4X8MA

Crystal structure of e. coli adenylate kinase y171w mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
b'MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEWHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
molecule tags Transferase
source organism Escherichia coli
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
total genus 65
structure length 214
sequence length 214
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8mA00
1G7SA 1N0VC 2D3WA 2OBNA 2BBWA 2XGJA 1W48A 2ZUDA 1UJ2A 2CNWA 3OE7D 4DSUA 3BWDD 2P6RA 1XEWY 3A8TA 2VSXA 2GCNA 2PEYA 1NJGA 1TADA 2XB4A 4HAVA 1IN8A 4UNRA 1G5PA 1U0JA 4HAUA 2CHVA 1SVWA 3B60A 3VKWA 4RCZA 1OFTA 5TVKA 1JAIA 1H8ED 3GLHB 4EQ6B 3REGA 2XZOA 5LDDC 2NTYC 2BBTA 2REBA 4E22A 2ODBA 3AF1A 4R71A 2AHOA 1E2MA 3EPHA 4CGZA 3WRYC 1XU4A 1ZAKA 4ASUA 2REOA 5JS8A 2DYKA 3GLFB 2YZ2A 2YNMA 1I4LD 4P4UA 5AJVB 3BFXA 4Q19A 4BEJA 4KYIB 2HT6A 3CNNA 2HDNB 2JASA 5FPSA 3NHBA 1I4DD 1RW4A 4DUGA 3E70C 5JJIA 2G0NA 3VU9B 1JPJA 3NDPA 1US8A 2IF2A 4BGDA 1GKYA 4TZ6A 2UVQA 1UBCA 2XTMA 1RJ9B 1T0JB 1XTQA 1RZ3A 3IUYA 4LHZA 4MYTA 1ZVQA 2QAGA 4JLJA 1R4AA 1KI7A 1EK0A 1IBRA 4ITRC 5A0FA 4DLZA 2CJWA 4Q02A 1T9HA 4WW0A 4DCTA 3ETLA 1R0WA 1N6NA 5EE5B 5CLLA 1GIAA 2IUUA 2J45A 5SZIA 1EGAA 1OW3B 4B71A 2WJIA 4Q4AB 5CLQA 2PLRA 3WHKA 1SGWA 1U94A 2BJVA 4IDOA 1ZD8A 1RRCA 2J1LA 1G20E 3CRW1 2VF8A 3KXKA 5FOTA 2VSOA 1FNNA 5AUPB 2YWEA 3U6KA 3VX4A 1XRJA 1H8HD 2X2EA 5L3VA 4PZYA 3DPUA 3UWOA 3NKVA 1ZUHA 1A4RA 3IBGA 5AK0A 2J0VA 4Q7KA 1ZU5A 2VEDA 2YWFA 4KLNA 3SQWA 1Z0JA 4N1AA 3BOSA 1XMVA 1IHUA 1L4YA 3AVQA 3SYNA 5L3RA 4FINA 4V0LA 4J0QA 3J81k 1U0HC 2ZVPX 2Z43A 2FSHA 1QHGA 2V55B 1D2EA 2J9RA 3M0EA 5B2ZA 2FPMA 2JEOA 3TSWA 3HJNA 5HKKA 4QM7A 1XEFA 2WMNB 3DM5A 4URZR 2JDIA 3MLEA 3E2IA 4OHZA 4ACBA 4ACAA 1MABA 5JFGA 1LF0A 3Q72A 1ZM2A 2ZAMA 1OB5A 2QT0A 4CEIA 3B1YA 3AUXA 2IX3A 2OFXA 3QENA 1TF2A 1P2SA 2GZDA 2BEKA 2QRNA 4PC1A 3VAAA 4B3BA 2ZYUX 3GJ5A 1NVVR 4DT1B 2IEZA 3EAQA 2VF7A 3SR0A 3U7GA 1NMYA 1SXJB 1PZNA 3QG1A 2SHKA 721PA 2D4HA 5HTKA 2XX3A 2FA9A 2ZJ8A 3CPHA 1KDOA 3MWLA 2ATXA 2GDJA 4JS0A 5LBIA 5E3HA 2O8BA 3RSLA 3FDIA 4JT2A 4ZI2A 4FCVA 3Q7PA 1YRBA 2JLXA 1ZUIA 2X8AA 4LYJA 5DE3A 2QL6A 1FNMA 1W0KA 5FI1B 3VR1A 4ZV4A 1AGPA 4CVNA 3VFDA 3DOFA 1X6VA 2XEXA 4LJAA 1QVRA 4QM6A 1E2KA 2WWWA 1Z8FA 1SHZA 3MWKA 4HLCA 3TUZC 2HUPA 5FTLA 1E94E 4UJ5A 1UKEA 1KO8A 4E09A 4E07A 1YVDA 3EASA 1FP6A 5D3QA 3AGPA 3AVWA 2ZRDA 3GD7A 4URUR 3SZRA 2O8CA 1TQ2A 4I81A 3EXAA 4DBLC 1W4CA 5EXPA 3BBPA 4MH0R 2FE4A 4US0R 4HLUA 1DS6A 4JLAA 1IN6A 3LW8A 1XCMA 2RGNC 1JEEA 4QBGB 4WIAA 1ZRHA 2LCFA 4QOSA 3Q3JB 3WYGA 3K0FB 4AKIA 4MUAA 3THYA 1G3QA 2V1UA 4MYCA 4FWTA 4R2HA 2QAGC 2JATA 3C14C 2GCOB 5DI3A 4KXFB 1JQJC 4M9QA 3TLXA 2P0EA 1R5OA 1XD2A 4O3MA 4M53A 1GAJA 1IJFA 4DZZA 1D8TA 3MSXA 3W8RA 4AWXA 3ZQJA 2YJTD 4DLRA 1EFUA 4A15A 4JJZA 1JI0A 3K0CA 1N6RA 1UBGA 4TMXA 5AUOB 2ZITA 3FTQA 3EZ2A 4YXWA 1ZC4A 1N5IA 2WKQA 1G4UR 3GJ4A 4HAYA 1CP2A 4IFBA 4QFMA 1CIPA 2ATVA 3BB3A 1VG9B 3DKPA 4PZLA 4L8GA 5EE3A 4PSAA 2WIBA 5F9HA 1NKTA 5K8UA 3ZD7A 4Q03A 1NN5A 1RJ9A 2ZVQX 3VR3A 3W5JA 4C7OB 3R9WA 3QXSA 4V0OA 1SKYB 2GCOA 2QMUA 1GNRA 1WBDA 1UDWA 5GJWC 1GNPA 1WDTA 3PJRA 2FN4A 3L8YA 3C16C 2JLQA 3QBVA 3GJ6A 2GZAA 2QA5A 4QL3A 1N0WA 4RZ2A 3KZ1E 4A9AA 4QC2A 2PBRA 2ZYTX 4KLZA 2ZI9A 3T1TA 1FQKA 2FZ4A 5FOXA 1NSTA 4PXAA 1P61B 1QF9A 3A4LA 2ZUBA 2J0QA 3OAAA 2BM0A 1Q44A 1DOAA 2F55A 5HE8A 4G1UC 3F8TA 4BFZA 4MRNA 1Q1QA 5HPYB 3X2SA 1S8FA 5FPTA 1TTTA 2VO1A 1ETUA 4ZDKA 2H7VA 2ZRFA 5KSYA 1B23P 5CB6A 3SQXA 3BK7A 3I5XA 3U7HB 3LNCA 1MR3F 2YWHA 3OIVA 1T0HB 3TK1A 3ZDQA 3DEFA 5L3SB 4B3XA 4WXPA 1TQDA 3LQRA 3FGNA 1GUAA 2AK3A 5E7IA 4IEEA 4JVNA 5L3QA 4UQOA 3FHCB 3NC0C 4UNSA 4B2LA 3GFTA 2A2ZA 2CVHA 2HT1A 3O8CA 3U4QA 4IDQA 2F43B 5FBQB 5FL3A 1EFHA 1FFHA 4Z54A 4ERNA 2DWOA 2VH5R 3A1WA 2J87A 1MRSA 4G5OA 4DLYA 2ZS8A 5CK5A 4NE2A 2FEOA 1KDRA 4NCHA 4BE7B 3FFAA 1SVOA 1DPFA 3O8BA 1VMAA 1EFRA 1GKIA 1YR6A 2QM7A 3ZZ0A 4M21A 3GLGB 2AXNA 4LPSA 4N0EA 5CYOA 3UATA 3TIFA 3B9PA 2HF8A 4OHWA 5UKDA 2UKDA 4RY2A 4AG5A 4CEIB 3NDBB 1YU9A 5JJLA 4MKIA 2HXYA 3LRPA 5EP4A 4D82A 1Q0UA 1W44A 4OKSA 4PSKA 3Q7QA 4LV8B 3MG9A 3UPUA 2BVNA 3ECCA 4OHXA 4TTQA 1SXJC 5DSZA 5JHGB 1T8UA 1MO6A 3HDTA 4BLSA 3GJ8A 2N46A 3EA5A 3IO3A 2CHGA 2F3TA 2VP6A 1JR3E 5FTNA 3SN6A 3TGPA 2ZE8A 3PUZA 3CR8A 4V03A 2BM1A 5AUNB 3KQLA 3PG5A 5G3YA 4E03A 6Q21A 2JJ1D 3S1AB 4MA4A 1P9NA 2HF9A 1Z0IA 4PO1A 5DHAA 1YJ5A 5GJCA 3KDSE 3BFVA 4EDHA 3RYTC 3RS5A 5BYKA 5EQTA 2LKCA 3BE4A 1XZQA 4PZZA 2QY9A 3CF2A 2RGGA 4CW7A 3TMKA 4BFUA 4A82A 2GEDA 3CF6R 1JEDA 3UMFA 1I2DA 1NVUQ 4Q21A 5EZ6B 2D7CA 2GETA 1KMHA 1Q21A 4HZUA 4KAXA 4DRZA 1ZNYA 4JT4A 1YRAA 4LHXA 4DB4A 4W9MC 4EPVA 2YHSA 1Z2CA 1PLLA 2ZSBA 1N5KA 4L4UA 5DISB 4FMDB 5FFMA 3MD0A 3KQUA 2ZUCA 5AJYA 5LD2C 2GKSA 3W3AA 1BYUA 1EXMA 4PHHA 2ZYVX 3EWAA 1OXXK 4B2PA 2R9VA 4BZQA 4JLDA 4YDHB 1U9IC 2ANBA 2BIFA 5IK2D 4IFEA 1VCOA 3THWB 1XPRA 4OHVA 2GJAA 3THWA 2FFBA 3QEJA 2J41A 1X1RA 4ZI3A 2JLWA 1Y3AA 1IOZA 3U3MA 1E2HA 1DE0A 3HPQA 4TYQA 4Q7JB 3FPAA 4YC7A 1J8YF 4ESVA 4JKYA 4URWR 4D2IA 3FYHA 3UG7A 2GJSA 5L3SA 3SHFA 