 2VHQA 4OQXA 4FD2A 1NVVQ 3SFZA 4EPWA 4YMWA 3VNUA 2AHOA 3MD0A 3TBKA 4PFSA 4ESHA 1QHNA 3KX2A 4MGIR 5EE5B 1QDEA 4Q01A 1Z63A 1L4YA 4FIDA 2RAPA 1Z5ZA 3NC1C 1AKYA 4MYHA 5CLQA 1LV7A 2X2FA 4Q4HA 4ABYA 1M7BA 5H1YA 5K8TA 2BJVA 2BEJA 4JL6A 4IFBA 4D4MA 4DLTA 1ZUNB 1MRNA 4C0JA 1NNEA 3HWSA 5F3WB 5C18A 1JJVA 1P2TA 2HJVA 4V03A 3A4LA 3GJ7A 3DOFA 3R9IA 4HAVA 3KQKA 1FNNA 2OV2A 4GNKA 2PX0A 4KHZA 4Q1BA 2CK3D 1VG1A 1UPTA 2B7BA 1AN0A 3GJ6A 4EJSA 3OE7A 1YZTA 8OHMA 2JLYA 1Q22A 2ZXUA 1XCGB 1KO7A 1G8PA 1TUEA 1KK3A 3B60A 4XSHA 1SXJD 1AZSC 3K09C 5D3QA 2AXPA 3C5HA 5CIWA 4ZCIA 5EUQB 2C9YA 4TSFA 4R71A 2IS4A 4IOKA 2NZ8A 4D0LB 2GILA 4Q48A 3ADBA 2VQSA 4GZLA 3UG7A 2ZI9A 3FPAA 2ZANA 4JL5A 1E2LA 1ZINA 3D8BA 5JS7A 1ZUIA 2HDNB 1WMSA 2PX3A 2R6CA 2ZJAA 2UZ3A 5GJVC 2F9LA 1XFAA 2FJUA 2D4HA 3AF4A 2ZE5A 1UKZA 5TARA 5IF9A 1OXVA 4DSTA 5CB6A 1E94E 2Z5FA 3Q7PA 5DI3A 3NKVA 2X2EA 4LJ8A 1KI3A 2IUUA 4MKHA 2VHUA 5FBQB 1G4UR 1E0SA 3RWMB 1G1MA 1UBCA 2JIZD 2WPDA 5JCPA 1P2VA 5A4JA 3F5FA 4BFSA 1VCIA 3MRSA 3LH5A 2WM9B 1VYVA 3KUCA 1BS1A 1BYUA 5FPYA 3VR4A 4AG5A 1ZU5A 2J0VA 2XOKA 2BJWA 1KO5A 3CPHA 2K5UA 3EWAA 2BMFA 3CM0A 2KWIA 2BBSA 2QQ0A 1N3BA 3ETLA 3THWA 2DFTA 3I62A 3KJHA 3KKNA 5A5GA 2JLSA 3KKQA 2IYZA 1G3MA 5BWMA 3BH0A 5B58C 3EZ7A 1GUAA 1X1SA 1ZC4A 3N5CA 1JALA 3EIQA 1AQYA 1BO6A 2KSQA 1RKBA 2ZSFA 3PG5A 4QGFA 1GM5A 4NU0A 2QT1A 1Z83A 4RY2A 4P4UA 4G5GA 3O47A 2ZR7A 5JCZA 2IHBA 2EVWX 1E9DA 4I99A 5DLQC 1XTKA 1MABA 2P67A 5SZJA 3UMFA 1G291 2BOVA 2JLZA 2XXAA 1S9HA 4P4SA 4ZCLA 1JAHA 1G3IA 2IS2A 2LKDA 4NE2A 4D4LA 2ZAMA 3EARA 3FWYA 4Q9JA 2EFEB 4B76A 4PZYA 4Q4AA 2JEOA 1ZNXA 3KL4A 3T61A 5GADl 1Q12A 4DKXA 3Q9LA 4KVAA 4DDTA 4F91B 3MJRA 2ZJ5A 4JLJA 5L3RA 4DCUA 4TYPA 3U3RA 1WBDA 4HAYA 1XZPA 5TV2A 3RDPA 4LJ5A 2CCKA 3SJAA 2CVFA 2PZFA 3U6BA 2FEOA 2PEYA 1UKVY 1SQ5A 2IYRA 3QOFA 4BFXA 1VPLA 4JJZA 4RD1A 3GLHE 3KQLA 3X1DA 3PEWA 2N42A 3QNUA 2WIAA 3IDQA 2G0NA 5TDHA 3G0HA 2O8FB 4Z54A 3W9YA 3WHLA 3E70C 2OLKA 4Q9KA 1E0KA 1OHHD 1C1YA 5KSOA 4HDCA 1T6NA 4LHYA 4OK6A 3TGPA 1KMHA 4BEBA 3U44B 3DM9B 4MYCA 1SXJE 3QJYA 2EFGA 3QKSA 2ZRNA 4W5JA 3K53A 2IW3A 1CRQA 2JLVA 4BWYA 4XH9B 2YWHA 1EXMA 4W5WA 1Z22A 3PITA 3CWZA 4PC2A 3MG9A 4DIEA 3KQHA 1LY1A 5AJZA 5FFMA 1G5PA 1GTVA 1DAEA 3AVOA 3UANA 2PZGA 1KO1A 3GLHB 2H16A 1IXSB 3KKMA 3L0PA 4MA4A 5JHHB 4PXAA 5L3VA 5GJWC 2IEYA 1UAAA 4NMMA 4JLPA 2FSHA 1W36C 2CE2X 5CM9C 2QY9A 4DXAA 2FSGA 4M8NE 3OEHA 1O87A 1N5LA 4KFSA 4IKEA 3FTQA 4A1FA 2LKCA 2CDNA 1JR6A 2WKPA 2NPIA 4YXWD 4KAXA 3SQXA 5B57C 1E4VA 3CKLA 1CBUA 1U0JA 1E2DA 2GJSA 1KSJA 1Q44A 3V9PA 3K0CC 1ELOA 3TH5A 2OBLA 1SXJB 1TX4B 3RWOA 2GA8A 2V6IA 3E2IA 3IO5A 1QHHB 4RZ2A 3CONA 1TF5A 5CITA 2VH5R 4M9SA 1R5OA 2PZEA 4KBFA 4NCIA 4L9WA 3W6PA 3AKEA 4D4KA 2P5SA 1B0UA 3JVVA 4LYHA 3MGCA 3NVAA 5AUNB 2IYLD 2C03A 3MAAC 3AH8A 4HLQB 3H86A 3KTAA 2ZQ5A 4HI0E 3VMFA 4TMKA 1NMZA 2QPTA 2C04A 1K6MA 4JVLA 1SKYE 5DI9A 2VIIA 5FPSA 3VR3A 3ZZUA 1XPRA 5EQTA 3MWJA 1U8ZA 4MDFA 5BYKA 1W5TA 4AKEA 2XAUA 3SS8A 3C16C 3CH5A 1CTQA 2YWGA 1OIVA 3OE7D 1UBFA 4D0GA 5KNDA 4TQAA 3AVQA 2ERXA 2YOFA 2R6AA 3LD9A 3Q7QA 2ONJA 4LOAA 4Q66C 3ZH9B 2AR7A 5H70A 4CDGA 4E5UA 1NBMD 4IJMA 2GAOA 2VHCA 1NI3A 4TL6A 4GMDA 1A82A 4HZIA 4O25A 1OJLA 4TSFD 2XX3A 1YZQA 2QU8A 2WJHA 3QBVA 3VAAA 1YZUA 3KFVA 4YMSA 1FX0A 2PEZA 1K8RA 4HLCA 4OI0A 1E9AA 2ANBA 3QG5A 4B32A 4S2EA 3U5ZB 4CIDA 4PC6A 3LXXA 2QMOA 4D0NA 1E96A 1A2BA 2QMHA 1SKYB 4IRUB 3IEUA 3MWKA 4PQRA 2VTKA 3AV0B 1TNDA 3LY5A 2AWOA 4I1UA 4WIAA 5J4LA 2CMKA 2XITA 4RFSB 1W7AA 4OHWA 3G5UA 3P4YA 4TMXA 1E9BA 1RRGA 2J87A 2PJRA 4AY2A 1KO8A 4ZI2A 4M1MA 1NVUQ 1TEXA 4DCSA 1ZW6A 5E7MA 2WPDD 4ZIRB 1COWA 1GRRA 1P75A 1ZM3A 4M1OA 4EUNA 2IYTA 1KGDA 4ITRC 4CGZA 4N0EA 1HUQA 2W6JA 4HLUC 2WJGA 1DTSA 1KO4A 2ZI5A 