4X8MA

Crystal structure of e. coli adenylate kinase y171w mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEWHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 65
structure length 214
sequence length 214
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8mA00
4UJ5A 4B32A 2ZAMA 2J87A 2ZRAA 1VIAA 4ACBA 1GL9B 5TV2A 3VKHA 2QTHA 2RGGA 1RYFA 2EFHB 4N0EA 3TAHA 1KDRA 4NYIQ 2GVZC 3R8CA 3NC0C 1KK1A 1G6HA 3PENA 3CF0A 4BFXA 2ORIA 2XTZA 3AP2A 4JLNA 4Y0AA 1IM2A 1GL6A 3GFPA 5JLJA 4XVRA 1ELOA 2IF2A 4XD7D 3W9YA 2J7PD 4E07A 5HZHA 5J5CA 2LWIA 4C2TA 3WNBA 2AKAB 1JI0A 3BFKA 3FHCB 4IEIA 1KGDA 3U44A 4B35A 5FR2A 5FOWA 1ZIOA 1GNPA 4B33A 2HT1A 2C96A 1E9FA 1I2DA 2ZRNA 1VHLA 1GDDA 1Y63A 2FSFA 2A5DA 2YJTD 4JJKA 1FX0A 5G53C 4BQSA 4Q19A 4G5SA 1XZPA 3BJIC 1E98A 3NBZC 1DO2A 4EDHA 1A4RA 3AF0A 1TQ2A 2GAOA 2ZI9A 4MRNA 4DCSA 5JRJA 2RB4A 3FMPB 1KKLA 5FBRB 1RKBA 1WA5A 1W36C 4C0LA 1E69A 5IF9A 3ZVNA 1OV4A 2A9KA 4OQXA 4ZV4A 3CRMA 3TIFA 2W6ID 3RRMA 3BGWA 3CX6A 1SHZA 2DCUA 4F38A 5IK2D 2B7CA 4IVPA 5LD2B 4URYR 5A4JA 5EXXA 1G3MA 1TF7A 3SN6A 2PH1A 4RKEA 3QIAA 4Q4JA 1ZM9A 1TEVA 2H57A 1ZD1A 4LGMA 2ZYVX 1E2IA 4JBXA 3TW8B 1YVDA 1GIAA 4A6XA 2CJWB 3U6KA 1IBRA 2Q3MA 2D4HA 4RCZA 1IN4A 1OJLA 4MKHA 2DB3A 1BOFA 5DH9A 2G1JA 1RZ3A 3DO6A 4N1AA 1IAQA 2J7PA 2GCOA 1CTQA 1KO5A 1G7SA 1IY0A 1U0HC 4LJ5A 3PUWA 3WHKA 2RGXA 4AI6A 3KXIA 1XXHB 1NMYA 3EPHA 3QKSA 4AYXA 2ZAOA 3QEOA 4NZYA 1GG2A 4RY2A 5EP1A 1CJMA 3LH5A 4LDJA 4P31A 3FYHA 3PUZA 4GZMA 4DT1A 5DHAA 4Q5IA 1AJEA 1ZBDA 1E2PA 1KNQA 1YZTA 4G3XA 4LHVA 2CE7A 1E0JA 2UZ3A 3BE4A 3GEHA 3WMGA 5LPNA 3K70C 2Q9CA 4GMXA 221PA 1M8PA 1KI6A 5GJVC 3H2YA 4ZDWA 3K53A 1N6KA 1SVLA 1QBKC 3B78A 2F9MA 1MRSA 2CEAA 5D3MA 2PJZA 2JJ8A 4BE7B 3A4NA 5L3VA 5SZJA 3WYGA 1I4DD 4XVUA 3RNLA 2H92A 3UATA 3EC2A 4US1R 4UXHA 1IXZA 2FOLA 4L4UA 2CHGA 4I1UA 3PEWA 2W6IA 3SC3A 4IFBA 1YR9A 1NVVQ 3A4LA 2AHOA 4K46A 4ZKEA 4F7WA 4RJLA 3HPQA 2FDCA 1EESA 3IEUA 2GXUA 2QMEA 4KYIB 2DR3A 3AVUA 4LI0A 4KLZA 1UBFA 1C4OA 1X8LA 1KDOA 1Z08A 2NOAA 4JL5A 3BERA 4I1VA 4UNQA 2XEXA 1P72A 3WHLA 4F4CA 1F3OA 5TMPA 4JKIA 3GLGB 2DFLA 1E2LA 5BYKA 2WSSA 2JASA 4OI0A 4ERNA 1U99A 4IDHA 1Q1ZA 1M1YE 2MMGA 2ZEJA 3A1WA 4UKDA 5EE5B 5FBQB 3KQLA 2C5LA 2V6JA 4B34A 1SQ5A 4KCGA 2NQ2C 4RD2A 4B2PA 4CEHA 4IFEA 3ASZA 3MG9A 3C7KA 2W58A 3RS4A 1X3SA 4TL6A 4NCHA 2H1LA 4BECA 2Q9AA 1KK3A 1CEEA 5LB2A 4B48A 3T34A 1JXOA 4DDWA 1P2SA 2F3TA 2C98A 2ANBA 2ZRFA 5HZKA 4DWJA 3X1WA 4DLWA 3RC8A 4IHQA 2WTUA 2F3RA 4Q1FA 5HKKD 4TTPA 3ZZUA 1QG4A 2OESA 1EXMA 4TMXA 1KY2A 1R8SA 2EW1A 1P6XA 4PXAA 4CZ2A 2FPLA 5HCIA 3LVRE 3U5ZB 1GFIA 2YWFA 3LO5A 3U2QA 1DE0A 1US8A 4DLZA 3BFXA 3K9NA 4LV8B 4Z8XA 4B71A 4TLAA 5EXSA 4CIDA 2VP2A 1DAKA 3GLGE 2O52A 2QP9X 4AYTA 5B58C 1U0JA 2YOGA 1KSGA 3EPLA 5F3WB 4PZZA 3ADDA 3K0CA 1ZINA 1GITA 2IXEA 4TMWA 4M2LA 3RYTC 2IYLD 3SR0A 3E1SA 4W7SA 5EP4A 5JI3E 2VF7A 3CF6R 2GJ8A 1MO3A 4H1UA 5J4HA 2CCKA 2RMKA 1FZQA 2GRJA 1ZU4A 3D8BA 4B3BA 1LTQA 3U44B 1W36D 4B2IA 2QRZA 5DI3B 4OBEA 1BYUA 4JYCA 1R6BX 3W6NA 3AUXA 3EX7C 4IXNA 2R65A 5BN4A 2ZE5A 3O8BA 4LK2A 5KHOC 1E9DA 3HR7A 4BEBA 5DHFA 1P9RA 3W34A 2V55B 3OAAD 2G9NA 2ZVQX 2VRWA 3AM1A 3GCGA 2BMDA 1KK0A 2EFGA 2NG1A 2PLRA 4LV6A 4V0LA 3LFUA 1TU4A 2ZSAA 2OHFA 3TLXA 4BEJA 3AKEA 4IJMA 2E9SA 4P4TA 3I5YA 1G3QA 4HLUA 2R8RA 3J81k 3H84A 4QM6A 5TY0A 5BN3A 2GXAA 2ZRLA 4Q18A 4B6EA 2DY1A 2I1VB 4NPHA 3ND8A 3VHXA 1XMSA 4IOJA 4FWIB 2ZI4A 4Q4HB 1VYUA 4CW7A 2DFNA 3LA6A 2BKEA 1GL7A 3NHAA 3ZS8A 4Q1EA 4W5WA 1GKIA 2J7KA 4DKXA 4MUBA 2OM2A 2F55A 2YINC 1GSIA 1RFLA 1XXHA 2BIFA 2BMFA 2FSGA 4RVCA 1N6RA 5JZVA 2GCOB 3B13B 3NTUA 4CGZA 1NLYA 4MYTA 1H65A 4GOKA 1I4LD 4FCWA 1Z83A 1AGRA 2ZTSA 2EFEB 3OIYA 5L3QA 1T3LA 2NIPA 2VHQA 1JNYA 4Q1CA 3WNDA 3FB4A 4LJ8A 3EZ9A 4JVSB 4IDQA 2O8BB 5FBLB 4LJ4A 4IVQA 3PUYA 3W3ZB 2BMEA 1NVUQ 2AK3A 2DBYA 3OAAA 2WWXA 3ZS9A 3W8RA 3Q7PA 2ZJ8A 1H8ED 3UMRA 2PZFA 3NH6A 5TXGA 2CVHA 1WXQA 1Z6XA 3QXCA 2BCJQ 2R6DA 1G3UA 1X1RA 4IOLA 4C3ZA 4HDOB 1UBCA 2SHKA 3GJ8A 3UG6A 5FTNA 5J4VA 3AQ4A 3IIMA 1HV8A 5FOVA 4BFVA 5JSZB 4V03A 1RRFA 1ZUIA 2ZS8A 1HYQA 1W2HA 3PEYA 1II8B 1ESMA 1TEXA 1AS2A 4HLDA 4OL0A 3GP8A 1CLUA 1JQLB 1OIWA 2A7QA 5FL3A 2YYZA 3ZQ6A 2HXYA 1ESNA 4PSKA 1KZ7B 3U4QA 5ELXA 3U6BA 2W2TA 2OLJA 2ZE8A 5KNDA 3QOFA 1FNMA 3U7EB 2ZJZA 4LBWA 3HU1A 2IS6A 1MV5A 2J41A 3Q5EA 1IQPA 4DSUA 2GEUA 1OKKA 2V54A 3B1ZA 4CEJB 4PTLA 2HDNB 1R5NA 2FGJA 4MRVA 4JJZA 1Z0DA 3LXXA 1BH2A 1G3RA 4PANA 2Z0MA 2GK6A 3PG5A 5G3YA 2FFHA 2IA5A 3IPYA 5FR1A 3L8ZA 1RRCA 4CF7A 1FX0B 1W7AA 2QT1A 4L15A 4DCUA 2ERXA 2GTPA 4XIGS 1AM4D 2FFQA 4EJSC 4DCTA 2HXSA 3U3JA 1E94E 3F8TA 5G41A 3C4JA 1DG3A 2P6UA 5EE9A 2WWGA 2ZI3A 4QM7A 4JLVA 3AVQA 3VFDA 4P4UA 1NF3A 3OEEA 5H68A 1ZM3A 1NP6A 1MO4A 1Z07A 1DG1G 1QHHA 1P3JA 1T8UA 2J46A 1XMVA 3MLEA 3GJ6A 3HPRA 3MUFA 4NYIR 3RRZA 3Q7QA 4FD2A 1UEJA 5L3SA 4B74A 5E7MA 1VYTA 4BFTA 1E2NA 3IGFA 5EQTA 2QQEA 3Q5DA 2GKSA 1KI7A 4MGIR 3MFYA 3AKCA 5AJWA 1P2TA 1Q22A 1G5TA 2FEOA 4MGYR 2HF8A 3VMFA 4PQFA 5CYPA 1C9KA 2TMKA 4QG7A 1FMLA 3CRVA 1KMHA 1SVMA 2G83A 4LJYA 3T1VA 2PMDA 5UKDA 4HZIA 5BXQC 5J4KA 1E0SA 2VP9A 1OB5A 4PPGA 