2VP0A 1W49A 1TL7C 4WZAE 4NCKA 4C0HA 2DWPA 2YOFA 4MQBA 1ZD9A 5G53C 2ZS9A 1NBMA 2BMFA 4RFVA 3FMIA 4P4TA 2QROA 3RC8A 1E2DA 1VYTA 4IXNA 4R98A 3OFNA 4URYR 2CCGA 3P4YA 4Q9IA 3I72A 1I4TD 1OHHD 1XXHA 4PAMA 4BUJA 3K70D 4ZO4A 2DPXA 2DFNA 3RAPR 3KFVA 3BH6A 3LV8A 2P2LA 3EZFA 3AH8A 2ZEJA 3DO6A 1AS3A 1MV5A 4IKEA 1G8YA 4ZKEA 5B57C 5E7MA 1GRQA 1TEXA 2G0TA 2GJ9A 2P5TB 3MJRA 3HYTA 4PR0A 1XEXA 1M74A 1GP2A 1UM8A 3WYAA 3MUFA 1LFDB 3QKTA 3BJIC 1W36B 2J0SA 1GRNA 1U90A 2WWYA 1W1WA 4YMSA 5EXTA 4C0AC 1YQTA 2L0XA 1S3GA 1HYQA 2ODWA 1Z6YA 4UXIA 3T1QA 2J59A 1D2MA 3VR6A 3A1SA 3K9HA 4Q7LA 1C9KA 2B7CA 2I1VB 2OAP1 2O0HA 4Q4JA 5FPYA 1G8HA 2XZPA 1FTSA 3RLFA 3G0HA 2KWIA 1E69A 4NONA 1EFTA 3QKRA 1KOFA 1TU4A 2ORVA 1N25A 1FPMA 1EWRA 3B1ZA 2ZRNA 5C18A 5HZHA 3NVAA 2NZJA 2BMDA 3P1JA 4TSFA 1W0JA 5EJEA 1AS0A 2WSSD 2WWGA 3K0CC 4NKRA 5CM9C 2EYUA 2VA8A 2OESA 2BOVA 5TXGA 2QSYA 2RH5A 4Q1DA 3M6AA 2HLDA 4WOPA 4ZDIA 3IHLA 3HU3A 4QGHA 3IQXA 4D81A 3F0TA 4B43A 2G77B 1NMXA 2HLDD 1A82A 5TARA 1F2TA 2Z4RA 2ZI7A 2W2TA 1BMFD 3OIYA 4OK6A 4OQLA 5KPDA 4EAQA 2IC5A 2G9NA 4NMMA 4MGIR 4QBIA 1UAAA 1XD2B 4HAWA 3I32A 4Z8YA 3MMPA 2JJ8A 1KO5A 1X8KA 2FZLA 3ONWA 1VHTA 2RGCA 3JVVA 3QF4B 3R8CA 3AVUA 3IHWA 3CBQA 2WOOA 4K8OA 4TYPA 1IXRC 4C0BA 4UXJA 4ZCMA 1T5IA 1E0SA 1N6OA 1ZM7A 4MKFA 1RYHA 2DFLA 4LJ7A 1KAGA 1YZKA 5DO9A 4QXAA 1OYYA 2FFQA 2OCYC 1E2FA 1VECA 2VQSA 2CEAA 2ZE7A 1E96A 3EIQA 4D0GA 5K8IA 5GVRA 1C1YA 2DHRA 1XF9A 2EFEB 2KSQA 3X1WA 5CDFE 2XZLA 3LDAA 3OEED 4LYAA 4YDSA 1CXZA 3X1YA 1JJVA 4PHGA 1L4UA 4MDEA 3B78A 3K9NA 5KYKA 1IN7A 3B82A 2JJ1A 4GMDA 1OT3A 3LLUA 4PHFA 3WP1B 2HYIC 2HXSA 3KJEA 4L16A 1X8LA 4WAUA 2RKOA 1E2NA 2PEZA 2Q9AA 3FKSA 1G19A 4LK2A 4QHTA 1HE1C 3WHLA 4BZXA 3RRMA 2F6RA 4RD2A 2VTKA 2ERYA 4N3NA 2ZSFA 2ZRBA 4JLNA 4DLWA 5B30A 5FUWA 1QG4A 3SYLA 3FMOB 4A6PA 3FE2A 1RYFA 1W4AA 4HDCA 3NBYC 1E9SA 4BFVA 3GLIA 1GM5A 2RGNA 4AI6A 4GT1A 4GL2A 1RRFA 5IDVA 1AZSC 4HATA 4CEJA 2BJWA 2QBYB 4CDGA 3ZQ6A 3H86A 5EP3A 5J40A 4IJMA 1KGDA 3LBHA 1G7CA 4CRWB 2ODEA 4C0QC 2Q21A 4IVPA 2VSFA 1E9RA 2W0SA 2REXB 2ZSEA 2QORA 1NIPA 2F43A 3V00A 3QIAA 4LC0A 2QN6A 4I1SA 3KQNA 3W6OA 3KB1A 4Z8XA 2BDTA 4LYFA 521PA 5L3QB 3E1SA 4JVMA 4PQFA 1IY1A 1COWA 1QDEA 3GP8A 2GXSA 4HI0E 4KBGA 3W34A 3UG6A 5JRJA 1OXSC 3LW7A 4C0SA 1EX7A 4NTZA 5CDFA 4QGAA 1KSFX 2E87A 1KNQA 2IYRA 1N6HA 1TX4B 1Q3HA 3FKSD 3KX2A 1YKSA 4KFSA 4LYHA 4RCYA 3RRNA 1YZNA 4OJKA 2NIPA 2BKUA 4UXHA 4EPTA 2ONKA 3DZDA 5BN5A 3RC3A 2R65A 4Q4HB 1NN0A 2Q9CA 2ZI4A 1IJEA 4D6PA 2DY1A 4XH9B 4D0NA 4Q7MB 1EG7A 3QXCA 3IDQA 1DAHA 1FMLA 2WPDD 4GOJA 4B33A 4IDHA 4LGMA 3LX8A 3RSOA 3TAHA 1FUKA 5G41A 5FOUA 2J7KA 1S0UA 1GFIA 2JLRA 3PV0A 1GOTA 1BOFA 1RFLA 4UJ3A 1QHYA 3SYKA 4C7OA 1WE2A 2KBFA 1U2RA 4KO8A 3QBTA 2XNSA 3EIEA 1NL3A 1CKEA 3REFA 2EW1A 2MSEB 1T91A 4C3ZA 1G6HA 2R6GA 1KK1A 2OBLA 2OV2A 4A92A 2QE7A 3C7KA 4H1UA 1GILA 3WXMA 3CRRA 1AM4D 4WA7A 1FP7A 5JWRA 5LPNA 3GLFA 2QMHA 2BHRA 4ZCLA 1Z5ZA 2O8DB 4TL9A 1J70A 3KXLA 4B35A 2A5GA 3NC1C 3SHWA 1CRPA 2PJZA 4EPXA 2CK3A 3TJZA 1E3MA 1TPZA 3U60B 3EPLA 1G8PA 3IQWA 3W6PA 2NZ8A 2V6IA 4OL0A 3EIHA 1P60A 1KDTA 3WBJA 4NYIQ 1X3SA 2GXUA 3UANA 2WWHA 3OEEA 1EX6A 3R9IA 4DJTA 2W0MA 2O8DA 3NH6A 2G83A 2B7BA 2BKEA 2RAPA 3FB4A 4KCGA 4KVGA 5CJPA 5JBQA 1ZNZA 1NP6A 5J4HA 1XWIA 5HCNA 1RRGA 4HUQA 1DVRA 3LBNA 2ANCA 4G5QA 4NBSA 3TUIC 4CEJB 3EZ7A 4GZMA 1AIPA 4Q1EA 4XVRA 3PXGA 2B8WA 3BC1A 1XXHE 4NYJR 1M7BA 2C03A 2GTPA 2QG6A 4JLPA 3UMRA 3VMFA 3FFBA 1G8GA 2C9CA 4X8MA 1GDDA 1UDXA 3BH0A 4KI0A 3ICQB 3L0SA 5DI9A 1NBME 1R8SA 4FIDA 2BMJA 5BN4A 4C4PA 4B3CA 5C1BA 1PV4A 3AF0A 2JLVA 2DCUA 2QZ4A 2Y8EA 5JWHA 4JBXA 3AM1A 2GF0A 2NO9A 1TNDA 2OUKA 2Z83A 5BQ5A 3T15A 3T61A 1GZSA 2MMCA 2FMXA 5KNDA 4Q01A 5HZKA 3THXB 3CRMA 4OQXA 5C2JB 3I61A 4KVAA 1N0UA 2WVJA 1G3MA 2EFCB 1U81A 4HB4A 4RZ3A 1NF3A 4ZIRB 3Q8XB 4TYWA 1AA9A 1UFQA 2G88A 5KSPA 2DR3A 1G3RA 3GEEA 4O25A 4A4DA 2QGNA 2IXGA 4UNNA 3VQTA 2JJ2D 2GZHA 2JIZA 1NJFA 2ZJOA 4EIWA 1Z63A 1WCV1 1ODFA 2VBCA 3K09C 1TQ4A 4B73A 2ZM5A 2PJRA 5A4JA 1HE8B 2HCJB 4HDQB 5IHPA 1G5TA 4LRWA 3CX8A 1QHHA 2F9LA 5KPJA 2ZETA 3O8DA 3ADCA 3TRFA 4DVGA 1CLUA 5KNCA 4JSTA 4PPGA 1ZC3A 2QPTA 5JI3E 2C98A 4QJ4A 4LHYA 2OEPA 1OXVA 3K0FA 3QXHA 4A1FA 4P31A 3I4LA 4V0ME 3UK6A 4V0KA 1XMJA 3IPXA 5JCPA 5JI2E 4DCNA 4CEHA 4Y0AA 2P67A 1OKKA 121PA 4LBWA 4Q4JB 2ZRMA 1IN5A 4OHYA 1WXQA 1E2IA 1CS4C 3RWMB 2YVUA 3M4YA 4U7DA 1FW6A 2VHCA 1NVXQ 1CRQA 2WJYA 1DAKA 3NWJA 3H84A 3QXXA 1QRAA 4U5XA 2OHFA 4MRSA 2ZRHA 2ZROA 1IONA 4XD7D 2H16A 2P6UA 3RHFA 2JDID 4B6EA 1E2PA 1LW7A 3RS3A 3AF2A 4JYBA 2IEYA 3QKSA 3NEJA 4UKDA 2QGZA 3OF5A 3U3KA 2I4IA 4NCNA 3HU1A 5IT5A 3R20A 1SKQA 1OB2A 3QPVA 1P5ZB 5B64A 1GG2A 4IOMA 1FQJA 2IK8A 2A30A 3A37A 2RB4A 3QF7A 1R0YA 2JGNA 2XNDD 2MSCB 2D2FA 1NN3A 421PA 1NN1A 1PUJA 2OM2A 1GKUB 1ZD1A 1VCIA 2FGJA 5CIQA 2VHTA 4EJSA 1CTQA 2W6IA 4Q1FA 1FX0B 2QM8A 1KO7A 3HWSA 3SI7A 4JBYA 1U98A 1XJQA 4DCUA 2PX3A 1XNJA 1TF7A 3D3QA 1OH6A 2FPKA 3DOEA 4PPQA 4AG6A 3K70B 2GA8A 2WAYA 5FH9A 5EXSA 3RS4A 1QVAA 1RE0A 1GNQA 5IRCD 1ZIOA 1SQ5A 1M6NA 3A36A 2QBYA 3L0IB 3GQBA 2FWRA 4R9UC 1S2MA 3CNLA 2WKRA 1R0ZA 5AR1A 4LSGA 2FGKA 2NO1A 