4X8MA

Crystal structure of e. coli adenylate kinase y171w mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEWHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
molecule keywords Adenylate kinase
molecule tags Transferase
source organism Escherichia coli
total genus 65
structure length 214
sequence length 214
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8mA00
4LUCA 4CW7A 3NVAA 1E32A 4PC6A 2YKGA 5CYOA 2HXSA 3ND8A 4HLDA 1XTSA 1KSGA 1NKTA 4B3FX 4C0LA 1LB1B 5FUYA 4DLZA 4U5XA 4WOPA 2YWGA 3D8BA 4MITA 3L0SA 1MO5A 3PXGA 1NBME 2KWIA 3CPEA 2IYYA 3QY0A 1CU1A 4V0ME 5KO2A 3U7HB 4LWZA 4RVCA 3CRRA 4KSBA 1XTQA 2QGZA 3NEJA 4QJ3A 3CRVA 2VP6A 4DLUA 3M1IA 1DOAA 3RANA 4AYWA 2XJ9A 1ZYUA 2IT1A 4IDQA 4OQXA 3FKQA 1YZNA 3TH5A 4OQMA 2WKPA 4A92A 4F4IA 2GDJA 2RGDA 3IHWA 1R5NA 4AIIA 2G0NA 4RCZA 2R62A 4RFSB 5TV2A 3EPKA 2D4HA 2F3RA 1NVVR 5F2EA 3N2EA 2JLQA 2ZI7A 2J0QA 1E9AA 1U81A 1W2HA 2ZU6A 1TQ4A 5L3VA 2ZQ5A 4WVFA 4US2R 1UBGA 2QRZA 3UIEA 5HKKD 5LB2A 4OI4A 2IYTA 3O8BA 1COWD 2X19A 3MWJA 4CEIA 1ZP6A 4A82A 1KI6B 1G17A 5DYIA 4B2IA 4RD2A 3THOA 3SBDA 5K8IA 1G7SA 1UEJA 5FI0B 1G8PA 2PLFA 1Q1QA 5FL7A 1WB9A 4M2LA 2A5JA 3HU1A 2FFHA 1NN5A 3VKHA 4IFEA 4EJSC 3THXA 2ZREA 3BB1A 4MRVA 3GP8A 3FVQA 1EG7A 4EFLA 5KTYA 1R5OA 2IK8A 4OJKA 1G3RA 3TR5A 2EU8A 1N25A 3AP1A 5FUVA 1JBKA 1ZNYA 3W6OA 2WWFA 3PQCA 2QZ4A 3TW4A 4TYPA 4KVAA 3MD0A 4Q9KA 1K6MA 2E87A 3Q7PA 1TF2A 3ZD7A 5KPDA 4IVPA 1IHUA 4XTRA 4ILEA 1Q12A 121PA 2GBLA 2EYQA 1A1VA 3CB4A 3AUXA 4BLPA 1HQYE 4M1YA 2IWHA 1OYWA 2GJSA 3DM9B 1EFRD 4AKIA 1DAHA 4KO8A 5C2JB 4HUQA 5JS8A 2HF8A 3LDAA 1P73A 3AQ4A 5EP3A 5F9HA 2WAYA 4BPBA 3KKPA 3AGPA 5DO9A 4TT3A 2ZJZA 2H5EA 1KKLA 1G7CA 2PX3A 3A4LA 2XTNA 3OZXA 3CX6A 3RVBA 4Z1MD 2HUPA 3WNBA 2O0JA 1P2SA 2RHMA 1II9A 2OBMA 4TMKA 4JLMA 1HE1C 3K9GA 2B8WA 4POAA 3VTKA 4E5UA 1J90A 4EPXA 1NN1A 1KNQA 1XB2A 1Z8FA 1BMFA 5TY0A 2JLRA 4XVRA 5GJCA 1F2TA 2CL6X 3B7GA 2BMJA 3BB3A 1OXSC 3AUYA 4P4SA 821PA 1N5LA 3X1WA 4BLSA 3UMSA 4FIDA 5KDLA 5UKDA 2ZRGA 4HI0E 3B1WA 1OFIA 5H70A 4TLAA 3A8TA 1PUJA 3KFXA 1FMJA 1FTNA 3CX7A 2WKQA 2V8OA 4L16A 5FI1B 2ERXA 1XU4A 2PLRA 4EIWA 5CITA 1LW7A 2GJ8A 4TZ6A 4H9GA 5JS7A 2H1LA 2OCYC 2FWRA 2QP3A 5F9FA 2A5GA 2IC5A 3PUZA 3RS3A 2IEYA 1XRJA 2C95A 3QXXA 3RNLA 1SVIA 3GEHA 5B57C 2QU8A 1OLOA 2XX3A 2PZFA 1HQCA 1DAIA 1UDXA 1GILA 1NMXA 1Z3IX 3FKSD 3TR0A 4V0KA 2RGGA 2QAGA 2Q3HA 3RRMA 3ZZTA 2VRWA 3LFUA 2FPKA 2EFHB 3OIVA 1S3GA 3ZH9B 5KSYA 5KSOA 2HF9A 4X8MA 1ZJ6A 4KFSA 1SXJA 1NN3A 2ZITA 1LF0A 3WHLA 1R5BA 5EXPA 1JEEA 3L8YA 1G41A 1Q1EA 1KMHB 2IYVA 3HYRA 4JKYA 3WMEA 1N5IA 3VR4A 3HP1A 1W36C 4MYUA 2YOGA 1ODFA 2DBYA 2QUZA 1GDDA 4EDHA 1CJUC 1UBEA 1ZVQA 4IDHA 4QHSA 2IYZA 3KB2A 3EZ7A 1FFHA 4D0LB 1D8TA 4JMPA 3LX5A 3FTQA 4PTLA 5AK0A 1CJKC 3TRFA 2WPDD 2YWFA 3VU9B 4DLWA 2IS4A 2VHTA 1Z2AA 3TSZA 1JXMA 3EC2A 4LI0A 3CF2A 5KU1A 3VX4A 1XD2A 5BXQC 2XITA 3GFOA 3LD9A 1BO6A 1Q0UA 4P0TA 2RAPA 1EK0A 4IOKA 4JT4A 1S0UA 2BBWA 2CNWD 1E2MA 3LRPA 2HYDA 2WIBA 1W44A 5FOWA 3QKTA 3SYKA 2NO0A 2ORWA 4DB4A 5HCNA 4P4UA 1P4SA 4ACAA 1NSFA 4MDEA 4EPTA 1VIAA 3LXRA 2YNMA 3C5HA 521PA 1AS3A 2PEYA 3Q5EA 5CK5A 4TZ0A 1YKSA 2VA8A 3KZ1E 4URWR 3SJCA 5HKKA 1NJGA 4RKEA 1U94A 3QG5A 4MGZR 1COWA 1RIFA 4TTRA 1S3SA 5DIFA 4IXNA 3E5HA 3IGFA 3DOFA 2ERYA 1VCIA 3N2IA 1W7AA 2Z0MA 2IYXA 5EE9A 1X6VA 5FPHA 1XTJA 5AJXA 3LQQA 3K9LA 4HATA 4CYMA 4RD4A 5FL3A 3KQUA 1M7GA 4Q9LA 3QIAA 4ZPXA 3RAPR 3WY9A 4TYYA 1P2VA 3DKVA 5BQ5A 2JEOA 4RCYA 4ARZA 2B7BA 3RRYA 3UKDA 4UNPA 1YZLA 4KLNA 1OW3B 1Y3AA 4DSNA 3WRYC 1AM4D 4K8OA 5FBRB 1RYFA 5L3QA 5JSZA 2N46A 2B92A 1GL6A 1KMQA 1ZC3A 2ZSAA 3CNNA 5SZJA 1A5TA 2IX3A 2ZU0C 5GVSA 1NY5A 1N6HA 2HXYA 3R9IA 4OBEA 3RWMB 4Z51A 1S1MA 4MKHA 1EFRA 4PAMA 2V9PA 3WXMA 3CNOA 5BWMA 2CL7X 2D7CA 2CK3D 3SI7A 4LOAA 3CUEF 3Q8XB 4DRZA 3AVQA 2X8AA 4IXMA 2JIZD 3TK1A 5JMTA 1RJ9A 1ZINA 2OLKA 2P6UA 1CULC 3NBYC 1Z08A 3QXJA 4BFXA 4EJSB 3ZDQA 2ATXA 4C0KA 3K0FA 1I4DD 2HV8A 5KUTA 721PA 1KO1A 1N5JA 3AVUA 1KGDA 1W46A 1ETUA 3T35A 4P3YA 3AGQA 3AEZA 4MQBA 4MGKR 3BJIC 5G53C 1E2FA 3N5CA 4CVNA 2PZEA 1VG0B 1G5TA 3HR8A 2XJ4A 3RS5A 1US8A 2JLSA 1G64A 1NLFA 1GKYA 1XMIA 2EWWA 2WSSD 1RRPA 4D4JA 1NMZA 2ZYUX 1YZGA 3RS2A 3QPVA 2PT7A 1LY1A 2ZSDA 4BZQA 3RABA 3T34A 5KSZA 1E9CA 3CF6R 1SVMA 3ADDA 1DARA 2XB4A 3QKSB 1G8YA 1H8HD 4ITRC 4KITB 1MR3F 2J9RA 1T3HA 2XZOA 3ICEA 1Z29A 1NIJA 2FZ4A 2A30A 2B21A 2ZSBA 4AD8A 4X8LA 5AJYA 3X1XA 3Q85A 4BLTA 1W5TA 1XWIA 2FG5A 1LTQA 2ODBA 3K8YA 8OHMA 1R0XA 1GIAA 1MO3A 5AJZA 2ANCA 3DO6A 4JVLA 3V9PA 2B7CA 1HA3A 2QBYB 4B3GA 2AX4A 2FNAA 2A3RA 1HV8A 3FKSA 2F1HA 2REOA 3THWA 3W5JA 1KYIA 2BEKA 2FH5B 2FF7A 2IYSA 4PZLA 2O8DB 4PAQA 4C0HA 2YV5A 2PMDA 1KJWA 4YMWA 4IVRA 3CPJB 1G6HA 1Q20A 3O8DA 1SVOA 2EFGA 2P6NA 1E0KA 3VKGA 1RRFA 4IOLA 4F92B 4DEYA 1L4UA 5EP2A 3THYB 2REBA 3EXAA 1P60A 2QPOA 4YQFA 3Q9LA 1VHLA 1UFQA 5JHGB 1ZUNB 1GG2A 2VIIA 4PQYA 2XNDD 4B2PA 2ZR7A 2DPXA 3QBTA 1GWNA 1JXOA 3CRMA 3OFND 3K0AB 2OCAA 2JJ2D 2RCNA 4JT2A 2YC2C 3CRW1 2WWWA 3VNVA 2ANBA 4B73A 4G1UC 4IKEA 3LLUA 2XOKD 5AUOB 3GCGA 3OEEA 4L15A 4DLVA 4D4LA 4E22A 1NMYA 5HPYB 4DSTA 3E2IA 2ZJBA 1X8LA 