6Q21A 1XEWY 3CRRA 2WOJA 1P2UA 3ZD6A 3CLVA 1XTJA 3TQCA 1NRJB 2VHTA 1X8LA 4RD4A 3WMFA 2BWJA 3ADDA 4ZDJA 1KI2A 2O0JA 1L7VC 3PCRB 3THOA 2Z4SA 3NEJA 1SHKA 3PUVA 4LDJA 2YC4C 3EG5A 2IS1A 2A3RA 1R5BA 3JVUA 4LCBA 1W4RA 5H8WA 1PLKA 5GJBA 5EE9A 4PZZA 3LXRA 2IL1A 4FMDB 1NG9A 2QENA 3AKCA 4QJ5A 1CJTC 1OYWA 3T06B 2KBFA 4DDVA 2I1VB 3EC2A 2JLUA 2OXCA 3QBTA 1CJMA 2EYQA 1G3RA 4PTLA 5HZHA 1LW7A 2CNWA 2R6DA 4FMCF 2OESA 1BKDR 1KAOA 3QEOA 1VYUA 3HR7A 2Z43A 4CT5A 1SULA 1FOEB 5JSZB 4OI4A 1G21E 4LBZA 1E3MA 2QI9C 1DBSA 4S35A 4TL8A 3BFKA 4B75A 3EC1A 2E87A 3A1WA 4MITA 1HH4A 3CRVA 1Z29A 4LHXA 2FE4A 5K8LA 2XTMA 1NLZA 4KYUA 4GDFA 1WE2A 2BMDA 4BFZA 1CJVC 1XEXA 1D2EA 4M9QA 3S1AB 1SVLA 3IHWA 5AJXA 3VKGA 5TXGA 4AG6A 2C99A 4RZXA 1XP8A 1KI9A 1KK0A 3U3KA 1Z06A 3T1TA 2F1JA 3QIAA 2G83A 2W2TA 3BC1A 1CS4C 4URXR 2ZJOA 2EWWA 1F2UA 1UDXA 2VP0A 2ZSEA 3UWOA 1JAIA 1RW4A 2BDTA 5CK5A 5F9HA 4MYUA 4M1SA 1Q20A 2ZE6A 3Q3JB 1F2TB 1GAJA 3EPHA 2ZVPX 2BVNA 4PHTA 2ODNA 1RRPA 3AP1A 3PFIA 3ND8A 3GFPA 2YINC 4JT2A 1GKUB 2GEUA 1LNZA 4EPTA 3C7KA 3KDSE 3LQQA 4LV6A 1OIWA 3I5XA 3CW2A 2OCAA 3CPJB 3NIBA 2Q0HA 2OSBA 1BMFA 4BLSA 2KI5A 4EIWA 2JJ8A 2J7KA 3GLHA 4XTRA 5KHOC 5AJWA 4B3FX 621PA 1NBME 5FOXA 4HATA 3FMIA 4GZMA 1E1QD 3WBKA 3BRWD 1JR3D 3TAUA 1FTSA 1XJCA 3QXJA 5CB8A 2IT1A 4Q4HB 3Q72A 4KODA 3VKWA 4HB4A 2DR3A 2YHSA 4LHWA 1AKEA 1KDPA 3ZS9A 3UK6A 1J90A 1BIFA 1TAGA 3L82B 3EWSA 4IVPA 4TYYA 1FPMA 1HQCA 521PA 3TSWA 2BBOA 1HV8A 1SXJA 3BWDD 2P6NA 2JLQA 4Y0AA 2P6RA 3W6NA 4F4CA 2IUTA 1QHHA 1AGRA 4EJSB 4IDPA 1E0JA 3GJXC 4KITB 5JRJA 5L3SA 1XTIA 3AF3A 3LBIA 4DLUA 2ZJBA 1P4SA 3CRW1 3FHTA 1XZQA 1AK2A 2REBA 3C14C 2EFCB 4HAZA 3IIMA 2DCUA 2XZOA 5FTLA 1M34E 4JBYA 1SKQA 4TTQA 4LZZA 2BIFA 5EP1A 3EAQA 3GEHA 421PA 3B7GA 2JIZA 3K70D 4HDQB 2OCPA 2RGGA 3LVQE 4UXJA 1XXHB 2KJQA 2DFKB 1ZP6A 1OXUA 4TYWA 4OKSA 2VP9A 5DI3B 2CJWA 4HDOB 1M2OB 3Q5DA 1ZIPA 4JLMA 2H5EA 2JGNA 4G5RA 3GLGA 2YZ2A 1QHSA 1JQLB 4UJ5A 3FKSA 2ZRAA 3LLUA 2QSYA 4Q5IA 4Q21A 5EUMA 3WNDA 1Q3TA 1ZD8A 1GSIA 4FI3C 2QRNA 2GF0A 4URZR 3TJZA 1HEIA 4RFSA 3GEIA 3X1ZA 3THWB 2BEKA 4PSVA 3EW9A 2ZTSA 4JT4A 5CJ2A 3PENA 2XSZA 4TLCA 3L8YA 1UEJA 1PUJA 3F8TA 3VFDA 3NH6A 4K81B 1HT1E 2JLWA 2W83A 3LV8A 2A9KA 2Q3MA 4RZ3A 3WNCA 4ON9A 1N2CE 1K5DA 2G3YA 4TLEA 4A82A 2PBRA 4D82A 4EDHA 3NBXX 2V1UA 3X1YA 1GNRA 1MOZA 1G7TA 1NKSA 1QVRA 2ZU6A 3BBPA 1NF3A 3JZMA 4QJ3A 3SZRA 4CEJA 1VG0B 1E9FA 1MABB 1EG7A 1COWD 2ZYWX 4RVCA 2XXAB 3RVBA 1R5NA 1RJ9A 1P60A 2FGJA 1BOFA 1AA9A 2QEQA 2FA9A 1FMLA 4F38A 2LWIA 3LW8A 2GCOA 4LBVA 5KUTA 1CXZA 2GRJA 2Q3FA 3TR5A 2ECKA 4QOSA 4FWTA 1Y63A 3M6AA 4JZKA 4CEIA 1HURA 3LO5A 4EJSC 2QP9X 4YDSA 3FFBA 3K9HA 3A1SA 4UKDA 2D2FA 3B1WA 4TMZA 4Q4AB 1RZ3A 5ANRB 5EZ5A 2RGNA 1T0HB 1OLOA 1T8UA 2D2EA 3BK7A 3CZQA 1VG8A 2FFQA 3PEUA 1JR3E 2N1BA 5G41A 4AI6A 1YQTA 1Z0IA 4N0DA 4IVRA 2MSDB 1D2MA 3FB4A 4LK2A 2OM2A 1ZD9A 1DARA 3RABA 1GWNA 2MSCB 2FZLA 4OHZA 4JVMA 4EAQA 1OE0A 3V4RA 1N5JA 1G19A 1OXTA 3WXMA 4DLVA 4RJLA 2W2VA 2QORA 4UXHA 2GCNA 4D4JA 2AWNA 2CNWD 2J5XA 4URUR 2WOOA 3P27A 4GP6A 3SJZA 3CF0A 5KPDA 3O8DA 4WXPA 3M4YA 2CL0X 1TQ6A 3EA0A 5KNBA 1Q1BA 4PPQA 2W6ID 4JYBA 1KMQA 1P62B 5J40A 4A8JB 4YONB 4KO8A 5KNCA 2A7QA 2ZI6A 4GI7A 2VPPA 4HUQB 4QJ4A 3QKSB 1Y3AA 4H1UA 5GVRA 2R2AA 3HPRA 4HYYA 3RAPR 2QL6A 3OEEA 1Z8FA 3RS7A 5J4YA 1OH8A 1X1RA 3HYTA 4YXWA 3CBQA 1E4YA 2ZI4A 4LGMA 3DO6A 2PJZA 2MSEB 3AB3A 4KFRA 4TL7A 4Q9LA 1N6RA 3K0EA 3ZGXA 2ZE8A 3LDAA 1U8AA 2C78A 1F48A 2WWWA 1W4BA 1IY1A 3B1XA 4MYTA 2GZAA 3NTUA 2O8EB 4ACAA 2ZRHA 1J2JA 3NG1A 4DLWA 3RYTC 2HT6A 1FNMA 3SC3A 5AUPB 1FP7A 4TMVA 1GKYA 3PEYA 5C46F 4M2LA 4EQ6A 2BKUA 2FOLA 2WJIA 1BMFD 2GJKA 3I72A 2GVZC 1OH6A 3R9WA 3OF5A 2L0XA 2OAP1 5BYJA 3W3ZB 2CHGA 2JJ1A 2V3CC 4E09A 2DFNA 2FMXA 