3GLFE 2RMKA 3WMEA 2ZYWX 4FMBB 3UKDA 3ZLJA 3SS8A 3THXA 4LY6A 4EPYA 4M0LA 2DWQA 4OI0A 4MYHA 4B76A 1JAHA 5EP2A 1W46A 3CB4A 2CVFA 3L8ZA 3T1OA 3B1VA 1E4YA 4TTPA 1OIXA 2BV3A 3LA6A 2CHQA 3H0KA 3U3OA 1LB1B 2IYXA 4CF7A 4JJKA 1FTNA 3SOPA 1OH8A 1KI8A 3BORA 4RD0A 1NLZA 2RGAA 2O8EA 2QSZA 3FKQA 3MJHA 2QUZA 3TKLA 4B2IA 3MWYW 2VHJA 1RPZA 1TUEA 2BCJQ 1OXTA 4QJ3A 1OSNA 4E5UA 2VIIA 3EPJA 4DKXA 2C95A 3A1UA 4L5BA 3SJAA 4TT3D 4YMWA 2P5SA 5FTJA 4AIIA 3F5FA 1CJUC 1W7AA 2DFKB 5J4VA 1Q1BA 2ZJ5A 2VP2A 2IBMA 4XSGA 2D2EA 3B5JA 1OLOA 4ON9A 1II8B 3TW4A 2V7QD 2CE7A 4I1VA 2GRJA 2WJVA 1XTSA 4EFMA 3BXZA 3RRYA 4A2QA 4BQSA 1WP9A 2OCBA 4M1OA 1JXOA 1D5CA 3BFKA 3CO5A 3LWNA 4HDOB 4JL6A 4PPFA 4DC9A 5JEEA 4LZZA 4ABYA 3U7FB 3O47A 1OV4A 3T5DA 2QP4A 1E1QA 1JJ7A 1A5TA 2A78A 4B48A 3KTAB 5FBWB 3I3SR 3RABA 4D80A 4X8LA 3ASZA 2FG5A 3ZVMA 5HR5A 3KUCA 1VYUA 2I3BA 5JCZA 1QG2A 3IKJA 1QHXA 5IK2A 1G9XA 2QAJA 1ESNA 2WIAA 5FR1A 1KHTA 4CT4B 1FZQA 1KNXA 1S4QA 2ZRPA 5EE1A 1KIMA 3D6TB 4PANA 4PAOA 1XEWX 1MRNA 1AGRA 4HB2A 2GWHA 1P73A 4RD1A 3K9GA 4NH0A 3A58B 4KSCA 1KYIA 5CYPA 4BFYA 4XWOA 4DHEA 3GLIE 1OH5A 1RRPA 1XTIA 2AD5A 1JALA 1WBBA 2ZJ2A 1K5GA 1KMHB 2XSZD 3LFUA 4B3DA 5GJBA 3RS2A 3QEOA 1XTJA 4URVR 3AVYA 2CMKA 3MAAC 1M8PA 4L9WA 4M1SA 4LI0A 5FPHA 4JL5A 4GBMA 4GSYA 3B6EA 4TL7A 4F38A 3DM9B 4F4CA 1ZBDA 3NH9A 1VCMA 3OAAD 1Z0KA 2AWOA 1W0KD 2CXXA 2V4ZA 3C5HA 3KFXA 1XCGB 3AB3A 5FBVB 1S1MA 1OH7A 2OLJA 1KZGB 1GVNB 4QG7A 3RS0A 2GNOA 1Z6AA 1XB2A 3QF4A 1KMQA 4EPRA 2RHDA 2ECKA 4DWJA 3BAFA 1ZJ6A 4A2WA 2ZS7A 1F2UB 2ZE5A 4KFUA 5G3ZA 3RWOA 5K8LA 3AVOA 3V4FA 2QPOA 1Z47A 2XNDA 2OO7A 2ODNA 4G01B 1PUIA 1SVLA 3ZVRA 3GEIA 3LH5A 3KQHA 3U61B 2A9KA 3BIFA 4I4LA 4NCIA 3LY5A 3VR5A 1P9RA 4I1OA 5JEDA 1K5DA 2IYWA 5E7JA 3OHMA 4TLBA 1JR3D 1OXUA 3VHXA 1DAGA 2H1LA 5A5GA 4JYCA 2FSFA 3U44A 1HY3A 2W6JA 2V8OA 2ZRIA 4JSYA 1BO6A 4B34A 3AKEA 2YINC 4G5GA 1OFIA 1VIAA 2CLSA 3IILA 1U8YA 5JSZA 3QY0A 3B85A 1E2EA 4LC1A 4P4SB 1J99A 2PLFA 1Y63A 2GILA 5H70A 3EZ6A 1J2JA 3H1TA 4KU4A 4B75A 1W36D 3DL0A 3E5HA 3KL4A 1G8FA 3CPEA 1XFAA 2NO6A 4ZKDA 1S9DA 3KB2A 2IYLD 5FI0B 2WWIA 4YQFA 2N1BA 4M1MA 2O8EB 5H68A 4JZKA 3GPLA 2YOGA 3DZ8A 4Q9HA 2HJVA 1J90A 4A0FA 2G1KA 4PSVA 2XTNA 1E9DA 1LS6A 1Z6XA 2WZQA 3R7WA 4F4JA 4Q1CA 4V02A 5JJKA 3QE0A 2QQ0A 4UNPA 1CBUA 2DBYA 1G291 4Q1AA 1W0JD 1HURA 5JZVA 1U0LA 1MO3A 4NHOA 2JA1A 5KHOC 4DLSA 3S1AA 4U02A 4GDFA 4KODA 4ZCIA 2XOKA 5L8VA 4JL8A 1QHIA 1Q12A 3TBKA 5EUQB 3HU2A 3M1IA 4V0NA 1KK2A 1XD9A 4IRUB 4LDJA 2O8BB 4XSHA 2KJQA 3MRSA 1F5NA 4EJSC 1JNYA 2LKDA 4LX0A 3TR5A 5FUVA 3ZZTA 4TMVA 4NCJA 2BCGY 4JMPA 2PZEA 4PAQA 4RFSB 2PCLA 1BMFA 3THOA 4F93B 1G7TA 2ZRCA 3HR7A 4H9GA 3HPRA 3EX7C 1E9CA 1HH4A 1UKZA 3CIOA 4L15A 2C9YA 3EZ9A 4NYMQ 4RZXA 1E98A 2F1RA 5E4FA 1R5BA 3K9LA 4LV5B 3LO5A 3JVUA 1OFUX 3FVQA 2O52A 2FEMA 4PHTA 3P26A 4ARZA 5CITA 2WMOB 3AEZA 3EC1A 5KSOA 1OFHA 1YR9A 3QI2A 3CONA 4DEXA 4D25A 1MKYA 2N42A 3RS7A 1UEJA 4D4MA 3PVSA 3SJCA 2XB2A 2C2HA 1CJVC 4F4IA 4YMVA 2OXRA 5EUMA 4AY2A 2MSDB 3BRWD 3AGQA 1G3IA 1JB1A 4Y0VA 3CKLA 4TLEA 2PZFA 1UEIA 821PA 2GXAA 3AP3A 2F1HA 2RGEA 3WRXC 5GADl 3AF4A 1E99A 1VTKA 2QI9C 3PR1A 4II7A 3RNLA 4IDNA 2Z4SA 3DVLA 2WOJA 4YMUA 5KSZA 1I2MA 3VNVA 1FMJA 4OQMA 1CEEA 4OI2A 2A7QA 3IEUA 3AQ4A 1Z6TA 3B2EA 1HQYE 3FHOA 3G5UA 4AYXA 4RD6A 1NI3A 1Z3IX 2HCBA 3ASYA 1X1SA 5C4MA 4OI1A 2FFHA 2ZU0C 3D8BA 5D3MA 4LJ9A 2WJHA 2YOHA 4BLQA 2GVZC 1IXZA 1ANKA 2RGDA 2XSZA 2J0UB 2OBMA 1ZM9A 4BRWA 1HUQA 1CULC 1CU1A 1VG0B 2GXQA 4MRVA 4JVSB 5E95A 4HZIA 3AUYA 3TQCA 4FXPA 2D74A 5JLJA 3T06B 1N6IA 4A8JC 1LTQA 2EYQA 2EU8A 4R7ZA 3VTKA 2Q9BA 1M7GA 3GJ0A 2ZJAA 3CWZA 1NLYA 2UZ3A 4RKFA 3OIUA 1HV8A 4B3FX 1LVGA 1Q1EA 1XX6A 3U4QB 4O2RA 1D9ZA 2R6AA 1JR3A 1OPXA 2GEUA 2XJ4A 4GPTA 2R6CA 2J0UA 3UIEA 2OCAA 3U3RA 4DDUA 2WTUA 2YC4C 4JLKA 4LJYA 1W2GA 4LBYA 4A0HA 2D06A 3A4NA 4OK5A 3PEWA 4AC9A 4OI4A 1E0AA 5DNYB 3W5IA 1W5SA 2VLIA 4B6FA 1TQ6A 1SZPA 1P62B 4NL4H 3V9PA 2PX0A 2D62A 4NDZA 3X1XA 4QKQA 4JLBA 4EQ6A 1ZCBA 3T1VA 4RFSA 2H18A 4PO8A 5CJ2A 1NBMD 3I92A 4Z51A 2ZXUA 1E79A 5TB5A 1P6XA 2WSMA 4DUGD 3SFZA 2G3YA 4BECA 1Z28A 4IOLA 4KBFA 1L8QA 4IVQA 1OHHA 4DLUA 3QKUA 3TUJC 4RZUA 3BERA 4PO9A 2HV8A 2WHXA 3OZXA 4P4SA 4AKHA 1UKYA 1CJTC 3B1WA 2BC9A 1SULA 4ARZB 4EUNA 5TMPA 3RANA 3EWSA 1M2OB 2OE2A 2B6HA 1E0JA 1WQ1R 4HLUC 1MH1A 4M9ZA 2HYDA 2AK2A 5TV2A 4ZPXA 4IDPA 4TSFD 1XCPA 2CLCX 1KI4A 2FPLA 1DAIA 1KZ7B 2FSGA 4FWIB 1DARA 3BH7A 3U3JA 1E0KA 5EE9A 1Z0DA 2C77A 5FBLB 3ZS9A 4PQYA 4Q47A 4Z1MD 2QQEA 2WICA 2X77A 5KTYA 4BEBA 5KNBA 1HT1E 4AKEA 1ZU4A 1ELOA 4W7SA 5FOWA 4HAZA 1P2TA 4Z1MA 1NG1A 1KAOA 3N70A 5C46F 5FPKA 1KK0A 4LJ6A 4URXR 2GAAA 2OT3B 3SBDA 5HKKD 2IYQA 2IHBA 4EFNA 4IOJA 4QNRA 2O8FA 1FUUA 2QTHA 1UPTA 1DG3A 2V3CC 3LVRE 1UADA 5J5CA 1WB9A 1P3JA 4OK3A 4BLTA 1K6MA 1ZIPA 2CE2X 2CBZA 1A7JA 2AFIE 2ZJBA 2FV8A 3Q5EA 3CX6A 2XXAB 5FOSA 5KU1A 4NYJQ 2J7PD 1F6BA 1F2TB 1E2GA 2GJKA 2F3RA 3H2YA 4C30A 3IEVA 4W5WA 1IQPA 1GWNA 3GLHE 3QXJA 1KJWA 3C5CA 1G1MA 4PTLA 1F3OA 1YE8A 3KJIA 3L82B 2F9MA 1OJLA 2IWHA 4OQFA 4KYUA 1N3BA 2WSSA 2KI5A 1FOEB 5JMTA 5K8TA 4A8JA 4LPKA 5JECA 1YR7A 3K70C 2CNWD 3OE7A 3SU8A 