1JAHA 3KTAA 3NWJA 4LPKA 4B43A 2ECKA 1PVOA 1YZQA 2HUPA 2BDTA 2FE4A 1ZUNB 4GP7A 3QBVA 4NHOA 3AF3A 2YHSA 2JA1A 3GEEA 2H18A 3I1FA 1HQCA 2C03A 1OYYA 3E5HA 3JZAA 3Q8XB 2GJ9A 4BWYA 4M1MA 2C8VA 1Q0UA 3DKVA 4OYHA 4HAVA 4IEEA 1CU1A 4QJ3A 1F60A 1JBKA 4OHYA 1CR0A 4Q4JB 3Q9LA 2O8CB 2N1BA 3TR5A 1G8PA 3RSLA 3A37A 3U7FB 5AK0A 2IYXA 4HYYA 4QKQA 4PAQA 4Z54A 2ZROA 4GMDA 5BW8A 4BLRA 4DDUA 1Q44A 1LW7A 2D06A 2JLSA 3I61A 1AN0A 1U9IC 2H16A 4PO1A 1CJUC 2PMKA 2D62A 3CNLA 4NE2A 1M34E 3GLFE 2V1UA 3IO3A 2JLWA 1NIJA 1JQJC 3EXAA 4M8NE 4E5UA 3H1TA 3DZ8A 4LOAA 5JECA 4YXWD 3X1XA 2H7VA 4M0LA 4QNMA 3I32A 1HT1E 3F5FA 3MMPA 4RD1A 1E2HA 3GQBA 3PEVA 3ZGXA 1Z6YA 4A36A 4C7OB 3A58B 1TQ4A 3PITA 5GVRA 4Q4AA 5CB8A 3HYRA 1ZRHA 2QT0A 2XJ4A 1E9RA 4XOIA 2Q9BA 4EPWA 1G7CA 2BEKA 2C2HA 5SZIA 5D3MB 1KSHA 1E9EA 4G5GA 4HUQA 2XGJA 2OFWA 4NMMA 4S35A 1XEWY 2DFTA 3RVBA 1CULC 3O8RA 2KJQA 4D82A 4TSFA 4LBZA 2J0SA 1ZNXA 5CITA 2CL7X 4P4SB 1KTVA 2HYDA 4BRWA 2IUTA 4Q48A 2B21A 5KUTA 3R7WB 4EPRA 3AVXA 4QXAA 2YWEA 3DMNA 4OQFA 1DAEA 1R0YA 2ZIAA 3LBNA 5FPTA 2RKOA 3ZYCA 2JATA 1G5RA 4QC2A 4WVFA 2ZJAA 4NL4H 3R20A 4LC1A 5H1YA 4QBIA 2ORVA 4EPYA 1XMIA 3BOSA 1F6BA 3Q3JB 3QKRB 5EE0A 2QBYB 1A2BA 4MDEA 1WRBA 4Q1BA 4A2PA 4OK5A 3K0EA 2WVJA 3L0PA 4KODA 3SZRA 3PQCA 3L0IB 1Z0KA 1NG9A 2Y8EA 1E3MA 3L2OB 3QNUA 3H4MA 3I3SR 4DDTA 3FHTA 1PLJA 4M9QA 3AVTA 1WQ1R 4YXWA 3AVYA 4LC0A 4AIIA 4A8JA 2IWRA 3B2EA 1KDTA 2W83A 1TAGA 2FH5B 3KKMA 3O8DA 2CL0X 2NO1A 2IHYA 4K8OA 3DL0A 4WA7A 2IWHA 1HY3A 1OFHA 2VBCA 1NSTA 2O5VA 1GUAA 1VPLA 4QFMA 3KJGA 3NXSA 4ON9A 1N6HA 4D0LB 3B5JA 3EIHA 1TUIA 2BKUA 2XNDD 4TT3D 3W5JA 2A5YB 2AL7A 2R2AA 5L3RA 5E7IA 2ZS9A 1BIFA 1UEIA 4YMVA 2RHDA 1FQKA 3ZD6A 1RIFA 4D80A 4L16A 4BFZA 1G20E 1XZQA 4MGZR 1XB2A 3TSZA 5JBQA 1IN8A 1ZVQA 4MA4A 3AVVA 2FFAA 1D2NA 8OHMA 1NKTA 3RSOA 2CHQA 2AN9A 2KSQA 5HPYB 1S0UA 4NYMQ 2OBNA 2QNRA 1FOEB 4RZ2A 4TL7A 2C77A 1CBUA 4TMZA 4EPTA 3P32A 3WYAA 4DC9A 2F43B 2FJUA 2A30A 3LD9A 3P20A 1DARA 3GLHE 4QHYA 1NKSA 3VNUA 1OH5A 2C9YA 1YZKA 1Z2CA 3S1AA 4EQ6A 2BM0A 3GJ5A 5FOXA 2FZLA 5BQ5A 5JSZA 2REBA 2G3YA 1AZSC 1E1RA 1XTRA 4D81A 3GLIE 1COWA 5JRZA 4B3FX 4CEIB 1YRAA 4IDOA 4V0OA 3FFBA 5JS7A 2RHMA 2O0KA 4OI2A 3CONA 2ZR0A 3X2SA 4CRWB 4LUCA 3ASYA 3CNOA 2GETA 3KXLA 4LJ9A 3HU2A 1G64A 4PC1A 4TT3A 4TLCA 2P2LA 3EARA 3IILA 4DIDA 3DHWC 1KIMA 4YMTA 1J8YF 4D4JA 1KI4A 4F4IA 3DEFA 1KDPA 1MABB 2VHJA 1ZIPA 2R6FA 3SI7A 3N2EA 4NU0A 4JLPA 3MWJA 4MRRA 4V0KA 3ZQJA 3GEIA 4X8LA 2VSXA 4ASUD 3ZZTA 4KBGA 5J47A 3SYKA 1E96A 1II0A 3P1JA 3IIKA 3L0SA 4QJ5A 4JLDA 4M1WA 1S9HA 3KKQA 1E2EA 2YWHA 1RJ9A 1X8KA 3W6OA 4L8GA 5DO9A 4XWOA 2ZRCA 2JAQA 3MSXA 1HT2E 2R9VA 3ZIAA 2IS2A 2ZRDA 1YR8A 1N25A 1XCMA 2CK3A 2F43A 1JAIA 2FZ4A 3O8CA 1WE2A 4Q00A 4TLBA 3EAQA 1H8HD 1I4TD 2WM9B 1XCPA 2V9PA 3X1DA 2WICA 4Q9IA 4C0KA 4DB4A 1FTSA 4M53A 4Q1DA 4Q7MB 1ODFA 4JKYA 1XEXB 2V7QA 2P5SA 1JJVA 1P61B 2FPMA 3BS4A 2XZOA 5KOYA 2BHRA 3IIJA 5C4MA 3IKJA 3QY0A 2BV3A 4BGDA 5KDOA 1QHNA 3AP3A 3U61B 1NVXQ 3KQUA 5FOTA 3SHFA 3TW4A 1DAHA 4UNRA 4F93B 5D3QA 1JR3A 3U3MA 1JPNA 4AWXA 1MR3F 1NI3A 1E1QA 1NN1A 2OFXA 1VMAA 2XSZD 2QP4A 1FUUA 4BFSA 1TNDA 1KJZA 2QE7A 1Q57A 1UF9A 1T3HA 3CM0A 3QPUA 1DBSA 5G40A 2C9CA 2HLDA 4NBSA 3VKWA 1W0JA 4QHTA 4C30A 4ESVA 2IF0A 1ZYUA 3DVLA 2GEDA 1Q3HA 1IJFA 2QBYA 5FUXA 2XB4A 2GHIA 4LZZA 521PA 5CDFE 1MRNA 1NJFA 2NMVA 3QPWA 3DKPA 1NVVR 3MWKA 3A36A 4CEIA 1V5WA 2OE2A 2HF9A 2IS4A 5KPDA 1E2GA 4W5JA 1E1RD 1S96A 1W4RA 3B1VA 1N5KA 4G5OA 4LHYA 2E1RA 2ZQ5A 3AKYA 1JPJA 4XTCS 1IN5A 2FNAA 3U60B 1NL3A 2I1QA 5E3HA 2QGNA 2QAGA 2IBMA 5CIWA 5DSZA 3EWSA 3ZD7A 1G3IA 2PX0A 3REFA 1C1YA 2PCLA 1LV7A 2NGRA 4DLXA 2RH5A 2JEOA 2W6JA 2WWFA 2J0QA 2R44A 1UPTA 5KSPA 1MH1A 1VCOA 3QE0A 3B82A 2GXSA 3TK1A 4AY2A 3AVOA 1XF9A 3HYTA 1HQYE 1SULA 2ZR7A 2WIBA 1LF0A 4B2LA 1W4AA 2P0EA 2O8DB 2NO7A 4TLDA 2WWHA 2JCSA 3CRQA 5F2EA 2BEJA 2CL6X 2GJSA 4IOMA 3KZ1E 3EIEA 5E4FA 3TGPA 5CLLA 3BD9A 2BOVA 2VHUA 2ZRBA 2ZRJA 3OIUA 4PHHA 4Q02A 1OXSC 1S2MA 4NH0A 2ORWA 4GOXA 2IT1A 3CPEA 3CX7A 3PIRA 3W90A 1ZNZA 4AKEA 2KBEA 3LW8A 1XD8A 5E95A 2ANCA 5FPYA 4HATA 5AR1A 1HE8B 3M1IA 1NRJB 2FFBA 2UZIR 2LKDA 3NG1A 1VG9B 4C7OA 2GESA 2RGNA 4HB3A 4KAXA 5IK2A 3LBHA 4A0FA 4Z8YA 3QKTA 1OYWA 4DSNA 2ATVA 3OE7A 3V00A 3LQQA 4YLGA 4FMCF 4PPFA 3GD7A 4C0BA 4C2UA 1ZC4A 2ZE7A 4MKFA 1KMQA 4WW0A 2W00A 2V1XA 1YHNA 2ZI5A 1Z29A 4DT1B 2WKPA 1HURA 3K9LA 3AGPA 1LB1B 1E4VA 2VSOA 2IHBA 1WBBA 1AK2A 3P4XA 2K5UA 2EQBA 2HT6A 3SQXA 2OBMA 3FKQA 3W3AA 4ACAA 1GZSA 2VTKA 5FH9A 2GA8A 2VQSA 1QF9A 3I73A 4HSEA 2J0UA 3UMSA 2O8EA 1AKEA 2IYZA 1KYIA 3FTQA 6Q21A 1FNNA 2GK7A 3AB3A 2V6IA 1Z0JA 3EPKA 4M9ZA 1FMJA 2WJIA 3SS8A 2XXAA 2WHXA 2ZPTX 4HUQB 2CE2X 3RABA 2Q6TA 2BBOA 3QI2A 2C9OA 4JVMA 1XJQA 2RGAA 2YOHA 4GP6A 1TTTA 1QRAA 4RZXA 4A8JB 2YKGA 2JJ2A 5HCNA 4I99A 1F2UA 3K1JA 4YDSA 3BFVA 1CF4A 1VCNA 2YNMA 1BKDR 5CJPA 1XTKA 1G4UR 1M7GA 2O8FB 4G5RA 2IXGA 4EQ6B 5A5GA 1OXUA 3IHWA 1VG0B 3QEJA 5AWFC 4C0SA 3QVVA 1ZAKA 1VG8A 4RD4A 2QM7A 2ZJBA 3NDBB 4R2HA 4DIEA 3QQ5A 4PO8A 4TQAA 5L8VA 4IDPA 4N3NA 4TYWA 1X1SA 1OXTA 2ZSDA 4D4LA 2OZEA 1W4BA 3FWYA 1PZNA 4R98A 