4X8RA

Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
304
structure length
304
Chain Sequence
ECEVTLRSSDTHPDGYPTVEGVKFMAERAKELSNGRICIEVFPSSQLGEEKDTIEQTQFGVIDMVRASFGSFNDIVPEAQLLSLPYLFRSEEHLHNVMDGPIGDELAKAFEAKDLIAVAYYDGGSRSFYNSQKPITKVEDLKGMKFRVMQSDVFVDMMSALGANATPMPYGEVYSSIQTGVIDGAENNWPSYDSSGHFEVAKYYTLDQHLMVPELVAISKIKWDALSPEDQQVLRQAAEESEPVQRKLWAEQEKASEEKVVASGAEVVREIDKTPFIEAMAPVYEKYVTKSEYQDLVKRIQETQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF A TRAP PERIPLASMIC SOLUTE BINDING PROTEIN FROM Rhodobacter sphaeroides (Rsph17029_2138, TARGET EFI-510205) WITH BOUND Glucuronate
rcsb
source organism Rhodobacter sphaeroides (strain atcc 17029 / ath 2.4.9)
molecule tags Solute-binding protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 114
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4x8rA00
4MNCA 4NQ8A 5I5PA 4PFBA 4MIJA 4MHFA 3U65A 4N4UA 4OVTA 4P56A 2CEXA 4PAKA 4O7MA 4MNIA 5IGAA 4N91A 2XA5A 2XWKA 4N8YA 4OA4A 4DI4B 4OVPA 2XXKA 4N17A 4MNPA 4OVQA 4PBHA 2ZZXA 5IZZA 2XWVA 4NGUA 4P9KA 4O94A 4PAIA 4X04A 5IM2A 2PFYA 2VPNA 2WYPA 4OVSA 4PGPA 2XWOA 4MEVA 4N6DA 4N6KA 4X8RA 4PF6A 4OVRA 4PDDA 4O8MA 4PGNA 4PAFA 4NN3A 4P1EA 4P8BA 4LN5A 2WX9A 4P1LA 4MX6A 4PETA 4NG7A 2XWIA 4PBQA 4PC9A 5LTCA 4P47A 3B50A 4NF0A 4PFRA 3FXBA 2HZLA 4NHBA 2ZZWA 4PE3A 4NAPA 4NX1A 2WYKA 4N15A 2V4CA 3GYYA 5CM6A 2PFZA 4MCOA 2CEYA 2ZZVA 4DI3D 4PF8A 4XEQA 4PFIA 4PCDA 5I7IA 4XF5A 2HPGA 4N8GA 2VPOA 4YICA 4P3LA 4MAGA 2HZKA 4MMPA 4OANA 4UABA 4YZZA 4PDHA 4XFEA
chains in the Genus database with same CATH superfamily
4U4SA 1FPEA 1GGGA 2HFBA 3VV5A 1QW0A 4IO7A 4AB5A 4MF3A 2VHAA 2Q8MA 3T1BA 5LDZA 2DWJA 2QS1A 3Q26A 1OIBA 2OWZA 2DE2A 3TTNA 3DLNA 2UYEA 3G3KA 3CSBA 4PBHA 3TZAA 3ILTB 3E79A 3JYRA 1ANFA 3LC8A 1OQGA 4O94A 3HN0A 3VFJA 4GX4A 2OX3A 4QFNA 4R74A 2QS4A 3T9XB 2QSXA 2F34A 2F7CA 4PGPA 4ECFA 3T0JA 1EZOA 1FPLA 2D3IA 2R71A 1B3GA 2A5TB 4PAFA 2HHMA 1LBCA 4P8BA 1DSNA 1Q1KA 3UGWA 1JNFA 4I3YA 2V3TA 4PBQA 1MRPA 4F31B 2OWSA 4LQ2A 1Q9DA 1DTZA 1FTMA 4HE2A 1LBWA 5DT6A 3GYYA 4LZ8A 3KGCA 3PTYA 1XC1A 2VD2A 