2IS4A 3DKVA 3N2EA 4M22A 2OFWA 5BYJA 2DB3A 3KKMA 2CCKA 3SNHA 1C4OA 4DLXA 1CF4A 2EFHB 3B1XA 1TU3A 1SKYE 5FTMA 3UMSA 2X19A 4Q9LA 2FFAA 4IOKA 3NIBA 1SXJA 3L43A 1DAFA 1NIJA 3GLIB 2PMDA 1E2JA 1E1QD 3LLMA 2FF7A 4DLTA 1CR2A 1GL7A 2LWIA 1P2VA 3QPUA 1A2BA 1NMZA 4G0NA 1U8AA 4HUQB 4K46A 3VNUA 5F2EA 3HP1A 3FOZA 5DIFA 1YZLA 1IN4A 4US1R 1UF9A 1QZXA 2PMKA 1D2NA 5G40A 3R7WB 1AN0A 1NLFA 2H17A 621PA 2ZRLA 2AWNA 2AD1A 3SJZA 2RGXA 3F3YA 3PUXA 4PC3A 1E9AA 2NGRA 5JRZA 4D4JA 3QG5A 1EESA 3K53A 3CWQA 2GBLC 4EKDA 5JWOA 1R5NA 1Z0AA 3SBEA 1E9BA 4Q9JA 3W8NA 3KUDA 2BWJA 3T35A 3VKGA 2QU8A 4Q48A 1P75A 2ERXA 3V4RA 2CL7X 2EQBA 2FU5C 4C0LA 2R44A 3AP2A 2RHMA 5JSZB 4GFDA 4FD2A 5CM8B 3B9QA 1W5TA 5J47A 4MGYR 1JBKA 3JZAA 5LD2B 4ESHA 4ASUD 2IS2A 4PC6A 2Z0MA 4Q1BA 4KJZA 2QP3A 2WJGA 3L2OB 5DGXA 4M1KA 3AP1A 4I1UA 4BWYA 3SE0A 4B74A 4QRHA 2JLUA 1LS1A 1AQUA 4D0LB 1Q22A 3HR8A 4HZUB 4LJ5A 3ZS8A 3TR0A 1KO1A 1E1RA 1S3SA 5LB4A 4FI3C 5J4YA 5KUTA 1NSFA 5ELXA 1W2HA 1XMIA 4I99A 2IXFA 1G64A 2H5EA 3DMDA 4HEJA 4TQAA 5AJWA 1O3YA 4US2R 1FX0A 1H8EA 1COWD 1KSJA 4K81B 1Q3TA 3VHLB 3MCAA 2O8FB 5ANRB 1XTRA 2ZANA 4NZYA 3QPWA 2XXAA 2ORIA 3KKQA 2WJJA 1E9FA 1X86B 2V54A 3W3ZB 3X1DA 2YKGA 3NBFA 1DELA 4TTRA 2YYZA 1WRBA 1JR6A 1V5WA 3QVUA 3TVTA 3R8FA 4XVUA 5J4LA 4MYUA 1AS2A 2HJGA 3QKSB 4GOXA 3AV0B 4BRUA 4A8JB 2E9SA 4AK9A 2QTVB 1HQCA 3PENA 3D31A 2VHUA 3I8SA 4QBHA 2F1IA 3A4MA 2PCJA 3NEYA 4S35A 2ZSAA 4KFTA 1Z06A 4FMDF 4QNMA 3VKHA 2RGBA 4LBVA 3KQKA 4ILEA 4LHVA 2CJWB 5KDDA 2FDCA 1G7RA 3UXMA 4FMCF 5EP1A 1H65A 1HA3A 1SHKA 1XMSA 5DLQC 1OKKD 3U7EB 3VU9A 2DFTA 1W36C 1CR1A 4XOIA 4D4KA 3GLGE 2NMVA 2GHIA 2WBLC 3IIJA 4YMTA 2ZI3A 5AJXA 221PA 4RKEA 3QSYA 4DIDA 1BH2A 3CX7A 1CR0A 2C04A 4C2TA 2QTFA 4GMXA 4MUBA 4TYNA 3U44B 5KO2A 2QENA 5KOYA 2JAQA 1W47A 4G5SA 4C0JA 4RJLA 4X8HA 4GP6A 2ZIAA 2Q0HA 4TL6A 1N6PA 4TMTA 1AZTA 1S1CA 1QBKC 1ZMXA 3BD9A 4LJ4A 5H8WA 4LJ8A 3K0AB 5D3MB 2CDNA 4TLAA 3CRQA 4A0GA 3KKPA 1W4RA 4GNKA 5J4KA 3K0AA 2ZREA 1AJEA 1Q20A 2ZAOA 5HCIA 1R2QA 4H1VA 1DAMA 4HAXA 1E2QA 2WV9A 5P21A 4DB2A 2J5XA 5GVSA 3NBXX 4IVRA 4Q18A 1T5LA 1G21E 2IYTA 3RDPA 3CR7A 4PFSA 1XPUA 1H8HA 3AKDA 3QUSA 4DSNA 4LHWA 3U2QA 4TMKA 1KDPA 1QHHB 3AKYA 4OQNA 2WM9B 3LBIA 2K5UA 3AVPA 1UBEA 2CL0X 1CR4A 3CLVA 4NP6A 1XEXB 3LQQA 2B92A 4PPNA 4DCSA 2D7DA 1YZUA 3AKCA 4MDFA 1XXHB 2NO0A 2VRWA 2BBOA 2ZRJA 1N5LA 1GITA 3I62A 1ZCAA 4IW3B 4MKHA 1XPOA 4KFRA 1VDZA 4HB3A 4WZBE 1LF5A 3SC3A 2KE5A 4M8NE 3KTAA 3GMTA 2VL7A 2ZE6A 4HLDA 4UNQA 4F92B 3KJHA 1JXMA 1OIWA 3B8HA 3B13B 1B0UA 1Z29A 2GJ8A 2ZI5A 4TT3A 2EFGA 3PUWA 3T5GA 2GBLA 4CYMA 3DHWC 2GK6A 4TQUS 5FUYA 3ZVNA 2WWXA 4M1TA 1US8B 2PT5A 3LXRA 1U99A 1NVVQ 1YZGA 2CL6X 4EFLA 4XIGS 1II8A 1OF1A 2X2FA 1PLKA 1D9XA 1GTVA 1TAGA 3N5CA 2NQ2C 4P0TA 4TMZA 2ONJA 1J7KA 5DI3B 1ZM4A 3ADKA 1CJKC 1KK3A 2NOAA 3TW8B 4A6XA 1K8RA 2BMEA 3WNCA 4POAA 2JIZD 4QHYA 2IYSA 3GFOA 4O2LA 2NPIA 2QP9X 1N5JA 3ZJYA 2A5FA 5FL7A 3FWYA 1E1RD 2ZRGA 1E9EA 2OG2A 3AF3A 2G1JA 3P27A 3GJ3A 3SFVA 2PH1A 1ZINA 4R2IA 2C9OA 4DIEA 5FL7D 1VHLA 1QHSA 4G3XA 1ZNXA 2H8KA 4TLDA 4Q4AA 1MOZA 2GF9A 1P4SA 1KKMA 2AX4A 2ZR9A 2IHYA 3K0SA 2AKYA 4IEIA 2JJ2A 1P9WA 2ZRAA 2FOLA 5CIWA 3ZD6A 3PEYA 2P3SA 2CLDX 2ZI6A 1EFCA 2NO7A 5CB8A 4P33A 1A2KC 3D7MA 1XJ0A 3NHAA 2ZU6A 1U9IA 1X8JA 1KI6A 5SZKB 3P32A 3K1JA 2C8VA 1KJYA 2W2XA 1ZNWA 3C41J 2W6ID 3PQCA 1G17A 3IPYA 1Z83A 3CZPA 4LCBA 1NKSA 2VPPA 1T6NA 3N2IA 4XD7A 3K8YA 4MITA 2ZTSA 2J3EA 4FN5A 3Q5DA 4F7WA 3WP0A 4HB0A 1YZTA 2ASEA 3PIRA 4P3YA 2V9PA 3A1TA 3NG1A 3OIWA 4OYHA 3IGFA 3LAWA 1HTWA 1QHNA 3LD9A 5BW8A 1D6JA 3PUYA 4QGGA 2Q6TA 4BASA 1T3SA 1DO0A 4DSTA 4YXWD 1KO4A 2W00A 3ZH9B 4PX9A 2GVDC 2HEIA 1RVDA 5KDLA 3O8RA 4QBFA 4TN1A 3IIKA 3MGCA 1ZW6A 3C4JA 3KKOA 1G6OA 2QAGB 2VHQA 1F60A 3JZMA 4B44A 3I8XA 1XZPA 2PZGA 3P4XA 1Z6GA 1RKBA 1NY6A 1ZYUA 5FTKA 5BN3A 1II9A 5FUXA 3SEAA 2XTZA 4GRAA 4PC7A 1Z07A 4W5HA 1G4AE 3LVQE 1T8TA 1II0A 4Q5IA 2QNRA 4JKIA 1Z22A 3U5ZB 1Q1ZA 1SVMA 3SDZA 1EWQA 2IS6A 3AVVA 1TEVA 2XOKD 4M1YA 5EE0A 2YC2C 4B47A 3Q9LA 2ZPTX 4TL8A 4A0RA 3GLGA 1KSHA 1XP8A 4AKGA 1YR8A 5TDHA 1AKYA 3Q85A 5DYGA 1DTSA 2GESA 3IBYA 1R7RA 1PLJA 1OYWA 2KB0A 2PT7A 2IUSA 2BEJA 3EG5A 2AN9A 4QJ5A 2IA5A 3AVXA 3TQFA 1M1YE 1MT0A 4WZ6A 4BLOA 4GP7A 5DN6D 3HYRA 1BKDR 2O0JA 3WY9A 3R9XA 1J8MF 4OJQA 4ZDJA 3QKRB 2EWWA 2Q3MA 3NXSA 2RCNA 1TF5A 4WBSA 1OE0A 3L0OA 2R8RA 4KITB 2OAQ1 4NYMR 4XTCS 3WNBA 3VR4A 1G18A 1M7HA 4CEHB 1T3LA 2ZSDA 4JIMA 1LNZA 2ZR0A 4PC2A 4EPWA 3KXIA 5BWMA 3UWKA 4P32A 4RSGA 3TH5A 3GCGA 2VYFA 4Q4HA 2FJUA 4PQRA 4DDWA 1ZM3A 1Z2AA 2ZJZA 2O0KA 4Q9KA 2IL1A 4GZLA 1VG1A 4DSOA 2Z5FA 3WMFA 2A5DA 2ZR7A 4BFWA 2CCJA 3GJ7A 4GI7A 3ZZUA 1CJMA 2IXEA 4L9SA 3PEUA 1Z08A 1NRJB 3NTUA 2JLYA 2C78A 2Q3FA 1AKEA 2QPAA 2UZIR 2W58A 5H1YA 2ZJYA 3I5YA 2VP5A 4MKGA 2O8CB 3ND9A 3TE6A 4BFSA 2OZEA 1L7VC 1Q57A 1VIYA 3NBZC 2Z6VA 4DXAA 1AQYA 1KI6B 1KJZA 3OFND 3PITA 1E32A 1ZUNB 3LXXA 3I73A 3TSOA 4NYIR 1VKJA 2R6DA 4CZ2A 4XJXA 4D26A 2JCSA 1P2UA 3B7GA 3FMPB 1L2TA 1VPLA 3GEHA 4JVLA 3ND8A 2EWVA 3BB4A 3QQ5A 5F3WB 1T3HA 4LOAA 1N6LA 4D4LA 3TVDA 4B3GA 2FH5B 1G16A 2V7QA 4MRPA 5IF9A 1R10A 2AR7A 1ONBA 3C8UA 1DAEA 