4A6PA 3BS4A 4RKEA 5FOUA 4Z51A 2NO6A 1E9EA 1Z0FA 3LRPA 4IFEA 1Z2CA 1OFHA 3C41J 5GVSA 2XJ4A 3PR1A 1T3LA 4KLNA 5G3YA 2O5VA 4YQFA 3K70B 4TWZA 1G7CA 1A7JA 2ONKA 3KTAB 3R8FA 3GLFA 2QSZA 2VP4A 4C7OA 1W46A 1CLUA 2CEAA 3L2OB 1QRAA 1WB9A 1NBMA 1Z07A 1GL9B 4RZUA 3OESA 5G3ZA 3B5JA 3DPUA 4X8LA 1Q1ZA 3VX3A 4BZPA 1WQ1R 5K8UA 2IYQA 1A2KC 2OLJA 3A1TA 1U0LA 4I1SA 2B8WA 3X2SA 2ANCA 3T5DA 5JFGA 3KXIA 1N6LA 4UNSA 1PV4A 3DMDA 3BB4A 4B2PA 2OZEA 2C2HA 2NIPA 1QHYA 2RH5A 1E2QA 4OHYA 4TLDA 1R2QA 2OE2A 4QFMA 4PQFA 4KSCA 2GK6A 3I4LA 3KZ1E 3D3QA 2REOA 5JS8A 4E22A 2EW1A 2QMUA 1XXHA 3QXSA 4C9BA 4ZI3A 2QAGA 2IS6A 4B43A 1FX0B 2I1QA 5IHPA 5F98A 4FMBB 1IAQA 2ZR9A 4LYAA 4KBGA 1W4AA 3PQCA 4NYJR 3IKJA 2FZ4A 4JLBA 2B7CA 5LD2B 2A5JA 1X86B 3RSOA 4G01B 5FTMA 1ZNZA 4M1WA 4DC9A 5EJEA 3KXKA 1TL7C 2J45A 2GXAA 4FWIB 4U02A 3ZIAD 1NSTA 3VU9A 1J8YF 1TUIA 1W0JD 4WZBE 4PSAA 1V43A 4OQMA 1P61B 2G77B 4GMXA 4KSBA 3THYA 2CLCX 4DSOA 1R10A 3FKSD 4MKGA 4D26A 1JBKA 3K70C 4X8MA 1Z2AA 2A78A 5DSZA 3AQ4A 3BD9A 5FUWA 4M1TA 4B44A 2QROA 4TN1A 1PJRA 4KV9A 1AGPA 1V5WA 1S0UA 3W8RA 2ZE7A 2FGKA 3A6PC 3U60B 1FFHA 5HCIA 1D6JA 4Z1MA 1YZGA 1Z6TA 3BAFA 3CR8A 2D62A 2R6GA 4IEEA 4KCGA 3OAAA 1D8TA 221PA 2XNDA 2F1HA 2W0SA 2XSZD 2X8AA 4LC1A 2IF2A 2VRWA 4TZ0A 4I81A 5E3HA 4IXNA 4R2IA 3VTKA 4NYMQ 5HKKA 2ZRCA 2RMKA 1OW3B 1KSHA 3R7WA 3N2IA 1GZSA 4IVQA 4G5SA 3N70A 1Q21A 3EZ6A 4LJ6A 1FP6A 3D6TB 1GDDA 3U4QB 1BYIA 5KPJA 1YHNA 3K9NA 4QBHA 3SFVA 4L5BA 1AS2A 1MT0A 4II7A 1G7SA 2WAYA 1EX7A 1R8SA 1RE0A 2B6HA 2ORVA 3DM5A 5CK4A 1DELA 4A15A 1ZM7A 2RGBA 2W0MA 2J9RA 3AGPA 2A30A 1AQUA 5EZ6B 1KI4A 3PUXA 2UVQA 3NEYA 4MUBA 2AKYA 2C5LA 1ANKA 2Y8EA 2HT1A 1DE0A 3ZQ6A 2WJYA 3IUYA 2RGXA 4RKFA 1XEXB 3AF0A 2VP2A 1KAGA 2IXEA 1ZCBA 5DYGA 1LS6A 3C4JA 2IEZA 1XMJA 5KOYA 3TUZC 1KHTA 2ZITA 2TMKA 4J0QA 3NDPA 4YMUA 3CX7A 5IT5A 4B6FA 4G0NA 4LHZA 1WCV1 2QGZA 1I2DA 1Z47A 1F2UB 2OHFA 5HZKA 4CEHB 4US1R 1Z6YA 4O3MA 1W47A 1R0ZA 3K9GA 5J4KA 1G5RA 4A8JA 1OT3A 1RPZA 2ZRBA 4HUQA 1TEVA 3U3OA 5FBWB 1WBBA 2FU5C 4LY6A 4DZZA 1E1QA 1DEKA 1JR3A 3T1VA 2C96A 1OFIA 1IY2A 1U9IA 2Q9AA 4FN5A 4R7ZA 2D74A 3Q8XB 5LD2C 2GK7A 4XTCS 1DO2A 3HDTA 2OO7A 4KLZA 1CJKC 3WYGA 2F55A 4Y0VA 4PC3A 2XJ9A 2WWXA 4XJXA 1S4QA 1HYQA 2VP5A 3T34A 1D2NA 4JLVA 3UWKA 1ESMA 5KDDA 3AP3A 1VTKA 5J4HA 2NZJA 2J7PA 2RKOA 3A58B 2NPFA 2O52A 1E2GA 1G8HA 1KK2A 4P32A 4B48A 1RC8A 3OEED 4LJYA 2O8EA 1S8FA 2MMGA 2DY1A 4AWXA 1UBGA 5FOWA 1IJFA 4CRWB 4GOXA 4NCJA 5JWHA 4M53A 2J41A 1G3UA 2NG1A 2ORWA 1DG3A 3EASA 4POAA 3ZQJA 5TB5A 2A2ZA 1G18A 3GJ5A 1S1MA 3WMEA 3LVRE 5L3SB 1TQDA 2AD1A 4ZKEA 3SHWA 1XMSA 1ZM9A 1M6NA 4B47A 2QBYA 2FF7A 2GJ8A 5CJPA 5LDDC 1FQJA 2GHIA 3DMNA 1NSFA 4KFUA 4Q7MB 4XIGS 3GLGE 2EYUA 5FBLB 5FL7A 5HR5A 5SZIA 1YRAA 1ODFA 2NOAA 2PMKA 4Q7JB 4A4DA 2V4ZA 1S3GA 3TRFA 1H65A 1YE8A 2JJ1D 4GT1A 4NYJQ 1ZC3A 2PH1A 4OQNA 1OB2A 1G17A 3ASZA 3RS5A 1ETUA 1GITA 2ZRJA 5AJYA 1U98A 4M1KA 2CCJA 1KNXA 3H1TA 3JZAA 1XX6A 1KNQA 2WSSA 2BMJA 2GXQA 1OSNA 5KSPA 1SVWA 2R44A 4PQYA 1SGWA 4JLNA 4MQBA 2CJWB 4R98A 2WMOB 1P9WA 1E9SA 4NKRA 4BPBA 1ZMXA 3J81k 4JSYA 3ADKA 3GLGB 2F3RA 4DDUA 2IC5A 4NONA 3DL0A 5DYIA 1JECA 2O8CB 2FEMA 2A5DA 1IN8A 1PLJA 2C9OA 5FTNA 3LX5A 4PO9A 4AKGA 3ZZ0A 3IQWA 4QM7A 1R4AA 1E2MA 2QMEA 3P4XA 4JLKA 4C0BA 2CBZA 2VYFA 2ZIAA 1CRPA 1ONBA 4C0AC 4ARZB 3F0TA 2HF9A 4O2RA 5DHFA 3MCAA 4HAXA 4PC1A 2YWFA 2OEPA 1T9HA 4FXPA 1XTQA 2GWHA 1E2FA 1EFUA 3LA6A 2VO1A 1GL6A 3B9PA 4BLRA 2NGRA 5FR2A 3BXZA 2RGAA 4JVSB 5JEDA 4C2UA 2KBEA 1IN5A 4FMCB 1N0VC 4DB4A 3T35A 3CWQA 1YVDA 2RGCA 3X1WA 2QQEA 1LS1A 4KFTA 2H92A 5FUYA 1AIPA 3L0IB 1RYFA 1JXOA 4CEJB 4XVQA 3NXSA 4TT3D 3H84A 4B35A 2PLFA 4LHVA 3PXGA 4F93B 1VYTA 1RJ9B 4RFVA 2WKRA 1KOFA 2X77A 2JJ2D 1SXJC 1VCMA 2GCOB 1S9DA 1UEIA 