4WAUA 4RFVA 3PFIA 4DXAA 2QZ4A 1E9CA 2WJHA 1A2KC 4HAZA 4A82A 4TYNA 1EFTA 2QGZA 3NH9A 4R2IA 1U8AA 4TN1A 4B6FA 2BBWA 2CXXA 2FN4A 2GILA 2CJWA 4TZ6A 5FFMA 4C4PA 1Q3TA 5CJ2A 5CK4A 5C46F 5P21A 3TH5A 5KU1A 2ZREA 2VIIA 4PSAA 1R0XA 4YC7A 1TQDA 1G6OA 4US2R 3EA5A 1RJ9B 3DPUA 1F2TB 5CYOA 1Z6TA 2PJRA 3LXRA 4EJSB 2GJAA 1KAGA 2PCJA 1GNQA 3D7MA 3PXGA 2R6AA 3JZMA 2HJVA 3B7GA 5TVKA 2MSCB 2PEYA 3NIBA 4LPSA 2A3RA 4DSTA 4AC9A 1KO8A 4CT5A 2J59A 1E2DA 4TLEA 4JMPA 2VO1A 3CRRA 2O8BA 3K9GA 1E4YA 4JVNA 4P4SA 3K09C 3C5HA 3PEUA 3T1OA 1BS1A 5LB4A 3WMFA 3KFXA 4TTQA 1LNZA 4AURA 1DTSA 2CLSA 4PHTA 2V3CC 1BO6A 4FINA 1XCGB 1FFHA 4ZKDA 1RC8A 4O2RA 4GZLA 3G5UA 1GKUB 3H86A 4BRUA 3CB4A 4Q9LA 1D2EA 2CBZA 2VHTA 4FIDA 5JHHB 2ZSEA 4IDNA 4Q9HA 1NY6A 1GVNB 4L5BA 2QTVB 3D6TB 4TYYA 4JZKA 3SJCA 3GJ3A 1J90A 1T91A 4U00A 4PR0A 1QHXA 3P27A 2H5EA 3FMFA 1R10A 3Q85A 3SBEA 4DLRA 4QGAA 1NY5A 1M74A 3FMOB 3BH6A 4HAUA 3WRYC 3B9QA 1DS6A 4OKSA 3WMEA 4JYBA 2CLCX 1IN7A 2IK8A 1EFRA 1SXJC 1N5LA 2REXB 1XJ0A 2VP0A 2GJKA 2QI9C 4MKIA 1J7KA 1P9NA 2VHCA 3NEJA 1AS3A 5KNCA 2DYKA 3ICQB 1G8HA 3I8XA 2BM1A 4M21A 3M6AA 4HAXA 4JT4A 4WBSA 1N6IA 5IHPA 3PJRA 1W1WA 1ZUHA 4JSYA 3NBXX 1WBDA 5GADl 3N2IA 1Z6GA 4ZDKA 2KB0A 2JIZD 2C95A 5FTKA 2OCPA 3T5GA 3U3KA 2HCBA 3N5CA 2AK2A 5JCPA 1XP8A 1ZM7A 2WPDD 2AR7A 1Q12A 2R6GA 4X8OA 2NZJA 2OAP1 3CR8A 4A4DA 3EPJA 1JR3E 1BMFD 1GILA 4IW3B 4QBHA 2FX3A 2D2EA 1YZLA 4JL6A 2O8DA 3IPXA 1CR1A 3CZQA 1ZU5A 3SU8A 2O8EB 4P3YA 2B8WA 1VKJA 3AUYA 1G7TA 4XSGA 4BPBA 4KFUA 3UMFA 3K0FA 1A7JA 1QZXA 2QPOA 2QQ0A 2QMHA 4A92A 3WNCA 3PCRB 421PA 1MT0A 1N0UA 5TB5A 3LDAA 5EP2A 2FF7A 4LJAA 2QSZA 3NHBA 4LYHA 5AJVB 4EIWA 4JVLA 1A1VA 3SFZA 4LCBA 1W5TA 3ZIAD 3WYFA 2X1VA 2GDJA 4BLPA 3VNVA 4WZAE 1H8EA 4M1OA 1XWIA 1Z0AA 3ETLA 1T0HB 3I72A 4D6PA 1VG1A 1IJEA 1M2OB 3GJ4A 4CEJA 2V7QD 4V0ME 2B6HA 4ZDJA 4L9WA 4KHZA 3KKPA 1PUIA 2B8TA 2ZSFA 1YRBA 4EFNA 2N46A 2F6RA 1L8QA 4MQBA 3W5IA 4FMDB 1UKYA 2HCJB 3SJBA 3LRPA 1KMHB 4KV9A 2IYWA 5DLQC 4OQLA 4AKHA 2PT5A 3RAPR 3ICEA 3RS0A 2WPDA 2HV8A 1SGWA 4DHEA 4PZYA 1W48A 3GLIA 4XJXA 1KO1A 2WWYA 2Z5FA 1KOFA 621PA 4E22A 3G82C 2RGNC 1FUKA 4M22A 5GVSA 4RCYA 3BB3A 4CYMA 3THYB 2FGKA 4ZPXA 2FG5A 1R4AA 2QE7D 1Z06A 3FFAA 5TARA 5EJEA 3RHFA 3PUVA 4OQMA 4BLQA 5HR5A 4PC3A 2YC4C 5TDHA 2AD5A 1GKYA 1XPUA 1S1CA 2IYTA 3QKUA 3FGNA 5AJYA 1RVDA 2EYQA 4E09A 2O8CA 5ANRB 821PA 3OIWA 3BB1A 5J4LA 2RGDA 1PLKA 2CK3D 3B9PA 4KFTA 3K9HA 4D4KA 3FKSD 2XJ9A 1QG2A 1YJ5A 4BZPA 3L43A 3OEHD 2AKYA 5B64A 1AQUA 2JLVA 1F2UB 3LAWA 4EUNA 2CNWA 4HB0A 4JS0A 3FDIA 5FPKA 4G5QA 2ZRMA 5EP3A 2ONKA 3T35A 1HTWA 1KI1A 2VPPA 2P65A 4B3XA 2X77A 4B76A 1QHSA 3T12A 1CS4C 3MGCA 1W2GA 2WJVA 5B2ZA 4HUTA 1OLOA 4QNRA 2VP6A 3LY5A 3A6PC 2CDNA 2R6CA 2WWIA 1HEIA 3KXKA 3VR4A 4AYWA 4U02A 3FE2A 1SVSA 1E1QD 1BMFA 2IS1A 2F1HA 4PZLA 1OHHD 1MOZA 4YONB 3D31A 3ZVRA 3UWOA 3I5XA 4CT4B 2ZRIA 4LJ6A 1NJGA 4PAOA 4UNNA 5KPJA 2GCPA 1XNJA 2BMJA 4BZXA 3SOPA 5CB6A 4C9BA 1Z63A 2WJGA 2NTYC 2QENA 3LBIA 4AD8A 3TUJC 2VH5R 4X8HA 3KQHA 4IOKA 1OH6A 2ZRGA 1LFDB 4KYUA 4IRUB 4A15A 4M1TA 2O0JA 1W0KA 4M1YA 2W0MA 1OFIA 4DZZA 1UBGA 4TL8A 2ATXA 3I92A 4FMBB 1KO4A 1IXSB 1Z2AA 4BUJA 2JLUA 1R5OA 1ZCAA 3LQRA 2VP5A 2UVQA 2KE5A 1JB1A 1NBME 1ZNYA 4A9AA 4MYCA 2JLYA 1FQJA 2VP4A 3LLUA 1SXJD 5JMTA 5F9HA 1R5BA 1GWNA 5B30A 2HLDD 5G3ZA 4DJTA 1W0JD 1OH8A 1IONA 1GTVA 3QF4A 4HDQB 2R62A 4XH9B 1EWQA 1DAGA 1NBMD 3K8YA 1R0ZA 1M7HA 1CKEA 2W6JD 4ARZA 5J4YA 3LV8A 2IW3A 4G0NA 4QJ4A 2QL6A 3RRYA 5BWMA 3FVQA 2V4ZA 4ZIRB 1KAOA 4MYUA 1J8MF 3EZ2A 5H70A 2Q3HA 1XD2A 1G1MA 3ZVLA 3GLHA 4JIMA 3T61A 2BBSA 2ZI7A 3SNHA 2XZLA 2YVUA 1KSFX 2AXNA 1P75A 1XD9A 121PA 4HLCA 4PHFA 3A4MA 1G9XA 1NG1A 1QVAA 4TTRA 3FKSA 4A6PA 4JT2A 4LJ7A 3KTAB 4ILEA 1Q21A 3OEHA 3MCAA 4DLTA 4Y0VA 1JJ7A 3VAAA 3VU9B 721PA 2CNWD 1ZM2A 4QGHA 3TAUA 4ZCLA 1UM8A 5EXTA 4URZR 4URUR 2D7CA 3I62A 5E7JA 3AVPA 5JEDA 3QPVA 2WWWA 1A5TA 3BH7A 4UNPA 3OHMA 1DPFA 4Q7LA 3KJEA 3SJAA 2RAPA 2OO7A 5L3SB 3CZPA 5DIFA 2VEDA 4AG6A 1W44A 1OHHA 1PLLA 2WIAA 4MDFA 3TKLA 4DEXA 1BYIA 1N6NA 5DE3A 1N2CE 2J0UB 3QBTA 1VCMA 4W9MC 1ZW6A 1J70A 3KL4A 3WBKA 4PHGA 4OI4A 1Y3AA 4DEYA 1M6NA 4JLOA 5FI0B 2ERYA 3IBGA 2F7SA 1TX4B 2RGCA 2F9LA 3GLGA 2ODEA 2H8KA 3CWZA 1L4UA 1KJYA 1SXJE 2IYQA 2XOKD 2WJYA 3MD0A 2QAGC 1EK0A 4P33A 3I4LA 1Q20A 1IY2A 1SXJB 4CDGA 5BN5A 3A1UA 5GJWC 2OSBA 2QTFA 1T9HA 4P0TA 4HZUB 3LX5A 4DDVA 2L0XA 1SZPA 2RCNA 3UG7A 1U81A 4A0RA 3U3RA 1EFUA 3KB1A 3VU9A 4I1OA 3A8TA 4PQYA 2IC5A 4J0QA 2P67A 4BFYA 2C99A 3RS5A 3IUYA 2J45A 4QHSA 2J3EA 2IXFA 3EA0A 3RRNA 2C04A 4Q9JA 1OXXK 1G17A 1NBMA 4FCTA 1JXMA 4TWZA 3THYA 5FTLA 3B6EA 1JECA 2ZS7A 5JWHA 4BLTA 4DSOA 4KJZA 5DNYB 2OEPA 4LBVA 5JS8A 1SVIA 3WRXC 3UPUA 3KDSE 3R9XA 5FPHA 2RGBA 4KFSA 4RD0A 5F98A 1COWD 2BCGY 2JGNA 2QA5A 3OESA 2D74A 2Z4SA 3RS2A 1YKSA 3RWMB 1J99A 3THWA 2JJ2D 2FSIA 1Z3IX 1LY1A 1T4GA 4JLMA 4HAWA 4DBLC 3PR1A 1K5GA 1YE8A 3AGQA 4QBFA 2PEZA 5LBIA 4D0GA 5AUQA 4MGKR 3RDPA 2QORA 3KJHA 2WOOA 1EFRD 3C14C 2BVNA 4RSGA 2PT7A 1WB9A 1XD2B 3BRWD 1EX7A 3NDPA 4F91B 3CPJB 1OW3B 3SJZA 2AFIE 1YR6A 1E9BA 2JDID 1E0AA 3MRSA 4W5HA 2FMXA 