3QOFA 5JHHB 1W4BA 1VYVA 3W90A 5KDOA 2H92A 2PL3A 4AURA 2OLKA 2OCPA 1KTVA 2GCPA 3RRZA 3PUVA 2WWFA 4AYWA 4BPBA 1ZP6A 1WMSA 2GAOA 1XTKA 3CW2A 4JBWA 5F9FA 3KKNA 5GJVC 5TY0A 2IW3A 1P7CA 2ZRKA 1BIFA 3QVVA 5C4GB 4M1WA 2F7SA 1HEIA 1KI2A 2O5VA 4C9BA 1SVKA 1KKLA 3DMNA 3GJXC 4TMWA 4C2UA 1E6CA 4JLOA 2YV5A 1E2LA 4HYYA 3DDCA 4TYYA 5DHFA 4B32A 2V1XA 3ZVLA 3WBKA 2IT1A 5SZHB 2C5LA 1ESMA 1SXJE 2C99A 3OEHD 1SVSA 3PCRB 1LY1A 1XJCA 3U6BA 1GRRA 4DLVA 1U8ZA 1P72A 2H57A 3OEHA 3TNFA 4BZPA 1XD8A 2V6JA 1NNEA 1DO2A 1VCNA 4DCVA 2WPDA 5LB2A 4N0DA 5AJZA 2FX3A 1GSIA 1YZQA 2IYVA 3QNUA 4RD4A 2IF0A 1HT2E 3FHTA 2EFDB 1M34E 1XBTA 4DDVA 1NVWQ 1DEKA 4AD8A 4KHZA 1WA5A 5AWFC 2W6JD 1R0XA 4GOKA 4DT1A 5JS7A 1GL6A 1UKVY 3PFIA 4MGZR 4MRRA 4ZIRA 3W9YA 4BFXA 2OFOA 4C0KA 1A1VA 2AKAB 3GLHA 2WKPA 2B8TA 1Z0FA 3CNOA 2CK3D 3ZYCA 4X8OA 4O0MA 3BS4A 1KI3A 3AVTA 2YWGA 4KSBA 2NPFA 4XWAA 1YHNA 1G41A 3H4MA 3IO5A 3T12A 1F48A 4M9SA 3ADDA 2ZQ5A 3ICEA 2GEVA 1KI9A 2QE7D 1IAQA 5DH9A 3VX3A 4NPHA 1BYIA 4WXRA 3IIMA 1IXSB 2XAUA 1OIVA 2BBSA 4G5RA 4U00A 2IYYA 2P6NA 3G82C 3L0PA 2J46A 3A1VA 3TSZA 3SJBA 5F98A 1MO5A 4FW9A 3OESA 4DDTA 2OXCA 2FNAA 4Q4LA 1WF3A 1IY0A 2X1VA 3THYB 1N6KA 1VG8A 1NY5A 1RC8A 1O87A 3WYFA 1JQLB 4Q00A 4XWKA 3ADBA 4BLRA 1SVIA 4IHQA 2IWRA 5DN6A 1KSGA 4MGKR 2A3RA 2NG1A 1PJRA 3WNDA 4AYTA 5EZ5A 1EFRD 3EA0A 3WMGA 2KBEA 4BLPA 4YLGA 3BB1A 2IUTA 4EJSB 5FBRB 5B58C 3T34A 2I1QA 1G3UA 4ZDWA 3K0EA 4W5JA 3KJGA 4M2LA 2EVWX 3GFPA 1FL9A 2QT1A 1IY2A 2AXPA 4KV9A 2E1RA 4FMCB 4V0MA 3EC2A 4HLQB 1PVOA 4LBZA 1E79D 1JECA 4TLCA 1XDBA 4LWZA 4QGFA 4S2EA 3C15C 1IM2A 4WVFA 2C96A 5M04A 3CZQA 2TMKA 4FCWA 3QJYA 1KY2A 2B21A 4JLMA 2IYUA 2OILA 3CH5A 2JLZA 3A6PC 3RVBA 2VP9A 4F91B 1R6BX 4HSEA 3MWJA 4XTRA 1S9HA 3ZGXA 5FOVA 2W2VA 2QEQA 1DADA 1MABB 4CIDA 2FSIA 1GL9B 1F2UA 4NU0A 4A36A 5HE9A 5BXQC 2W83A 1RIFA 3I1FA 4A2PA 2F1JA 1N2CE 3CM0A 4CT5A 1UBFA 2R2AA 2JLSA 1T4GA 2QRZA 8OHMA 2IS1A 3EW9A 3ZIAD 4RVCA 4JLVA 5FR2A 1LV7A 4OBEA 4HUTA 5DYIA 3LX5A 4M4SA 4M9XA 3P20A 3TAUA 2XITA 1S96A 4IXMA 4TQ9A 2OSBA 2ORWA 1JPNA 1G5RA 2QMOA 3CPJB 1E4VA 2XJ9A 4Q66C 2R62A 5EXXA 2Q3HA 3VR2A 1V43A 3CF0A 2R6FA 3PEVA 1MO4A 4TZ0A 1AK2A 1BS1A 1KY3A 3BGWA 2A5JA 4YONB 2G6BA 2AFHE 2QMEA 3EARA 3ZIAA 2J7PA 4LUCA 2VP4A 3EPKA 2MMGA 3MFYA 1TUIA 1NG9A 2P65A 2WAXA 3CRVA 3K09A 1SXJD 1TMKA 3CH4B 4BFTA 3W6NA 4DEYA 4LV6A 4RD3A 1KI1A 4TWZA 4XVQA 3CUEF 5CK4A 5AUQA 5SZJA 4FCTA 1R8QA 2GK7A 1DG1G 2IYZA 1DBSA 4QHSA 3X1ZA 3FMFA 2A5YB 2AL7A
chains in the Genus database with same CATH superfamily
4ZQCB 1N0VC 1QGUB 2OBNA 3G6KA 4RA9A 2GZ2A 4ARUA 1UZMA 4GLJA 4D43A 5FUQA 2CNWA 3BMNB 3OX1A 1E6EA 4QLBA 5MN5A 2I2CA 1WPQA 4YPVA 7YASA 1D6SA 2LP4Y 4D3YA 1QKKA 1AO0A 1V1MB 3VU0A 4UNRA 3QMWA 2QTGA 1IG3A 1E4OA 3CR3C 2W8BB 1N57A 1V6CA 1X1EA 1WHSA 2FI1A 4TM7A 3C6MA 4X63A 2Y1DA 4E5PA 4EQ6B 4F4HA 3WAGA 1IG0A 4WOJA 1HDIA 2WIGA 4E22A 4GMKA 3GI1A 3JQ8A 3AF1A 3NHWA 1GCIA 1SBTA 1E2MA 2GD6A 3T3NA 3EPHA 3WRYC 1ZAKA 4GS5A 4PS0A 5SY4A 2RB5A 1CDDA 1Z2PX 4X20A 3PQ5A 3CJRA 4JYZA 4GP9A 5JZSA 3VA7A 3HSSA 1KBQA 2YZ2A 2YNMA 3W5SA 1I4LD 4QVKA 4P4UA 4Q19A 4BEJA 3FPHA 2HT6A 1QCZA 3CF4A 4CMBA 2G1AA 1IMOA 2ZIEA 3UK2A 4MMZB 1DAOA 2X4LA 1I4DD 1B1AA 1RW4A 3ODGA 3ANMA 3Q41A 5E9WA 3HU5A 4EECA 3V4OA 4ESOA 5C80A 5JJIA 5AW7A 4R8MA 2LW7A 1BS9A 1JPJA 4OGFA 5AJHA 1A97A 4LFCB 1US8A 4BNGA 1GARA 4G0MA 4KNVA 1M8FA 2DZDA 4XRRA 3LT2A 4BGDA 1IXYA 4ZT4A 1RM0A 4I0WB 1WMAA 1JIJA 5FXMA 5HK8A 2PHZA 4MVXA 2VZEA 4KNWA 2XXBA 3JYPA 4MVJA 1T4CA 1F8GA 4JLJA 2AKEA 1VL6A 4BBAA 3RIMA 3C70A 4KQ6A 1QK5A 4DLZA 1UQRA 4Z0HO 4DCTA 1O9GA 1R0WA 1WTCA 1QH1A 3RVOA 1N6NA 1XNGA 3OZ7A 5DTMA 2G0AA 4P93A 1MDFA 4E5VA 1DNPA 1SPXA 3N07A 2YRXA 4QYTA 5SZIA 3MXOA 3X2FA 4B6SA 4BMYA 3LLVA 2WJIA 4Y98A 2HF7A 3WHKA 5CLQA 3DFIA 1SGWA 2MSKA 2XKAA 1EX9A 5F1OA 4IDOA 3WGUA 1ZD8A 4QO8A 3FWZA 5JNVA 1G98A 2OB1A 2P5UA 2H4FA 2XA1A 1GCUA 3H11B 3MCVA 1H2FA 1FNNA 4ED9A 4Z49A 2V7PA 3ZW7A 1VL1A 4TLMB 3ZGNA 5LVAA 5BY2A 3U6KA 1HYEA 1XRJA 3BA1A 3PC3A 2X2EA 1Z13A 2JBHA 3Q15C 3L9WA 4PZYA 3V1LA 2FP3A 3KKKA 2HGZA 3E3NA 3D6AA 3NKVA 5JS2A 3WIBA 2OLEA 3F74A 3VOTA 1TKAA 4AF6A 4DMRA 2YV3A 5FV4A 4WN3A 2RBEA 3A27A 3EXFA 1ZU5A 2VHEA 2YWFA 1WCIA 2DPYA 3P9SA 5EHIA 3QVOA 3S2SA 1VKHA 1VLJA 2VK4A 1GTSA 1HBJA 4TYMA 3SYNA 5L3RA 2MJLA 3KLMX 2YQ5A 4V0LA 5B5SA 1AQNA 3B36A 3QI7A 2J9RA 3M0EA 2X41A 2FPMA 5B2ZA 2ADOA 1K06A 2C8LA 4ROSA 3SOZA 3TSWA 3WK4A 4DGSA 1GPUA 2Y66A 4AUKA 4UATA 1NPTO 3H6HA 2ZUSA 3DOUA 3E2IA 3Q10A 4ACAA 2Q7XA 3B6KA 4JJ8A 5TGTA 3BQNB 3UT5B 2LE0A 3KWLA 3T9BA 1B41A 3UAXA 4ZGWA 2QT0A 1OB5A 2HRRA 3RVLA 4I1IA 1J0AA 5HJ7A 1OAOC 1N1GA 2B30A 2NXCA 4PTYA 1TF2A 5DLPA 1RBMA 2QRNA 3ESDA 3ROFA 2C88A 1C41A 3KZCA 4ZQGA 4AY5A 4B3BA 1KU6A 2JIQA 2ZYUX 3BMNA 2HOQA 3GJ5A 1U11A 4RK7A 4A6EA 4F04A 3QM1A 3QU2A 1A9PA 2VF7A 3QWIA 4S1OA 4W99A 4UE6A 1ORVA 2D1RA 3O8QB 2DBQA 1IHPA 2CSUA 5E6RA 5T8KA 1TZ2A 2FA9A 2ZJ8A 4J43A 3ZHOA 1KDOA 3PLRA 1U0GA 3H4IA 3Q12A 1R18A 2O8BA 4YAWA 1YRBA 2DX7A 1QQAA 4R1TA 1G8AA 2HY7A 3IBSA 4HYTA 1R9GA 3RFTA 5FI1B 2ZYGA 5I3ZA 2QRMA 1AGPA 1N32B 3VFDA 2C20A 4EX6A 1IHDA 1YCHA 4LJAA 1QK4A 2CLHB 