3TUIC 4A2WA 2PJZA 3IBYA 1G3UA 1NBMA 2VPPA 4V0MA 1NKSA 3KUCA 3CM0A 2XZPA 4RZXA 3RS4A 3VX3A 1JNYA 2WJYA 4LCBA 3ZVMA 2G77B 5DN6D 5GJBA 1KSHA 3HU2A 4GP6A 4FN5A 4L9WA 3DM5A 1BYUA 1V43A 4BUJA 1ZD8A 2RGXA 2ZUCA 4DCVA 1E2DA 4TSFD 2ZUDA 2F43B 2G3YA 3B82A 4OHXA 4BWYA 2GCOB 5LD2C 2BEJA 2XGJA 4B76A 1L7VC 3HU3A 2G6BA 1R4AA 3A1WA 3W6PA 2AD5A 4ZIRA 4Z8YA 2IW3A 3ZQ6A 4LJ5A 1P9RA 1KI7A 4KBGA 2JLUA 4PPGA 4W9MC 1OHHD 5AJWA 2W58A 2ZJOA 3L43A 4N0DA 4W7SA 3X1DA 5CYPA 3U3OA 3EPJA 2QY9A 4FMBB 5FOUA 4G5SA 1A82A 2FSGA 2ODWA 2IL1A 1W0KD 2IA5A 1M8PA 2QMUA 1K5GA 3IIMA 3IO3A 3LW7A 2GXUA 3BAFA 2I1QA 4M0LA 1CR4A 2GJ9A 2Q9AA 2ZR9A 1MH1A 3A36A 3WMFA 2A78A 4I99A 2GF9A 3GLFB 2Q3FA 1JECA 1Q1ZA 1ZIOA 4A0RA 3U4QA 1YRAA 2LCFA 1CLUA 1Z0KA 3A4NA 5DE3A 2ZRAA 4ZDWA 5CIQA 2DR3A 1X8JA 2YINC 1E9RA 3WBJA 2FU5C 2J7PA 4PC2A 1IY1A 3EG5A 4KAXA 4XSHA 1ZAKA 1W0JD 1OSNA 3CNLA 3CWQA 5K8UA 1HUQA 2OFXA 4XWAA 1PV4A 3O47A 3V4FA 2VBCA 3LXXA 4CEIB 1GSIA 3B5JA 3BS4A 3K0CC 1ZU5A 1FUKA 4KU4A 1ZM4A 3V00A 1IN4A 2QRNA 4ERNA 2JA1A 1XPOA 4C0SA 2R2AA 1AKYA 1OXUA 1VG9B 1M74A 1UKYA 2V55B 4PC1A 4F7WA 2YWEA 1II8A 4NH0A 1ZW6A 2VYFA 4HAWA 4MRPA 2LKCA 3I5XA 2BMFA 2AKAB 2QP9X 3NBZC 3SQWA 4CIDA 3NBFA 2VP4A 1B23P 3FFBA 4I1SA 4A0HA 5JI3E 1U99A 1QG4A 2WSSA 2PL3A 1T3LA 4CEHB 2VQSA 2EW1A 3AVVA 1T8UA 1Z6GA 2ZRMA 1DS6A 5SZKB 3UK6A 1F6BA 4BE7B 1E1QD 5FPYA 2HEIA 4JVNA 1GZSA 3BOSA 2PT5A 4URXR 4OJQA 1Z83A 4WAUA 4EKDA 4HUQB 4L5BA 3H1TA 1AGPA 1E98A 2I4IA 3VHXA 1FX0A 3NDPA 3I61A 3RLFA 1Z06A 5JECA 3GLGE 2WHXA 4LV8B 4O0MA 4LJYA 4Q48A 4WXRA 2WWYA 1N6OA 2JATA 2QPTA 1XDBA 4HB0A 1OB2A 1FNMA 3SN6A 1UAAA 2ZEJA 5KHOC 3LBNA 4AKEA 2PCLA 4DDWA 1PLJA 1P9NA 2X2FA 4PFSA 1QHXA 1SZPA 3RYTC 1P7CA 3L0IB 5JCZA 2WJIA 3O8CA 3ADBA 3SJBA 4PR0A 1S9DA 2BWJA 1HYQA 1F60A 1KO8A 1SULA 4NYMQ 5FTMA 1VCOA 3P27A 5DI3A 4P4SB 5L3SB 3AP3A 2KBFA 4LDJA 4CEJA 1OFTA 3BFVA 4A8JA 3X2SA 5H68A 2J5XA 3M6AA 2W2VA 3OEHD 3K9HA 4LHYA 2HT1A 3OFNA 4UQOA 1YRBA 2JJ2A 4RZUA 1L8QA 1AGRA 1BMFD 1GKUB 2UZ3A 3PR1A 4YONB 3E70C 5FTKA 3W90A 1ZM9A 5CDFE 3AV0B 3DZ8A 4MKFA 2IHYA 3RC8A 4NONA 2QSYA 2MMCA 4B6FA 1WF3A 1IN6A 2IYLD 3FMIA 2O8BA 5DN6A 5IHPA 3PG5A 4LGMA 1XD9A 5FOVA 2QAGB 1Z63A 1NG1A 3QE0A 1DO2A 2C99A 3RC3A 2ONKA 2R9VA 1E79D 2QA5A 3RRZA 2ZPTX 4MA4A 1OE0A 2WJHA 1E2EA 3HYTA 4CT5A 1ZU4A 4D4KA 3C4JA 2Z6VA 4MYHA 4PSAA 4C0BA 2BKEA 5E7JA 4C4PA 4PQFA 2D74A 2ZJ5A 2C2HA 4II7A 1KO7A 4Q1DA 1CR1A 1ZD1A 1EGAA 2ZI5A 5FOSA 2OV2A 2J46A 2ZS8A 4B3CA 4YXWA 3CR7A 1S4QA 1W0KA 2ORIA 2WWGA 2LWIA 3L2OB 1NVVQ 4IFBA 4NCKA 3L82B 4URYR 3QEJA 3A1UA 3MLEA 4DLYA 1XPUA 2WVJA 1E99A 1SXJD 3A4MA 3IKJA 4IW3B 4JSTA 4O2RA 3QVUA 2H17A 1XD2B 1ZMXA 4TL7A 3TLXA 5L3RA 3AVXA 3QNUA 4BGDA 2IUUA 5BN5A 2WJVA 4US1R 2ZI4A 1KDRA 2YJTD 1W0JA 2AFIE 5LD2B 3DHWC 4B6EA 5JWRA 1D6JA 2JCSA 3GEEA 1T6NA 4OI0A 1G3QA 3AKEA 1Z0AA 3VHLB 2QNRA 1TTTA 3HDTA 1G20E 4LPKA 4EAQA 3ZJYA 1FQKA 4WW0A 4TYWA 4URVR 1X86B 2WWXA 4JL8A 1FP6A 3MG9A 3G5UA 4WIAA 1LS1A 1BOFA 2CLCX 4FMCF 2EFDB 2IXGA 2OHFA 5JEDA 1F3OA 3H84A 4QJ5A 3PUWA 4OI1A 4JIMA 3SZRA 1NF3A 4KFUA 3PITA 1W4RA 3Q5DA 2F1RA 4C3ZA 2V3CC 5FPSA 2FV8A 2J41A 2WWHA 1YQTA 1KJYA 1R6BX 221PA 3C8UA 4HDQB 5L3QB 4B3DA 4QKQA 5GJWC 5JSZB 4IRUB 5JWOA 2BVNA 5GADl 3WBKA 4UKDA 1OPXA 3UWOA 2GETA 4AURA 1FPMA 1GRRA 1E1QA 1VDZA 1DELA 3OHMA 4M9QA 1IN7A 1TX4B 2QSZA 3I32A 4WZBE 4EUNA 4TTPA 4GI7A 5E3HA 2DWPA 1IBRA 4J0QA 2ZVQX 3A58B 1M7BA 1Q57A 4QM6A 1Z28A 4B74A 3SDZA 5EZ6B 3CR8A 3B9PA 2N42A 3P32A 3QF4A 1RJ9B 4RZ2A 1UPTA 2B8TA 4ESHA 2QM7A 2G1KA 4NPHA 2OM2A 1SHZA 2P0EA 1VYTA 4NZYA 2OAP1 3OE7D 1G291 1N6NA 4AK9A 3NXSA 1A2KC 4HLUC 4X8HA 3LW8A 4IVQA 5JBQA 1HEIA 1TQ6A 3GLHB 4G3XA 3ZD6A 4KV9A 2DFLA 1KNXA 1XXHA 2NQ2C 4GP7A 3L0PA 3KJIA 4I1UA 621PA 2XXAA 3FHTA 1EX6A 1XZQA 1GL9B 3EAQA 3DOEA 3NWJA 4GMXA 1A7JA 2W83A 1FOEB 1KZ7B 2FGKA 2QM8A 5J4LA 1QHHB 1G21E 4D4MA 2P65A 2ZYTX 4H1UA 2NZJA 1Q3TA 1T5LA 1WBDA 4TL8A 1EFTA 2WJJA 3OEHA 3R9WA 4PANA 4IDPA 3X1YA 1YZKA 3IIJA 4Q1EA 4W5WA 4B75A 1IY0A 4E09A 3KQHA 1GAJA 3TAHA 1W2GA 5DNYB 3U61B 4OQFA 1DG3A 3WYFA 1SVSA 2FFBA 2CMKA 3W9YA 3IQXA 4I1OA 2F9MA 4MGIR 4TLCA 1SVLA 4YC7A 3G0HA 5JJIA 1OJLA 2JASA 2FE4A 2F9LA 3KDSE 1OYYA 2RGNA 1KSJA 5CJ2A 1E0AA 1CR0A 5FTJA 2Q6TA 2QMEA 1XP8A 4ZCLA 3EIQA 3BRWD 5M04A 4NHOA 2FMXA 3BH6A 3GFPA 3P20A 5TARA 1ELOA 3RSLA 5K8LA 2V6JA 3F3YA 2ZR0A 5EXTA 1EFHA 1DO0A 3B6EA 4AI6A 4Y0AA 3K70D 2GRJA 1E79A 4MKIA 2FSIA 2V4ZA 1Z6TA 4Q4HA 4HDCA 1TUIA 4Q01A 3TIFA 5DHAA 2HYIC 2UKDA 4DZZA 1H8ED 4TN1A 4QGHA 2GJAA 1X8KA 3B78A 3A1VA 2GZDA 3ND9A 2O8EA 1O3YA 1YVDA 1KOFA 1F48A 4DHEA 3CLVA 1QBKC 2DYKA 3BORA 4AC9A 1CF4A 1CEEA 2C9YA 2IF0A 3ZQJA 4Q5IA 4HYYA 3U44A 3KB1A 2EYUA 4LYFA 3BXZA 5SZHB 3MMPA 4FMCB 2YOHA 3SEAA 4JLPA 2UZIR 2GTPA 1XTRA 3AB3A 3SS8A 4FWTA 2OXRA 5BYKA 4M53A 1G4AE 2FN4A 3MAAC 5DH9A 5DISB 4YDSA 1MOZA 1E9BA 3KKQA 3AP2A 3LWNA 3TSWA 1NL3A 4LJ6A 5J4KA 1DTSA 3W6NA 3NHBA 3H4MA 4LJ9A 2C8VA 3SNHA 2AHOA 3TBKA 1KI8A 3QENA 1S96A 4DCTA 2Y8EA 1YE8A 3JVUA 4Q00A 4NYIQ 2J7KA 1DEKA 3KTAB 3BB4A 2QAJA 3A1SA 3NKVA 1L4YA 4LBWA 3UATA 1IAQA 2CCGA 2X2EA 3DMNA 3GLIB 4P31A 3EPLA 1E2NA 5IK2A 4I81A 