3THXA 1CR2A 1CXZA 1U94A 3MAAC 4DLYA 5K8TA 1KI6B 4OJKA 4DRZA 4WXRA 1TUEA 1DOAA 3UIEA 3U3OA 3C8UA 3AF2A 3CR7A 4KLNA 2G77B 2DHRA 3FOZA 3QF4B 5KNBA 1YZUA 1HA3A 1KI3A 1FP7A 3F3YA 2J9RA 1N0VC 4EPVA 2VSFA 4OK6A 3HR8A 4KXFB 3EZ6A 1FPMA 3LW7A 3QKSB 1R2QA 2A5GA 4GRAA 4II7A 4C0JA 2E87A 2HEIA 2MSDB 2G0NA 3QKRA 5J40A 4ZCIA 4O0MA 1XXHE 3CKLA 3OFND 1GRQA 3E70C 5JCZA 1WCV1 5HTKA 4HLQB 2GCNA 4F4JA 4PPQA 5SZKB 3SYLA 2ZYWX 3ZH9B 4D0NA 1OKKD 4PAMA 3HJNA 1ZC3A 4A8JC 3P26A 1TF5A 1S8FA 1GM5A 2WBLC 4TYQA 4NCIA 3ECCA 3REGA 1Z28A 4YMSA 1KI9A 2ONJA 2FSHA 4IVRA 3E2IA 4HAYA 5FBWB 3L82B 1YU9A 1ETUA 1TU3A 3MWLA 1EFHA 3N70A 4R71A 4FMDF 3R9WA 4MRPA 2ZXUA 1U0LA 4AG5A 1XEXA 2IEZA 2ZSBA 3TRFA 1CR4A 1PJRA 2ZU6A 4HLUC 1OE0A 1X8JA 4FI3C 3OIVA 2OG2A 4LY6A 4KSCA 5EE3A 3ZLJA 3QG5A 1SVOA 2OBLA 2ODBA 4Q4LA 3T1TA 4HI0E 5CLQA 1B0UA 4LYJA 1JEDA 2P6RA 3AVWA 5JJIA 2WKRA 1LS1A 5FTJA 3RWOA 2G88A 1L4YA 4O3MA 2B7BA 3KQNA 1TF2A 3BAFA 4BFUA 3VX3A 1IOZA 4QL3A 5AUNB 1VIYA 2OXRA 5GJBA 3QXXA 1CJKC 2BC9A 2NO9A 2WAYA 3GJ0A 3CX8A 2IX3A 3IHLA 1M7BA 3PVSA 3GMTA 1E9AA 1W36B 1QVRA 3CNNA 4JBYA 2A5FA 2YOFA 5K8LA 4B44A 4U7DA 1TQ6A 2ZM5A 3BB4A 5KSYA 2QG6A 4E03A 3A1SA 2XXAB 2J0VA 3VR5A 1XEFA 3AP1A 3TNFA 1MKYA 1JR3D 1UDXA 2WKQA 5KDDA 5H8WA 4TSFD 1RYHA 1N6OA 4B3DA 1LVGA 1UKZA 1FL9A 2GVDC 3B1WA 1O3YA 2BWJA 2V8OA 3SE0A 3KKOA 2ODWA 5DI3A 2JLQA 3VR3A 2J1LA 2NO6A 4Z1MA 2PLFA 1K8RA 2IYUA 3GFTA 1F2TA 5FOUA 4KITB 3CW2A 1KNXA 4RD6A 5CIQA 4RFSA 3WBJA 1S1MA 4PC2A 1RRGA 4MITA 1ZM4A 5SZHB 4NDZA 5K8UA 4NYJQ 3T15A 3TUZC 4PQRA 1W46A 3CLVA 2WV9A 5DI9A 1AZTA 2G1KA 1O87A 1W47A 2YC2C 3GLIB 2VLIA 2OV2A 2ZUDA 1UKEA 4FXPA 5FL7A 4M9SA 3AKDA 1G7RA 1XPRA 4FMCB 4O25A 2EWWA 1ZMXA 3KQKA 2F1RA 3GLHB 1Q1EA 1X6VA 1QHIA 2IL1A 3BORA 3B1XA 5LDDC 3CH5A 1U2RA 2ZRKA 1MABA 1SKYE 1DO0A 3BH0A 3KFVA 4DCVA 1YZNA 1OPXA 2G6BA 4NP6A 2ZUBA 4PFSA 3DDCA 3EC1A 1P73A 3DMDA 4KSBA 3GLFA 1VECA 1RW4A 5CK5A 5EZ6B 3OF5A 2OILA 2G0TA 5JJLA 4FWTA 3C16C 4B73A 2PBRA 2ZRPA 3HDTA 1E79D 2JJ1D 4OHWA 5AUPB 3T1QA 4I4LA 4YMWA 2FA9A 4PSVA 1NSFA 1OIVA 2VL7A 4OJQA 3EIQA 5C4GB 4BLSA 1E2QA 3I8SA 3R8FA 4JBWA 2D7DA 4UQOA 1CIPA 3QJYA 2KI5A 5FOSA 1T5LA 1CP2A 4ZIRA 3EZFA 3TQFA 2C78A 4ZI3A 1EX6A 1ANKA 4TQ9A 1F48A 2YV5A 1UFQA 4ZI2A 4GL2A 1G41A 1N5IA 2EVWX 4H1VA 4LBYA 5EUMA 2ZE6A 3T06B 3K0CC 4TMKA 2XNSA 2O8FA 1XRJA 5IRCD 3CF2A 1II8A 2AXPA 4DUGA 2CCJA 4V02A 2VF8A 4FW9A 4PPNA 1EFCA 4ZCMA 1SVWA 5DYGA 1VYVA 3BBPA 1SVKA 4WZBE 2ZJ5A 2J5XA 3TJZA 5JI2E 2CVFA 2W2VA 3AF4A 3SYNA 3IBYA 3P4YA 5DYIA 4GOJA 4EPXA 5C1BA 2FU5C 4UJ3A 5JHGB 1XMJA 3TSOA 2CMKA 1A82A 3BC1A 4TQUS 4YQFA 2HJGA 2N42A 2OFOA 1F5NA 2ZRHA 1KSJA 3WP0A 4A0GA 1U98A 5FUYA 3KB2A 5K8IA 2QMOA 2OXCA 4RZ3A 1ONBA 1L7VC 3UKDA 3NKVA 2OCBA 4KFRA 2IEYA 4B3GA 2REOA 4V0NA 2XTNA 4LSGA 1TMKA 1G8FA 3MJHA 1P5ZB 2X8AA 3PUXA 1YZGA 3SFVA 3TSWA 3THWB 4BZQA 1P4SA 4X8MA 1II9A 1D9ZA 3LX8A 4DCNA 1NIPA 1VHTA 4IKEA 3AEZA 2BBTA 3V9PA 3U4QB 4Q21A 1SHKA 3AH8A 4C0QC 1AQYA 3K0AB 1FP6A 3L8YA 3TUIC 2FEMA 2GZHA 1TL7C 1N0WA 3MJRA 4NYJR 4D2IA 4ARZB 4K81B 3SHWA 3CIOA 2QROA 2ZI6A 1ZNWA 2OLKA 5KO2A 3BK7A 3VHLB 4ABYA 2XZPA 2ZVPX 4OI1A 5FL7D 2GAAA 4A1FA 3QVUA 4DLVA 1XDBA 2AWNA 4B47A 4EAQA 4HB2A 1W0KD 3A1VA 3NBFA 4A0HA 3K0SA 1QHHB 4JLBA 3AV0B 3W8NA 4NONA 3RS7A 1B23P 1P9WA 1OFTA 1XTJA 1H8HA 1UBEA 3WXMA 3LVQE 3DOEA 2Q21A 4V0MA 4FN5A 4TYPA 4A2WA 3NVAA 5F9FA 3JVVA 1UAAA 4BLOA 2JLXA 1J2JA 4EJSA 3ZDQA 1G21E 2YWGA 4U5XA 3QXJA 4AK9A 2XOKA 5JFGA 3KX2A 5B57C 1XU4A 4Q1AA 4QBGB 1G8GA 4PC6A 3THOA 3UK6A 2P5TB 2ZJYA 1E79A 2JJ1A 1U9IA 3DOFA 2Q3FA 1K5DA 3B60A 4QGFA 3M0EA 4Q4AB 2GXQA 4LYAA 4NCJA 1K6MA 2GF0A 4RFSB 3ZZ0A 4QRHA 1D5CA 1RPZA 2IYVA 4MKGA 4PX9A 3GFOA 3IEVA 3Q72A 2WOJA 3SEAA 5JEEA 4Q7JB 2NPIA 3L0OA 2F1IA 1R0WA 1HE1C 1DELA 3UANA 3IQWA 3QF7A 1XJCA 2JLZA 2O0HA 4AKIA 4XVQA 5CM8B 2ZU0C 1GRRA 2ZYTX 1CRQA 2VA8A 3K0AA 3SQWA 5EE1A 4NKRA 4S2EA 4OHVA 1JR6A 4HDCA 2WZQA 5L3QB 4GDFA 2X2FA 4CVNA 3F0TA 1PV4A 2W0SA 5AUOB 2EWVA 2MSEB 2Z4RA 1UJ2A 3ONWA 1NVWQ 2GWHA 1DAIA 1DVRA 3X1YA 3K0FB 2WMNB 3G0HA 1LF5A 5CM9C 3B85A 1RE0A 4GBMA 1WMSA 1SKYB 1KO7A 1NLFA 5DISB 1T8TA 2A2ZA 3FMIA 4NCNA 4KVAA 3W6PA 4M4SA 4JLJA 4N0DA 4Q01A 5IT5A 3THXB 4F92B 1P62B 2WSMA 2A5JA 1KKMA 2YZ2A 4I1SA 1XX6A 4XSHA 1DAMA 2FV8A 3K70D 1VDZA 1GP2A 1OXVA 1XTSA 5HKKA 1UADA 1Q1BA 2CHVA 4OHZA 3VTKA 4XTRA 2AFHE 4RKFA 3TMKA 2QN6A 4I81A 5AJXA 3ND9A 1XFAA 2DPXA 3IDQA 3LLMA 2WAXA 3QG1A 3QXHA 2OCAA 4PC7A 2FWRA 4GI7A 4WZ6A 1D2MA 1T0JB 4HB4A 1G16A 1IXRC 2QMUA 5HE8A 2RGEA 5A0FA 1YR7A 2IUUA 1Q1QA 2EFDB 1D9XA 2QY9A 4GT1A 2CLDX 1TPZA 4G1UC 2F1JA 1RRPA 1OT3A 2NO0A 1D6JA 1TADA 1S9DA 1P7CA 3TE6A 1YQTA 3D3QA 2PZGA 1N6LA 3V4RA 4GSYA 4TL9A 2ZANA 4Q03A 4EKDA 2WJJA 4M1SA 4PO9A 1CJTC 1E2MA 3CUEF 3R7WA 1DEKA 3OE7D 2QU8A 1NMZA 3JVUA 5FI1B 3TR0A 1Z5ZA 1Z0FA 1U90A 2EFCB 4UXJA 1VCIA 3VR1A 3DM5A 2QEQA 3RLFA 4Q66C 2BJWA 3B8HA 1WF3A 2B92A 4IXMA 4GFDA 2WSSD 3R9IA 4WXPA 4B3CA 2D2FA 2CCGA 3ZJYA 5HE9A 4AKGA 1HH4A 1IN6A 1AIPA 1UDWA 1NN0A 4ESHA 1AGPA 4WIAA 4DVGA 4DB2A 1OF1A 1OFUX 1AS0A 3H0KA 3DM9B 2QPAA 1MO5A 2PZEA 3VR2A 1XBTA 2EU8A 1V43A 