2G9NA 1CR1A 4ERNA 3U61B 2IBMA 4KU4A 4CEIB 4UNNA 5J5CA 3M1IA 5KTYA 1FUUA 1R0WA 4Z1MD 4NCKA 5FPKA 2XNSA 3OAAD 2WHXA 2H57A 2XNDD 5FPHA 3U4QA 4QBFA 4LRWA 4Z8XA 2OBNA 2ZS7A 3RS0A 5DO9A 2H8KA 4C30A 1G3QA 4OI2A 3TLXA 4P3YA 5HKKD 5L3QA 1IONA 3CNLA 2VF8A 2ZJ8A 5M04A 4NZYA 2OCYC 4QRHA 1GG2A 5G40A 1KJZA 2W6IA 2H7VA 3GMTA 4GPTA 4DWJA 4BFUA 1DS6A 4LJ9A 3IPXA 3EX7C 3GD7A 2F1IA 1YU9A 4BASA 4OJKA 2JDIA 2V9PA 2ZUDA 4DT1B 4C0QC 5F2EA 1QHIA 2ZAOA 1E1RA 3QPUA 4MH0R 1UBEA 5FOTA 2FH5B 3P32A 5FBRB 1P9NA 4DJTA 1M1YE 2E9SA 2VSFA 4CT4B 5C2JB 1RIFA 1MO3A 2O0KA 3DOEA 2NO1A 3T12A 2N46A 2DPXA 4CEHA 2ZM5A 1WF3A 4B33A 2ZS8A 1WP9A 3M0EA 4L9SA 4MGZR 1DAGA 1RVDA 1KJWA 2HV8A 2J46A 4TMWA 3ZVMA 3UIEA 2F6RA
chains in the Genus database with same CATH superfamily
4KWEA 1SVIA 3KZNA 4QU0A 3LQRA 1R3DA 1GCAA 1PSWA 2OG1A 3BRCA 3BKXA 1SCKA 4COOA 3COSA 1JBEA 2AUTA 1U3FA 2Z0MA 5IUKC 3WFJA 1QIIA 3EVEA 3KPWA 5JASA 1Z75A 3ETEA 5FOSA 2YWBA 4DLNA 1ZGCA 3TNLA 4DMFA 2YXNA 4FYYA 1SBQA 4V0MA 3DHNA 3R7DA 4HF7A 2ZJ3A 3CTMA 4PF1A 2WICA 1RFLA 4QHSA 2HWWA 1M1YB 4BLTA 2OAEA 2ZIFA 3K6SA 2O2ZA 3DZCA 2EF1A 2SICE 3IJEB 1P3Y1 3CLSC 4YRTA 3QSYA 3SNHA 4O2BA 3A1FA 4C4XA 3W77A 3K6KA 4K6OA 2MTBA 4IS2A 1XNRB 4ZTBA 2HAEA 3CGGA 1GPAA 3B3GA 3U3JA 1U4NA 1IQPA 1TE2A 2RCNA 1AD2A 4R7GA 3S4YA 3WHPA 4AIIA 4AZTA 4P22A 1G6HA 3GQBA 4DC9A 5AVXA 1FDWA 1GPKA 1T0JB 3IKTA 3ZWYA 2BDEA 2QQFA 3ANXA 2TS1A 1WCYA 3NI2A 1C4XA 5AQEA 4Y0NA 3UATA 3K0FA 1QTQA 2ZOSA 1XXHE 3R3JA 5EQJB 3VHRA 4ZHQF 5FPTA 2JEZA 1VLQA 3BAZA 1JZQA 5DWQA 3BHNA 1CUIA 5DHPA 4LOKA 3OZDA 4MUNA 4OA8A 5BV0A 3SFTA 1ISFA 2YQ5A 2VOJA 2QM3A 3K4HA 3KQPA 1X7XA 4X00A 4NR0A 3FNGA 4C4PA 5J43A 4WK0B 2JHPA 5JAUA 1DC5A 3D7LA 1IHDA 3WP1B 2G71A 1XNGA 2FCAA 4J9VA 3R6TA 5LQSA 1Y6GA 1HZZC 1JIQA 5JLAA 1U2ZA 5A3SA 3E5NA 5LQAA 5IM5A 1T15A 3WVNA 3EZXA 1V7PC 1H6AA 4OK5A 2XPCA 4XCVA 4F3TA 4LWOA 1C7FA 2IVZA 3H0KA 4ZCMA 3FY4A 1KDRA 2BKAA 2WT8A 3D54D 1EK1A 1VCNA 5EXTA 2GPSA 4HOYA 3EK2A 1EFCA 1TYBE 1ORTA 3D8RA 4D41A 4JJFA 4O33A 4RL6A 1KEKA 1NE7A 2HFJA 4AX8A 5HJEA 4CMCA 1YDMA 3ONNA 1LB1B 1CEXA 1JG2A 1XU9A 2REQA 3DMFA 4DIFA 4IGEA 3NWBA 4RD6A 3TZKA 1X6VA 5ALVA 3UW1A 1CUWA 4RW0A 5I9BA 3O84A 5KVSA 2AVNA 4IIVA 3R9XA 3QVMA 4DQDA 5K8IA 4NARA 2AJCA 3X1XA 3ZW9A 3R0JA 3RS7A 1QH8A 2JBWA 2BGUA 2N3ZA 3GZ4A 3HKCB 4FKMA 5AXAA 4MV4A 4NJEB 4G4SO 2AK3A 1C3EA 5JDCA 1A98A 1SBHA 1TPYA 1JSXA 1LI7A 5CYPA 5LB2A 4A92A 2EZ9A 3RFVA 3TLAA 4L4SA 4CLHA 1VDMA 1GXSA 2YNMD 3GHHA 3U39A 3WOHA 5JAHA 1M2NA 2V58A 1PS8A 1KPHA 1XZEA 1X39A 2H51A 3ABRB 2GARA 3OJCA 3Q40A 4ARZA 4YV1A 2HYIC 4FOTA 3S2YA 2HNAA 3N2EA 3PX3A 2Y0BA 3IPAA 2NXNA 1RQGA 4QDKA 4WNYA 5BR4A 5FQNA 1P2DA 2F9MA 4V0OA 3KUDA 4GOOD 4Q3AA 1EVJA 1TJ4A 2ZG6A 1XQXA 2C2ZA 1UQTA 5DIFA 3HTXA 1QFYA 2O8DB 3V00A 4K8OA 2X1MA 4ESOA 2QXTA 3PUZA 1W4CA 4QGHA 3W5AA 2HZ7A 1G2QA 3JSAA 3PT9A 2LDXA 4HH3C 5JQWA 1PK8A 3IDZA 4Z7QB 5GGYA 1S2IA 1CB0A 1EFDN 4HT3B 3IB3A 1C80A 4EMTA 1NKVA 4KO1S 2R84A 2FN9A 1KMCA 4P3KA 1NN3A 5T6BA 3P9XA 3IODA 4M49A 1OJ7A 2B0CA 4OA5A 4RK0A 1YO6A 4IDBA 3DOJA 2C3PA 3G2OA 1QVZA 1XU4A 1A5SB 3GCGA 4G0WA 4A36A 2E37A 4IZIA 4QOJA 2JFXA 2IYUA 3OM0A 3G0BA 5LOVA 4CDMA 1QQ6A 3WLIA 3E7XA 5FTJA 1GQFA 2CXOA 2WV9A 1C9DB 5JPIA 3CUEF 1PR6A 3FLAA 2AG6A 4IV0A 4MQ5A 1L4NA 3HHPA 5LBIA 4C05A 2EJBA 3ZOZA 3FMPB 3MT0A 1AB6A 1U1DA 1M2FA 3AVVA 3EGXB 5E8JA 4KMMA 4BJ6A 1WV0A 2R6JA 2P6UA 3B9BA 4YT5A 2VC2B 1W36D 4DEXA 2IUYA 3ZD7A 1E0AA 2GJAA 3NWJA 4ZZ1A 5K8CA 1YU6A 2IEBA 2J5KA 2VJDA 3GY0A 4R6XA 3U7GA 3PX7A 4B6PA 4DMUB 1ZJYA 2GD0A 3QLUA 4PO1A 4WLEA 4MIEA 4X64B 4G09A 5HTKA 4F21A 3FBGA 4E3ZA 1SHLA 4PFKA 4G0VA 2W6MA 1J2UA 3GGJA 1GPH1 3HDYA 3MCZA 1JVBA 4U2DA 1YJAA 1UFKA 2INGX 4MMXB 3MMNA 3I5YA 3ORQA 3AZQA 1OXXK 1ENPA 