1R9LA 4NEDA 5BUUA 4OYVA 2ZZVA 5I2NA 1M5FA 4XEQA 3T22A 4FORA 3H03A 3CFXA 1JEVA 3ZKLA 4I8CA 2CZIA 4LZ5A 4UABA 3H4ZA 5BWJA 4WEPA 1NNTA 4GFRA 1LSTA 4OHNA 5EQ7A 3FJGA 2G93A 3D4CA 4IB2A 4BDQA 2DQVA 3MVWA 4R6YA 4X48A 2W7YA 3PUYE 5F1QA 2IA4A 3E3KA 4ESWA 4OERA 3PMVA 3CIJA 1SW4A 2XXXA 4H6DA 4FJPA 5IM2A 4KR5A 4MLQA 2HXWA 4U22A 2PVUA 4ZDMA 2UVJA 1VFEA 4IGTA 2FHYA 1FPDA 4YKJA 2Q74A 3G3IA 3ODBA 4F1VA 5A5XA 1XVXA 4H8JA 1MH3A 5EQAA 5I57B 4MX6A 4WEDA 3TUSA 1TXFA 3SETA 4RA1A 2DVZA 4G8MA 4NF4B 1LFIA 5F24A 1SI1A 1BK4A 3SDFA 1IMFA 4OESA 5H8FB 1M5BA 1SBPA 2PFZA 1URSA 2VOZA 3LSLA 5DEXB 1XHYA 3S9LC 3L6HA 1INPA 4H5FA 3SERA 4P3LA 3LUYA 4X9TA 1XVYA 2I58A 3TAJA 3Q25A 5AA3A 1QVSA 2QMXA 4JSOA 2ZYOA 1M5CA 3TCFA 4KFQA 2VGQA 4O3CA 3W9WA 1G0IA 4ONYA 1A99A 1NL5A 3A3CA 4QBAA 1MQHA 1B52A 5ELVA 3SESA 1LGBC 1ATGA 4NF8A 4GXAA 3LUZA 2XWKA 5KDTA 3T66A 4POXA 3N6TA 2Y5LA 2XHDA 5H8HB 3PPNA 3K01A 3B6QA 1MXXA 2P3VA 4OQOA 1POTA 3C33A 1URGA 3EPEA 4WKMA 4H0WA 2RC8A 5ICTA 3G7WA 2DXYA 2FNCA 1B46A 1UQWA 2XWOA 4N6DA 4DCYA 4YMBA 4XTCQ 4KPTA 2RC7A 3KC1A 4GWOA 4OEVA 1I69A 4BDRA 1D9VA 4PGNA 3UN6A 3PV0E 5A5XB 3HV1A 5FHMA 1RDZA 3KSXA 3FXBA 2HZLA 3HCQA 2RF1A 2QPQA 1TFAA 3O66A 3PMXA 1MPDA 1FTJA 3K1MA 3TTRA 3T96B 1FBCA 4ELQA 3VVDA 3RTWB 3M3FA 4ZEIA 3RLFE 4DI3D 3C31A 1FQCA 4PCDA 3PGFA 2HPGA 1BTJA 1OLCA 3KJTA 4YB7A 1MM7A 1JEUA 1US4A 3AXFA 4HS7A 3EHSA 4KYSA 4XKNA 4BDLA 3IB1A 1OVBA 4HCWA 3U65A 3U8QA 1NKXA 4OVTA 3RPLB 4KQPA 1UTHB 3CG1A 4EDPA 1KZ8A 4QFPA 5B70A 5L9SA 3MP6A 3MPLA 4XKPA 2XXHA 4DDDA 3OD7A 3MP8A 4F2QA 1QJMA 1S50A 2GHBA 2QMWA 5H8HA 3BFTA 3E4RA 3IORA 2Y84A 2WYPA 3WAEA 3C34A 4GX3A 2FVZA 4EUOA 2O51A 2QFLA 4NE4A 2F36A 3FUZA 1JW1A 2PMSA 4UA8A 2WKYA 3OO8A 1NMUA 1SW2A 1PEBA 4GWSA 2A5TA 3G3HA 4RPOA 1B32A 2YPNA 1DBZA 2XXTA 2F3BA 1MY2A 1MXVA 1AMFA 2B65A 5FTIA 4NAPA 2UVGA 2F97A 4U21A 1RDXA 2WYKA 4YMAA 5CBSA 3JV9A 2Y7IA 2QJEA 3FJMA 1EYJA 3OENA 3U93A 4BDOA 2B4MA 1J1NA 2L5VA 1IEJA 1LBVA 2XXIA 3BKIB 4MAGA 1B3FA 2HZKA 4OANA 5L8DA 4QFLA 4NF5A 4XFEA 4MNCA 4OWDA 2F6GA 1LFGA 3A29A 4JBZA 4N4UA 1A8EA 3MPKA 2ZNTA 1B9JA 3MZ9A 3TCGA 