2HKIA 1KYZA 1CUXA 1FDSA 4DA9A 5JCJD 5KYXB 1S2DA 2H7XA 2WWWA 2Y76A 4L3VA 3JD1A 1FE8A 2VJQA 2QN1A 1UKEA 4G0XA 5CURA 4A03A 2WRZA 1ONNA 1YVDA 2XT0A 4E09A 1QANA 2I34A 5D3QA 2I22A 3T3PB 2DLDA 1EGMB 1NFQA 1OCEA 5KHLB 1MCZA 3GD7A 3I6YA 1EWVA 3GRPA 4UUNA 5IMBA 1KZHA 4CKZA 3EXAA 5JZ9A 3RVSA 3IQHX 1ZCFA 1UXOA 5L40A 4Q3BA 1ISIA 1TK9A 2BGKA 2AZTA 2RGNC 1JEEA 4GPBA 4WIAA 1R9NA 3OLVA 2YDXA 3BWYA 3G0OA 3Q3JB 3KSMA 4RX1A 5MF6A 1JDJA 2WAMA 3K96A 5LNK6 2R8PA 4MA5A 3JPWA 2QAGC 2OTCA 3UQYS 2IU4A 3WVNA 2ZATA 2HD4A 1E7MA 1I2AA 5HMLA 3KQSA 1YMUA 4O3MA 3CKMA 2Q5CA 4DIFA 4KQ2A 5AVRA 1HKUA 4FPXA 3QU7A 4HZGA 3RO7A 2SNIE 4AWXA 2W70A 1FZTA 1HT3A 2A7XA 1TCAA 3GZJA 2QWXA 3DV2A 4IVNA 4YAKA 5BNIA 2ZITA 1YS6A 4GOOD 4RGBA 5BSTA 4XDGA 4LAFA 1PEAA 1TA9A 1WHTB 1VG9B 3WLNA 2P2GA 4KYVA 3KLOA 5COQA 3H05A 3G9ZA 2QGFA 3S7TA 4DUZB 4C7OB 3W5JA 1Q74A 1H1LA 2FWAA 1V3UA 3QXSA 4M0UA 3VDNB 5ITVA 2PKEA 1JH9A 3LP8A 1WBDA 3IQIX 1GNPA 1WDTA 2ZOSA 4HOYA 4BVKA 1T1RA 4QATA 3GGGA 2DBRA 3L8YA 3M1YA 5CG1A 4CG3A 4OQ4A 3NNDA 4XVHA 1QFMA 4OFWA 5I48A 1R8YA 4FDLA 4O4JA 1Y9AA 3C3WA 1XJWA 4J16C 2A6PA 3GY0A 4KLZA 1NASA 4IFIA 3R3UA 5D87A 1NSTA 5FOXA 2O57A 4PXAA 1P61B 4BHTA 1L1EA 2HWYA 4N7RA 4F9EA 2HHCA 1ZVKA 3QVSA 1FTGA 5KI6A 5BXYA 5K0BA 5J2TF 3FZGA 2BM0A 1Q44A 1DOAA 2PMCA 2X5JO 3EPRA 4L22A 4YREA 2G7MC 4MKRA 4BFZA 3H4VA 1T2VA 1ZRMA 4U6QA 1D8AA 4ZDKA 2H7VA 2ZRFA 2VHXA 3CLHA 1B23P 1HC7A 1OA1A 2YWCA 1V6SA 4NQRA 4OQPA 4U7PB 4B4DA 4YUXA 3IR6A 2IBSA 4H59A 3OIVA 4RXMA 4H7HA 5JQGF 3ZDQA 5CA1A 3BJZA 2EOAA 3W78A 3WL5A 4CI0B 3L8CA 2JHAA 1DIAA 1TQDA 1YS1X 3LQRA 1SUIA 2BFFB 5E7IA 4IEEA 5L3QA 4TTVA 1OXMA 1ZNQO 1BCRB 1Z4NA 1H42A 3GFTA 2A2ZA 2OVBA 3NC0C 2HT1A 1OJ7A 4PG4A 3U4QA 2EFJA 1KERA 3H04A 3E4CA 3E22B 2YJ4A 3K31A 1OA0A 3F7OA 1H2YA 4U2EA 1MB0A 2J87A 4UCQA 3W4JA 4UCXA 2VZ9A 4G5OA 2I76A 3PQ7A 4DLYA 1GQRA 6GPBA 1GTJ1 2PBFA 2FZGA 4IQGA 3IRVA 2FEOA 1AKVA 1PEYA 2BFNA 5KVCA 4GI3A 1UBMS 3HUDA 3V8NA 1SVOA 3HFGA 1DPFA 3A2NA 3RVPA 3A06A 5DGIA 2DHQA 2QM7A 1ESEA 1EEHA 4M21A 4LPSA 3T8YA 3GLGB 3UATA 2IYOA 4R69A 4OHWA 5JBIA 3M83A 2XQGA 5CDTA 3P2IA 4MKIA 4MLZA 5K0NA 2HXYA 4GEGA 4MB2A 4DJDC 3EXG1 3D6UA 1N0IA 2B1GA 1Q0UA 1Y7IA 1ZIDA 2IHVA 2JIDA 2W2LD 1CQPA 1E63A 1N3IA 1R6DA 1PZMA 1TUGA 2GKGA 1VMIA 3MG9A 2W6PA 1Z0ZA 2YMPA 3ITDA 5B7NA 2X14A 4U2GA 1I2BA 1JWLA 2X3FA 4TTQA 3Q3IA 3I9OA 4OX9B 1V41E 1MO6A 1ORRA 2VLBA 3EDCA 3HDTA 3GJ8A 3U80A 4BLSA 1L5HB 3EA5A 4GQIA 4YAOA 2ZYAA 5BVHB 2CHGA 2F3TA 5FTNA 1UT8A 4LDAA 1PL0A 5FQNA 2ZE8A 3PJEA 5E1BA 2PR7A 2BM1A 1XKQA 2ZBVA 4BO8A 1TCCA 3PG5A 4YWJA 4E03A 1Q50A 4OYYA 4UULA 4FHGA 4GZ5A 1G5IA 2WUDA 4DMMA 5C32A 2A33A 4MA4A 2ZSIA 2HIHA 3A4VA 3E27A 4YRCA 1PG0A 1NKVA 5DHAA 3W7AA 5LN1A 4HQRA 2V7UA 5CX4A 3OPQA 5FHQA 4RZQA 4N9QA 3TEFA 1KY4A 1THZA 3BFVA 2WK1A 2OM6A 2G4LA 3RS5A 1K68A 2A0XA 5I9BA 5E6SB 2NX2A 3N2KB 1SCDA 1U5BB 7AT1A 2ICAA 1D4ZA 2C7QA 1QH1B 4HX5A 4A82A 3CF6R 1JEDA 3INRA 2DFDA 3GF4A 1KMHA 3BDVA 2NO5A 4FE4A 3RRJA 3VNBA 2R97A 2CLIB 4HWPA 1Y3HA 1EM6A 3CC8A 4W9MC 4KRGA 2M32A 3PJFA 2YL2A 1N5KA 4TPKA 5BUZA 1QGOA 3KQUA 2Y99A 1SIWA 5FWXB 2AYXA 4PHHA 1QYVA 2J6CA 1N34B 4YGYA 1VL0A 3OFJA 3AOGA 4F3RA 1BSVA 2RFLA 4XGKA 5KTMA 4J6FA 4FYJA 4MWBA 4ZEVA 4ZYLA 4O2BB 4QAQA 3WYEA 4BMDA 4CNQA 3N76A 1J23A 1PYGA 1PFVA 5F4BA 5KCZA 1XPRA 1JXAA 2WUFA 3DWEX 1XTBA 3RUPA 4HDMA 4B4UA 3UXEA 3OTWA 2FFBA 1X74A 3D3JA 3G8DA 3COWA 3QEJA 3TS1A 4B6GA 4DCCA 1ZKMA 4JBLA 3GA0A 1UZUA 3B3JA 3ROMA 3UYKA 4RH3A 1E2HA 1OFGA 4X1IA 1U0BB 5DULA 1K7FB 1SG9A 3F7TA 4QXRA 4TWBA 1J8YF 2EL9A 3TTVA 5FFFA 4URWR 3MOSA 4YCSA 1FK8A 1M3SA 3PXBA 5D00A 1DUVG 2GJSA 5L3SA 3BT7A 1LLCA 3LY7A 1YQGA 4WEQA 1JSCA 1TM5E 4JP2A 4N0PA 4IV5A 2G5PA 3V4ZA 2YOFA 1M1ZA 4WK0B 3NZEA 4L0MA 1B93A 4DLBA 3LE8A 3GEPA 2LR0A 1XA4A 4P4TA 4MVJM 4ZICA 1VIMA 3OJ0A 1RYBA 4ZYYA 2CCGA 1K86A 4NWIA 1GTZA 1DO8A 5B1HA 3IAS1 3DKIA 1DWQA 2RHTA 5HXAA 1MUUA 1XXHA 3K70D 1QE3A 1AU9A 1P3DA 4MUFA 1YTUA 2KPOA 3VDRA 1Y81A 4LQLA 4TLLB 2NSHA 3F7NA 4X97A 5EKUA 2JJYA 4UMFA 3CE6A 3LCVB 4Z3OA 2CFOA 2I4MA 2PMBA 3LV8A 4E46A 4P38A 3T7EA 5EVJA 3TCKA 4IIJB 4NY1A 2Y6VA 2YWBA 5LBTA 3HHPA 4CKEB 4YRKA 5B57C 5HKBA 3TF5A 16PKA 3UC5A 4E5MA 1PZHA 3W2FA 1V8BA 3U7JA 2PMFA 3EAGA 1NP7A 1KJNA 1R27A 2O50A 3NYIA 5LJIA 4AN4A 4D4GA 3EXHB 3ROGA 2PGAA 3AC0A 1CQWA 3OECA 4NAVA 3HADA 2H9AA 4YP7A 4CMIB 2GPBA 3T9EA 1YQTA 1OLXA 2L0XA 2OOKA 3C43A 5GPBA 1QP4A 3RODA 4ER5A 1KOJA 4UXIA 3KE9A 3THYB 4KN8A 1AHIA 2C42A 1TCVA 4Q7LA 3L04A 5KCMA 1P0CA 2XUFA 1RSZA 4EZIA 1GG5A 2OYCA 5FPYA 2W8ZA 1FTSA 3RLFA 5AH0A 3RVMA 1E69A 2GLUA 1EFTA 1V7ZA 2C5HA 2JCBA 3DF9A 3EMBA 3I9LA 3NWEA 4OBWA 3BRSA 2QRQA 4CM7A 1N25A 4KE7A 1NRWA 1FPMA 1P4JA 2HQOA 4KXWA 5ER9A 3VSCA 5L4NA 4DVJA 4NE9A 4C78A 2BMDA 4TWJA 1PT7A 1EUZA 1C5KA 2IGBA 4GYJA 1W0JA 4TSFA 4H60A 3SSAA 3A9WA 2NTNA 4JT8A 2WJPA 3IAAA 5EJEA 3DVQX 1AS0A 1WG8A 3GGCA 2P6OA 4L4SA 3CWCA 1XLUA 2Z04A 4JB3A 4NKRA 4LX8A 8LDHA 1ZISA 1R4MB 1C0IA 4Q1DA 4JELA 3REOA 3DYIA 5NLLA 3M6AA 4WOPA 3AJ8A 4R54A 4W5TA 5KYWB 3QZUA 3G9UA 3PQ6A 3Q3EA 4JJ6A 4B43A 1YULA 1IZYA 4MI6A 3F1KA 1A5SB 3GH3A 1F2TA 2Z4RA 3TZBA 4JN6B 2W2TA 3DE1X 