2ZSKA 4UNRA 3JD3A 2QTFA 4H7JA 2FDCA 3DVLA 1WJGA 1CYEA 2EHJA 3ECSA 3OZTA 4E5YA 2OB1A 2OD7A 2PYZA 2X19A 2YQZA 4RPHA 4TTPA 2XQVA 2VQEB 2YRXA 5SV2A 4C4SA 4MS3B 4KR0A 3GLIB 3IIIA 1QFSA 3BX1A 2GDZA 3BK2A 4U00A 3T3MB 2PVPA 4Q39A 3E9DA 1FZQA 5JCOA 1AT1A 3W8DA 2PO5A 2EIHA 3UW3A 4YRDA 2JDID 3FZQA 5JJCA 2EQBA 1M66A 1EK2A 2C1ZA 3ICWA 3MN1A 3QOYA 5E6UA 5ESXA 1JLSA 4IIYA 2DHDA 4DUGA 4CLOA 1XKLA 2J30A 2WTXA 3PGMA 2O3JA 4JC0A 4MKFA 2CUNA 3F5MA 5ESWA 3ZJ5A 4LPSA 2YDYA 5AVRA 2WZCA 2HMTA 1I6MA 1PEAA 1S2OA 2FZWA 1U2RA 2X15A 1RR6A 4V2UA 3RYCA 5I9IA 1RQPA 1Z17A 1SU4A 1B73A 4BMZA 4D9MA 4LDNA 1XDUA 1M3SA 1N2HA 2Z5VA 3B1YA 2ZYAA 4AJKA 2I22A 1ZJZA 5HE9A 4CG3A 3NJ4A 1N9GA 1PVOA 1LF5A 1X1AA 1QZ3A 4PYOA 3BBLA 4HFRA 4KLRA 2WEKA 4G5YA 3QVUA 4Q7KA 4RCYA 3PFCA 2I91A 1QCCA 3QKWA 3S7ZA 1YDGA 5EHIA 2E82A 4WPGA 1AO3A 3EC7A 3A1NA 4HB0A 3VR2D 3H5OA 4BNFA 5HIJA 4EQZA 1OFUA 1M1NA 5CYFA 3SI7A 4C4TA 1RM4A 1PV2A 1Q0LA 1F9AA 1ST2A 5HPYB 1F6WA 4IOLA 1X77A 1F0NA 1NP7A 1NY5A 3ZHYA 1I5OA 4Y2VA 3W9BA 2H2IA 3AM3A 3AHGA 5CFRA 2G6BA 3H5NA 2CHQA 5EMMA 3D6FA 1CQJB 1KI6A 3O8CA 1SCUB 3U7JA 3PC2A 3ZGOA 4EW2A 1K8YB 4NZ9A 2WMNB 4CFYA 1RRFA 1RWVA 4HEJA 1MVLA 1X42A 4Q0MA 1FXSA 1Y6QA 4IQ4A 8ATCA 1G2OA 3LZDA 1X1BA 2D5AA 4GLJA 3S2GA 2YTZA 1BHQ1 1YNOA 1XNJA 4OHFA 4FC6A 1R74A 1RJGA 3PRKE 5CA0B 3KT3A 3QPWA 3FVQA 1Q1QA 3UJCA 2V0CA 4DZRA 1EUCA 2BM9A 3KU1A 5KS2A 1XWIA 3EVBA 1T0PA 4DLYA 2R8PA 1HDGO 4BN5A 2W2NA 5JSUA 5K3AA 2O2EA 1N7IA 3DOUA 2IXDA 1ZVJA 2YOGA 5EINA 3TIFA 3ZWWA 4B74A 5IU6A 4R81A 4WVLA 1HT3A 3QEMA 1S1CA 3JYOA 4MQLA 4N3NA 3ET5A 4PCAA 3ASVA 1V26A 2QUIA 4J0KA 1T8TA 5FR1A 4AUMA 1NN1A 5LIPA 3PNLA 2PRJA 2GH1A 3Q1LA 3E4CA 3AVYA 3B8HA 2C84A 2JAXA 4BZQA 1AQLA 1UFQA 1JTEA 1Z2OX 1U3GA 1JIIA 1DIRA 1N7HA 1QHXA 2V59A 3NGLA 3ONWA 4L5JA 3KR9A 4OEHA 4Q00A 2FOIA 4H2DA 3V8QA 4A5SA 5I51A 2WU8A 3PD0A 1DJMA 3OFNA 3DTTA 2B4YA 2ZBQA 3ASYA 1W8IA 3KBOA 4II7A 3W8NA 1XPOA 4JI2B 3BN3A 3R1IA 5CK4A 5KYNA 4X7MA 2BMEA 2C4KA 3ESZA 2ZP1A 3WZMA 4QBGB 4QATA 3DTVB 2NZWA 1ZNYA 2R5NA 3IIEA 3O75A 3RUEA 1G4AE 5KQLA 4R1NA 2QR5A 1MOSA 4EHLA 5KCZA 3SBXA 2LCFA 1NN5A 3A7DA 4LC0A 1JSRA 3HVRA 3K0HA 1PN3A 2BHNA 5KI6A 4ECAA 1X74A 4KUEA 4BX9A 2XCIA 5JJKA 4M55A 4PSUA 1VMEA 4NTZA 4XIYA 1SUBA 2WVHA 4Y6OA 3MWEB 1SO8A 4ZO4A 2F7SA 2ODQA 3JZDA 4CCYB 2WWHA 4RA9A 4TT3A 3X1MA 5ETJA 1U80A 4RIGA 4JMPA 2FMTA 1WMEA 2BZSA 5DISB 3VPBA 3NYWA 2NYAA 4JOBA 5EXSA 1DKMA 2V8OA 1V3TA 1ZJ4A 1ZICA 2COUA 1AHHA 3CN9A 3I6MA 3KB8A 2E1RA 2J31A 4DCCA 1E3WA 2P2GA 4EJ2A 4LTNA 4P4NA 2VJAA 2H1HA 3FDZB 4W8HA 2CLIB 1DAHA 2FWRA 3TXAA 3PEEA 4RO0A 3SP1A 1CY2A 1H85A 2C42A 1KI1A 3IAHA 2VCYA 2FSFA 3MJCA 1YK1A 3FKQA 2AFHA 2OCXA 1YL7A 3KT8A 5TQ0B 5TT0A 4KJZA 1O77A 2AUMA 3W3AA 4LJ4A 4BLUA 1SBTA 1DKUA 1QF7A 2CGEA 2GJ4A 3KJIA 5TJHA 4QGSA 4B8ZA 3LLMA 4RCVA 1XBTA 4RU1A 5TY0A 4V3BA 3B6ZA 3QSGA 2O54A 4WSOA 3T52A 4YDHB 1S3SA 3QEBZ 1UFOA 4AZ3B 5FBVB 4N1AA 3E22A 2YKGA 2ZT5A 4AURA 3ABZA 4M8KA 1AS3A 3IO3A 1DXQA 4G8CA 3RGGA 1N6OA 5KJ6A 4KXWA 3U49A 1V5FA 1WNTA 2BGRA 1EZ1A 2X3FA 2IZ1A 1NMXA 2WKWA 2A5YB 2YN2A 4I7EA 4GI2A 3TM4A 1L4LA 2B1JA 1I1HA 1NG1A 2JAQA 4O4HA 4UEWA 4C0KA 3AEZA 4LG1A 4GPZA 1YR6A 1NC3A 2QZ4A 4GH5A 1GL7A 3TOZA 1J42A 1GAEO 4FCTA 2N1MA 5KYUA 1U90A 5BY2A 3ZYCA 5JMTA 4B4DA 2AG5A 4AKHA 4MWEA 1ISHA 2H5LA 3HP1A 3JTEA 3PEFA 3B1ZA 1KJQA 4LXYA 3TMYA 1GOTA 1P8AA 2QSUA 5KKAA 3KAQA 3G85A 1DADA 4UCWA 2J32A 4LVCA 4F85A 4KWCA 1A1SA 4FOOA 5KYXA 1H2BA 2BEUB 5M3BA 4H16A 3IB6A 1N3LA 5AR1A 3UV7A 3VC3A 1ZRHA 1MDBA 2ZU0C 3UAXA 3PIIA 3WYBA 2H4ZA 2PUVA 1NOJA 4U9IS 5IDQA 2ZPAA 1OFVA 4II2A 2HC9A 2C98A 4C2BA 2PQ6A 3SSOA 3VH4A 3FRIA 4XM1A 1RAHA 2D5LA 2HH9A 1DIHA 2ZAYA 4PY2A 3TLMA 3JR3A 5HIAA 2EKDA 4MV0A 3HPQA 1WZIA 2ZRDA 2WHYA 2H00A 