4F1UA 3VLVA 1LAXA 1FQFA 1B5HA 1DPEA 1QKBA 3TTMA 4OFOA 4RY1A 4U1ZA 3KZGA 4FATA 1B0LA 2XX7A 2H98A 4EXLA 2A5SA 1FBGA 1OMPA 3G3FA 1ELJA 2Q89A 3IJXB 2HAVA 4QHQA 3VLWA 1QULA 4KYEA 2P3NA 4OXVA 4Q5TA 1D9QA 3FZVA 2E1SA 2I0BA 2G29A 4KD5A 4N6KA 3IO4A 4X8RA 1QUIA 2NVUB 1IUDA 1ZMGA 4H8IA 1HSJA 4HE0A 5DW8A 1UIVA 1NNPA 3K0VA 5ESYA 2DSFA 3THIA 1PBQA 2XXWA 2DE3A 2P2AA 3UP9A 3HHFA 3TDJA 3RYDA 3U72A 2DP8A 3DELB 3ONMA 2ABHA 1QGXA 2MKZA 3N94A 1A55A 4K3FA 3T93B 4ELRA 3GXAA 1UIUA 5I2NB 3I6VA 2YLNA 5TP9B 1EYIA 1FBPA 4F1YA 3OEKA 3GBBA 3TTLA 1FTAA 2FA7A 2O7IA 4RXLA 4POWA 5B7DA 3KG2A 3EF7A 3UORA 4OFJA 4F39A 1IMEA 3T9HB 1WVJA 2QL3A 4PP0A 4JVDA 2ONRA 4JB7A 1B51A 5CMCA 1SDXA 4YB6A 4R73A 4MHFA 2I0CA 1B3LA 1II5A 1MQIA 2Q2CA 5A5LA 1RYOA 3TYHA 3IO6A 3VDFA 1MG1A 4EF1A 2FIXA 5IGAA 1CNQA 5EHMA 4F18A 2ZYMA 4OVPA 1LCFA 1YAEA 1A7LA 1NUYA 4EQ9A 2OJTA 1MPBA 4Q30B 4H5GA 3K2DA 4GWXA 2V93A 3TEPA 2Z8FA 3K4UA 1N7XA 3FV1A 3OMBA 3FBPA 3MUQA 3MVXA 1TWYA 3EKIA 4OFLA 1LCTA 1AIVA 3RY3A 3MSTA 1FW0A 1AH5A 5HM4B 3FGSA 4Z7EA 3CRBA 1NI9A 2B4LA 3SEWA 4P1LA 4G61A 3SKPA 4NG7A 4KCCA 1B1XA 4PC9A 3M8UA 4FIMA 2UVIA 4NF0A 3S2VA 4C1UA 3RPWA 1S7YA 2UYFA 1SYHA 2V4CA 2Q9TA 1ZJLA 2Y5KA 4MCOA 5M2VA 1NUWA 2CEYA 2RCBA 3RN8A 1VFDA 5ET7A 4YU0A 5EQ9A 4XXUA 1N3WA 1UTBA 3TPAA 1LFHA 3M3LA 5CMKA 2KLFA 2Z8DA 3IK6B 1FJ6A 4HXVA 3KSJA 2Q2AA 1ZLQA 5LOMA 3V89B 1Y1ZA 5CMMA 4I40A 1GR2A 3S4UA 4GL0A 5HPQA 1Q35A 1H44A 4PAKA 1FBDA 2RINA 1B4HA 2PX1A 1GV8A 5DVIA 1B7HA 3FJ7A 1PB7A 5TPAB 4JDFA 4E0XA 2PT1A 3TODA 1MXYA 1YPNA 5CC2A 1NNFA 1LB9A 1TT1A 1H43A 2VPNA 4R2BA 3RTFB 4OVSA 1Y3QA 3DP6A 4MEVA 3QUFA 4BDNA 1TFDA 4GQOA 1FCKA 1NH8A 1B05A 4OVRA 4XIGQ 5AA4B 4DLDA 3V83A 2I6EA 1IXHA 4RPNA 1AL3A 4LN5A 4PE5B 4U2RA 1M5EA 4GOTA 5I58A 5ITOA 1VE4A 1FPBA 4OTEA 1SYIA 3VVFA 1NV5A 2DOJA 4WXJA 3B6TA 4JSDA 3E78A 4NHBA 4GXSB 1FSAA 1D9YA 3C4MA 1P1WA 3L6GA 3O6HA 3R26A 1R1NA 1MXZA 1FBFA 1F9BA 2M8CA 4G68B 4H1XA 4LZ7A 1NH7A 4NF5B 1SVXB 2RCAA 4L17A 2DE4A 1A8FA 3O28A 2XX8A 5AA2A 4U23A 5I59B 1H45A 2Z22A 2O7UA 1FTKA 2Y7PA 3D4GA 4DIGA 4MFIA 4AB6A 2CEXA 2RC9A 1IITA 1FPJA 1P99A 