3OIYA 4OK6A 4OQLA 1MEJA 4IUDS 3ANSA 3NOXA 2IC5A 4MIEA 4NMMA 5AOBA 2G9NA 1UAAA 1L5GB 4HAWA 3I32A 3KEGA 1EX1A 2DHDA 3OFSA 1LVUA 3OZVA 3GLUA 2QM3A 4HGYA 2PUEA 3GFQA 4MUYA 4O2AB 5T4BA 1NA5A 1X8KA 3ONWA 3PRKE 3R8CA 3RC2A 4AJ2A 1UODA 4C43A 4HNTA 4BUZA 1Y1RA 3CBQA 4GWKA 2WILA 2FPUA 1IXRC 3ICOA 2G4CA 5JMOA 3A25A 1TTHA 4HBGA 1GLGA 4C0BA 4ZZ0A 5KTNA 1ZM7A 3K30A 4ZODA 4UW9A 1TK3A 3UZUA 3RUDA 2OCYC 3FG9A 3KJZA 2VQSA 3PC8C 3OHPA 3OPYA 4I55F 5CVTA 3BTVA 4AUMA 4D0GA 2C2OA 1C1YA 5CDFE 1ZN2A 2EW8A 3OQVA 4YASA 3LDAA 4LYAA 2F1OA 3LP6A 3T3OA 2GB4A 1CXZA 3X1YA 1JJVA 3C2QA 1KMMA 4URFA 4Z9YA 3EQ6A 1A27A 2RGWA 1C2TA 4CLOA 1GPNA 1F8UA 2QRPA 3WP1B 2F2TA 4AM8A 3KJEA 3IQGX 2QLMA 2VJYA 4EH1A 5ALQA 4MP8A 1E2NA 2XDWA 4LK2A 3QA3E 4GKKB 4BZXA 4HPWA 1DEXA 5AKIA 3RRMA 1FRFS 4HDSA 1X7HA 2R1TB 3RIGA 4RD2A 2ERYA 1YKFA 1DSSG 1RXWA 5KX5F 2VK1A 1FNDA 1T9BA 4DLWA 4V2UA 1A9QA 4NIMA 4IJKA 3SYLA 1QZZA 3TYXA 3G5LA 4A6PA 1X42A 1KEUA 1ACMA 5D5HA 3J80A 1N3YA 4L28A 4BFVA 1MF7A 3NOOA 1NBHA 4IIJA 2ZPUA 2J30A 2JGDA 3DP7A 4GT1A 1WZNA 2JFBA 1KKUA 2JI9A 4YCDA 1F17A 1ZL0A 3M6UA 1KH2A 3PWTA 1JFSA 3HGTA 3BL5A 4CDGA 4HX2A 3TLGB 5J2UF 3ZCTA 2YJZA 4HKTA 1I94B 3NAMA 4J07A 3NBMA 4ND7A 2BSQA 2Q4DA 4GHWA 5CX1A 4KOEC 4YK7A 1R0CA 3LQYA 4HRXA 5ICGA 1OLUB 5HF9A 5HFNA 4CCSA 4BX8A 3UTCA 3RJ9A 3F5SA 4MVJI 3T4XA 2Q8PA 3WQRA 3QIAA 2G7ZA 2QN6A 4ER0A 5CLGA 1VZ2A 4GD3Q 1F5SA 2V03A 3KTOA 4Z8XA 3V7NA 3BGIA 4LYFA 3OZCA 1A5AB 1M8JA 4KQCA 4NMWA 5HBGA 3E1SA 4JVMA 4BNVA 4PQFA 5L3QB 3OCUA 1QDEA 1Y9EA 1YGPA 2BPOA 3GP8A 1NNLA 1TA4A 3LNTA 4KR7A 3ZGLA 3W34A 1M1NA 4C29A 2HV9A 1OXSC 5JRJA 1SXPA 3P9YA 1EX7A 2QRJA 5CDFA 1BQ4A 1OAOA 1Y3FE 3LHFA 2E87A 1KNQA 4GVPA 2XMZA 3V8RA 3FKSD 1JFTA 1K7EB 1WP4A 1YKSA 2H59A 2XUZA 4ZAFA 1XMOB 3M6VA 2NIPA 4UXHA 5A9RA 5A7GA 4D3FA 4MHSA 4Q05A 5JIBA 3FPEA 4W1QA 3U7QB 1NN0A 2ZI4A 4D0NA 3WL6A 1QZTA 4QYMA 1EG7A 3IYLW 1Q0HA 1BWQA 2WF8A 1R8JA 2I9KA 2WPDD 1AB6A 5EWMB 4GX2A 4AN0A 1WB4A 6LDHA 3Q4GA 4C4SA 3D9QX 4F5YA 3LX8A 4XX1A 2XRFA 3RSOA 4FQ5A 3JQ9C 4TTIA 4WNAB 1CY6A 3SC2A 2XE8A 2WM3A 4LG1A 3AW9A 3T0FA 1S0UA 1HT0A 5DIZA 4CM8B 2V3VA 1GFIA 3KTFA 2JLRA 4FUTA 1GOTA 1Y7HA 3VBCA 1L9XA 4UJ3A 3L46A 1QHYA 4R8RA 5A6SA 4C7OA 1WE2A 1U2RA 3WRVA 4KO8A 2X6QA 3E7PA 1C4WA 4RE6A 3GL9A 4DWWA 1T91A 2IU3A 2WNHA 3I39X 4BMSA 2HMWA 2OV2A 5BN5B 1Q92A 3C7KA 3DVRX 2B4YA 3WXMA 3CT6A 1Z6PA 2XOXA 4ZEWA 1MC4A 4BMPB 1AM4D 3S8YA 2AOWA 5LPNA 5LZ7A 3GLFA 2J5KA 1ZGBA 4Y6RA 2OQVA 4BAZA 2ZK7A 1MN6A 2CZCA 3LA8A 3NPAA 4CMEC 4P5PA 1BQ3A 2QUBA 3KXLA 4P7GA 4RF4A 1SXGA 4CG1A 4RTPA 3JAWA 1DT5A 1OU0A 2JLAA 3DGEC 5ALLA 3TB4A 3U60B 3W6PA 4G0OA 4R2MA 2BH9A 2NZ8A 3HRIA 4BNLA 4DMLA 3C7DB 1TDJA 2FPIA 4ZEOA 2AR9A 3CG4A 4P22A 1X39A 3E2PA 1KDTA 3VVMA 1X3SA 4ZU1X 1VE3A 5T4HA 3WADA 4A8PA 1BAPA 3OEEA 1L7DA 3ZTWA 4EG3A 3IP8A 4H35A 2O8DA 3NH6A 4RGQA 3FB4A 4KCGA 5JBQA 4KVGA 2O1XA 3PNQA 1XWIA 1YS4A 4ZP1A 3VNSA 5F5LA 4YJ3B 4EY3A 1VB5A 5BOVA 3W2GA 1WW8A 2DG2A 4U6NA 4G5QA 3WL3A 2WFAA 2H08A 4GZMA 4Q1EA 4XVRA 3DPIA 3PXGA 2QRLA 2E5LB 3JS5A 3U9SA 1G20B 3IKMB 2XAAA 5ECYA 1XXHE 2W2NA 4MQEA 4Y6SA 3FGOA 2CNKA 1NQ5A 4OLJA 4OA8A 2GBIA 4ZJUA 2C03A 5IUJC 3HZRA 4R1UA 1J1IA 4IQ4A 3UMRA 5KJ6A 2C9CA 4X8MA 3BH0A 4AS2A 2HR1A 4DAEA 2REQB 3EOZA 3FOBA 4FIDA 3DEAA 5BN4A 2BD0A 1PV4A 1W581 3AF0A 4OB7A 2DCUA 5FA5A 2P69A 2GF0A 1CF9A 1VGVA 3T61A 1ZCZA 4FLFA 2MMCA 4PEVA 4Q82A 3THXB 3CRMA 4OQXA 5C2JB 5CDGA 2HUNA 3QELB 2I2DA 4KVAA 1CQZA 4QU0A 4A8TA 4EBFA 1KZ9A 4TYWA 4ZOAA 3KZXA 4CKWA 2DR3A 5KVSA 5ILGA 2KX7A 1GEGA 4QVIA 3HCCA 4A4DA 4JP3A 5KX5B 2IPMA 4JAVC 4LYEA 2ZJOA 3KQQA 4EIWA 1H6DA 1WCV1 2Q28A 2VBCA 2PTHA 3L0DA 3T7SA 1JYSA 3C8DA 1E9VA 4IXDA 4B73A 1A5ZA 1HDZA 2GPTA 2KM1A 3TXAA 5BV8A 2WVGA 1G5TA 1QTRA 4FC6A 1M76A 1QHHA 4DPLA 4EY6A 5KPJA 4ZYVA 1Z0SA 1K6IA 3ADCA 3TW6A 1CLUA 3JWEA 4BIIA 2PXHA 2G17A 2P9YA 1B6GA 1N2CB 3AEKB 2X2OA 4E11A 4QXMA 1KOGA 3GB9A 3ZE9A 1R66A 1ZSVA 3F97A 2QJRA 3LWBA 4JC8A 1DJQA 3R24A 4RVNA 3H1PA 1DKNA 3WGOA 1KWGA 4X1YB 3QW4B 3GJRA 4GG1A 3ZW8A 3O2SB 4CM8A 1DX9A 3EOBI 1GGMA 1KMNA 5LCXA 4Y0AA 3X1MA 2XWPA 3ICCA 4Q4JB 1GL3A 3RG2A 4OHYA 1WXQA 1PEKE 1U1DA 4Z9AA 1RAHA 1FW6A 4Q7QA 4JUCA 4P4GA 5CDYA 4S05A 1CRQA 2VPTA 2FXIA 4HWGA 3TXYA 2OHFA 3BFPA 1DHRA 3MJSA 3U1TA 2PRYA 2ZRHA 4H6PA 2QZSA 4L7VA 4S1WA 4X85A 1AVTA 1W75A 2C2ZA 3HN2A 3AO0B 3BJEA 3P0RA 4XD7D 2JDID 3R74A 3RHFA 5LMCA 2EXXA 3WO1A 1LW7A 3DBLB 4RF2A 1DC7A 2HMYB 4ND5A 3OBIA 4O4JF 4EY8A 1KYTA 2OXTA 3ZDRA 2IEYA 2VKTA 3P0FA 1T43A 5C0OE 1E3IA 2OV1A 2L82A 3AX6A 4NCNA 3B6IA 2PZMA 4DIOA 2B4AA 1FBNA 1FCJA 4MB6A 1ZCJA 2HB6A 3PPVA 1FQJA 3TRHA 4B7UA 4OFXA 5E6UB 3ZWVA 4MVCA 5JPIA 3QOWA 4ZVRA 2D2FA 3I9KA 4X64B 3DBRA 4ZOEA 1KETA 4IDCA 1QM5A 3BPSA 2OM2A 3T5CA 1A4IA 2J9ZB 4E7OA 3F3SA 4OMCA 4XB2A 3CZMA 5CIQA 1SBNE 1YRHA 2V45A 3AI2A 2VEOA 4UC0A 1V37A 4E6EA 4ZANA 2L42A 1RC0A 2LBPA 2EG9A 1XJQA 4P83A 2PX3A 4EY4A 1ZD3A 1XNJA 2FPIB 3GNQA 3OZTA 4PAGA 4BMOB 1P74A 4JJFA 5JPCA 3FSGD 1G4HA 2R4TA 3MRXA 1OH6A 2C4VA 4WCFC 2FK8A 3FZYA 2GA8A 5FH9A 3RS4A 4EEKA 3E18A 2IU0A 2QX4A 2BF7A 3STXA 1RE0A 1MZVA 4R3UC 1GXSA 1NQAO 4JY7A 3UH0A 1T0BA 2QVLA 3AY3A 