1KHHA 1M2JA 3UF0A 1T3SA 1UADA 3K73O 1D2HA 4PZLA 4OL0A 5P8WA 2XD4A 2PCLA 5EHNA 1WXEA 1YBMA 5G1NA 1F6BA 1LC3A 1VPEA 1W34A 2IUEA 5JZBA 2ODTX 3HJTA 1JWLA 1U63A 2WTEA 3NJRA 1KSGA 1T1JA 2IYVA 2BV3A 1HYGA 1T6YA 5GZ3A 1HL3A 1BXGA 3QF4A 2WTAA 4EHNA 2I4RA 4D8UA 3BWCA 2HYDA 5CB0A 4ASUA 1RAGA 1G20A 1MVNA 2G1JA 3AM5A 3MB8A 2QJFA 4Z9YA 1ZESA 5GZ6A 1H4TA 3KRTA 3VR5D 4B46A 5LP1A 1DJOA 1ZLYA 1OV4A 2XTNA 4GE3A 3EY4A 2XKAA 4DUGD 4JB8A 1JFSA 3ZDCA 1S8OA 4FMPA 4P80A 4LZJA 4JY7A 2OUKA 2XE6A 1UAYA 3H99A 3BJIC 4FYJA 4JB3A 5IX8A 4LI0A 3ZJUA 1NU8A 1UJNA 3K05A 4HPJB 1JG4A 4OP3A 1Z6XA 4H4EA 5I7EA 3WMWA 4RSRA 1XVTA 4ND4A 5F7OA 1XN1A 2J3IA 1EE1A 2R47A 4YRRA 4CI0B 3BMNB 3BD6A 2D13A 1GVNB 1RLUA 2VNIA 4L3OA 2F43B 3HJRA 1TTTA 1IWPB 2VHVA 4PRZA 4O3FA 3RKSA 4MRMB 2IHTA 3WRXC 4BE9A 3BICA 4PG8A 1N2XA 2FEWB 2WU3A 4JODA 3R75A 2PMFA 1PGPA 1YB1A 3G82C 5FRDA 3RS3A 3GZNA 3STYA 2XW6A 3TR0A 1SCAA 1TQ4A 1NVEA 1LBEA 2FWBA 4MHSA 3U4DA 4EZEA 5KTKA 4O5AA 1Z0DA 3SSNA 4M0UA 1A8QA 3Q98A 1T9AA 1VHQA 3HA2A 4XPIB 4AN4A 4UZEA 1JN0A 3OO1A 4UDNA 5CDGA 5EE3A 4MQ6A 4R3UC 4PANA 4R1OA 2CF6A 2K4MA 1NW9B 2XUIA 2W6ZA 5FA5A 3U40A 5ES4B 1R0XA 3ECCA 3LT1A 3U7EB 1EEHA 4IGIA 3R3SA 1E79A 4WBNA 1TJPB 2QRVA 3A9RA 4IJWA 5LSAA 1EUDB 3GEEA 1ATIA 4KRXA 1CU1A 4QBTA 4Q1AA 1WWKA 3ORYA 2VP6A 1QZUA 5LUBA 1VBFA 2C1XA 3P0RA 2BC9A 2C3UA 4FYKA 5EUBA 5TVKA 4B0OA 3RSCA 4URVR 2ZUBA 1FQOA 1U3VA 1T4BA 5IAJA 3I04A 4QGGA 5LP6B 1T9ZA 5IJ0A 1JDNA 2IP2A 1Y8QB 4WVFA 3ND9A 1Z28A 2QTZA 3PV0A 3W34A 5TQVA 2ZZKA 3VOTA 4BIMA 1MO2A 2V55B 1JXMA 4B3XA 3AYZB 5LQCA 5EJ8A 1H9CA 3CZAA 4Q7EA 3U56A 3EWIA 3PHCA 2CBGA 3FSEA 1JVNA 4WA7A 4EKYA 2QJTA 3KWLA 1BVYF 3VR6A 4DNXA 4BEVA 2VUUA 4TKUB 3JAKB 3SBDA 1W88A 4F2PA 2V98A 3WADA 2PZBA 1XEAA 4GXNA 2PS0A 3SDZA 2ZSHA 4DIDA 3IVCA 2YWJA 2R1UA 3VU1A 1RRVA 2QT0A 4RL4A 1KAQA 2DU8A 4BFWA 1GTL1 4R05A 4D8VA 3OBBA 2PY6A 2Q5LA 3OFND 2CHUA 1CVLA 2PKYX 2AKEA 4KQCA 3E9QA 1JG7A 1NFQA 4NQRA 3V7NA 1L3BA 5CMLA 2ZB2A 4KRFA 4JLOA 2DCMA 3JQCA 2AMJA 4XGNA 3STWA 4DSTA 4I55F 4PAMA 4QDJA 5AJVB 2DFVA 1GNVA 2WE8A 3CISA 1HRDA 4IEFB 4KG7A 4MMZB 5HX7A 4QDZA 1TAHA 1LJUA 5KSWB 5A02A 1QGZA 1QG2A 1JNYA 3L84A 2O2CA 4B84A 5KB3A 2UUAB 3IP5A 3BMXA 3DLAA 3TG2A 3TCKA 3LGAA 5KQPA 4XGQA 2GUGA 1TRHA 4A2WA 2A7XA 4IWNA 1J24A 5JMWA 2J0UB 2YVKA 4O0MA 4R2WA 1NG9A 5BVHB 4FIZA 1FFCA 3WGNA 3HFSA 2IYYA 2Y05A 3PGXA 3IBYA 1LSUA 3F3MA 4MB0A 2XZPA 1D9XA 1LVGA 2FMKA 1VKOA 1SZJG 1PGJA 3JRNA 4LXUA 2AOWA 4OBBA 3SOPA 2GAJA 3W1EA 3EF1A 3R7AA 3DZIA 4ZANA 3O4RA 3ZY4A 1GKLA 3DDCA 1P0FA 4CTOA 2UUOA 5AKYA 3WFZA 4H1VA 4EBFA 1MAAA 3ROKA 3Q10A 4LXXA 2FMFA 3G59A 4B80A 1ZMOA 2RHMA 3QVSA 1DHRA 4HK4A 4CNQA 3TRKA 4WY5A 2V96A 3AR3A 4FONA 1DVRA 2P6MA 3LWBA 5F5NA 1IJEA 1L4MA 1ZH0A 4LSGA 3SR0A 4ZGGA 4LJAA 4GC9A 1RPAA 4O5OA 4ALMA 5A5VA 1KJIA 4KPEC 2YWXA 3FOAA 1SC1A 3FTFA 4JUAA 2JGDB 3A37A 3S40A 2YCLA 1E7YA 1DQZA 2QUJA 3P0IA 1DT5A 1GILA 1V1MA 3LFUA 2I7XA 4PR0A 4Q1DA 5E2BA 3OE1A 4RNCA 2AXNA 3HMQA 3WGGA 4CMIA 1G8FA 1NL3A 2VK4A 4A6XA 3LDGA 2O2GA 2OVBA 5K2MA 4E2XA 3KEMA 4IDNA 4M1YA 2AEMA 2H4YA 3QKRA 2CLEB 5A7FA 2ODBA 3BSWA 5IG2A 1YBAA 1LLCA 5EXPA 2E0IA 3BB1A 5B1SA 2QN9A 3C85A 5F9MA 1FUKA 1SKAA 1UPBA 3AL0C 4IDQA 3ONDA 1OKKA 5DGXA 4TZ6A 1J5XA 1OF1A 4QTTB 4YCDA 3Q8KA 4EL5A 1O97D 2PGIA 2RI6A 4MINA 4P86A 3L0BA 4RIHA 4K8RB 1MEOA 3QMVA 4MKIA 1QBGA 3PJFA 3QFFA 2P5TB 2B1IA 4CLDA 1R16A 2WWFA 1F8GA 3M4NA 4MB2A 1LW6E 3DF7A 3QMMA 4NE9A 5BQOA 2C97A 1LWNA 4N6OA 3IT3A 4P33A 1WTCA 2IHVA 1ZU4A 1PL7A 1II0A 2DBZA 3DZBA 3FM9A 4J1TA 5CPFA 2M1XA 3ENZA 4V0LA 1O9BA 5F1KA 4ZV9A 1AKNA 1CZRA 3PC7A 2AEFA 4JJ4A 4FZRA 3GMSA 1US8A 2P4SA 1AM4D 3PUJA 4GAEA 4LMAA 4DCGA 1PIWA 1YJBA 1BDJA 2H0RA 4ZEMA 3E6AA 7MHTA 3L7MA 4BKMA 4MS1B 4Y1GA 