3EASA 4TMVA 1W5SA 4YDHB 3NEYA 1I2MA 1XTIA 2AX4A 3B1YA 1QHGA 3OFNA 3TQCA 2XAUA 1E99A 1W49A 1Z22A 1AA9A 2QAGB 2QP3A 3KUCA 1UKVY 2GNOA 2NZ8A 2GF9A 4Q47A 5KSOA 4B75A 4LX0A 1OH7A 5FTMA 2XITA 3PV0A 1VTKA 4UNSA 3CO5A 1E2KA 2JDIA 4NCKA 1N6PA 2ZR9A 3EZ7A 3QXSA 4KU4A 5DGXA 5KYKA 2HYIC 4JLKA 2QUZA 5FBVB 5FUVA 3HWSA 1JEEA 3A1TA 4GNKA 2XNDA 1X86B 5FUWA 4XWKA 1FW6A 2PX3A 1KI2A 2P6NA 4D26A 2ZETA 4RD3A 5EXPA 4NTZA 2ZYUX 1DAFA 2I4IA 2PL3A 1E0KA 2X19A 5GJCA 2DWOA 4URXR 4TMTA 1OIXA 1P2VA 1FTNA 1QDEA 4HEJA 4FCVA 1GAJA 4ITRC 2KWIA 3C15C 4LHZA 3NBYC 4C0HA 4Z1MD 1U8ZA 5KSZA 4CEHB 4LHWA 4GPTA 1CRPA 4KI0A 3TVTA 1R8QA 1ZD8A 2IYRA 2H17A 3GJXC 4ASUA 4Q9KA 4EFLA 2GBLA 1G18A 1G5PA 4JLAA 4EFMA 4G01B 4MH0R 5BYJA 4URVR 4MRSA 3S1AB 4NYMR 1T5IA 2JLRA 4M9XA 4L9SA 2Z43A 1HUQA 1Z6AA 4KO8A 2NPFA 3CH4B 1N5JA 1E9SA 1ZP6A 1T3SA 2KBFA 4US0R 4KVGA 5DN6A 2Z83A 4LRWA 1E32A 1MO6A 1XPOA 2IUSA 1EGAA 3SDZA 4XWAA 1NMXA 3CWQA 1E2JA 2GZAA 1IY1A 1PUJA 4TZ0A 2OUKA 1U8YA 1XTQA 2BJVA 1G4AE 1IHUA 2QSYA 3FPAA 2QM8A 1OSNA 1NNEA 4MUAA 1SXJA 3ZVMA 3U7HB 3UXMA 1ZCBA 2FPKA 2QAJA 3T5DA 1S4QA 4OK3A 5FPSA 3QUSA 5M04A 3ADKA 3LNCA 4YMUA 3GLFB 1G8YA 3GPLA 2DFKB 4XD7A 2ZJ2A 3RS3A 2XTMA 3HU3A 5C18A 1OB2A 2Z6VA 2IYYA 1QHYA 1JALA 4DLUA 2VYFA 1G291 3OEED 1EWRA 2OCYC 2EYUA 3EG5A 4R7ZA 5IDVA 1KHTA 2XSZA 3C41J 4QGGA 1S3GA 2QPTA 3WY9A 5LD2C 2OT3B 3UWKA 3C5CA 4A2QA 1WP9A 5JJKA 4M1KA 1P2UA 4Q4HA 1ZD9A 4MYHA 4QOSA 4Q7KA 4LV5B 3AF1A 5EUQB 2AD1A 3VX4A 5KTYA 1EG7A 4LYFA 4DUGD 1R7RA 1T6NA 3CBQA 3ADCA 1E6CA 3KKNA 5EZ5A 3RANA 3EWAA 2DWPA 3O47A 4ZO4A 1KY3A 4OQNA 3U7GA 1AKYA 3FHOA 4POAA 4D4MA 4D25A 2ODNA 3SBDA 4ZDIA 2QRNA 4R9UC 3NC1C 4LHXA 4WOPA 1ZJ6A 3DZDA 5CDFA 1KK2A 1Z8FA 2P3SA 2WMOB 2ZJOA 1L2TA 2GZDA 2JIZA 3LWNA 1G19A 3BIFA 4LWZA 4KBFA 3VKGA 4C0AC 5JWOA 2XB2A 3CPHA 4H9GA 4Z51A 3WP1B 3BXZA 2XX3A 3HP1A 3K70B 1WDTA 1N3BA 3V4FA 1NN5A 2MMCA 3X1ZA 1GRNA 2W2XA 3IQXA 4DLSA 1S3SA 3RC3A 3EW9A 1Z0IA 4UXIA 2GBLC 1US8B 2LCFA 5C2JB 1XEWX 4BFWA 1NLZA 1D8TA 1SKQA 2ASEA 4BASA 3QSYA 3GJ7A 4JL8A 3ADBA 1Z47A 3IO5A 3OZXA 4HZUA 1E2FA 2A78A 2AWOA 3QENA 2GEVA 5JWRA 2OAQ1 1NN3A 2D3WA 5KDLA 1DADA 1W4CA 3KJIA 4URWR 3TVDA 2I3BA 2ZITA 4O2LA 1LS6A 1GOTA 1P60A 3CRW1 2LKCA 2UKDA 3BWDD 1KI8A 3VR6A 2ZUCA 3K09A 2Q0HA 1GNRA 3MWYW 2IYSA 1KJWA 1KZGB 2X2EA 3KUDA 4JSTA 4RZUA 1CJVC 5AJZA 4P32A 3VQTA 4OHXA 3TBKA 5DN6D 3M4YA 2DWQA
chains in the Genus database with same CATH superfamily
2ZAMA 4C4ZA 2J5BA 1YNSA 2ZRAA 3SR4A 4N01A 4BNDB 1VXRA 2C59A 4DCGA 4HVAA 1V25A 3R77A 3VKHA 2QTHA 1Y3BE 2RGGA 1CP3A 1Q91A 1Y8CA 1YKGA 2Y0CA 4M8SA 4TN5A 3VSEA 4E1VA 1LPNA 1KK1A 4ZCQA 4HDAA 4O4IF 5B1IA 3S8MA 2ORIA 4JLNA 2JFXA 4Y0AA 3W2TA 3A0UA 4DC0A 1GL6A 1XDUA 2H7XA 3AI7A 4MV5A 3C8MA 5JLJA 1NI4B 2LD4A 1S02A 4XVRA 1ELOA 4GI5A 2Z2IA 4XD7D 3QVWA 2Z8ZA 2LWIA 3BJEA 3WNBA 1NBIA 1DT5A 1JI0A 2MSWA 2XVYA 1KGDA 4BB0A 3NIWA 5FR2A 1J42A 1HEYA 2ZPAA 5FWYA 2P4HX 3PHJA 4QU0A 1QO0A 1Q84A 1DUIA 2UYQA 1L1EA 4QXQA 5LM3A 4FYVA 1E9FA 4B8ZA 3WA7A 3O1IC 4JJKA 2YJTD 1FSPA 1BNCA 4BQSA 4WNCA 5GP1A 4BLVA 3BJIC 1E98A 3NBZC 1GGNA 5FT9A 2HCRA 5F3DA 1E7SA 2PBZA 2O5CA 4LE0A 1Q1AA 3LG2A 3AF0A 1K7XB 2GAOA 2ZI9A 5JRJA 1MAWA 2RB4A 1I0IA 4RY0A 1RKBA 1GG9A 1BQEA 1ZH2A 5DHSA 1WA5A 2P68A 2HA3A 2J3LA 2RK3A 4C0LA 3ASUA 4R1NA 5IF9A 2WR8A 1M5UA 1MJNA 1DXOA 1EP9A 2PY6A 3TIFA 1QKIA 3CX6A 1UJBA 3OM8A 1SHZA 4NBKA 4WXEA 2F3QA 4W6QA 4IP0A 5LD2B 4CLDA 1TF7A 4FDLA 1ZVVA 4RKEA 3MS4A 2R8EA 4Q4JA 1WDKA 2OVFA 3GLVA 1TEVA 5AESA 1LRLA 2ZYVX 1I9CA 1QTIA 3PDUA 2MR5A 2Q5QA 4JBXA 3TW8B 1KWKA 1YVDA 1CEQA 2DBVO 1GIAA 4NY1A 4ZQHA 4ZREA 2IHUA 2CJWB 4RVHA 5JARA 1IBRA 4BMDA 1SD5A 2D4HA 2IYOA 4BHTA 1TMYA 3SNKA 5I7EA 2WNIA 3RFFA 1HDZA 3EXHC 4NVRA 1MC1A 2AVNA 2HHCA 3F4BA 3H2KA 1RZ3A 4DABA 2EKDA 1ITZA 2B20A 1Z2EA 2G28A 4N1AA 4YA6A 1IAQA 3C3XA 4FHEA 2AG5A 4YROA 1B1CA 1V6CA 3O75A 4M8LA 4LJ5A 4D1YA 5T8KA 4P86A 3WHKA 4F9EA 1NMYA 4JXKA 1W5EA 4EJFA 2EL7A 4AYXA 3QEOA 4G0OA 4NZYA 4TUYF 5EP1A 5JYBA 4U9IS 1EX9A 5JAPA 3PP8A 4RNDB 1SY7A 1YQXA 5I51A 3CA8A 4NMHA 2UUOA 4CR6A 1WPQA 2A84A 1YZTA 1J0XO 2A94A 4UBNA 3LDUA 2G4LA 2CE7A 3L77A 3GEHA 2BZGA 1M8PA 3NIGB 3R7DA 3RJZA 4U4AA 2H29A 4QDKA 1UAYA 1HKUA 2JVKA 4YRRA 5D8DA 1D1PA 4EMBA 2PJZA 4EKGA 4YMIA 4CFYA 3JSAA 1I4DD 2J3IA 1T2VA 3T95A 3IIEA 1IXZA 3KLMX 4KIWA 2CHGA 4OY3A 4RM3A 4I1UA 3PEWA 1DKOA 3DW1X 2B0CA 4B4DA 1EGMB 3PI6A 2OO5A 2G1UA 4D45A 1KR5A 2DR3A 3K0HA 2B98A 4OXQA 5CURA 3J81A 1Z8DA 1RQNA 4YGYA 1K6EA 3WWEA 3AEUA 3UPTA 2DFLA 4CTJA 1JAXA 1E2LA 2ETXA 4WXMA 1EI9A 3MGBA 4UAJA 4ZVNA 4TM7A 2JASA 3WWDA 4HWSA 4ER0A 3AO0B 4CXMA 1M1YE 2WG0A 1BXKA 1OR8A 1XLTC 2JGIA 3GGGA 3JPYA 1YMVA 4FFDA 3NORA 4B34A 3UQZA 2BFOA 4RD2A 5KVSA 3Q6NA 4CEHA 1SKBA 4TS3A 3LZDA 3MG9A 1WETA 4YQYA 2EX0A 4R8KA 1B15A 4TL6A 2HO5A 3GHHA 3EBLA 4NCHA 2H1LA 4P53A 4TXLA 4OA5A 5A5EA 3T34A 1GPLA 5L6LB 2AFHA 1RZUA 1JXOA 1USVA 1O5OA 1IHPA 2ANBA 2ZRFA 3I5MA 2RIRA 3L7JA 4XE5A 1KYZA 3OJLA 2IV2X 2WTUA 2P9GA 4XFJA 3EQ2A 4FLFA 1UZAA 1F51E 3UJ7A 2IZ0A 3EULA 5T5QA 4ZC1A 2V7WA 4C4SA 2HA0A 1KY2A 5BVGA 2Q5JA 1R8SA 4O2BA 3WLRA 2X0RA 4C5BA 