3OZEA 4QYIA 1PR6A 3L0IB 1L4HA 1C7JA 3MUEA 4P3KA 1NHWA 2YICA 4MK4A 2Z08A 4O2AF 3OIGA 1NRXA 4B8ZA 3LF2A 2P9JA 4XJSA 2GYWA 2NYAA 2Q1XA 3CA8A 3DEYX 1V2HE 5AHRA 9ABPA 3DG9A 2NU7B 1V8OA 2ZYWX 1TT5B 3KD3A 4RMJA 3SX4A 5EHQA 4PZ9A 5HFAA 4CM3A 3M9XA 4FGJA 4YAGA 3ZLJA 5IVIA 3THXA 4LY6A 4MO2A 4EPYA 1P0FA 3C5WP 4B76A 1JAHA 3IE2A 5EP2A 4E08A 4RS4A 3CB4A 2CVFA 3L8ZA 1CVLA 3NQ41 1XYYA 3NFRA 4BNXA 1EUYA 3LWZA 4NXNB 4Y2JA 1RHRA 2W2QA 1OIXA 4Y1EA 4YJFB 2BYTA 3JW8A 3ZCRA 3LA6A 3H0KA 4PWZA 1C8BA 3ORYA 4Y7CA 2V7EA 3KR1A 5T3UA 4C0XA 2Q5EA 4AJNA 3FNIA 3BIJA 3BORA 3FA2A 5KINB 5CGQB 4W9NA 1O5TA 1IQRA 5K7SA 5FV7A 5AK6A 5FPPA 1UC5B 1KDYA 1YB7A 2PX8A 3MWYW 1RPZA 1TM7E 4PZEA 1OXTA 1TK2A 1A1SA 4R51A 1OSNA 1NXPA 4FZJA 4MQLA 4YA6A 5KEIA 1L6IA 2C95A 3TLGA 3V1UA 1FSGA 3WLQA 4D41A 5TMBA 3U16A 3ZHUA 4YMWA 3NT4A 4LFBB 4UM8B 1W7AA 3GPCA 3TQHA 1NC3A 3OIDA 5J4VA 1WBJB 1T9DA 1PJ3A 5JAOA 1Q1BA 1DAPA 1L5QA 2AQHA 2H51A 3OOSA 2IBMA 3K0KA 3VZPA 5BWNA 5JTTA 3ZJVA 1OLOA 3BXHA 3A04A 5G1NA 4ZVNA 3TW4A 2HQSA 4EYKA 4I1VA 2NVWA 2GRJA 2Y1FA 1XTSA 5DX0A 4B17A 2GFHA 5I4CA 4CKBB 2AJLI 2OCBA 3HVUA 3LIPA 2I71A 3V46A 1BHQ1 1LXCA 5FLEX 3LWNA 4LWOA 3TPZA 3U62A 3W1WA 4BQIA 5A1JA 5LMUB 4NF2A 2CHUA 1OWLA 3OWHA 2A4KA 1R64A 5EPOA 2OWDA 3KTAB 2PWBA 1FFXB 1RADA 3N1UA 3NHRA 4P92A 2RK6A 1EZ4A 1QHEA 4L07A 1LPOA 5FBWB 1AUVA 4OXIA 2OENG 3AQIA 2FG5A 2GCEA 4LOJA 3WIUA 4CBVA 1P5HA 5BV1A 1VYUA 3S70A 1LPBB 2D0OB 4ITUA 1U63A 3GEGA 2OK7A 1OGYA 3IKJA 3P2MA 2B8JA 4DNQA 1ESNA 5FR1A 1HFKA 1KNXA 1L7NA 1S4QA 4ETNA 1O8CA 1AKWA 1KIMA 3D6TB 4MWCA 4YT2A 1NUTA 5KWVA 3N3BC 1TIKA 1QAMA 1OFVA 4ZMRA 4FT2A 1MVNA 5CVEA 2GWHA 5FKJA 3CUTA 4OSEA 2X0KA 2QW1A 4RD1A 1U7DA 3VKVA 4DJFC 4U2CA 2XMSA 3ZNPA 4KSCA 3TNYA 2EZUA 3C45A 3IKVA 3RT9A 3GLIE 4BUCA 1C7IA 4MWDA 1FSFA 4M88A 4AO7A 1XTIA 1W93A 1SBZA 1JALA 3ESRA 1WBBA 3TECE 3ILXA 2WJWA 3I23A 1K5GA 2JGFA 4PSUA 2XYPA 4DEVA 5KWIA 3HM9A 2HK6A 3LFUA 1U2PA 4FFRA 4V0QA 3TOVA 4B3DA 4TKUB 1SQ6A 3AUFA 3QEOA 1M8PA 3DKKA 4OXNA 4L9WA 3AR9A 4M1SA 4ZMBA 2D5CA 2DBZA 4JL5A 2JFYA 1DKQA 4GSYA 4PYOA 2ECOA 1EFVB 2ALJA 2VNIA 5ELLA 2WYOA 4JI0B 2WB2A 3OU7A 3L4SO 5IKMA 1ZBDA 2PX5A 2XBMA 5DGDA 4M89A 4Q93A 2P27A 1T8PA 3OAAD 1W0KD 2CXXA 2VDRB 4UUBA 3UHAA 3AB3A 3O0DA 1V6AA 1CIVA 4ZT6A 5DRYA 3ELDA 1M6EX 2LTAA 5DWDA 1A77A 3KXPA 1DDGA 4ZAYA 1M1YA 1NXVA 1U7TA 5AIBA 3EFOA 4MQ5A 4XA8A 2PNJA 4QYWA 1LJUA 2C97A 1MLDA 3BAFA 4DWJA 2ZS7A 2C7RA 3P0IA 5HS6A 2J3DA 4CHGA 4RANA 3EF0A 2J3KA 2POQX 3B89A 4U9UA 1EVKA 5GIOE 3AVOA 1UBHS 1Z47A 4H6VA 4HP8A 5EXEA 4G07A 1FTWA 1PUIA 4K5QA 1G8JA 1KYYA 1V0JA 2WQZA 5DHTA 3GEIA 3B7PA 2XQVA 3NHLA 1PFWA 3BIFA 1KYXA 3G2KA 5AVVA 1ZW1A 1KORA 4NCIA 4UTPA 2WJAA 3QHPA 5JEDA 2VT3A 4J0GA 4RJJA 5A9SB 1C9YA 3BZUA 4D99A 3TQQA 1YU6A 3RFCA 5K05A 3EG9A 1DAGA 1J20A 1FP1D 2H1LA 4GVXA 4M0EA 3LIIA 3U44A 2BRUA 5BPFA 3O91A 4RY9A 3FZQA 1V47A 2ZRIA 1ZESA 4JSYA 3RFXA 2XUHA 3I01A 3QLVA 4AN1A 1OFIA 5JSZA 1EUQA 1X9HA 3ST7A 3MRVA 1E2EA 4P4SB 3T5BA 1H9BA 1J99A 2AQIA 1Y63A 4CMEA 3F6RA 3PWKA 5LQCA 1XTTA 3H1TA 1K4MA 4I4CA 1IZ8A 3ZI0A 5AVUA 3E5HA 3SMQA 2XQIA 1NW4A 2AZDA 4RO0A 1L5LA 4GE0A 4G8CA 2FPXA 1FFBA 1GSOA 3KSUA 1YCFA 3T1NA 2WWIA 1G5QA 1ZH8A 4OOFA 2HWWA 3OPNA 1GU7A 4PZCA 4RVGA 5H68A 2G1KA 3LZCA 2XTNA 5FT9A 4JQZA 1LS6A 1LUAA 4PSCA 3LCCA 2AOXA 4FYMA 4EF6A 1E1DA 2WZQA 2BGLA 4NDAA 3AL2A 3KT8A 3ZCQA 5JJKA 1NVKA 4AJOA 3QE0A 1I3OA 4OU4A 1HURA 4GUAA 1U0LA 4GPAA 2ZTLA 1T1JA 5CYFA 2JA1A 4MKZA 3PUHA 2W22A 2KHZA 3WLPA 2IGTA 4GDFA 4KQKA 5CT9A 2IXDA 2WZDA 3RYCA 3IEIA 3RVDA 1KH3A 4I55A 1HZZA 4O8ZA 3RVJA 5LKRA 1XDWA 4V0NA 3WNVA 1OLSA 2X0NA 3GWGA 3IALA 4HXEB 1T3ZA 3UJBA 3GP5A 3E0QA 1YI0A 4IMRA 2MINA 2P7IA 1JNYA 3UUEA 1KEEA 4EL0A 1LRKA 1JT2A 2XRMA 3MTJA 4TMVA 3K9CA 4QFBA 4NCJA 4JMPA 5KYUB 4QT0A 2H2WA 5ALEA 5LZ9A 3JZIA 1G7TA 3JQEA 1I13A 2FMFA 2J9FB 5EIBC 4Q3LA 4NBRA 2H54A 5CCDA 3VI3B 1F1JA 2O4CA 2OHXA 3L05A 1H1LB 1UKZA 3NALA 2XNHA 4FOOA 4L15A 2X8BA 1GTL1 4NYMQ 3MB8A 4JOCA 4B6OA 5M2QA 2QL5A 1R5BA 3R7SA 3LO5A 2JFXA 1OFUX 5GMOA 3LUHA 3PJDA 2JVIA 2O52A 2C2GA 2IZ5A 4P1ZA 1N0HA 1H4QA 4B09A 4WZAA 4B3SB 1CC1S 3AEZA 2IZ6A 2C31A 4FCCA 5KSOA 1ZH0A 1V39A 2RI6A 4GLLA 2JFWA 3QI2A 5TRTA 2I6XA 4QLOA 4CMJA 4JJAA 4D5GA 4J0HA 1D3AA 4D25A 1DJMA 1P5FA 3IC5A 4P4NA 1JJFA 3JAMA 3L4BC 1DKRA 5TMDA 3PVSA 2GN4A 4C05A 4OSPA 4YMVA 4MEBA 4PYQA 5EUMA 5C81A 3RSSA 1RRKA 1SUBA 1VBFA 3AR6A 2BEWA 1UC4B 1B8OA 1G3IA 1M1YB 2H3HA 1C7EA 2VC2B 3ETNA 2AMJA 1VI6A 2EX1A 3IDFA 3AP3A 4XX0A 3UHJA 3SWWA 5CRIA 1U8CB 2QN9A 2X13A 3ROTA 3AF4A 3SR3A 3BCUA 3PR1A 3EJ6A 5TT0A 4P81A 3HGMA 3IOYA 2VT7A 3X3HA 4F9TA 2GZMA 1W19A 1FP4A 2NU6B 2O3RA 2Q1SA 2R4QA 1FMJA 3DVLA 3EIFA 3H97A 3IMEA 2JEZA 3JTEA 3NANA 4HNSA 2A7QA 4NEGA 4EKIA 1CEEA 2WTNA 5CBKA 3CGGA 3GC6A 3QHQA 4MOWA 2JHCA 3G5UA 5JVDA 4LSWA 4LOHA 1J2YA 3URKA 4JQOA 3BSWA 3BAZA 3ASYA 2YIVX 4DQKA 4FNAA 3B1FA 2IYPA 7ADHA 2O2XA 4CL2A 3QEBZ 1Y6GA 1BVHA 2I3ZA 2JJQA 2YOHA 4TTTS 2GVZC 4D02A 2CB0A 3WB2A 2OSVA 3IUQA 4K1XA 1ANKA 2RGDA 3IAM1 1UH5A 3HJRA 3IPRA 3JQBA 3PYLA 4KL8S 3SKYA 3O1JC 4X7RA 2J0UB 2OBMA 4PRZA 3RC9A 4AG3A 1JKFA 4D3DA 4IDAA 3I04A 2FWMX