1MO6A 4CDGA 1E69A 3GJ3A 2GILA 3FWYA 3NBXX 3OEED 4RJLA 1DAEA 1Z6YA 5G3ZA 3LQRA 4A0GA 1N6LA 4DT1A 3LNCA 4PPNA 2AK2A 5KNCA 4TMTA 1AS0A 2ZROA 4IJMA 4G5GA 5D3MA 3UXMA 4NU0A 1NBMD 3L0OA 2GVZC 3SFVA 4DLRA 2O8FB 2GXSA 5KDDA 4LJ7A 2QTFA 2WZQA 4W5HA 2ZS9A 4TTQA 4R2IA 3BH7A 3PIRA 3DMDA 4NE2A 2VHJA 4Q4LA 1G18A 3OESA 1VECA 2KE5A 4LYAA 4S2EA 1P9WA 3SFZA 2WTUA 3GJXC 2VP2A 2C04A 2YOFA 2OFOA 3B9QA 3TAUA 2NOAA 2AXPA 1E2IA 1KO5A 4PSVA 4HB2A 3MWKA 4PZZA 3U4QB 4BFZA 1C1YA 3I62A 1FL9A 1G4UR 1OIXA 3UG7A 4HLCA 3HR7A 2FFAA 4YMTA 4LHXA 5FR2A 5DLQC 4MRSA 4KYIB 2ZE6A 2QENA 2G0TA 4HZIA 4KSCA 4Q4AB 4UNSA 5J5CA 2PEZA 2ZRHA 4A36A 1N6PA 3WHKA 1PUIA 2N1BA 4A6PA 2VSFA 1GM5A 1PLLA 1N6KA 5C46F 1YZTA 1FQJA 1U9IA 2OG2A 4A9AA 3QVVA 5JJKA 5DYGA 5JHHB 3U3RA 5C4GB 1I2DA 2BJWA 3WNDA 3ZIAA 2CBZA 2R8RA 4DIEA 3OE7A 3AKDA 1G5PA 3NG1A 4RKFA 1IY2A 4OQLA 1BH2A 1CS4C 2FPMA 4PZYA 1HH4A 1S8FA 5KNBA 3NIBA 2J7PD 1T8TA 4Q19A 1W4BA 3UMRA 4G5RA 2AFHE 3B1VA 4GOXA 1E2GA 2GBLC 3QJYA 2RGEA 5FBLB 2IS6A 1J2JA 3GLGA 2EWVA 4NP6A 2OE2A 4PHHA 4PHGA 4TQ9A 4EQ6B 2C5LA 3GLFE 1ZNXA 4TLDA 2C98A 2Z4RA 4LJ8A 3CH4B 2VH5R 4D81A 1JQJC 5EE1A 4DLXA 2ZRKA 3WP0A 1ZRHA 3ZZUA 4QHYA 4B33A 3I1FA 4BASA 1ZM2A 3SE0A 1JI0A 2CJWB 1JR3E 5KYKA 4QNRA 1XMSA 2QMHA 4OHVA 1TU3A 5JFGA 1XJCA 4QG7A 1UBCA 4BFVA 2KI5A 4DLSA 5KSPA 3SHFA 3WRXC 4ZDKA 1U8ZA 4TYQA 1MABA 4BFWA 4D0GA 3KKMA 1RC8A 1EXMA 3D31A 3AVYA 2AKYA 4D26A 3K9NA 3ASYA 4JLDA 1QHGA 1KTVA 1DPFA 1FTSA 1E4YA 4A6XA 3T1TA 2IBMA 1VMAA 2QN6A 2ZRFA 2CLSA 3P26A 3QPWA 3W34A 1JR6A 2DHRA 5EP4A 2JLVA 2J0UA 1Z47A 2LKDA 1E6CA 4IDNA 3RSOA 3OIYA 2WIAA 4A0FA 5CDFA 1H8EA 4OI2A 4AG6A 1NNEA 1XCGB 3I8SA 3I3SR 3P4YA 3C7KA 4KFTA 4NDZA 4CEJB 4A2PA 4DCUA 4OHZA 1CTQA 2DWOA 5P21A 4GSYA 1Z0DA 3IEUA 2ZSEA 1FMLA 4HZUB 1FNNA 4LBVA 4JJZA 4WBSA 4CZ2A 1IN8A 2NTYC 1P5ZB 2FSHA 1GKIA 2GF0A 4Q21A 3CX8A 3C5CA 2SHKA 4XD7D 2QTHA 1OV4A 3WMGA 3AF4A 1GVNB 1PVOA 2QAGC 4M1MA 2R6GA 3A37A 1QF9A 4BRUA 1G8GA 1I4LD 5G41A 2V1UA 3B2EA 2F7SA 1KK2A 1SXJC 2F6RA 1N6RA 2ZE7A 4B3BA 4ASUD 2BOVA 1GNPA 1XFAA 4TYNA 3AVTA 3X1ZA 3HPQA 3OAAA 1J8MF 4FINA 1KY2A 3T5GA 4M21A 3KX2A 3ZS8A 1Z07A 4DSUA 3VR1A 4Q66C 3W3ZB 1Z6XA 1V5WA 4GPTA 1Z0IA 4CRWB 1GNQA 4BLQA 4R71A 2W0SA 2QROA 1UDWA 3CKLA 4TMZA 5JJLA 1AQUA 5CK4A 3QXCA 1QDEA 3GEIA 4LRWA 4PPQA 1F2UA 4PQRA 4PX9A 4XSGA 3AM1A 5A4JA 2IXFA 3TQFA 1T9HA 1NN0A 4XVUA 1GUAA 1IJFA 4O25A 3AVPA 4C7OA 2H18A 3KXIA 3U7FB 3ICQB 1T4GA 2NPIA 1CP2A 3PUYA 1XPRA 3D7MA 3QKRA 2H8KA 5FUXA 1KMHA 1XTIA 3QOFA 4L8GA 3BE4A 3HWSA 1QVAA 1TMKA 1U8YA 3OIWA 1DAKA 1OH8A 2BBTA 2Q9BA 4HAVA 5H1YA 4S35A 1D2MA 1XCPA 1AS2A 5EXXA 2NO6A 3NH9A 2OBNA 1UBFA 4YXWD 4JBXA 4RSGA 4TQAA 2ZAOA 1YR8A 4LPSA 3W5IA 2ZI9A 5J4VA 1ZBDA 2O0HA 3VU9A 2GK7A 5F3WB 2ZETA 2AL7A 2OXCA 2HLDD 3ASZA 1FZQA 2NZ8A 3K09A 4QC2A 4Q4JA 3IPYA 4CF7A 3SHWA 4BZPA 1QG2A 2ZRNA 2ZYVX 2NMVA 4M1SA 1R2QA 2XEXA 3KL4A 4BFSA 4HB4A 1IONA 1XEWX 2BMDA 4GFDA 3TGPA 2X77A 1R0ZA 4TMVA 1M34E 4GNKA 4RD6A 1RVDA 4B44A 2W00A 3UG6A 2J0VA 4OQNA 5DI9A 1CRPA 4OK6A 1OKKD 2ZM5A 3H0KA 1W36D 4B43A 3WYGA 1JB1A 2D62A 2W6ID 1HY3A 1M7HA 4K81B 4RD3A 3W8NA 2VHUA 1Z0JA 1GFIA 3EZFA 3SOPA 1I4TD 4LV6A 1E2HA 4QBHA 2KBEA 4XWKA 1LNZA 1JJVA 1KO4A 2IHBA 1XEXA 4LK2A 1KDOA 4E07A 5K8TA 2QE7D 2GEVA 1E9EA 1XJQA 3VQTA 1I2MA 3PEWA 3THXB 4R2HA 3VNUA 1A2BA 2I3BA 5JZVA 4QBIA 3DVLA 2GZHA 5HCIA 4D0NA 1C9KA 4NTZA 4B32A 2ZRPA 2MSEB 3NEYA 3EX7C 3ZGXA 1KI9A 2OESA 5FBQB 4G0NA 2FA9A 2DB3A 2XTMA 1CRQA 3QEOA 3BBPA 2JJ8A 1TNDA 3B85A 4TMXA 2CEAA 4U02A 3LY5A 4DXAA 2FZLA 1S9HA 2ZRDA 4FD2A 2J0SA 1WCV1 4A4DA 2KJQA 5F98A 2GJKA 2QQ0A 4HAXA 1XXHB 2Z5FA 3JZAA 5TXGA 4F38A 3PV0A 2G9NA 1KAOA 2HJGA 1T5IA 4Q02A 4RD0A 1WMSA 4JSYA 1AZSC 2DCUA 1U0LA 2P5TB 4QBFA 3H2YA 1U0HC 1KKMA 1RW4A 2CHVA 4QOSA 4EJSA 3G82C 4DWJA 2ZIAA 1EWRA 2GEUA 1M2OB 2BBOA 3IBGA 5AJVB 1LV7A 1LVGA 4D6PA 4R9UC 5AUQA 4N0EA 3J81k 1FUUA 2J1LA 4MUBA 4PHTA 1NG9A 3AKCA 4NBSA 4IHQA 2ZRCA 4LZZA 3TMKA 4QM7A 2WSMA 4MH0R 4XD7A 1YZUA 4G5QA 1F2TB 4JBWA 1DAGA 5EE0A 5B64A 3BGWA 1YR7A 2WJGA 3AF0A 4HAZA 2AWNA 4Q9JA 4WA7A 3R8CA 5AUPB 1CJMA 1AQYA 1SHKA 4RFVA 4EPRA 1L2TA 1TAGA 3PUXA 3EARA 3ZVNA 1KDTA 2OLJA 2JGNA 2ZJ2A 4NYJQ 4HAUA 4PO1A 2YVUA 4ASUA 4B71A 1OT3A 3FMFA 3GLHE 3QKSA 3UWKA 3KKNA 4DC9A 1DE0A 2WMOB 3SYLA 5TMPA 2QORA 5JRJA 2OEPA 3NTUA 5KPJA 4Q4HB 2G83A 1P75A 1HTWA 1TEVA 2C96A 1WQ1R 3VR2A 4LYHA 4CT4B 2A5DA 1VPLA 2WICA 5HE9A 5C1BA 2W2XA 1ONBA 4B3XA 2R6FA 4KFRA 1WA5A 4HB3A 1ZNZA 2QBYA 2O8CA 3MWLA 4DBLC 2NO1A 3VR3A 2F1IA 1GTVA 4EFMA 1ZUHA 5FTLA 4UXHA 1R10A 1E2QA 2QI9C 5ELXA 3E1SA 2R6CA 2YC4C 1SXJB 1T0HB 2C9OA 1G7TA 3DKPA 4JBYA 2FJUA 1ANKA 4H1VA 4Y0VA 3LBIA 2QMOA 3EPHA 2IUTA 4ZKDA 2EFCB 4BECA 1NVWQ 2REXB 5B2ZA 4AYTA 4BEJA 2VP5A 2RB4A 1IQPA 3FHOA 3QQ5A 1MKYA 4NYMR 4Q18A 3K0AA 4NMMA 3U7GA 2A7QA 2PMKA 1P2UA 4Q1BA 1W48A 2V7QD 1XTKA 2GCNA 2D7DA 3TSOA 2I1VB 1GRQA 5EXSA 1E3MA 2C78A 1P2TA 2HLDA 3OF5A 2IWRA 2D2FA 1XCMA 4P33A 3GFTA 4C30A 1TEXA 2A9KA 3LAWA 3MUFA 4DT1B 1TL7C 5HZKA 1KAGA 3ETLA 2PH1A 4C2TA 5D3MB 2GAOA 2XSZA 3I72A 1G6OA 1CIPA 1Q22A 2WWIA 3AVOA 3U3JA 3PFIA 3LV8A 4FW9A 2P6RA 2O5VA 