3MWBA 2ONSA 4O7MA 3SEYA 1R6ZA 4N6PA 4X1DA 4N07A 4O3BA 1XT8A 4F3GA 4N81A 4ZECA 3BBRA 1NV6A 1GTKA 1XI6A 4G77A 1DPPA 3HHGA 1IQ7A 2GH9A 3UK4A 1B1HA 3FD3A 5FHNA 4FE8A 3CHGA 1EU8A 4O7IA 1UTHA 1Y20A 5EYGA 4AQ4A 2ONKE 3SEUA 5I57A 3CG3A 1B5IA 3D1RA 1FTOA 2CZHA 3T9UA 1NUXA 3PUVE 3TQLA 2H4IA 2DYXA 1IIWA 1HSLA 2FIEA 3USDA 4P11A 4F22A 4RYAA 4ISUA 2OCUA 2ZZWA 4PE3A 3FVOA 3PPQA 5EYHA 2PYYA 2REJA 1DOTA 2FBPA 1NV0A 1IXGA 4G8HA 4JVIA 3K1NA 3RPLA 2F78A 4NWCA 3FATA 4GRKA 5ET8A 1FPGA 1MQGA 5J1DA 3OSQA 3B6WA 4YB5A 3EHUA 4YZZA 4GWYA 5HBCA 3H7MA 4YAHX 3N26A 4DXUA 1LAFE 4HE1A 4FEBA 1N84A 2I3WA 1KWHA 2ZYKA 4MLVA 5H8QB 1QUJA 1S9TA 5KDTB 3S9EA 4NGUA 4P9KA 4NF8B 4KI0E 1FRPA 5K2XA 5H8NB 4X04A 2H25A 4THIA 3E13X 1MDP1 3HSTA 3DP4A 3RUMA 1NV2A 4GWWA 4UACA 4PF6A 3Q28A 3EN3A 3O6GA 2D5WA 1M5DA 2KQZA 1O7TA 4QSEA 2F5XA 3OELA 1SQYA 3OSRA 2WEFA 3P7IA 1L5TA 4F3PA 4M4GA 2QS2A 5H8SA 2YJPA 1FQDA 3K6WA 5H8FA 1CB6A 1FBEA 5I59A 3I5OA 5EHSA 3B8BA 5CM6A 5AA2D 1T0KA 3CFZA 4KYDA 1DCUA 4PTKA 4JWOA 2I48A 3IJOB 2QS3A 2Q8JA 2ZNSA 4PF8A 3IOWA 3MQ9A 4R2FA 1EYKA 3I3VA 2NWJA 2R8TA 2VPOA 5H8NA 1IMCA 4MMPA 1P1NA 4QXDA 1AWBA 5CI5A 2DWIA 2XD2A 2KR0A 4KXPA 2O1MA 1LEVA 1B3EA 4MIJA 2P0SA 3KFMA 2F8DA 2X7PA 3IFCA 4ZEFA 1B58A 1Y3PA 5H8QA 4RK9A 1JETA 1N3XA 1YCJA 1MXUA 2F7BA 4NWDA 1B3HA 4GL8A 4MNIA 4NF4A 4N91A 2XA5A 2OK2A 4MNPA 1NUZA 1Y3NA 4ND9A 4P0IA 3K02A 5IZZA 4YKPA 1ZBMA 3MP1A 3PU5A 5T3JA 2X7QA 4TLLB 3SEVA 1K9ZA 3FVGA 2R9JA 2QRYA 1YXIA 1JQFA 5ICQA 1FBHA 1RYXA 3FVNA 4NN3A 4FBPA 3T9VA 1VDWA 4F19A 4PETA 3H6VA 3K6VA 1MPCA 1FQEA 4GBVA 2VP1A 5JK4A 1B2HA 2I3VA 4R72A 4YKKA 1A54A 3OO6A 3OEMA 4IO4A 4MBPA 3PUZE 3TTKA 1UTBB 1KA0A 4ZE9A 3ILUB 5J16A 4GWZA 4DCXA 4ZZEA 2VT5A 1PC3A 2XXYA 1LLSA 2ANJA 3B7DA 4P56A 1MY3A 4KCDA 4LVQA 4U1OA 4IY5A 2OZZA 4R9GA 1IXIA 2LAOA 2DS9A 3HFUA 3IR1A 4DI4B 4FEDA 4N17A 3FIRA 3IAZA 1N04A 4OVQA 1BKAA 4HW8A 2O6AA 2REGA 1QKAA 1JVXA 2HAUA 4E0WA 1LAGE 3IX1A 4OEUA 3O9PA 4TLMB 3RT6B 1FPIA 3V5AA 1AOVA 1MQDA 3C32A 1Z7NE 2B3FA 4ZS9A 1NV1A 1USYE 2OBGA 3HO7A 1WDNA 4AS5A 4OMBA 2NUVA 4LUBA 5CRYA 2THIA 3IOTA 2F35A 2XXVA 