3MTDA 1WUJS 4PXAA 5A7FA 1FFAA 2VDNB 1KC3A 2FPLA 4J07A 5HCIA 4EVSA 5JIBA 2YWFA 3QY9A 3RSCA 3U2QA 5BOVA 3BGDA 4RTKA 3RU2A 4EGFA 1BCRA 4Z8XA 4FU0A 1YQEA 5AMXA 5ADHA 2OV1A 4YV7A 1SOVA 5EXSA 4DCVA 3BZBA 4AZ3B 4ADSG 1DAKA 3EPLA 1KSGA 3SLRA 5F3WB 3AYXB 4PZZA 1QFMA 3ILSA 5BOSB 1GITA 3Q6MA 3W2EA 4MX8A 5GONA 5LMCA 4TMWA 1NVBA 4BNFA 4URHA 4W7HA 1TK3A 1UK8A 1TCCA 5B37A 3HXOA 3E9ZA 1JKJB 1V9LA 2LUOA 1PZMA 2EIHA 2JI9A 1RWWA 4YJ3B 2VF7A 3CF6R 5J4HA 1GNSA 4YQEA 2CCKA 4MKZA 1U8FO 5I9SA 1FZQA 1I0LA 1ZU4A 1ZG3A 1VIDA 1D4FA 2GRJA 2HA6A 5EJ8A 1LTQA 1PR0A 3ADOA 1SH7A 1D07A 1CWUA 2CYBA 1BYUA 2OBFA 4OBEA 3LWZA 2I2BA 3T3PB 5T3YA 3AUXA 2WVAA 4IXNA 4NDAA 4PRZA 1X13A 2ZE5A 3EX7C 3PX7A 1GAXA 4LK2A 3H9GA 3NTLA 2I3ZA 2WLTA 1XAGA 2ZVQX 3FFWA 3SE7A 3RYCA 1M8FA 5EXEA 1RVV1 2BW0A 3A70A 1AA6A 3GCGA 4ARCA 4X3PA 1BX3A 3R3HA 2PLRA 4LV6A 1K9VF 3KSMA 1JSCA 3ULKA 1QIGA 1WLSA 3LFUA 5C8DA 5C9ZA 5LQCA 1G59A 1NGSA 4UVDA 4IJMA 4A23A 1K97A 2EZ8A 3CGGA 3IQHX 3ZIUA 2ST1A 4P4TA 2H2IA 2FP3A 3I5YA 1KU6A 3DGFC 4Z4FA 2R8RA 3W05A 5BVGB 1W29A 3UV7A 4Q3CA 2ZRLA 3P2OA 2DY1A 2XOXA 4ALKA 3FNGA 4JI3B 2HNKA 3VHXA 4DJJA 3DBLA 1AY0A 3D6JA 4NBTA 4OH7A 2DFNA 3LSYA 3LA6A 5FOQA 4NNPA 2HTFA 3UV3A 4Q1EA 3VO1A 1GKIA 1R6AA 1NW6A 2H2HA 2C0PA 1JI3A 1R8YA 4U8HA 1U2QA 2EW2A 2QVCA 2NVBA 3OQPA 5A5FA 3BBLA 1XXHA 2D4AA 3FPGA 5JYCA 4MROA 2FSGA 1PWZA 1DC7A 2FPIB 4MAFA 2Q1YA 3LY8A 1C0LA 4LJKA 1TKCA 2IZOA 2DLNA 1P91A 5F64A 5AW0A 3PJDA 4CGZA 1H65A 1XZKA 4GOKA 2ZVDA 3SX2A 2O2SA 3F1LA 2B82A 4C78A 5IKEA 2EFEB 2QD4A 5INTA 2NIPA 4UCWA 4KW7A 4Q1CA 5IDXA 2GO1A 2OXFA 4AROA 3NC4A 1O95A 2E0IA 3LY7A 4LJ4A 3B6KA 5D5QA 4X44A 4JWKA 1KS2A 2BMEA 4G25A 2DBYA 3U13A 4KR7A 2Q1UA 1FU7A 2D00A 3WNVA 3KRTA 1EWTA 1E1CB 3NH6A 3IOMA 4QRIA 2Q3EA 3ED1A 2J07A 3JALA 1A4UA 1Z6XA 3QXCA 2Q6KA 4OTZA 1WD7A 1UFKA 3CQ9A 1XVLA 1LX7A 1A4IA 3R5FA 3WK5A 3WK9A 2CVZA 5JSZB 2F1OA 3FJYA 1W2HA 3LOUA 3LL4A 5E3IA 1M34A 2XT9A 1BRMA 3GP8A 3LVBA 2C8JA 3ESAA 3IAFA 3M6UA 2H2WA 5EXDA 2XB9A 5TQ2A 1BX0A 3QJGA 1E8MA 4ENQA 2IPXA 1MLDA 2RK6A 4MUKA 3A14A 5FL3A 2YYZA 1I5OA 2DHQA 3AJDA 3ZQ6A 3MXOA 1BFDA 3OKCA 1V9CA 1OAOA 2QLBA 3DKRA 1YHZA 4Y30A 3EVZA 3OE4A 3BQMB 3LNTA 2FQYA 3U6BA 4OHUA 4HNAB 4CMIB 4Z4GA 1XAJA 3DMPA 1SHLA 4MR8A 3W7VA 5G4KB 1CVLA 1BHQ1 3UC9A 1A69A 5JS1A 1IQPA 4EG1A 4PTLA 3QIVA 4JJZA 2R8ZA 3KZOA 5F7OA 4RKRA 1MOPA 2GK6A 3DAOA 3TMAA 3IPYA 4K05A 1RRCA 1QF6A 4G0YA 2YV3A 3EGVA 1ZK3A 2VUIB 4CTNA 1KMCA 4GXNA 4MQEB 1P9OA 1IATA 3C97A 4XIGS 4EJSC 4HBZA 3JQ8B 3R6GA 2Y92A 3I45A 1T8YA 4R05A 1VKHA 5FRDA 4ZHQA 2R68A 2PFSA 2JW5A 2WWGA 1AUVA 1Z0UA 4IV0A 4Z3KA 4IDFA 4V3CA 1L4MA 3OEEA 4X93A 1JFTA 5H68A 3IE0A 3JALB 5FOTA 1T8UA 3MUFA 3TLYA 1QH8A 1XMVA 3O3OB 3H17A 4EUSA 3JQRA 1FFGA 1QIFA 2WYHA 3G68A 4B74A 5E7MA 3I1IA 2VF2A 4BFTA 5G1PA 3B3GA 3ZR4B 3Q5DA 1PQWA 1FFWA 4JITA 5HNKA 1I6MA 2C8KA 4GHWA 1BWSA 5J2TA 3GLGE 3PL1A 1P2TA 4FYIA 2DR2A 2FEOA 3QNWA 1KH3A 2HF8A 4Y0NA 4YP9A 5J9FA 4PQFA 4C21A 4ZYUA 1DCMA 5G2OA 1Z7WA 1PZFA 1CLEA 2G83A 5BXQC 1N34B 2PMDA 3C4QA 5UKDA 4ZODA 2J08A 2WTMA 1OB5A 1U63A 1JAHA 3IP1A 4L8WB 3DR5A 1PSDA 1I10A 3QMPA 3H9JA 1D2GA 5LQUA 3P9SA 4F3KA 1X7WB 3EY4A 5FV7A 4QLBA 3JAWA 4CKEA 2I4OA 1JILA 1W8DA 2JL1A 3HVUA 2H18A 1TUGA 1HQCA 1E2BA 1OYYA 4Z0TA 1NNLA 3G2NA 4QVIA 1MZPA 1QTQA 4JH0A 3WC4A 3HL4A 1NASA 3R40A 4F8EA 3KT6A 4OYHA 1TVEA 4QJ3A 4OEHA 4E1AA 1ZGGA 3C1AA 4ZK6A 3GCZA 3P0HA 1CR0A 3L6RA 5LC1A 1UJ4A 3BMOA 3HBLA 1GZUA 5BUSA 1G8PA 4FI3F 3RSLA 3AMVA 5B3AA 5AK0A 3GAFA 3N28A 4O6VA 4HYYA 4EP1A 2LW7A 1KP2A 3DVSX 4NE9A 5EJ4A 1ZX1A 3TNDA 4KEAA 1GYRA 4UREA 4GLFA 4BLRA 5ITZA 3LLSA 4FFRA 2Q5HA 3JARA 3C6ZA 4LDNA 2BR5A 1LW7A 3K2BA 4MLCA 3UXHA 4AULA 3A9CA 4O4JB 5AIBA 1R88A 3I61A 3KB6A 1SG0A 1EUDB 2VWGA 4PO1A 2GEJA 2XUJA 5DMHA 2V1UA 2FZGA 4EY7A 3RHTA 2JIDA 1ZOOA 1NIJA 1JQJC 3EXAA 1U65A 1YJXA 2QWXA 3B2NA 1OC4A 3VOSA 2H1OA 1ISHA 4YXWD 1JB9A 3OJOA 4AF6A 4J0GA 4PRKA 4QNMA 5K1ZA 3ZWKA 2EJBA 3I32A 2VA9A 4RQBA 5DP1A 3DFUA 3KJNA 4EHJA 3ET4A 1E2HA 1XMXA 3LKBA 2O2EA 1WXGA 5EKXA 4IKPA 3DLIA 4RVUA 3HYRA 2CUKA 4OSOA 5FLEX 4X64B 4EH1A 2Q9BA 3H4TA 3PFFA 4JI0B 2XLBA 2AW5A 5I4CA 3D64A 2ZCUA 3WWZA 4E08A 5SY9A 2CN1A 3OD5A 1XVIA 2ZB8A 3RUAA 2P35A 2GPYA 3C7TA 3JAKB 3RVBA 3TLCA 3CVVA 2KJQA 3HQ4O 1DX4A 4NJOA 2B0JA 5FHQA 4D82A 4FDVA 3CLUC 2OCXA 1RBQA 4LBZA 2PZAA 4U7JA 5EIBC 5IDYA 2X58A 3DFFA 1KTVA 4ZVVA 4BRWA 3PUKA 2IUTA 1JL3A 5KUTA 2X15A 4EPRA 4QXAA 5K99A 5J23A 5DV9A 3UAYA 4CNQA 2QUJA 3FPLA 1P3DA 3JQAB 3LGAA 1DAEA 4ND8A 4FOLA 4IICA 4X24A 1DIOB 4QC2A 3ZWYA 1H2AS 3TN7A 3WLJA 1GAWA 4DXHA 2NUAB 2ZK7A 2W2PA 2ORVA 4QBIA 1Y81A 3WLHA 1RJEA 1QYCA 1XMIA 1L1QA 4PR3A 1I36A 4E2YA 1QO0D 3KDAA 4ENTA 3DCNA 1D09A 1U2PA 4LXYA 4YCNA 4MDEA 1UMBB 4ZTBA 3T7KA 3ABSB 4L78A 2MYPA 1JKIA 2VNIA 3EUWA 4KE9A 4RVDA 4D9HA 5LPNA 2WVJA 4I14A 1E3MA 3DEKA 2B61A 3L0IB 1P31A 3M1AA 3O03A 4ZU3A 1RYYA 3L2OB 3QNUA 4HWKA 2XE7A 1CQIB 3I3SR 2FSUA 3IAAA 4BN5A 4O3FA 2WVHA 4BNZA 4Y1RA 1YS6A 2X1MA 3AVTA 1R9NA 4KR2A 1EQUA 4X7PA 1LDYA 4AIIA 4DCOA 2R1VB 4WSOA 4F1JA 1YKFA 3OTIA 3KKMA 5IEBA 1N9ZA 4QAQA 5LCXA 5TLSA 4NATA 3JVIA 