1UEIA 1OKKA 4BQSA 4PO9A 3VAAA 3AH8A 1WRBA 4FCTA 4XTCS 5IK2D 5FTNA 2W6IA 2F43A 1LFDB 4WZ6A 3NDBB 2V54A 2GCOA 1R0WA 1JAHA 2ZRJA 2VP9A 4GL2A 1UKEA 2DFTA 2PCJA 3GD7A 1LF5A 3TW8B 2XB2A 2VF8A 2O52A 4TWZA 1IOZA 4QJ4A 2NIPA 3QG1A 1KSFX 2IUSA 2QE7A 2Q21A 3KJEA 5JEEA 3QSYA 3BC1A 4NCIA 2EVWX 2R44A 1OFUX 3MFYA 2V1XA 2JJ1D 3GLIE 3BWDD 1WDTA 4DDTA 4V0LA 1OIWA 4G5OA 4ARZB 1N2CE 4JLKA 1P62B 3SJAA 3GLFA 1ZM7A 4XH9B 4OHWA 4LHVA 3RHFA 2ZRLA 2OZEA 4CGZA 4BZXA 1YU9A 4K46A 4MYTA 2AXNA 5A5GA 1DG1G 2ORVA 2RGAA 1OF1A 1RE0A 4TL9A 3TVTA 5ANRB 1Q44A 4FMDB 4BFTA 5JLJA 4FWIB 4OHYA 1JR3A 2BCJQ 3ONWA 1XF9A 4Z54A 1QHIA 4A15A 4PHFA 1BYIA 1FP7A 1KK1A 4DSOA 4C0QC 3GLGB 3BK7A 4JZKA 3I5YA 3D6TB 1KI1A 4Q03A 4Q47A 1U8AA 1AIPA 4IDOA 1KDPA 4LYJA 1SKYB 3ZIAD 3ZLJA 2WM9B 4NCHA 3K0FB 4WZAE 1SKQA 2ZE5A 4UNQA 1RFLA 4PAOA 3EIEA 1KJZA 1IM2A 2RKOA 1E0JA 2IF2A 4L9SA 2XNSA 4MRRA 1EX7A 2QL6A 2UVQA 1E1RD 2QT0A 4MUAA 4KHZA 4GBMA 3KJHA 3B8HA 1JJ7A 1G8FA 1P6XA 5BW8A 4NKRA 1US8B 2OT3B 3EASA 4GOJA 1MABB 4CEHA 1S2MA 4HEJA 1NVXQ 2H92A 5BN3A 4YMUA 1Q1BA 3C15C 2RGCA 5J40A 4JKIA 3K70B 3R9XA 2OCPA 1J70A 5KNDA 2QP4A 1MO4A 1QZXA 2BV3A 2J0UB 4JYBA 5AR1A 3GPLA 4A8JC 3FYHA 4B35A 3U2QA 1N3BA 4MGYR 3LLMA 2BHRA 1NSTA 1IXSB 4M1TA 2JDID 3PJRA 3B60A 1GOTA 2KSQA 5JCPA 2D06A 1QRAA 4Q9HA 5TB5A 4A2QA 3R7WA 3THWB 2BM1A 3VR5A 1R8SA 4ZDJA 4N1AA 3SC3A 4HLQB 1QHNA 3QXHA 4KVGA 2JAQA 4PPFA 2W6JA 1SVKA 4JLOA 5IF9A 3GJ0A 3KJGA 3F8TA 5L3SA 2PBRA 2BBSA 1F5NA 4MKGA 4D25A 3CPHA 4OL0A 4P32A 3GJ4A 2JLXA 1TF5A 1E2KA 3AF1A 2JLZA 5FUWA 2QPAA 5CJPA 1K5DA 4N3NA 2C77A 2ZE8A 4HUTA 2CE7A 3VMFA 3TE6A 3LVQE 2K5UA 2V7QA 3TUJC 1YR6A 3REGA 1N0WA 5FOTA 2YYZA 5IRCD 4DEXA 1J99A 2GKSA 3LBHA 2CVHA 2NG1A 4V0NA 4TLEA 3JVVA 1O87A 2GWHA 4DCSA 1NJFA 4OK3A 2GNOA 2ZYWX 4YLGA 1WP9A 4URZR 3REFA 2VEDA 1S1CA 3U6KA 4DB2A 4EPVA 5L8VA 3GQBA 1AN0A 3A1TA 3QXSA 2HJVA 2ATVA 3WNCA 2G88A 2VP0A 2H57A 2ZRIA 5EQTA 4WXPA 3QBVA 4JS0A 3AVWA 5E7IA 3MGCA 4D2IA 2QTVB 4Q1FA 4LHWA 4GDFA 4UJ3A 1KI4A 4OYHA 1F2UB 1JQLB 4DUGD 1NVUQ 1Z6AA 5DSZA 3KKOA 1R7RA 1XEWY 5GVRA 4DDUA 4X8OA 4UXJA 3OAAD 1TQ2A 1OH6A 2NGRA 4ZCIA 3W3AA 1VIYA 2VF7A 4C7OB 2OILA 2EQBA 4BLRA 1JEDA 3T61A 3EA5A 3QKRB 4LC0A 5EUMA 3T5DA 3LO5A 3ADKA 5FH9A 2BM0A 2OUKA 1P61B 3SYNA 1XMJA 1VCMA 4ZIRB 5AUNB 1JPJA 4BFUA 3B1ZA 5FFMA 1HE8B 2EFEB 4ZI3A 4FI3C 1RZ3A 3P4XA 5CB6A 2VHQA 2JJ1A 1GNRA 2OFWA 3S1AA 4F91B 3I73A 4Z8XA 1E4VA 2P5SA 2F3TA 1A4RA 4W5JA 2MMGA 1YR9A 4IOMA 2RGBA 2FDCA 1E2JA 5IT5A 5FR1A 2J3EA 5H8WA 5BN4A 3FDIA 4AWXA 2F55A 5E4FA 1R8QA 4Q4JB 5CIWA 3U60B 4Q1AA 2GESA 3LX8A 1T3SA 1VG8A 2CCJA 4RD1A 2ECKA 4DDVA 5FBVB 2GZAA 4XJXA 1HT1E 2QG6A 3ECCA 4KBFA 2IYRA 3GJ7A 3NH6A 1VG1A 4P4TA 4RZ3A 3ZYCA 2XAUA 2ZI3A 5CM9C 1E9FA 4NL4H 3KQNA 4M8NE 1RKBA 2IYQA 2WAXA 1M6NA 1KIMA 3QF7A 3QUSA 4QGGA 4Q7LA 1ZIPA 2E9SA 4KXFB 1P72A 1X1RA 4DKXA 3PVSA 3GMTA 2ZS7A 1NIPA 4NYIR 4AKGA 2OCBA 5E7MA 4QGFA 3V4RA 2HCJB 4RFSA 1G1MA 3U3KA 4PC3A 1J7KA 2GAAA 1W1WA 1XEXB 3IIKA 1E0SA 1E96A 3B1XA 3MWYW 4BLOA 1RYHA 2W0MA 4TL6A 5J47A 2Z43A 3IEVA 1X1SA 4LHZA 4Q1CA 5HZHA 3RS0A 1II8B 2Z83A 1E1RA 3UANA 3SQXA 4UJ5A 3MRSA 3SU8A 5B30A 2WV9A 1QHYA 2F1JA 3FOZA 3CZPA 4O2LA 4EFNA 5C4MA 1KI6A 5FBWB 2BKUA 1XD8A 3GJ5A 3K53A 1NRJB 4ACBA 1MV5A 3PENA 1G19A 2GXAA 3BFXA 5LDDC 3GJ8A 1HURA 4LJAA 1JPNA 2RMKA 3PEUA 5CB8A 4LX0A 2RHDA 1ESNA 4EPWA 3BH0A 2PX0A 3DPUA 1G3IA 3FB4A 3QI2A 1G9XA 4U00A 3K0CA 3LH5A 4F4JA 3VR6A 5EE3A 2HT6A 2A5FA 2CXXA 1FX0B 2A5YB 5BYJA 2JDIA 4JVSB 5DGXA 4Z1MA 3FMPB 3MJRA 4ZV4A 2YWHA 3CRQA 2ZRBA 1KK0A 4AKHA 1YJ5A 2NO9A 2DFKB 3TVDA 1RPZA 5TDHA 2VLIA 3HJNA 3GLHA 5G3YA 1EWQA 4DVGA 1ZC4A 2RGNC 4MRNA 5GJVC 3Q72A 1CXZA 3BIFA 4M22A 4XOIA 3ZVRA 4IEIA 2X1VA 3K0EA 1KY3A 1Q3HA 3EZ9A 4HDOB 4AYXA 2P3SA 3C41J 2ODEA 1QHHA 1OXTA 3FPAA 1Q21A 2AWOA 5DI3B 421PA 5G40A 2B6HA 2C03A 1YZQA 2VTKA 4M1WA 1MRSA 1QHSA 4C9BA 4C0AC 2H7VA 2BDTA 3EW9A 2ZJAA 4JYCA 4A8JB 3LVRE 4LBZA 3PEYA 4R7ZA 2V6IA 2CHQA 5E95A 3CONA 1XXHE 5EJEA 1D9ZA 1MT0A 2NO7A 3TQCA 3EIHA 2WMNB 1UKVY 1BS1A 2ZAMA 3FGNA 2W2TA 3GJ6A 4M9XA 3T1VA 4V02A 1DAMA 2IYWA 4C0JA 4MDFA 3IHLA 3EZ2A 3AKYA 3KXKA 1GITA 3EZ6A 4LY6A 4YMSA 1XMVA 1VTKA 3CBQA 2GA8A 2R6AA 2ODNA 2O8CB 1N5KA 2O8BB 3WYAA 4US0R 4QRHA 3CF0A 1CBUA 4QFMA 4DUGA 4KJZA 4KI0A 4M1KA 4O3MA 2JLYA 2BIFA 4F93B 1QVRA 3L8ZA 2Q0HA 3NC1C 4HSEA 4QGAA 1W4CA 3ZS9A 1UADA 3IUYA 5C18A 4JLAA 1IXRC 2DY1A 3A6PC 1M1YE 5EP1A 3AF2A 1R0YA 4ZI2A 4OK5A 2Z4SA 2IS1A 3VFDA 1TF7A 3T15A 3UMFA 5EE5B 5SZIA 2GEDA 4LC1A 1UKZA 1W4AA 1G5RA 4EPYA 2ASEA 3O8RA 1U98A 1CKEA 1CR2A 1W47A 1WXQA 1TADA 2G1JA 3CO5A 3JZMA 2WPDA 1DVRA 3U3MA 2ZI6A 1NI3A 1VYUA 1RRGA 3DL0A 4KLZA 4M9SA 1XJ0A 2P67A 3BFKA 1AZTA 4B34A 1VYVA 2CDNA 5CLLA 5KDOA 4ZO4A 2NPFA 1U0JA 2CNWA 2ZXUA 1JALA 1IXZA 3KQLA 4U7DA 5JRZA 1ZM3A 1E2LA 3EWSA 4QHTA 3KTAA 3SBEA 3ZZ0A 1B0UA 2R65A 3IILA 3MCAA 3GLIA 3W8RA 1WBBA 5HE8A 2WKRA 2YHSA 3PUVA 4GMDA 1W36B 1Z5ZA 1AK2A 1EFUA 1KK3A 2VSOA 3F0TA 4UNNA 4QBGB 1T91A 3I8XA 2WBLC 1SXJE 3B1YA 2DWQA 5FPKA 1GP2A 2MSDB 2MSCB 1JAIA 1H65A 3R20A 1IJEA 1VHTA 5AWFC 1Z2CA 1IN5A 3EWAA 4M4SA 3NHAA 3M0EA 4DLTA 3TJZA 