2I4BA 1CE2A 3TMGA 2HCAA 2JJKA 2ZXTA 4R9FA 5KCJB 1BIYA 2UXAA 4GWUA 5AA4A 1MS7A 3OOAA 4ZZAA 2UVHA 3CFLA 5AA1A 4F2OA 2Y7WA 3SZPA 3S9NC 3KN3A 3DP8A 2I4CA 1LB8A 5IZ3B 3LBSA 4PFWA 4F3SA 4RNSA 3QMFA 3NOHA 2ALUA 4MJOA 2FYIA 2O68A 2DWHA 1YTVA 2H99A 2PT2A 3O6IA 3U94A 5TPAA 5I5PA 3KOSA 2ZNUA 2WBBA 1Y4CA 2R6GE 1URDA 3ECRA 4FECA 2Z23A 3TKDA 3VVEA 4I62A 1I6BA 3RGYA 3SEXA 4AS4A 1FPKA 4F29A 1FTLA 2DWAA 4C0RA 4XKRA 5AE4A 5I56B 5IKBA 1I6AA 4LONB 2E0SA 3KC0A 4OETA 4G68C 2X26A 3PPRA 4X1BA 5FBPA 2O69A 1BP5A 3FVKA 1MH4A 3MJNA 3K6UA 1MDQA 3CVGA 1A40A 5EQ8A 3TCHA 4O8MA 1EH3A 1PBPA 4M1VA 5I84A 4LA9A 4ELPA 4QFKA 4Q8RA 4P0GA 5F7VA 1MY1A 1LBZA 4QSCA 4QFOA 4ZEBA 1P1QA 2HQ0A 5FTHA 4IO6A 5JTYB 5L9OA 3FXRA 2AIXA 4N15A 5K2YA 1IXCA 2GHAA 1VR5A 1NV7A 4JXIA 1LBBA 1LAHE 3H06B 1USYH 3K6XA 2NOOA 3MVZA 4GBWA 4NF6A 4Z0IA 3R7XA 1SD3A 1ZU0A 2DDKA 1I6QA 2HEUA 3TELA 1KA1A 3LSXA 3MW0A 1OLAA 1Y9UA 5IZ1A 4DE8A 3A09A 2XXUA 2QVVA 3DM0A 1NFTA 2AL5A 4R75A 4OA4A 4PQJA 3QSLA 2B3BA 2HXRA 4PFUA 1FPFA 3PD9A 2XWVA 1YZ0A 2P1SA 4JVCA 2RKMA 3C9HA 4PAIA 4G2ZA 5I2KA 1B5JA 3ZS6A 1SPIA 3ISPA 2DXRA 3BIHA 2D21A 1ZTYA 2XXPA 1NV4A 4JWXA 4HTGA 3IFAA 3KBRA 2VD3A 4IGRA 3GLBA 2F7AA 4PFYA 5TP9A 1RDYA 2CZKA 1B0HA 4GX6A 2WX9A 3IOUA 3K00A 3RNNA 3QK6A 4PFTA 4F3BA 3H6TA 5I2KB 1GVCA 3PUWE 4P47A 2I49A 2BJIA 3B50A 4PFRA 3N6UA 1JW5A 3OO7A 1D4NA 3VLUA 4BDMA 4IR8A 3TFLA 1YYZA 5ISUA 1FJ9A 2V25A 1OVTA 1HSEA 5DTBA 2GFEA 2ZYNA 5KZTA 3IB0A 4H45A 2F6PA 2Z8EA 2GQ1A 1N7WA 3UA8A 4C1TA 5ET5A 4N8GA 5JEIA 3KN8A 4YICA 3BIGA 3EQ1A 5I3SA 4R6KA 4ZE8A 3GZGA 1NV3A 4PFBA 3QYTA 4NF6B 4OVJA 4Q0CA 1P1OA 3ZKKA 5AA2B 3QAXA 4HCYA 2H5YA 1D3KA 4N8YA 1FQAA 2WBDA 1Z7ME 2XXKA 4GVOA 3G3GA 1EZ9A 2Y7KA 4XKQA 2ZZXA 4G68A 4OENA 1DMBA 3UIFA 1B6HA 4MH5A 1SW5A 4FAJA 4TOZA 3MYUA 2PFYA 4O3AA 1RKMA 4LP2B 1P1UA 5I58B 4QF9A 3O2AA 5CBRA 2NXOA 2F3DA 1MY0A 3F11A 3KOTA 2CZLA 3ROJA 4U4XA 2XWIA 1JW4A 5LTCA 3QXMA 1SI0A 3TQWA 1NNKA 3VE1B 4I9DA 4R6HA 5TU0A 4NX1A 1PB8A 1N0TA 3C36A 1B7ZA 2CMOA 1ZKBA 2Q88A 3CR9A 3IB2A 4PFIA 5EYFA 1O63A 3MZ1A 3LR1A 3H6WA 3IOVA 4IY6A 4PDHA 3KBZA 1N76A 3Q29A 