5EMLA 5T4BA 3W1WA 2RKWA 3DE2X 1NDHA 3PXDA 4WFJA 5L9AA 1OFHA 5MN5A 1JFSA 2O5VA 1B4DA 1QKKA 3U1TA 1KBQA 5EIFA 3U62A 3CE6A 4KWEA 5HCUA 1T4CA 1JS1X 3DWEX 3TRJA 1TUIA 1RLMA 4TT3D 3TCXB 5A03A 3T5MA 1NMEA 2EG5A 2ZOSA 1BIFA 4YMVA 3GFSA 4E5DA 1FQKA 4I55A 1RJDA 4H4CA 1NNUA 1MIOB 4KQWA 3UQYS 2C8LA 3HDQA 2RB5A 3AR2A 1FVHA 3GEGA 4WCFC 3U3XA 3IQZA 2QMZA 3UFXA 4ERXA 3PQ2A 1M2HA 3PGXA 3D81A 4TPKA 1XN4A 4QD3A 3JQ9A 3AZPA 1W96A 3JASB 3OFVA 4BNKA 4Z99A 2AQHA 1N2IA 4NS4A 2JIMA 1DQNA 1NKTA 2RHWA 2D1TA 3RSOA 4LF8B 3IKMB 2A3NA 2KSQA 5JAIA 5JYEA 3S28A 2FW8A 2MU1A 2VH1A 1QWOA 3CZMA 4NYMQ 4H4DA 2OBNA 5HK9A 4TL7A 4TMZA 4EPTA 1T9AA 3P32A 5LYJA 4DC9A 5DTEA 2CKMA 1YK1A 5CEFA 1I3LA 3P20A 3PTAA 2ISQA 1DARA 4IZHA 2OP1A 1NKSA 4QHYA 5CCDA 2JAHA 3H11A 2O2YA 3S1AA 3TDMA 4LOJA 3TINA 5IWCA 2BM0A 3ABZA 3S3TA 5ALEA 3U16A 4MRMB 2HUNA 2QTBA 1EYZA 4HAIA 3DNMA 2O7NA 4D96A 5L7TA 1H3NA 2IKQA 5CH5A 1OA1A 5ENDA 1ID1A 2QX4A 1XCBA 2ACEA 4D81A 3ESZA 4CEIB 1IQUA 1OZAA 4IDOA 3WIVA 1EIZA 3FFBA 3LPMA 5JS7A 3UCEA 2O0KA 1KEWA 3B9BA 2ZR0A 4OI2A 4RK5A 3FLMA 4LUCA 3PXAA 1NVEA 5ICMA 2UXDB 2WQZA 4RPJA 4FZ5A 3OWHA 5JV5A 1NOKA 4P4NA 5ALNA 5KYNA 2GETA 4DA0A 1X70A 3HU2A 3Q10A 4PG4A 5DYYA 4CF3A 4DMLA 3EARA 4INZA 4XOUA 1KIMA 4XDZA 4M86A 4F4IA 3RU3A 1MABB 4DF3A 3VDRA 2PT6A 1T6ZA 4CE6A 2VHJA 3A4VA 2R6FA 4HAOA 4QWMA 1JLKA 1U9YA 4U0JA 4WCVA 3RT9A 3SI7A 4BWVA 4JJ4A 1CRZA 1Y3IA 2IUFA 3MWJA 1XRPA 2VJKA 4JLPA 3AT1A 3GZTB 5EJ6A 2VSXA 3DAFA 3UHAA 5KX5F 5KJ1A 2NXWA 3SG0A 4G84A 5EHGA 4PBTA 1M66A 4YT2A 4OATA 3IIKA 1BH6A 1SK9A 1QO9A 4G8JA 4JLDA 4GWGA 4KP7A 3EIUA 5FORA 4FK8A 1C7FA 4NFLA 1Q0TA 2ZUEA 2XA9A 1TK9A 3A6EA 5TEVA 4ENUA 1LX6A 1HT2E 3ZIAA 1XCMA 4Q3LA 2W71A 1JAIA 1N7HA 2Q5IA 3OLQA 1OI3A 1WE2A 2UDPA 4H6PA 4Q00A 4TLBA 3NPMA 4GW3A 4UUNA 2ZIGA 1I4TD 4NCBA 3K9BA 2IPAB 2G9QA 1ZSVA 3ROEA 3W78A 1HGXA 4Q9IA 5JD3A 2OCDA 1RP1A 1K66A 5ILQA 2QQ5A 1I1OA 4LEIA 3GQBB 4C7BA 3N05A 3D7SA 3PYMA 4EG8A 4Z49A 5BT8A 3K94A 3MWEA 2WQ7A 1LW6E 1QZZA 1P61B 3FZGA 4LDPA 2AYXA 2P78A 4R8RA 3WWCA 3IIJA 3NU1A 1M1XB 1ZWKA 3I9MA 4PLYA 1G60A 1B14A 2GSWA 1DRKA 2OOKA 3FUCA 1RXCA 4XX0A 3U61B 3ZLBA 1XYGA 3RG2A 1YI1A 5D3QA 4QOEA 4TX1A 1AF4A 4FJ2A 4R9SA 4JU9A 4TWBA 4FNOA 5KTSA 1NI3A 2WUDA 2BGNA 2CNBA 4PS0A 3N2LA 1V2GA 4RZHA 3VR6H 3CUYA 4RIIA 3FOEC 2XQKA 2X8BA 3ZHXA 2XSZD 1K0FA 2C7GA 4QPPA 1LNQA 3RSFA 3JQBC 5CT4A 1UF9A 1T3HA 3CM0A 5KTPA 2D5LA 2C9CA 1NJ6A 4GI1A 4NBSA 3BHMA 4QLOA 4C30A 2PWYA 3CMMA 1HTBA 5A3JA 3G13A 1E4EA 1Q3HA 2OSVA 4G85A 5E6RA 1JIQA 1G2OA 5FUXA 1P77A 4Y1RB 5TRTA 1Z17A 3VR6D 1F1JA 5EIOA 1KH1A 1QX4A 5L4LA 2CDAA 4YTEA 4NZPA 3G8DA 2EW8A 2C2GA 3DKPA 1NVVR 1BN7A 2QW1A 1EP2B 1YZ3A 2GN8A 3GLQA 3K30A 3RFUA 2H07A 4ZPJA 1GRVA 5AXAA 1NQVA 1H2ZA 2IXAA 1S6YA 2BGIA 2QL7A 1GNVA 1S96A 1W4RA 5C1PA 4LHYA 2E1RA 3DBHA 3SIWA 4D8YA 1JPJA 2PA3A 3BIXA 1E3SA 4CTMA 1N0IA 5A2GA 2VHWA 2NZ2A 4RXUA 4WOKA 5ELLA 5IC5A 2DHEA 3KP1A 4YAEA 3KPWA 2ZT7A 4LY3A 1Y6FA 1ZVKA 4WWHA 2IITA 5KQMA 2GLTA 3QUCA 1DX9A 3ITNA 3D3WB 5DSZA 4YPOA 2H48A 2NO4A 3LLCA 3C3WA 3DAHA 4P7JA 1BWQA 1C1YA 2QD5A 5C7LO 1I9GA 1IDOA 1EVEA 4X1OA 3TX6A 2NGRA 1WVIA 5CMLA 2RGRA 1H0RA 3D3JA 1M10A 1L1FA 2HF7A 4X9XA 4W63A 4WUVA 3B82A 1MVLA 1PWHA 2BFMA 3TW0A 3LOQA 3MM4A 4EZIA 4LZAA 4NMLA 4JBIA 1RI4A 1TD1A 3DCYA 3Q7RA 1E7RA 3OZSA 4M0MA 3ITDA 2O8DB 1GU0A 4J1SA 1CY1A 2NO7A 2V97A 1R50A 3I42A 4IOMA 1RPNA 3IVCA 1S5PA 3E9YA 3BG5A 4KL8S 1ADFA 3RV4A 1MMFB 5BV1A 2Q5LA 1KY5A 3CU5A 3HL0A 1NRIA 3MYYA 3QVTA 1HNNA 1BMQA 3IAS6 1QIJA 4JJEA 3NLLA 2J9GA 4WKGA 1DFGA 5EJIA 1DSSG 3OIUA 2I2AA 4PZEA 1UXGA 3BT7A 4NH0A 3F47A 1Y1QA 2C2OA 3PIRA 3JAMA 3IP6A 1ZNZA 1UK6A 4E32A 3OP1A 1XD8A 2VN8A 2OKGA 4GD3Q 5E0OA 2FSVC 1QGUA 1PYGA 2G76A 2J30A 1HE8B 3OI7A 3QA3E 4CMKA 3COSA 4HNVA 2UZIR 1ND5A 4RH0A 5HJ7A 3T7SA 3B8EA 1WEHA 3KR9A 1J07A 3E7XA 4QUGA 3N8GA 3LC7O 5TQ0B 2RI1A 3F74A 5IK2A 4JENA 2KYRA 5LR6A 2W6MA 3WIOA 4CUZA 3LKDA 4DJ5X 1OYWA 9ATCA 2ATVA 4LQCA 3NXKA 1BGWA 4IDCA 3NHKA 4PPFA 4C0BA 2Q4RA 3A3KA 3WQQA 1NSYA 4AN0A 1T24A 1B93A 1T5HX 2CSUA 4GMHA 4X20A 4CQMB 2FQ1A 4JFRA 2BGTA 1HYHA 3DV0B 3GRAA 4GECA 1BE1A 1O6BA 1VRWA 3K9LA 3AGPA 4UE6A 2YZMA 4HN9A 2C42A 2HQBA 4HNQA 5B1YA 1WBBA 1AK2A 3C7AA 3GRYA 1QOZA 1E6WA 2OBMA 2P9HA 1L7XA 3I30X 2FPOA 3W3AA 3S2FA 1GZSA 2HD4A 4ACAA 2VTKA 2WMYA 3OT5A 2GA8A 2VQSA 2A88A 3MTEA 1JHQA 4YJ2F 1D7AA 2J0UA 3UMSA 1B16A 4BXOB 4G24A 1NP3A 5HS4A 2JKYA 2XF2A 2MINB 3UENA 2YY5A 1AMUA 2B83A 3MRTA 3VKUA 3U19A 5AVSA 1B7GO 2GK7A 4JUDX 5CYGA 1Z0JA 5EKTA 1GGVA 3EPKA 1FMJA 5ARDA 4H7DA 3SS8A 2WHXA 2XXAA 4KNYA 4HUQB 3PBKA 3O3NB 4ZP1A 3DJYA 2Q6TA 3QFFA 3FSEA 3QJ5A 4JVMA 1XJQA 3GWZA 5L6MB 5EIHA 4DIUA 3E7PA 3VZRA 1NJ8A 1ARZA 5FLYA 1GQYA 3AHFA 4LG1A 4WKOA 3VYTB 3PC4A 1YZYA 1P0FA 3OZIA 4D9NA 4LGCA 1PEAA 2AZ4A 2YNMA 3DEJA 4YUZA 2PYIA 1IMOA 1WXFA 2GTHA 1XTKA 4YRIA 2IXTA 1M7GA 4N6OA 2O8FB 4M36A 4EQ6B 3IHWA 5EESA 3QVVA 4UW9A 1YJBA 1PJZA 1VG8A 5JXIA 2G82A 3CVWA 2JLAA 4C5CA 1ZL2A 2AXEA 2ZJBA 4WK4B 3HCRA 4ER5A 2ADOA 3ZE1B 3N76A 2CJYA 1R8JA 4PO8A 3BTVA 5AM3A 3VYUB 3IUJA 1U2ZA 5D3KA 2R3SA 4PZ9A 3VHRA 1W4BA 3RTBA 3UYKA 1ISIA 