2VSXA 4Q7MB 1U9IC 1UJ2A 4QNMA 2O8FA 3H86A 1NP6A 3UPUA 1EESA 1II0A 2PJRA 4NCJA 4ABYA 4JL5A 2XSZD 3DZDA 4G01B 1U2RA 2KB0A 4KCGA 2OBLA 4BRWA 3RDPA 4XVQA 2BJVA 3B13B 4M1OA 5EUQB 4UNRA 2DFNA 3RRNA 2BCGY 3VKWA 1OFHA 3K1JA 4F4CA 2VHCA 1TU4A 4URUR 4HAYA 5TVKA 1NLZA 4LJ4A 4Q7KA 4R98A 2P2LA 3QKUA 5LBIA 3HPRA 4JL6A 4Q4AA 3CH5A 2O0KA 2CK3A 3M4YA 4GZMA 3MSXA 1NLYA 1T0JB 2OSBA 2Q9CA 4TLBA 1VKJA 1G3MA 4OKSA 4D80A 3U6BA 4B47A 4NCNA 4Q7JB 2JIZA 3BERA 3FFAA 4IEEA 4DJTA 4ZCMA 3QF4B 3RWOA 1ESMA 1X3SA 3C14C 3FHCB 4B48A 2ZJ8A 2XTZA 1ZD9A 1KZGB 1OXXK 1XNJA 4GRAA 4KODA 3T12A 1NY6A 3DDCA 4B2LA 5JWHA 3R8FA 3T1OA 4BEBA 4FCVA 4PSKA 1OH5A 3CIOA 4ZDIA 1HT2E 2PZGA 4XIGS 3CW2A 1OB5A 1DADA 1SQ5A 4JVMA 1JR3D 1SVWA 3MJHA 2XXAB 4XWOA 1VCNA 1C4OA 1PLKA 4LSGA 1D2NA 1UF9A 1XBTA 5CLQA 1TQDA 4ZKEA 2ONJA 5D3QA 4EQ6A 2FPLA 3IDQA 3K70C 1OH7A 1CJVC 3CZQA 2IXEA 2GXQA 1YHNA 1J8YF 2CL0X 2QT1A 3N70A 2J45A 4LBYA 1ZCBA 3WP1B 2J87A 5JI2E 4I4LA 1E9SA 4GZLA 1FW6A 5FL7D 2Q3MA 1H8HA 4D82A 2QGNA 1W5SA 4M9ZA 2CJWA 2AK3A 1N0VC 1GRNA 3FE2A 4PC7A 4TMWA 1E9DA 2AN9A 3TNFA 4JLBA 4RY2A 3DEFA 4PO8A 1N0UA 2CCKA 2QQEA 4HLUA 1TUEA 4BFYA 2XZLA 4FMDF 3KFVA 5FPTA 4ESVA 2ZANA 3NC0C 1PJRA 1N6IA 4ON9A 1Y63A 1SKYE 4Q9IA 1U90A 1D5CA 1Z22A 1AKEA 4JLJA 6Q21A 2FEOA 2BC9A 2D3WA 4V0OA 3R7WB 4C2UA 3KQKA 4LV5B 2CE2X 1GL7A 3TKLA 2L0XA 1EFCA 3IQWA 4A1FA 5LPNA 1SGWA 2AR7A 5J4YA 3TUZC 3KUDA 1XEFA 2C9CA 2WOJA 4E03A 2R6DA 2ZUBA 4AY2A 1G16A 3FMOB 3SJZA 2IS2A 1XX6A 3LA6A 1OIVA 4JLVA 4TT3D 3U5ZB 1E94E 1P3JA 5J4HA 4I1VA 1D9XA 3D3QA 2O8EB 1W49A 1KI2A 2FEMA 3K0SA 3ZVLA 1G8HA 2XNDA 2VO1A 3I4LA 4QL3A 1ZUIA 1ZCAA 2VL7A 4V03A 3Q7QA 4JJKA 4HZUA 2ZSFA 5IDVA 1PZNA 3U44B 2O8DA 2E1RA 1G7RA 4GT1A 4DCNA 2GCPA 2GHIA 2WOOA 3OIUA 1UM8A 3EA0A 3I92A 2FGJA 4UXIA 3CWZA 2GVDC 2IEZA 2XOKA 3U7EB 2W6JD 5DHFA 1WE2A 4AG5A 2OAQ1 1AA9A 4KYUA 3THYA 4L4UA 3ADCA 1XZPA 1K8RA 2HDNB 1AJEA 4TQUS 4DIDA 5HR5A 2OO7A 2J59A 1BKDR 4YMVA 1RRCA 3KXLA 1KI3A 3RS7A 2ZJYA 4GOKA 1Z0FA 1TPZA 1E2PA 4IOJA 2AD1A 2BMEA 3Q3JB 4MYCA 2YZ2A 4PXAA 2JLWA 3P1JA 5KOYA 1DAFA 4TSFA 1CJTC 1ZNWA 3BD9A 3AF3A 3QPUA 2H16A 4FCWA 2FFQA 3IO5A 3SR0A 2HCBA 1DBSA 3T1QA 4NYJR 5CM8B 3EC1A 2GK6A 4QXAA 2FSFA 3F5FA 1D2EA 1LS6A 2IYUA 4YDHB 3C16C 4FXPA 5LB4A 1KHTA 2CLDX 3IPXA 2ZTSA 2CVFA 2FOLA 2RH5A 4JLNA 1OHHA 2FX3A 2QEQA 1OXVA 5A0FA 5B58C 2D2EA 2A2ZA 2ZVPX 5HTKA 1BIFA 1MRNA 5EZ5A 5FOXA 2TMKA 3K09C 3S1AB 3T06B 2CHGA 3PCRB 3PEVA
chains in the Genus database with same CATH superfamily
3NVAA 1E32A 2YKGA 2YN2A 2HXSA 3ND8A 1PKEA 5F76A 2O5EA 3T38A 1T2CA 3WLNA 1RXIA 5JNUA 4YJ2B 5KBYA 2OV3A 2W43A 1Z75A 2G28A 4WRRA 4ZO8A 4DLKA 3A9CA 5KVCA 3DHEA 1Y3BE 4V0ME 3VYWA 4RSMA 4TTJA 1V1RB 5FBKA 5AW9A 3SEFA 3PTAA 1JSZA 3AR6A 1DNPA 2DQZA 5FJJA 5MN5A 2A1TR 4KSBA 3NEJA 7MDHA 4MUEA 1EAYA 5A05A 3WNVA 3OLCX 4RTLA 4IEFB 2CYBA 4JOQA 2EG9A 5ER9A 1NJ1A 5JSFA 5L4SA 3DBHB 4MIKA 2QI9F 4AYWA 1EGVB 5COAA 3RAJA 4FE7A 4YNBA 1OLSA 3F7MA 2ZYIA 1JFLA 3INNA 4NARA 3NP9A 2C7VA 1JE1A 4F4IA 2RGDA 1MVOA 3IHWA 3Q88A 4TN5A 2GVNA 4AIIA 5A9TA 5AVWA 4CQNA 3IE0A 1P2GA 1HOTA 1C30A 5JDCC 4JCCA 1GAQA 4WUVA 4OXRA 1AC5A 2D4HA 5F2EA 4OMUA 3GDWA 5BSRA 4LYEA 1E9AA 1U81A 2CUNA 3L7NA 4I4NA 2XE6A 3PRJA 3HXLA 4MVJA 5L3VA 2VTVA 3PLNA 2ZQ5A 4RWZA 3MT7A 3ZE1B 4I7EA 4K6HA 4JP1A 2C3YA 3Q3CA 2YXNA 4X61A 2YJNA 5I7SA 4B3MB 1COWD 2XI4A 3MWJA 5HFJA 1KI6B 1G17A 2P4SA 3SYTA 4GSKA 4RD2A 1SUAA 4WCFC 1CEYA 4MCHA 4Z0HO 1EJ6A 3HLTA 1JKIA 5HEKA 3NOOA 1WB9A 1Q1QA 3BFJA 4YYZA 1R64A 4M2LA 3L9XA 1NN5A 1P91A 4AMVA 4BCDA 3VPCA 3VKHA 5KOIA 1QV7A 3ME5A 4LXHA 3VZDA 3W7AA 5L7WA 1R9NA 4HJXA 4R1LA 1JLKA 4MRVA 1EE2A 1NXOA 5REQB 4I8DA 3F1LA 5KTYA 3FVRA 5BSEA 2BM9A 2Q2NA 3CUKA 1I9CA 4Q1VA 5KOHB 1CUAA 2BFDA 1H93A 1L7EA 3AP1A 5F9MA 1I7LA 1NBAA 4GPIB 4TYPA 5FYQA 4D5EA 4EA6A 1BDHA 2P9BA 2E6UX 3LKBA 4KVAA 3A6GA 4WLNA 2E87A 2GN1A 1ORVA 1UDBA 1CERA 4CG3A 4DQLA 4IVPA 4ZVRA 5KPDA 1XG5A 4FDVA 2YHUA 4CLEA 121PA 2B98A 4UBIA 5PNTA 3CB4A 3C8HA 5K45A 4ZCQA 2PUCA 2PH7A 3LG2A 2GJSA 2R4QA 3DPSA 4HKTA 3DDZX 3EN0A 1DAHA 4CKEA 2GD2A 1MHPA 4HUQA 5JS8A 1UPUA 2HF8A 5EP3A 5F2KA 3MWDB 2WJ4A 3JAWA 4M6WA 2AQ8A 1UJNA 5C8VA 3DW3X 1YS6A 4TT3A 4DQKA 1G7CA 4R51A 5L51A 2P4HX 1UPFA 3PNYA 4FNGA 3OZXA 3CX6A 5LOVF 5DXAA 1D5WA 4Z1MD 3WNBA 4FPXA 2JHFA 2PUAA 4MW2A 2XH8A 2GM3A 1J5EB 5ECWA 1J2YA 4EH1A 1U8CB 1II9A 1NXVA 1YCHA 1GADO 2EZ8A 2OBMA 4LC9A 1J90A 1XB2A 1Z8FA 4XQ9A 2R1VB 4IDGA 1VZ2A 4DAEA 2JLRA 4FJ1A 3ND6A 4P82A 4C1NA 3C6BA 1HFEL 3B7GA 4L5YA 3CLUC 4S1WA 2Q5HA 3N0TA 3GXOA 4L8VA 821PA 3H5LA 3N2GB 1W8IA 1CW2B 1Y6RA 1IIBA 2B34A 3MRTA 3NIDB 1AUPA 3WLOA 3X1WA 3UMSA 4FIDA 5KDLA 2P90A 3ABRB 3FGPA 2ZRGA 2QF7A 2NYVA 3B1WA 2YUIA 4LHSA 2F64A 5DT9A 1PUJA 1Y4UA 3UMCA 3KFXA 1BQ3A 5GAJA 4L16A 3TW0A 1YULA 4C03A 1E7MA 1DV1A 3GBPA 4OB8A 4YY3B 5CITA 1EYZA 2O2SA 3IMGA 2V03A 2H1LA 4MVJI 2QP3A 4I2NA 3E5NA 4REOA 2R7AA 2JCBA 4QYWA 2FCAA 1OZAA 1FRZA 1PSDA 1RHMA 2IC5A 2O6LA 2PBLA 3NJ8A 4QQKA 3DMTC 2QS9A 3NAQA 1OGYA 3H1AA 2JHAA 4DR2B 1N3LA 1OLOA 2XX3A 2PZFA 4J3FA 3SIRA 2K7FA 1HQCA 3BF8A 3R5TA 3ORHA 1UDXA 4IQ8A 4RAOA 4FYMA 3HXOA 2NPOA 5GY7A 