4NQ8A 2V84A 3PPPA 3QUJA 5CMBA 4EF2A 3GBAA 5DVJA 1XS5A 4OZ9A 2V3UA 3OO9A 3U1OA 3LSFB 4H46A 3W9VA 3FASA 1JP4A 1R9QA 5DVFA 2XXRA 3M3KA 4ESXA 3OXNA 4DXBA 1XOCA 2PBWA 4ZEKA 3EHTA 2ZMBA 3KJ7A 1MM6A 4IO3A 1MXWA 2OWTA 2QVUA 3MBPA 3RT8A 1PB9A 2XXQA 3S9MC 5L9MA 4GF8A 3KN7A 4PDDA 3ZSFA 3PMWA 1H3DA 4KHZE 3H6UA 3CSGA 3LSWA 1BLFA 5DYHA 3IL1B 1WODA 4YKIA 3FV2A 1OQHA 2O84X 1DK4A 3WAFA 2O1LA 5FHOA 2BJJX 4IO2A 2DVCA 1POY1 3QIMA 3W15C 3FXQA 3MAMA 4DZ1A 4EQ7A 4I1DA 5JTYA 3O29A 1JVYA 3G3JA 4DXCA 3U92A 4LQ5A 1LBYA 3PD8A 4GIZA 5I7IA 3BFUA 1DTGA 2XD3A 3MC2A 4ELOA 4ZEDA 1B7UA 3H3GA 4EQBA 1IMDA 4H65A 3RQTA 3E9XA 3JZJA 1IMAA 2QVRA 4BLAA 2XX9A 1EZPA 4TQUQ 4QRZA 4G4PA 4JWYA 1QUKA 5IAIA 1US5A 1MY4A 2V3QA 1PDAA 2OLBA 4I3EA 1VSOA 3V8XB 1Y4TA 3K1PA 5ET6A 4NMYA 1B4ZA 2PCRA 3KEIA 4NTLA 3LV0A 3R6UA 3A3UA 4QSDA 5DEXA 3FXUA 4H67A 3N5LA 1O64A 2AL4A 1LBXA 3PUXE 2GRVA 4P1EA 1FQBA 5I56A 1Y1MA 3VXCA 1G0HA 1ZIUA 3MZBA 1K9YA 4IO5A 3MVYA 4G8NA 1MQJA 4GLIA 2Y7RA 3C35A 2AYSA 2H9BA 1H76A 1SW1A 5KCJA 3Q27A 1B40A 1IZ1A 1IMBA 3VXBA 4EXKA 5ITPA 4LATA 2IEEA 4RK2A 4XF5A 3HPIA 2ESNA 3CI8A 4GD5A 3PPOA 5IZ3A 4N13A 4RJZA 3O97A
chains in the Genus database with same CATH topology
1FJ6A 1NV3A 1IMDA 4MNCA 4NQ8A 5I5PA 1LEVA 4PFBA 4HCWA 4MIJA 4MHFA 3A29A 4HXVA 1KA1A 1FPEA 3U65A 4N4UA 3IFCA 4OVTA 4P56A 3W9WA 2WBBA 3RPLB 1G0IA 1IMAA 2QVRA 2CEXA 4F1UA 5IGAA 5A5LA 1KZ8A 4I40A 4HE1A 4QBAA 2Q8MA 3T1BA 5LDZA 4H46A 5IZ1A 3W9VA 4PAKA 1FPJA 4HCYA 4O7MA 5EQ7A 1FBDA 2QVVA 2FIXA 3HFUA 2OWZA 1CNQA 1JP4A 2DE2A 3LUZA 2XA5A 2XWKA 4MNIA 4N8YA 4N91A 4P3LA 4OA4A 2WBDA 4F18A 4N81A 4DI4B 1NV6A 2XXKA 4OVPA 4N17A 4AS4A 4MNPA 2Y5LA 1NUZA 2V3QA 2HXRA 4I3EA 1FPKA 4OVQA 4PBHA 1FPFA 1NUYA 2ZZXA 5IZZA 1XI6A 3E79A 1FBGA 2XWVA 4NGUA 4P9KA 1YZ0A 4JVCA 5ET6A 1FRPA 4O94A 2P3VA 4PAIA 4GX4A 3MYUA 2OX3A 4GWXA 2PCRA 3KC0A 4X04A 5T3JA 5IM2A 2PFYA 2VPNA 2P3NA 3LV0A 3CHGA 2WYPA 4O7IA 1D9QA 5FBPA 3FBPA 1SPIA 1FPIA 2QVUA 3ISPA 4GX3A 4OVSA 4PGPA 1K9ZA 2XWOA 5EYGA 2FVZA 4MEVA 3EKIA 4N6DA 4N6KA 3T0JA 3BIHA 1NV2A 2FHYA 4GWWA 4X8RA 4PF6A 1FPLA 1FPDA 1LBXA 1YXIA 