3IELA 1DOHA 4IIXA 1RRMA 1LJLA 2VPTA 2WE8A 3O21A 3PJGA 4OLJA 4R83A 1JQ3A 4BZZA 5KYXA 1GV0A 3B70A 4MMYB 4BQQA 1EFTA 4XEHA 4DUPA 5H7XA 1QHEA 4EATA 4TYNA 2C2BA 1XAIA 1WUYA 1S3FA 4B6FA 4EVQA 2BBWA 3E9MA 4BKRA 1ZGZA 2GILA 4DR7B 4TZ6A 3L84A 2Q2QA 2O19A 1Q3TA 5BSVA 4HFJA 1DIAA 4JELA 1UC4B 3QELA 2Q7XA 5E1BA 2YN0A 3TH5A 2ZREA 3ABQB 4PSAA 1R0XA 1ZJ4A 4DG9A 4WBNA 4ZI7A 4KRFA 3L9WA 4D9BA 3GGCA 4MP8A 3L7IA 1E1NA 3KZMA 4UCFA 5DNEA 3QITA 3P2EA 5CYOA 3L05A 5ALSA 2C4MA 5FYQA 5I7FA 1Z6TA 4RMNA 3K8QA 1CPYA 2XB8A 2VT2A 1SBZA 2V7VA 1GNQA 4L72A 3PXGA 4DA7A 4D4IA 2PSFA 2HJVA 3B7GA 2EBUA 1UOPA 1IQ0A 3H5WA 2FEXA 5JLAA 4KQEA 1ZR2A 2PEYA 4LPSA 2A3RA 1KO8A 3WAJA 1PX2A 1E2DA 4IRXA 4JUFA 1UPFA 2VO1A 2O8BA 1VPWA 4DZRA 1IPFA 1U2EA 1U9JA 3K09C 1LBHA 1UWLA 1OGIA 4P4SA 4DDKA 5BRJA 1BS1A 5LB4A 5F7XA 2PYZA 2Y9MB 3WMFA 1HT0A 3UMJA 4BMCA 1THZA 2VJBA 3FMVA 4CN8A 2YZKA 3G23A 3LHKA 1YVUA 3H5OA 4FINA 1FFHA 3QNMA 1TJ3A 1P1IA 1BE0A 3BL6A 4TZKA 1XG5A 3GJZA 2VHTA 4UD2A 3DEZA 1VL0A 3COVA 1GVNB 3K9CA 3GAMA 2QTVB 4G65A 3D6TB 3KHSA 5IUNC 4QQKA 4PBSA 3PE6A 4G81A 1KYVA 1F20A 3A9WA 1PJQA 4PR0A 1QHXA 1TD9A 3LBAA 1F9AA 1R10A 2JA2A 3FMFA 3P27A 3LUPA 1M83A 3GBVA 4KPEC 1GQFA 2F9FA 1NY5A 2GS9A 3ECSA 3FMOB 4QOFA 4RF3A 4HAUA 4Y9DA 5ICSA 1TOAA 3DF7A 3SZ3A 4ZJZA 1M67A 1PTJA 1UWVA 2E5WA 1NATA 3WTCA 5EGSA 4EG5A 3HABA 3KV1A 1PL7A 1KXJA 2QX9A 3LUCA 4X61A 3QYJA 1PT6A 1R12A 3I8XA 5BW5A 1QG6A 4HAXA 3PRYA 4IJ6A 1QGAA 1N6IA 1JH9A 3GUZA 1JDBB 4H18A 4JSYA 3ND5A 1XZFA 2L17A 3NBXX 3NV9A 4RSHA 4CM3A 5GADl 1Z6GA 3P7MA 2F17A 1VIVA 2QOEA 4LE2A 3VU1A 1P3Y1 1U28C 3QHAA 2P6PA 2HCBA 3N5CA 1E1KA 2YCBA 3T9EA 5JCPA 2C4UA 5ALIA 1ZM7A 1K68A 2WPDD 3S5JA 1M1ZA 1KYQA 4EWLA 4EYOA 3JYNA 5HUHA 1TC2A 4X8OA 3EPJA 5BXYA 5FV4A 1EUQA 1JR3E 1NLUA 2FW6A 3PDWA 4IW3B 4IUBS 2FUNB 3OJXA 2FX3A 4YY3B 5K4HA 4ILKA 4NZMA 3KBOA 5A4MS 4M49A 4MR9A 1YJ8A 1GA1A 5F77A 1NT4A 1I3MA 4P3YA 4KGDA 4XSGA 3GFFA 4K7JA 3A2KA 2COKA 2ROQA 1RACA 1M2WA 1A7JA 2QPOA 4IF6A 3PQ6A 2QZPA 4A92A 3R6WA 3KOWA 4JD5A 1E77A 4EOGA 1U0GA 1W75A 2FF7A 3NHBA 2ZBUA 4UVGA 4X7RA 3KE9A 1ECPA 1A9XB 3SFZA 3GRUA 2X3FA 2A67A 4ZVOA 3N3BC 3NBAA 3U4GA 2GPTA 4ZT2A 3PPVA 1EDDA 5JAHA 2NN3C 3CLTD 4K28A 1KOGA 2CB9A 4ZYLA 4D02A 3NWOA 5ALKA 4QUKA 4X62B 2IPOA 4EKEA 1V8BA 3NHWA 2YXNA 4NU6A 4U2KA 4D42A 1NTOA 4EX6A 1QCDA 1PZGA 4J4BA 3UB4A 2B36A 1M2OB 3ZX5A 4BN4A 3ZQUA 4EM6A 4LXIA 2B6HA 1XC7A 3NQ41 4L9WA 4RDCA 4V0ME 5GM1A 3VKVA 4DCMA 3KKPA 3P9XA 1AHIA 3H04A 1YRBA 2C2WA 3D5EA 1IAVA 2ZJ0A 5KJFA 1Q11A 1XDDA 1YE3A 4Q37A 5GONF 3W5IA 1UKYA 2HCJB 4UU0A 1Z7GA 3LRPA 4NJEB 4EHHA 1Q2XA 5T7BA 5K0BA 4LMBA 3ZQ4A 3N2KB 2VZ9A 5WRFA 1KQNA 4NICA 1B00A 5K8CA 4PPYA 3QVGB 1QIIA 1P7WA 1X87A 2WWYA 2VHEA 1UPBA 3S5UA 5AHWA 3SF0A 2O2DA 1LPMA 2XBLA 4LKOA 2HDHA 3T0FA 1HFEL 1KTIA 3E9EA 5KOJA 3JQ8A 4K6HA 4CYMA 5HQJA 4GKKB 1R4AA 4R8VA 3FFAA 1Y8RA 4QATA 2R96A 1L4GA 5DXJA 2I80A 2V96A 4OQMA 3RHFA 1C1DB 2I78A 3SOZA 1FJXA 1V3QE 2ALJA 1Z6QA 3B51X 1OVMA 1P0CA 3I6ZA 1JQDA 4I2VA 3PYXA 1XMQB 1GKYA 2WJAA 1S1CA 5AJYA 4TYMA 3QWAA 5LP6B 4HTFB 1QYIA 3UAWA 3IFSA 5IMSA 2HU7A 1V11B 1XT6A 3U4AA 4AZWA 3OECA 2D7JA 3WKAA 1FZTA 1M6HA 5DBOA 1TM5E 4REQA 1UANA 2CMFA 3FVTA 2JLVA 2CWWA 1F2UB 3LAWA 3RYFA 1SQFA 4HB0A 1A7AA 4COOA 5I7OA 3JATA 4KN6A 1NBWB 4MINA 4G5QA 2ZRMA 1T4BA 1EVIA 2PQ2A 3ZWXA 2KPOA 4P2GA 4FE7A 3VYWA 4B3XA 1OJ7A 1JZTA 1QHSA 3T12A 4IWYA 2UYOA 4D9FA 1WX1A 1W2GA 2F3UA 2WJVA 1ZSYA 4JQZA 4YHBA 1JEOA 5FJJA 1AURA 2VP6A 1YRQA 3LY5A 4X1IB 2R6CA 1FXSA 4YV0A 4HDMA 4YT4A 1I7DA 1EJ0A 1CY0A 3G2OA 5I9MA 4U02A 1ACMA 2C0CA 2FWBA 1TFUA 4G97A 1E1QD 1Z39A 2HU5A 3RF7A 2W6NA 4MUYA 3TZHA 4PZLA 1OHHD 3IQFA 3D31A 4JXJA 3ZVRA 3TOCA 1CSEE 3BXPA 5JADA 2ZRIA 4KIJA 1NJGA 3O4RA 3R7BA 5K09A 1HDEA 3D2CA 1YFKA 1MD9A 2FKNA 1IU9A 1GZ4A 3BF8A 4L0DA 3NHMA 1MOQA 1XNJA 3IUPA 4GUDA 4Q9NA 2O5RA 3V33A 2BMJA 3SOPA 1QX3A 1SQ0A 2HRRA 5F33A 3I5AA 3QA9A 1Z63A 2XCTB 1ZI6A 1N1MA 3ML1A 4IXWA 4NDNE 1IWBB 3RE1A 4B6SA 4DL9A 3KQHA 5F7JA 3GUVA 4Z7OB 3PQEA 1X7ZA 2L2QA 3NM4A 5BMOA 5AKKA 3T9FA 3TTVA 5CLFA 6AT1A 5LP6A 3RQIA 3JAWB 3GCXA 3P94A 3K96A 1VJGA 2GF2A 4KWIA 3EXFA 3V1LA 1SHUX 3OSUA 4A27A 4UPDA 4KQ9A 2Q3JA 3U1VA 4CIYA 5EQFA 1EA7A 2UUBB 2MR6A 1UEXC 2AR9A 2B2CA 5G0TA 1XVTA 4MRAA 2RG7A 1RQPA 4YRDA 3X2EA 5JH7F 3H99A 4NBWA 4DV6B 2GKOA 1R5OA 1ZCAA 3OTWA 4RDHA 1ZNYA 4GBED 4ITVA 3RB8A 4BVEA 1CW2B 1OD6A 4BN0A 5KYUB 1FQJA 3KT0A 3RVKA 2JLYA 4PX2A 3A3NA 5JMTA 1R5BA 1C5KA 3FNIA 1I7PA 2IW1A 5DLEA 4DJTA 3ICOA 2R8YA 1GTVA 1VE1A 3QF4A 4HDQB 3AFOA 3QX9A 2RH8A 3D2LA 5ALPA 4ID3A 1U7XA 2AS0A 1R0ZA 4CDRA 2W6JD 3IYLW 1A76A 3K6SB 2UYYA 5LIRA 5ES3A 1SBCA 2QL6A 5AOVA 2BE7A 1TVMA 1TZJA 1ZFNA 3M5DA 1YBAA 3QVOA 1KAOA 4FUTA 5H70A 4D0RA 4TXHA 1F0YA 1DZ3A 4GMFA 2Q3HA 3EF0A 2CLIB 5FUBA 3ZVLA 1L5RA 3C3YA 3FYCA 5FO0A 2PKWA 2BBSA 3DDNA 1ML3A 1PJCA 4HMQA 3T61A 4CV1A 3SNHA 3TLMA 3VPCA 3V8BA 2J5KA 2NM0A 2AXNA 1I7LA 4EHKA 2VBGA 1DC4A 3TAXA 4YV1A 7MHTA 4B7UA 121PA 2BFAA 2OQIA 3JWJA 3A4MA 3R41A 2N47A 4J90A 3FX2A 4PHFA 3LYLA 4YP7A 1WCIA 4L02A 1FUIA 3BREA 2HX1A 5EOVA 4CU5A 5I7HA 1LK0A 2VEOA 4CT0A 1NR7A