2ZVDA 3I5AA 2W93A 3K20A 5CH3A 3IPLA 1GUZA 4JC0A 5F64A 3HA5A 3TDKA 4CLXA 1H2YA 1J25A 1DIRA 3LRTA 2EGUA 2Q3HA 1H0RA 2XUPA 3BWCA 3GBVA 3MWEA 3N39C 1E3EA 4HD8A 2VRWA 4YDRA 2X0FA 3ZNQA 4PRZA 5DM60 1YC5A 4ER0A 3TSCA 2FPKA 2EFHB 2VYQA 1YO6A 3IDAA 4FGLA 3UJCA 1DZIA 1YA4A 1ZJ6A 2WLSA 4I4TF 4QLBA 4N76A 1NN3A 3L8FA 2MINA 3GUCA 4EKIA 1FXWA 3IXMA 1WLYA 5EL0A 1BN7A 1RKVA 2HZBA 4GS5A 3D64A 3L8YA 4MVJM 1G41A 3DS8A 4E33A 5EJ8A 3GVPA 3FYUC 3HYRA 3MUEA 2CZGA 4JKYA 1PR2A 3D3NA 3HBFA 5DK4A 1C7JA 2YOGA 4GP9A 4TQGA 2QUZA 4JXXA 3ZU2A 3YASA 2I3AA 2VDRB 2GM4A 1FJGB 1CJUC 4Y1FA 2AVNA 5J2TB 4IDHA 1PJAA 1LSOA 4Q0MA 5C4IA 1YUBA 1R8YA 2KYRA 5ALPA 1QDUA 5AK0A 4UFPA 5DT2A 4FDTA 3UK0A 3TRFA 1POWA 3EMBA 5DOVA 4F72A 5FPQA 4O4JA 3VU9B 4DLWA 2IS4A 2HU8A 3KZMA 3PHLA 2HQ1A 5DB4A 3EYWA 3HN7A 3QVGA 5KU1A 3AW8A 1FSZA 2WAMA 1PG2A 2WM3A 3VX4A 1TKBA 4P0TA 4JXZA 2RAPA 4MW0A 1S0UA 3LRPA 1HQKA 1E2MA 3F6SA 2HYDA 5FOWA 4P6VF 4DB4A 3K05A 2OY0A 2NO0A 1DIHA 2WRZA 3HDVA 3L6BA 4HOYA 4K6MA 5HCNA 1J39A 5FBHA 3CLTC 5P8WA 2X0JA 3PR2B 1DUSA 4E13A 3LXRA 1RWOA 1AS3A 1WVMA 1YFKA 2E7ZA 3KHTA 1WUTA 1BCSA 3C3EA 3NTOA 1YKSA 5CH5A 2QKYA 2VA8A 3QY9A 3SJCA 5IJ9B 3KQMA 4HGPA 2CD7A 3DFMA 3GP5A 2QIOA 1KIAA 2Q5QA 2G4CA 2VQ6A 1PTKA 4MGZR 4QODA 3TZHA 2HRQA 3BMNB 1COWA 3DP9A 1N3IA 1WSBA 3DOFA 4NENB 3WQSB 1V1MB 3IEPA 4L85A 1I3OA 4AP5A 4FYXA 4DDKA 2IYXA 2DLNA 1X6VA 3O0TA 2Q6OA 3PU6A 5EE9A 1XZMA 4LOIA 3ACBA 3WA6A 4ENVA 5FPHA 1AMOA 5B7NA 3FTEA 2ECOA 3LQQA 1YL6A 5ALIA 3CWCA 4PYLA 3VH1A 1Z7EA 2Q1YA 2BHSA 4EM6A 2P3LA 2QRVA 4TRRA 3EFOA 4TYYA 2IVFA 1NR5A 2BGRA 3L6EA 1IEXA 2OQIA 4IO0A 4RCYA 1ZCZA 5CLJA 1DBIA 1ODIA 1Y3AA 2BGNA 5FBRB 3IA7A 2N46A 1CIJA 1HZZC 3CNNA 5SZJA 3OA0A 5K8JB 1PDOA 2ZU0C 3NHMA 2VI5A 2PWAA 4YEDA 5C8XA 2HXYA 4TSKA 1P1JA 2ZUUA 2OXFA 3OM9A 1S1MA 4LKOA 5IAKA 3TZQA 2I67A 3HA3A 4EFDA 5A62A 1P1BA 4DLAA 3C7DB 3CNOA 2CL7X 2J07A 3VUEA 2CK3D 2VUUA 3CTMA 4WCFB 5LZ8A 2HNBA 3PVCA 4GLOA 1VJGA 3EVDA 3KB6A 1GGEA 3AUUA 1R0KA 4KPUB 4PG6A 4W82A 4WOKA 1W73A 5IAEA 2XUGA 4DRZA 3LLVA 2X8AA 1Z2OX 1QIHA 3IS3A 3CNEA 1Q19A 3P9RA 5CVDA 2WU4A 4QGBA 1CULC 1Z08A 4OYRA 5AKGA 1WW3A 2ATXA 2DSNA 1FSFA 3U48A 3RW9A 4HNUA 2DFDA 1DC7A 2WJ3A 3K0FA 4QT4A 1MX9A 4YWJA 1KJJA 1N5JA 5J5VA 5A1JA 1W46A 2CDAA 2NUAA 3LSTA 4XA8A 3ANXA 4BO1A 5H5JA 1KQFA 1U5BB 3DV0B 2CL5A 3AEZA 4DKJA 5YASA 4DR4B 4MGKR 3UAGA 3BJIC 2H3HA 2HF7A 1UBNA 1HI9A 5ALRA 3QFCA 1G5TA 2BTEA 1N2BA 1S3FA 4PIPA 4KVZA 1ZKDA 1SNYA 3TZLA 1F8YA 1SOWA 2JLSA 3HJUA 1XMIA 1ZD5A 2EWWA 2COKA 4CIVA 1RRPA 2Z2JA 1L5GB 1Y3CE 4D4JA 3GCDA 3QX8A 1CLEA 1CZNA 4PVCA 3D3EA 3QPVA 2ZSDA 4WXHA 3RS2A 4ZO9A 3RC9A 4BZQA 4ZVLA 1PS0A 4KK3A 4KGVA 4QE3A 4RHYA 2H31A 2VH1A 1JU3A 4LSWA 5G0VA 3U3DA 5K3CA 1G8YA 3FTPA 1ULHA 4KSYA 1B00A 1T3HA 5DMXA 5IPFA 1UDAA 5DW3A 3TD2A 1H6CA 2OM6A 3HSSA 3ICEA 1Z29A 3ENQA 2FX2A 2ZSBA 4X8LA 5HS6A 1H9CA 1HLFA 4GOND 4M7RA 4RNDB 2VK8A 1LTQA 3PPYA 5TQJA 3K8YA 8OHMA 3GMIA 5LJIA 2A0XA 1GIAA 3G1TA 5AJZA 2RAVA 4PCVA 1NUPA 4S04A 5K9ZA 4JVLA 1HA3A 2AX4A 2FNAA 3W06A 2HHCA 3FB1A 4G24A 3EF1A 5CA0B 1T2UA 1IHPA 3PC8A 4HTFA 3C3DA 2FF7A 2I4OA 4AXXA 4E14A 2O8DB 2ALJA 2B1IA 2YV5A 5K7SA 1KJWA 2C29D 2RAUA 4XQGA 4FBMA 5ALXA 3CPJB 5E6SB 3G5TA 4DFDA 1E0KA 5FWXA 5TPWA 2NQTA 1L4UA 2F8LA 5EP2A 5EHNA 3C3CA 4RIGA 3EXAA 4BTVA 1XZGA 2GWRA 3H8VA 4R3UC 4QULA 2C5SA 2UZ1B 4DNFA 3DFZA 1Y81A 3IBCA 1ZVKA 1H0SA 1VHLA 4Z7NB 4H7IA 4DXHA 2J67A 1N2OA 4RANA 5JHGB 1ZUNB 4F5DA 3BJRA 3V1KA 4CG0A 4ZICA 1U3TA 2ZR7A 1USWA 1UT8A 2NUBA 3K0AB 1A0OA 3G7NA 1VA4A 3O1IC 1ML3A 3VR5H 4JT2A 2YC2C 5KJEA 4UTRA 2PXCA 2CMFA 3GPBA 1SWVA 6YASA 4E6PA 5EPEA 1WB4A 3CZAA 4IHAA 5H80A 2X6RA 4H4EA 4EHIA 4DLVA 4O4HB 4FGKA 5TRTA 2A67A 2XDWA 2ZJBA 2BFEA 3MJFA 5A7HA 4C4AA 3GA7A 3DAOA 3IBYA 4O4IA 3GLSA 4XPIB 3SYKA 1W4LA 2C31A 3D6HA 4R8RA 3BQMB 1JDJA 1GU1A 2XQGA 1KJIA 3CM0A 3QVWA 5E6RB 3VKFA 1JNYA 4E12A 3ZVMA 2CLIB 2G77B 1MC1A 5G0UA 3B2QA 5DN6D 5ICSA 1SQ6A 5GJBA 2R8ZA 3S81A 5A6SB 2A92A 3QLEA 4L9WA 1PF7E 4NI5A 4YWHA 6PFKA 1FRNA 4RA9B 3E2PA 1BYUA 1MF7A 1V43A 3D59A 3RUPA 3FYUB 2BZSA 2RGXA 4BUJA 3LGSA 1O6BA 1E2DA 2GK4A 1H4SA 2ZUDA 2W70A 2F43B 4YQYA 3WGTA 2EQ5A 2VT3A 3OJFA 2AI2A 3OZVA 4TPKA 4G0UA 1E7SA 2QSJA 1IWBB 1HWYA 2MJLA 3HU3A 4BQNA 2RIRA 5AI5A 3W6PA 2V45A 4MUFA 1I24A 1FFXA 1UT6A 2EW8A 4WK2B 5EPOA 1I3NA 2ZJOA 1OWOA 3G0CA 4IX9A 2FP3A 4N3AA 3R76A 1U3FA 5BVGB 1HNWB 2RK4A 2P62A 3RVRA 4E3WA 2BFCB 2C92A 4G5SA 1HE5A 3ZKAA 4G41A 4OKSA 4AMYA 3VMMA 1EP3B 4NPCA 4M0LA 3LE8A 1JEOA 1CR4A 3SPXA 2ZB2A 1A5BB 4YRLA 2X14A 4CR8A 4I99A 3TTUA 4DOMA 5F7XA 3GLFB 2Q3FA 1UXIA 2JCXA 3PHHA 1Q1ZA 1ZIOA 3F6RA 1YRAA 1W5EA 2SKEA 3FTNA 3E8SA 1Z0KA 4HDKB 1GCOA 2ZRAA 1YQUA 3U4MA 1G9TA 2YINC 4QFDA 1E9RA 4MARA 3WBJA 2QUIA 3DDOA 2QU7A 1SEVA 1T35A 3S2ZA 1IY8A 2DP4E 3QUBA 2FRDA 1MJGM 1PV2A 2D7JA 4TTTS 1QGDA 3QFHA 3CWQA 3O92A 4IIVA 1DDGA 1HUQA 5IKPA 2RARA 1IRIA 5C1PA 1HMYA 1DWOA 1KKUA 1XLUA 3N3AC 4IIFA 1LRKA 2IYOA 4OTZA 2JBHA 1Y5MA 1DKNA 2XYPA 3GNTA 4WKGA 2J31A 4H6XA 3STHA 3VTZA 5JYDA 4FGZA 4JH0A 4L2IA 5JDIC 3B5JA 1FTYA 2HFJA 2WD7A 3OJCA 3N2KB 4P0PB 3X0DA 1U0FA 1AKRA 1FUKA 3KE8A 