4DF3A 5CFOA 3B20A 4R1UA 4MLCA 4N01A 5KWVA 1O95D 4YO7A 2ZIXB 3CH6A 3H3XA 1F5SA 2NZVG 4XQ9A 2MIIA 2AZMA 3O91A 3TLGB 3CVYA 2P78A 1QR6A 1SKMA 1ZJJA 2D7CA 4Q1VA 4CI9A 2C4HA 1TKRA 2WJJA 4GRDA 4XWGA 2EBWA 3RJZA 3EIXA 4IMIB 5JI2E 5JAOA 2FQWA 1EWQA 2DGDA 2VAXA 3I9FA 3S70A 1H8EA 4B73A 4ODIA 3U44A 1PGNA 1TM2A 2ZIVB 4KQWA 4LNUA 2VYNA 1Y1SA 2ZTHA 4ISBA 2IF0A 2AMVA 3K1JA 4QL3A 4D99A 4DC0A 5AI6A 3ZVNA 2UUBB 3T1NA 1XEFA 1OOEA 3HB4X 1CEQA 2Q5HA 3VZDA 1X8KA 3M49A 3N0TA 4JOSA 4PIPA 1TZBA 1F9EA 3OZXA 5IH3A 3C3DA 3UYLA 3VI4B 1O6ZA 1XIVA 1GR1A 1YR2A 3NMUF 1P9RA 5SZKB 5LN1A 2GZDA 3K0SA 4DUZB 4KVGA 4XWKA 1LK7A 1YRBA 2P9CA 2W70A 4E31A 1E2PA 3HACA 1C0KA 2G4CA 1I9CA 2P6PA 2YYAA 5LDGA 5CCBA 4X62B 1W9HA 4LE2A 2AXQA 5TEVA 1JDVA 2CXPA 5D8DA 2HWUA 2PL3A 4HLUA 1N36B 4ETWA 4MIKA 2ZQYA 2H4HA 3HADA 3KOZA 1KVSA 3KSMA 3RRBA 1IM2A 2I76A 4K6FA 2J4CA 2JANA 3WNBA 3KELA 4NBSA 5EFZA 1J22A 4JLAA 1PEDA 1AKRA 4HHEA 4PE5B 4TLBA 3DDZX 1MAWA 3OEHD 1KVRA 4LUCA 5FA8A 4A0GA 3G5LA 5T8KA 4ZEVA 1KYVA 3SSMA 1ST3A 1A5ZA 2GNPA 5C4MA 3HK2A 4LGVA 3HXTA 1PYOA 1UMDA 4FEEA 1WZUA 1A3CA 1LZLA 3OOHA 2I66A 5TGTA 3MVEA 2XGJA 3FJYA 4NBRA 4N6NA 1KSFX 1Y34E 2ZDGA 3THXA 4KXXA 3OZUA 1LTQA 2W37A 4AYWA 1WLYA 3IUNA 1Q1GA 5GJCA 3ZWKA 2P2YA 4IHAA 2FPSA 2EZ4A 1CR4A 3MTGA 3PEVA 4ZOQI 3A1VA 2Z9BA 2AD5A 3H1PA 4IW3B 5K0CA 1FFDA 3E2PA 1E79D 4JEIA 3BF7A 4RD2A 3ZDYB 2DC1A 3WE7A 2WYVA 1JQJC 3B3FA 2FQ1A 5C1BA 5ERGB 5LXTF 1PX2A 4N65A 5K6TA 2PNFA 3GLQA 1ZMBA 4LQ4A 5KX5A 1EBBA 3TW6A 3ZXYA 3F6YA 2B21A 4RTQA 3S3TA 4XVCA 1NI5A 1H2EA 3AR8A 3MSXA 1OBVA 1S2DA 2O9JA 2X22A 3PCXA 4BP9A 2BFNA 3LQ1A 2O06A 4LV8B 1G9XA 1OTHA 1JQBA 4FFDA 3PWKA 5ALTA 4ZU1X 1Y3FE 1DRKA 5EZSA 2I8LA 3NC0C 3VR3D 1JT2A 5KJCA 1AF7A 1JF8A 4MRSA 4OQPA 1UBMS 5IKEA 5MF6A 2AF4C 3FBWA 4EJ6A 2W5UA 3PHGA 1MOQA 2XUGA 3JCZA 3VR6D 1DOAA 1BA3A 3H6KA 1ODIA 4Z2YA 2GYWA 3HCNA 3WKEA 2GPAA 4R5MA 1J5EB 3DCNA 2SKDA 4MARA 3LZCA 3NBZC 1G64A 4U1RA 4X7BA 4ZFNA 5KNDD 4JJ6A 4GMFA 3OJLA 1IHUA 1KRWA 3Q2IA 3PUWA 3ZQ6A 1L9XA 2Q41A 4OTZA 2FG5A 2LIPA 3QI2A 5IVDA 3VSCA 3GFVA 3VBEA 3K8OE 2ECPA 1PW5A 3Q1KA 3K6JA 3SE0A 4JOCA 1Y3CE 3DULA 1L4GA 1X0VA 4P7JA 3SEZA 5IWAB 1E7MA 2L18A 1EP1B 1ZZEA 3C3WA 1G7RA 2QW0X 3PZRA 3EQZA 3GUCA 1HEUA 3UT5B 4PAGA 3ZDXB 1HRKA 3VKVA 3ZY5A 3RC8A 5IC4A 3WDMA 4ZDWA 4ZIRA 1X1TA 1WOYA 2QR2A 5A0FA 4YMVA 3K8ZA 4ZRMA 5JXWA 4LOLA 1OLUB 1CX9B 2XMGA 3KCQA 2IYPA 4Z4EA 4BQIA 3PFKA 1RQLA 4HQKA 1J8MF 1VMIA 1M33A 3RSZA 4DDMA 5BW8A 3DKPA 3LUKA 3T99A 5FEMA 2V7PA 2DQYA 1C7ZA 2IY8A 1EESA 3AFMA 3BF8A 5EJ9A 2IUSA 4R2MA 4H0CA 1X13A 1OFUX 3ZE6A 1MFPA 1Z2DA 3CW8X 3K1TA 1THGA 4DLWA 6REQA 1TMKA 4OGFA 4R16A 4V0KA 4JBWA 3NWEA 3GT0A 3HCCA 4ZVQA 4F4JA 4ZYUA 2YC2C 5ENZA 3WLOA 1BH6A 3TECE 5KOJB 3C43A 2YFHA 4KI7A 4PWZA 2Y9PB 5FUXA 1KGSA 2Q7OE 2F48A 2ZREA 2ZUVA 3WGHA 4NG4A 2X3UA 4JJ8A 4YMLA 4EEKA 3D4PA 4EO7A 5JCJA 4MUAA 2P0AA 2VF5X 1CJCA 5F5XA 2C83A 1LPBB 5ILQA 3S2SA 3HJAA 2CVHA 3IYLW 2Y99A 2CL6X 3ZHBA 2NUTB 2HHCA 5JO0A 5TQ2B 1LFDB 3T6KA 5B2ZA 4WESB 2A86A 2JKZA 5G4KA 5JSZA 3P2IA 4AECA 1SBNE 2NO9A 4MVJF 4LJ7A 2AN9A 5HRCA 1VHLA 2A33A 3FSJX 4KQ6A 4DV2B 5EXDA 2RGEA 1T13A 1JG6A 4OHOA 5IBQA 2L19A 4BGUA 1DCFA 1XROA 3GJ4A 1MR3F 3PPXA 3LCVB 3QXXA 4BVLA 2B1RA 1B15A 3RFTA 2KE5A 3GFTA 2R68A 1UJ4A 3IAAA 1P9LA 2WU1A 3A6DA 3JY6A 4K0RA 4TVKA 1E7RA 5LQRA 3OJXA 4BLOA 2CMHA 3EXFB 1IHPA 2VSXA 1OVMA 1WSBA 3LAWA 1WUJS 2X76A 3H65A 1Z7EA 3V1LA 3IP9A 4AUNA 3BFXA 3LHSA 3QVOA 2NSDA 3O9ZA 1GQSA 3PVSA 2ZIWB 1CETA 1GZHB 3MS2A 4DRXA 5DH9A 4F46A 4Q15A 1E6CA 4QNRA 4BNDA 1VXOA 3FNHA 1T3HA 1Q0UA 3S99A 3X0DA 1UUFA 4B45A 4D74A 1THZA 3CRMA 3PS9A 3SYLA 3EPJA 3A9TA 1MQ9A 2CE7A 2O2SA 5DNUA 5CBPA 3GU3A 2PT5A 5CJJA 1WF6A 2NZXA 4IIGA 4V1CB 3VHQA 1HE1C 2V54A 4BX0A 