2QFLA 3KC1A 4OVRA 1NV4A 2Q74A 5EQ8A 4PDDA 4AS5A 4F1VA 3IFAA 4HE0A 5DW8A 3MSTA 1FBHA 3D1RA 1NV1A 2KQZA 4O8MA 2CZHA 2HHMA 4PAFA 4PGNA 2F5XA 5ESYA 1RDYA 2CZKA 4M1VA 4FBPA 4NN3A 4P1EA 1NUXA 4GX6A 4P8BA 5EQAA 2F3DA 4LN5A 2WX9A 2WEFA 1NI9A 4GWSA 2DE3A 2B4LA 1G0HA 1FPBA 1VDWA 4F19A 4P1LA 4G61A 4MX6A 4PETA 1K9YA 4I3YA 4NG7A 3ROJA 3RYDA 2XWIA 1NV5A 2FIEA 4PBQA 1DBZA 4PC9A 1LBZA 1DK4A 5LTCA 1RDZA 2DVZA 1QGXA 2MKZA 4P47A 2BJIA 2F3BA 3B50A 1Q9DA 3FXBA 4GBVA 4NF0A 2HZLA 4PFRA 3E78A 4NHBA 2ZZWA 4PE3A 5EYHA 5F24A 1FSAA 4NAPA 2FBPA 4NX1A 1NV0A 2QPQA 2JJKA 1RDXA 5JK4A 1FBEA 2WYKA 4HE2A 1BK4A 1EYIA 1FBPA 1LBWA 2V4CA 4N15A 1IMFA 2Q9TA 1IMBA 4IR8A 1YYZA 4GWUA 1FJ9A 4JVIA 3RPLA 3B8BA 1FBFA 3GYYA 5CM6A 1NV7A 2Y5KA 2PFZA 4MCOA 1NUWA 2CEYA 3PTYA 5ET8A 3SZPA 1EYJA 1DCUA 4PTKA 1KA0A 1FTAA 1FBCA 4H45A 5ET7A 1FPGA 2B4MA 2GQ1A 2ZZVA 1LBYA 4PF8A 4DI3D 2L5VA 5J16A 4XEQA 4PFIA 5IZ3B 4PCDA 5EQ9A 1LBVA 4GWZA 5I7IA 4XF5A 1INPA 1EYKA 2DE4A 2HPGA 4N8GA 5ET5A 5J1DA 2R8TA 2VPOA 4GBWA 4YICA 2VT5A 3QMFA 1IMEA 3NOHA 1IMCA 2HZKA 3BIGA 2CZIA 4MAGA 4MMPA 4MJOA 4QXDA 4X9TA 1AWBA 4OANA 4UABA 4YZZA 4GWYA 5I3SA 4JVDA 4PDHA 3KBZA 2KR0A 5IZ3A 4XFEA 2DDKA 4KXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MNC A;  4NQ8 A;  5I5P A;  4PFB A;  4MIJ A;  4MHF A;  3U65 A;  4N4U A;  4OVT A;  4P56 A;  2CEX A;  4PAK A;  4O7M A;  4MNI A;  5IGA A;  4N91 A;  2XA5 A;  2XWK A;  4N8Y A;  4OA4 A;  4DI4 B;  4OVP A;  2XXK A;  4N17 A;  4MNP A;  4OVQ A;  4PBH A;  2ZZX A;  5IZZ A;  2XWV A;  4NGU A;  4P9K A;  4O94 A;  4PAI A;  4X04 A;  5IM2 A;  2PFY A;  2VPN A;  2WYP A;  4OVS A;  4PGP A;  2XWO A;  4MEV A;  4N6D A;  4N6K A;  4X8R A;  4PF6 A;  4OVR A;  4PDD A;  4O8M A;  4PGN A;  4PAF A;  4NN3 A;  4P1E A;  4P8B A;  4LN5 A;  2WX9 A;  4P1L A;  4MX6 A;  4PET A;  4NG7 A;  2XWI A;  4PBQ A;  4PC9 A;  5LTC A;  4P47 A;  3B50 A;  4NF0 A;  4PFR A;  3FXB A;  2HZL A;  4NHB A;  2ZZW A;  4PE3 A;  4NAP A;  4NX1 A;  2WYK A;  4N15 A;  2V4C A;  3GYY A;  5CM6 A;  2PFZ A;  4MCO A;  2CEY A;  2ZZV A;  4DI3 D;  4PF8 A;  4XEQ A;  4PFI A;  4PCD A;  5I7I A;  4XF5 A;  2HPG A;  4N8G A;  2VPO A;  4YIC A;  4P3L A;  4MAG A;  2HZK A;  4MMP A;  4OAN A;  4UAB A;  4YZZ A;  4PDH A;  4XFE A; 