1U1CA 2QR2A 1Q14A 1JKJA 1IN4A 2CNLA 2QRNA 2JA1A 2WG0A 5HKAA 2V9ZA 1S89A 3F4KA 4HEQA 4EJ0A 5IAGA 2B4RO 1OXUA 1P44A 1F1JA 4QU0A 1B76A 3DE6X 4YCDA 1QFYA 2BEVA 1PQPA 3LY9A 1FP4B 4HNGA 2VYFA 4JD5A 4RGYA 1JF8A 5AJHA 5LBTA 5JS2A 5ILQA 3WK6A 3FOCA 3LUFA 2ZB4A 3UXEA 4K9PA 2W37A 4W1PA 3W7VA 3PUHA 2AG8A 3SQWA 4G07A 4IIYA 1U99A 3NHFA 1O6GA 2W2NA 2PL3A 3H3FA 4Z99A 2JS7A 2X9VA 3RFTA 3RK1A 4RAQA 1T3LA 1TT5A 4CEHB 3AVVA 1U6IA 3NO4A 1EVEA 5KC8A 1FYVA 1RDFA 5SZKB 3WLAA 1DKUA 2HMSA 2BUAA 4H7FA 5ARDA 5IJWA 3D6UA 4IUBS 1JHPA 2XGOA 1RCUA 5L4NA 3I28A 1QQ5A 3RHZA 1N2EA 3I09A 4OJQA 1AKMA 2BFPA 4GEKA 4BZWA 4ZYYA 2FFRA 5T6BA 3BQ9A 3NDPA 5IN5A 1WCWA 3QSGA 5JECA 3L46A 2X5JO 2FI1A 4AM8A 3U7IA 3I30X 1OYVA 1NF8A 4P54A 2QPTA 4WFJA 4B17A 4MWZA 2EJVA 4HB0A 3TKYA 4YRSA 2DSTA 1FNMA 1OB2A 4DR7B 4XFKA 4FEAA 4I46A 3UOGA 3LBNA 1O96A 1PJTA 5DLYA 3HSYA 5BQFA 1COZA 1X0XA 2KW5A 4JROA 3ORSA 4X85A 3CLRC 4PFSA 4UAUA 2Q4TA 1SZPA 4I0WB 2D5AA 2H9IA 4Z0TA 4X00A 2K6GA 3RVDA 1KIFA 3QUTA 2Z8ZA 3A9TA 3RYTC 5JCZA 4JFAA 1YQQA 3ADBA 4UOEA 3SJBA 4PR0A 3NNNA 4GKKB 2BWJA 2FMIA 2JAHA 3ANMA 1SULA 4B6PA 2C7QA 3DAPA 4NYMQ 1VCOA 3ZWDA 1Y7PA 1NJ5A 2CYCA 3TG2A 2Y1KA 3V8BA 3DOOA 3QU4A 2VRNA 3QA9A 1NUUA 2QUAA 3G85A 3H9JA 2KBFA 4UEQA 1WR8A 4UPDA 1WW8A 2XOXA 1GG5A 3ONDA 1GZ7A 1HK7A 1LPMA 2C8KA 5DZSA 1FUYB 3DHVA 3BFVA 2GK3A 2PPLA 4PYNA 4Y2HA 4I1RA 2NSHA 4P7BA 3AEXA 4I4TA 4EYQA 2FPPA 4L3VA 2IU4A 3OEHD 1EP9A 1UXHA 3IRUA 3K9HA 2AW5A 3KCNA 4C3VA 4LRYA 3LIPA 4FFBA 4UQOA 3EGXA 2BSQA 3EQ6A 3K4QA 4EVQA 2V5VA 5DK6A 1XC7A 3VDRA 2WYWA 4AF8A 4MRMB 3RFVA 5B3JA 4YONB 1Y8RB 5EZSA 1B3BA 2EARA 4MQMA 2WUWE 4YAKA 4KR2A 1WW2A 1CY4A 1ZM9A 3FLMA 2ZBDA 3DZ8A 1ZG3A 1CUGA 1FC0A 3JWEA 1JG7A 2P1ZA 3INRA 1VL1A 3KYIB 1FFEA 2WVHA 2XHEA 5LA6A 3S99A 4NONA 2DH6A 2O3QA 4NMHA 4BO4A 3FSEA 4CKCB 5EQFA 2Q4RA 5DN6A 2DTDA 4GRIA 5CT5A 3HZZA 4NJMB 1XD9A 5FOVA 1C9YA 3QE0A 1DO2A 3EYAA 2O7SA 3U1TA 4D9FA 2YV4A 4EW1A 3L4EA 2M2IA 1KJQA 2AN4A 2EEPA 4EYGA 3O31A 2ZPTX 3EDOA 2PSFA 4QVGA 2WJHA 4WESB 4HQFA 1MFZA 1ZPDA 2HIAA 3PUIA 3WKBA 4YRAA 3KK0A 4EQZA 2Z6VA 5K20A 1I3CA 1YAJA 4IO1A 1BX3A 2XTJA 2PYZA 3T7JA 2JVIA 4W8OA 1Z2NX 2BKEA 4HTAA 5E7JA 4EGQA 3VNAA 2D74A 2VAWA 1NRWA 3D5TA 4UUAA 2I9KA 1HL7A 3QH4A 1HEYA 1KO7A 4OATA 4JEMA 3MNFA 1O94C 4YJHB 2BGWA 4G1CA 1XHLA 2J46A 2EJBA 1E1LA 1P7YA 2OHGA 2AC7A 3CR7A 1S4QA 1O6FA 1T9AA 2WWGA 3VH2A 4MUGA 2H9YA 3N5KA 1NVVQ 2II6A 3LXUX 4DLYA 5K99A 1XROA 2RHWA 5E7QA 1XPUA 3LC2O 2FZWA 1E99A 4RSRA 1PWHA 1SXJD 2HMVA 3A4MA 2G9QA 2PSHA 2OPHA 2H00A 3HSKA 3FOFC 1TCAA 3G2NA 3TR6A 1KEWA 1GN8A 1ZRSA 1ZMXA 4MMYB 4TL7A 4MVJP 1ORTA 1Y1QA 1EFLA 1EUCB 2IUUA 3Q7IA 5LCXA 4AZ3A 1U7HA 3I1YA 5KTPA 3I52A 1F7UA 5AKZA 2Q5LA 2B0JA 5AM5A 1KDRA 5IABA 2YJTD 1G1AA 4JA0A 4Y8VA 5FKJA 1RI2A 4XQEA 3S7TA 4EZIA 3GRKA 3FGZA 1T6NA 4LFCB 4OI0A 1JT2A 2C2OA 4GLLA 4E2ZA 3EOBI 1L7QA 3T5CA 4EAQA 2FW7A 3ZJYA 1O0BA 4TYWA 2WWXA 4JL8A 1FP6A 2FN3A 2QL7A 2O2HA 4KPEC 2OHFA 4LX8A 5KYWB 3GFRA 5H0IA 1M72A 3VI4B 2JGEA 5DASA 5EYPB 4RF3A 3SZRA 1NF3A 2SCUB 2VDJA 3PITA 1HL3A 4HBZA 4ND7A 1ZGAA 3VH3A 1A4IA 4X6UA 2JANA 3S1LA 4AY3A 4HP8A 2V3CC 4TKZA 5FPSA 3UV3A 3VSDA 2J41A 5G4KB 3CW8X 3RSFA 1GLVA 1EFVA 1YQTA 2AKEA 1QZ3A 2Z5LA 2X3FA 4P3NA 2X7XA 4EL0A 3CNBA 3C8UA 3QNWA 1TK2A 3UMMA 2AOVA 1TRHA 1U9ZA 4YBRA 5GJWC 4A16A 1EBBA 4UKDA 3MILA 2A33A 4TTAA 1OPXA 1PG5A 4HF7A 2A0KA 4KWHA 1GRRA 1AUOA 4RF5A 3UWOA 1ULSA 2D0PB 2WAAA 1VDZA 3OHMA 3OKPA 1IN7A 2Z8XA 2QSZA 4L4RA 3HCFA 3OQNA 3HE3A 5JQGB 1Y9ZA 2R4TA 2FPXA 1MP0A 5E3HA 1VL5A 5AOAA 3O1HB 2OO3A 2ZVQX 2YVQA 1T1JA 1A04A 1Q57A 1QH1A 1RBQA 2W90A 3D9QX 4QM6A 4B74A 5EZ6B 3CR8A 3B9PA 4G0QA 4RZ2A 1RJ9B 1T3ZA 2AEJA 1TFUA 4ZQBA 4M99A 3UMGA 4ESHA 4ZT2A 2OM2A 1WLSA 3ROMA 1NXTA 4YB8A 1SIUA 4NZYA 4E5MA 2OAP1 2PGAA 4TRMA 3TO5A 4F96A 1DJMA 1G291 3EWNA 1N6NA 4H6VA 3G0IA 3CVXA 2A86A 3LW8A 4I9NA 3IIIA 4G3XA 1YBMA 4QPNA 2NQ2C 3K6KA 4GP7A 621PA 3TG8A 1QYXA 3P9XA 1A9XB 1KRWA 1GL9B 3EAQA 2WFMA 3NWJA 4LG1A 1QONA 4CQLA 3ROEA 4ZAFA 3L4SO 2Y99A 1BKYA 1YZ3A 4NFYA 5J4LA 1HORA 1UOEA 4H7DA 1RI1A 3T1NA 3ORRA 3PNKA 1P4AA 1Y3HA 2NZJA 4EABA 4OU5A 4CKWB 1QNFA 1ZHFA 1ZN8A 2F8MA 3DTYA 3OEHA 4BU0A 5AM2A 2GHQA 3R9WA 3S5UA 4IDPA 5IC5A 3AEQA 1TU0A 2Q6IA 4FC6A 4B75A 3D4PA 4G0ZA 2H06A 2XNCA 2G0AA 4P34A 4M1QA 4ZZ1A 1DO8A 4DV0B 2JBWA 3U61B 1AO0A 2CT8A 1A88A 3DAGA 3I9OA 2CMKA 4QYMA 1U6JA 2BMAA 3T52A 3W9YA 3M6WA 4MGIR 5E2AA 1AKWA 2FE4A 4TVOA 1QLHA 3IPRA 1P39A 3LGXA 4H2DA 5HWSA 3C3WA 3GC6A 4LZOA 4LKRA 2P2YA 2Q6TA 2V59A 4QDKA 3RU2A 1STOA 2CKDA 2GD0A 4JXKA 1E3WB 3GT3A 4J6FA 4WLFA 3BRWD 5D1HA 3UBMA 5M04A 4NHOA 3AUKA 2XAAA 1RU3A 4RGVA 3Q4GA 5DXJA 1VJRA 4TWAA 3CYFA 3F9IA 4RJTA 2V6JA 4KG7A 4YV1A 3MCUA 1DJQA 2BKVA 2L69A 3ZDBA 2WJ6A 4L8FA 3TTYA 3K70D 4AI6A 5AKJA 2VNSA 3RVPA 3F5MA 1WPRA 5G4LA 4Q01A 4H0CA 3UT6A 1TUBB 1CUWA 2O2GA 1L7DA 2UKDA 2D5CA 4TN1A 4C04A 5C8ZA 1ADFA 1P0MA 1FUIA 3FUUA 4Z2AA 5CLIA 5KINB 1P2DA 3DBLA 3ND9A 3B53X 2O8EA 1U2PA 2YFQA 4WDQA 2FUG1 1T2AA 4DHEA 1KEKA 1DKQA 2VAXA 1LZLA 3CLVA 1QBKC 1R3UA 2X6QA 3MXOA 3TYXA 4X3OA 5KOYA 2HD4A 2JB9A 2IF0A 3NGMA 1HYEA 3B36A 3W9UA 