4CTJA 1G9TA 1Y9ZA 3NKFA 1NVWQ 3VR5H 5EJ5A 2H4XA 4UM5A 3D2AA 3IE2A 2BZ1A 5E1BA 5DT2A 5AW4A 3GARA 1OI3A 3N2GA 3C3EA 4JBLA 3M6VA 4MSUA 4Y6RA 4S3MA 3CF4A 3IVAA 1Y42X 2BTOA 1U04A 3I8SA 2DPYA 1FQKA 1M5TA 2CDBA 1H8ED 2VHQA 4G8BA 4LRUA 4OQXA 4UTOA 3WFIA 1WDMA 6ADHA 1WHSB 3VZCA 3VNUA 2VYND 3RVOA 4PFSA 3TBKA 2QVYX 4ESHA 2UYYA 3ISTA 2DBRA 3K2IA 1QDEA 4OG2A 4R8LA 3H2IA 4RZHA 5IXJA 1Z63A 3NC1C 7ADHA 4OYYA 1ESZA 2IU3A 2EEZA 4K28A 4TROA 5BXYA 1MA0A 1SBCA 4O4IB 4MR7B 1K3UB 3AHCA 5EKTA 3VDNB 3ED5A 3FOFC 2MINB 1ZUNB 4L2IB 1HFEL 1UINA 1H5NA 2JCXA 2Z3ZA 5F3WB 1P4GA 2QRLA 1HQDA 2A9PA 1XMQB 1W30A 2AT1A 3A4LA 4HEA1 1OA0A 3WQQA 1KE2A 2O2XA 2ISSD 4PAWA 4RTOA 1NZFA 4TWRA 3HCDA 2QG4A 4XRRA 2DLCX 2I2XB 2B4AA 2JBAA 4HGRA 2NU6A 2A0UA 2RJNA 3D1VA 1BMDA 2LVBA 4P34A 3GUVA 5MHTA 2ZTUA 2GT1A 3OF2A 1YZTA 3COYA 4RDIA 5IANA 3CLTC 4HDKB 1C30A 1TVKA 4WKCA 3RVNA 4OAOA 3WK6A 1G8PA 4NHEA 4YRJA 3AOEA 5LA6A 4YJGB 4XSHA 2MCFA 1AZSC 4PLTA 2AXPA 2PPLA 4F1JA 1LKZA 2HCFA 2O7NA 4QUAA 1V39A 5EUQB 4R71A 4IOKA 2NZ8A 4ZCIA 2IS4A 1WLSA 3WLHA 2WT9A 2JLCA 2Y71A 4D0LB 1PR1A 4Q48A 2VQSA 4XB6B 3DFZA 2HSEA 1ZD5A 2XOXA 5HSGA 1DWOA 1X2EA 2Q3DA 3FRJA 5KWSA 4HJXA 1FNCA 2VZEA 1E2LA 4X3CA 1ZUIA 5FWXB 1COZA 5EC8A 2OECA 2NXWA 4GR4A 4KR9A 5K9ZA 1CY4A 1H69A 4RETA 2PPVA 4G0QA 1XFAA 2HA2A 2X0KA 2R87A 3L6BA 4Y1FA 5IF9A 2W6PA 3UKOA 4OXXA 1E94E 4QG3A 3G8BA 1WVMA 4LJ8A 2B0JA 2IUUA 3RVQA 4MKHA 4EO4A 5CG1A 1Z68A 2VHUA 3L7BA 1WQ4A 3O2NA 2R00A 1Q0ZA 2NVWA 4UVDA 3RWMB 4KREA 2B36A 3ANMA 2WPDA 1HMPA 1KFJB 5ALNA 5BW4A 1GO2A 3F5FA 4DNPA 2RGWA 2BKVA 1ZXXA 3V4FA 2HU7A 3MRSA 4CG2A 1SIWA 2CLKB 1JYSA 3KUCA 1BS1A 3MW8A 5ERYA 3SBOA 1CSEE 4IYJA 2RSLA 3RYIB 1KO5A 1TO2E 2V0NA 4YUWA 4JBIA 3RAGA 3SZUA 3EWAA 1WMFA 2L42A 1LBSA 2YIJA 1GQYA 4ZI7F 4BO9A 1F8UA 2BBSA 4WUVA 4DSAA 5IVPA 3H87A 4QJBA 1PVDA 1VL1A 4G36A 1W93A 3NV9A 3OSUA 5BMVF 1KJ8A 1P6UA 1HL7A 2J5QA 2JLSA 2AI3A 2VATA 1TK9A 1CUAA 2F4NA 2GBIA 5KTTA 1IZZA 2F8TA 1CZLA 1F06A 1ZC4A 3SR4A 3PLRA 4QOEA 4YRFA 4QUEA 4EGCB 4KQHA 3JAWA 1AQYA 1BO6A 1D04A 2E1PA 3ORRA 3PG5A 4JJIA 4TRRA 3WB1A 4BX2A 4E08A 3D8UA 4DOMA 1ECFA 3LQ4A 3A7EA 3DCIA 4R51A 5COBA 4R2LA 2IV3A 1RS0A 3EGCA 3PWZA 3B1KA 3ESQA 3ET4A 1JHVA 1R0BA 1UH5A 4RVOA 2AF3C 2IHBA 4ND8A 2BF7A 3CLKA 3PNYA 3C6KA 5DLQC 2BELA 2WF9A 5LWQA 4W9NC 3L6CA 4OX9Y 4JBNA 2W93A 4WCDA 2XXAA 2EKBA 2RHGB 4P4SA 3CLRC 4C08A 3P0FA 3OZSA 2BYTA 5M5BA 1C3OB 1M83A 2RBKA 1EDZA 4ZMRA 3PUHA 3C8MA 2VXYA 4J16C 4XQGA 4Y2PA 4D4LA 2QD5A 4QZVA 5DBGA 4KPUB 4BGEA 1PNOA 3W2IA 2RHLA 3B7PA 3GUZA 3SF0A 3BE8A 2IDMA 3KTFA 3ZWXA 5JTUA 3T61A 2VT3A 4S05A 2FQYA 5H3LA 4CT0A 1WW2A 1U7HA 1UFVA 4YIHA 5E3IA 1T9GS 5A2QA 1S3IA 3E3MA 2ZJ5A 1BQEA 1YCHA 5F2KA 2R8OA 5L3RA 5K2OA 2IEDA 4I8XA 2VH1A 2CCKA 5K51A 2YWCA 2CVFA 4GBGA 2YMMA 4I8IA 3SJAA 4RYLA 5GONA 2GM9A 3KIPA 4YFYA 3L4KA 3KQLA 1UFRA 2M6RA 5JCJD 1U8EA 4CDNA 2OO3A 3GRFA 3NHWA 3NUZA 2N42A 4P35A 2WIAA 3BL6A 2G0NA 2HSGA 1ZO8A 4ZO7A 3UWSA 4Z54A 1FFXB 1L7XA 2C5FA 5BNTA 1IOLA 1QONA 3DE3X 1T36B 2I2FA 5SY9A 4KQ2A 3EFBA 1Z5PA 2W2KB 3ZY6A 2EERA 3V7UA 2B2CA 5AVVA 1FFBA 3AU8A 5K6AA 3FZEA 4DCOA 5I9SA 2G9QA 3L40A 1GR0A 4HGYA 3N7AA 4FX5A 1BCRB 4IF6A 3ZU2A 3CW9A 2IX9A 3VSEA 2OV3A 2X5JO 1DKPA 1MVOA 2R8EA 2Y1OA 2RAUA 1ONPA 2A94A 1SXJE 4RORA 4D0RA 2EFGA 3K31A 1K5HA 2ZRNA 3KZMA 2AUNA 2FEXA 2BY4A 4NK4A 2IW3A 4RDHA 4L75A 5BNFA 4MVCA 4W5WA 4ZVMA 5KQMA 4E5NA 3CWZA 1U7OA 2AEEA 3H2JA 3G2MA 3KQHA 3VJLA 1RBQA 4KXNA 1GTVA 1DAEA 3RPEA 2VRNA 3UANA 2PZGA 1KO1A 2OHJA 5HKBA 4B3RB 4MA4A 3GYGA 1OBFO 2IEYA 4JLPA 4G1EB 3RTEA 2NQTA 2CE2X 1YQUA 4F96A 3MHTA 2QY9A 1M10A 2BD0A 3D8TA 5AYVA 1KXJA 4KFSA 5F21A 13PKA 1X7YA 1L5ZA 1DQRA 2PH3A 1WHTB 4A1FA 1H1TA 2LKCA 3L06A 1E6WA 4UCFA 2WKPA 5ALSA 3PJEA 3C3JA