3ZQJA 5LP6A 1PTJA 2VAPA 3BXZA 3U16A 5FDFA 1JQ3A 4JLPA 3COYA 2GTPA 1XTRA 5HIIA 1CSEE 3A32A 3D4NA 3M81A 1L7AA 3OE5A 5CB4F 1TAQA 3IVAA 2Q3DA 4QYXA 5I7EA 3GP3A 4M53A 5F33A 3U4AA 3HZHA 2WZDA 1MOZA 4XM1A 3EGVA 3KXPA 3UJPA 3AP2A 3BMOB 1Q7RA 3O1LA 3OP1A 3WSWA 3U9TA 3EUEA 5LU8A 4CV2A 2ID9A 4LJ6A 1Q11A 1V95A 2Q41A 3W1EA 3GVCA 3O4GA 1EGHA 3PA8A 3NHBA 1E61A 3H4MA 3TOSA 3MAGA 4JUCA 3W6NA 1WVGA 1SWWA 3QENA 2GN6A 2OGWA 4CM8B 3A25A 3FRHA 1XQVA 2HCFA 3KTAB 1X7WB 4ROTA 3OPQA 4HRYA 5FA5A 3A1SA 3NKVA 1PI3A 2X86A 3WRXC 3NHSA 4HWOA 4YV7A 3EPLA 3KEFA 3UPDA 2FW9A 1YBFA 9GPBA 1TJ5A 1MO6A 4I81A 2G06A 4YAGA 1W88A 4B80A 5JCXA 5CTJA 1AG9A 4MQEB 1PSZA 4P7JA 3UHAA 3LOUA 4X91A 5TGTA 4BJ6A 1Z6YA 1SOAA 3WL5A 1ADJA 3LQRA 4PS0A 4UC0A 2EGHA 4DT1A 3LNCA 2B2CA 3ZKWA 3KQYA 1AS0A 4TV8B 2O8FB 4PRKA 4DLRA 4DUZB 2ZT7A 2GXSA 4N4AA 1A9TA 2QTFA 1OY1A 1XN4A 1PX0A 2FWMX 3IJEB 4W5HA 5JH7F 3FR7A 3Q0TA 5AM3A 4I1PA 3HXQA 2FHPA 4D45A 4NEHB 3M6UA 3OPVA 4TROA 1VC2A 4NE2A 3FAZA 3OESA 2X6TA 4S2EA 5FNVF 3VTFA 1L5FA 1P9WA 5LVAA 3DLPX 3GJXC 2FSSA 2H4XA 4Y3UA 1EA7A 3EVAA 3AB7A 1EU1A 1J8VA 4DGQA 4PG5A 4EP1A 1JXAA 2EOAA 3DC7A 1M2JA 2AXPA 1X92A 3HL4A 1H6AA 1E2IA 1KO5A 4L5JA 4P08A 4PSVA 4PZZA 1H6DA 1TAHA 2V58A 1C1YA 2CKMA 4MW7A 1Q91A 3GCZA 5JAZA 4RKQA 4KXNA 4HLCA 4YMHA 4LHXA 5JISA 1L5ZA 4DXAA 2B37A 3QTTA 3JQGB 1DHRA 2PX6A 3FSRA 4MRSA 3ST7A 4HZIA 4Q4AB 2C4HA 2CZCA 4BMPB 5J5CA 4ZVPA 2PEZA 3H42B 1DC5A 4HDNA 3T6KA 4BX2A 4D0SA 2G08A 1N6KA 4E1AA 4K2AA 1ENYA 1U9IA 1YGPA 4LJSA 3ZWPA 4A9AA 1YH3A 1KYTA 2HA2A 2ZXEA 3OJOA 3QVVA 2ZZKA 1URPA 3IERA 2CWWA 5DYGA 5JHHB 2C5EA 3U3RA 3CEMA 3C5WP 2KMLA 4TMYA 4ZT4A 3MGAA 2XQIA 3L01A 3RAEC 3KALA 3NG1A 2M6LA 1HKHA 5CEJA 1U5CA 4R5HA 1BH2A 4WNAB 2EJWA 3L8MA 2FPMA 2P8JA 1WEHA 4YRDA 5I7AA 3WGQA 3O91A 1NSYA 2J7PD 3K2EA 2FLWA 1S2IA 5HQJA 4R6WA 5K0ZA 1M54A 4EUEA 4EY3A 3QJYA 4AJHA 2RGEA 3A3NA 3ZCQA 1J2JA 3IELA 3EG9B 1D1TA 1LSJA 4ER7A 2GM9A 3GLFE 2Z4RA 3OU6A 3CU5A 4LJ8A 1NOJA 5C52B 3IKTA 1RWNA 3U26A 3MHPA 3P19A 2FUCA 2PFSA 3PQDA 4HRXA 1JQJC 3IVXA 2ZRKA 4KUEA 1IUNA 1ZRHA 3WP0A 3ZZUA 1UMDA 3IQFA 2VJPA 9ABPA 4NS4A 2HR1A 1X7GA 2AN3A 1JI0A 2CUTA 3BHNA 3SIWA 2V7GA 3ZZMA 1JLLB 4QU8A 5E4TA 4ND8A 4QNRA 5AI0A 1M2VB 1SUEA 4Z53A 2FYTA 3ZWBA 4K3VA 5EHGA 4OHVA 5A9SA 1ZNQO 2QNBA 1GZ6A 2O48X 1MOPA 4G63A 1EJ2A 4MUNA 3C3BA 4NBWA 1T36A 4DLSA 5KSPA 3SHFA 4Q9AA 4RYDA 4BFWA 3BRWA 1TC2A 3EQ8A 4OOEA 1RC8A 1OBCA 4CDRA 4UDNA 3H0CA 1QWSA 4WFKA 3TOCA 3C1AA 3ASYA 3IVMA 4PCUA 3AI2A 3K1YA 4CIBA 3FNGA 3TRHA 4J7XA 1L4MA 2A6PA 1EUYA 1R4MA 1E4YA 2OCXA 4MUJA 4UU8A 2QN6A 1F6WA 2H0AA 3EF0A 3P26A 3VKUA 2DUUA 3EY4A 4WVLA 3D4IA 2Q5OA 4QRDA 1A69A 3RSOA 4IDNA 3ZHBA 1Y8QA 2WIAA 3DMHA 5CDFA 1U2EA 1K1EA 2UVPA 4GOLD 4J8PA 1JIKA 5TNXA 4PFJA 5I47A 2V6BA 4YIHA 2Q1UA 5AVQA 3D0OA 1H3EA 2HMWA 4GGPA 4NDZA 3FM9A 4BNTA 1BVUA 1T29A 1GPBA 1QH9A 4PTYA 3HM2A 3UTCA 4DCUA 4RL6A 2GCIA 5CDHA 5EJ2A 3T4PA 2IEDA 5BMVF 1UFRA 3GYGA 1NAHA 5EIEA 1R1DA 1C2YA 3OI7A 4IDDA 3GNSA 2YV3A 3VZCA 1DXOA 2JFQA 3IEUA 1WDLA 4D9KA 1FNNA 1F38A 4JJZA 4KRFA 2C8JA 3RTEA 4LE2A 1IN8A 2NTYC 4J3JA 4MHOA 4RK1A 2FSHA 4P93A 1NPYA 1RC0A 1NUSA 3CX8A 4RZHA 3EW7A 3RIMA 1GCGA 2QTHA 5FXMA 1CZKA 1OA1A 5KSWB 1NW6A 1OV4A 4OX9B 2AZMA 4OSPA 1SCDA 1QJCA 3AF4A 2YCBA 1PVOA 3RU9A 1I4OA 1Y1TA 3GGOA 2XB8A 4FS8A 5EJFA 3ZQKA 4K9NA 3R5SA 5EUBA 3DE5X 2HBZA 2PZ8A 1T26A 2ZJ6A 1QYIA 3WDKA 3DHNA 3H0EA 1IWPB 1B42A 2GLXA 3NNSA 3IAXA 3AZOA 3ZU4A 1XQYA 4B8YA 4ASUD 1QR2A 1XFAA 6REQA 1EI9A 3FCSB 4Q9DA 3IMCA 1K3UB 1QTIA 2R5NA 1RC1A 1KY2A 1G6Q1 1LI7A 1YUNA 2R8EA 3MJSA 3W3ZB 5AVTA 1Z0IA 4CRWB 2NZWA 4BBAA 4YJ3F 1TIKA 5E38A 3U31A 3KYDB 4JUIA 2GPTA 1CQXA 4FE4A 3CKLA 4TMZA 1PEDA 5JJLA 2VPIA 2PA0A 4NOLA 3AIIA 2ZIVB 3Q5GA 2OENG 3PI7A 2E4YA 3L7LA 1D7AA 2PZJA 2YQ4A 2AFIA 3GEIA 2ODTX 3DG9A 2DCMA 1PGJA 4FYWA 2GPBA 4OFZA 2QRUA 4JASB 1RD4A 3TD6A 2XMQA 4JY7A 2HIMA 1R0BA 1VA5A 4P9NA 4X1IA 2IXFA 4Y6RA 5A4JA 2C9MA 3S2SA 2QZPA 4XVUA 3K2BA 2NXEA 2AJTA 3MGKA 4BXOB 4WKBA 4C7OA 4EY8A 3UK2A 1TT7A 2NPIA 4C7JA 4F9GA 1GSHA 5D3KA 2FG7C 3D7MA 3QKRA 5L6LB 2QX6A 1E64A 2WKSA 1G63A 2X58A 3LFHA 4IMIB 2HUNA 1XTTA 1PSWA 4L8GA 5DWDA 4OFXA 3CUVA 3BE4A 3P0EA 4LWOA 5DCLA 1TMKA 5M29A 2ET6A 1OH8A 5H1YA 2ATCA 2PX8A 3TNJA 1Z2PX 4S35A 4ALNA 3LYUA 4P3OA 4DW8A 3GW8A 3NH9A 1ODSA 2XB6A 2QJRA 4JBXA 3P52A 3DZCA 4W6ZA 5J1TB 3IMEA 4N8EA 1RZVA 2GS9A 1TVKA 1OLSB 3ETDA 3D6MA 1WNTA 1VMDA 2COUA 2ZETA 5I9IA 5F3WB 2ZIXA 4WX2B 3AHIA 1FZQA 2QRKA 5D7BA 1LWNA 2V6GA 3VC7A 5JY6A 4MIYA 3MEQA 3OCXA 3FLEA 3GB9A 4WACA 1QG2A 4F2PA 4EF4A 3TLYA 1JW9B 1C30B 1Z35A 2IIVA 1K6XA 2QV0A 1CQPA 2VJLA 3KL4A 3VZSA 4ECAA 2GSWA 3TECE 4HB4A 3SKXA 2BMDA 3TGPA 1NASA 2OV4A 2Y4NA 4R40A 1BFUA 3ZW9A 2I4RA 5IZCA 4B44A 2ZWAA 4OQEA 1BTOA 5FLYA 4OQNA 2YV1A 4PGMA 3WWCA 4P3KA 5HG0A 1UQRA 5THKA 1CS0B 2OHIA 4P22A 1W36D 1OZFA 3E58A 4KH0A 4FQ7A 2I7TA 2W6ID 4OEHA 1HY3A 2PRJA 3KZXA 4RD3A 3V5NA 1M2EA 1KYQA 2KHZA 3IAM1 3ONNA 4MCIA 3WZMA 3FLAA 4TZKA 4AP9A 2GHRA 3CJRA 4XWKA 4MVWA 5EJAA 1AF4A 1LNZA 1FXUA 1PR1A 1NQ5A 4FC7A 4L57A 4WV3A 1KDYA 2JGFA 2P9HA 3HFRA 4R16A 2H9AA 3MUNA 1MD9A 4QT0A 4CBVA