#chains in the Genus database with same CATH topology
 4U4S A;  1FPE A;  1GGG A;  2HFB A;  3VV5 A;  1QW0 A;  4IO7 A;  4AB5 A;  4MF3 A;  2VHA A;  2Q8M A;  3T1B A;  5LDZ A;  2DWJ A;  2QS1 A;  3Q26 A;  1OIB A;  2OWZ A;  2DE2 A;  3TTN A;  3DLN A;  2UYE A;  3G3K A;  3CSB A;  4PBH A;  3TZA A;  3ILT B;  3E79 A;  3JYR A;  1ANF A;  3LC8 A;  1OQG A;  4O94 A;  3HN0 A;  3VFJ A;  4GX4 A;  2OX3 A;  4QFN A;  4R74 A;  2QS4 A;  3T9X B;  2QSX A;  2F34 A;  2F7C A;  4PGP A;  4ECF A;  3T0J A;  1EZO A;  1FPL A;  2D3I A;  2R71 A;  1B3G A;  2A5T B;  4PAF A;  2HHM A;  1LBC A;  4P8B A;  1DSN A;  1Q1K A;  3UGW A;  1JNF A;  4I3Y A;  2V3T A;  4PBQ A;  1MRP A;  4F31 B;  2OWS A;  4LQ2 A;  1Q9D A;  1DTZ A;  1FTM A;  4HE2 A;  1LBW A;  5DT6 A;  3GYY A;  4LZ8 A;  3KGC A;  3PTY A;  1XC1 A;  2VD2 A;  1R9L A;  4NED A;  5BUU A;  4OYV A;  2ZZV A;  5I2N A;  1M5F A;  4XEQ A;  3T22 A;  4FOR A;  3H03 A;  3CFX A;  1JEV A;  3ZKL A;  4I8C A;  2CZI A;  4LZ5 A;  4UAB A;  3H4Z A;  5BWJ A;  4WEP A;  1NNT A;  4GFR A;  1LST A;  4OHN A;  5EQ7 A;  3FJG A;  2G93 A;  3D4C A;  4IB2 A;  4BDQ A;  2DQV A;  3MVW A;  4R6Y A;  4X48 A;  2W7Y A;  3PUY E;  5F1Q A;  2IA4 A;  3E3K A;  4ESW A;  4OER A;  3PMV A;  3CIJ A;  1SW4 A;  2XXX A;  4H6D A;  4FJP A;  5IM2 A;  4KR5 A;  4MLQ A;  2HXW A;  4U22 A;  2PVU A;  4ZDM A;  2UVJ A;  1VFE A;  4IGT A;  2FHY A;  1FPD A;  4YKJ A;  2Q74 A;  3G3I A;  3ODB A;  4F1V A;  5A5X A;  1XVX A;  4H8J A;  1MH3 A;  5EQA A;  5I57 B;  4MX6 A;  4WED A;  3TUS A;  1TXF A;  3SET A;  4RA1 A;  2DVZ A;  4G8M A;  4NF4 B;  1LFI A;  5F24 A;  1SI1 A;  1BK4 A;  3SDF A;  1IMF A;  4OES A;  5H8F B;  1M5B A;  1SBP A;  2PFZ A;  1URS A;  2VOZ A;  3LSL A;  5DEX B;  1XHY A;  3S9L C;  3L6H A;  1INP A;  4H5F A;  3SER A;  4P3L A;  3LUY A;  4X9T A;  1XVY A;  2I58 A;  3TAJ A;  3Q25 A;  5AA3 A;  1QVS A;  2QMX A;  4JSO A;  2ZYO A;  1M5C A;  3TCF A;  4KFQ A;  2VGQ A;  4O3C A;  3W9W A;  1G0I A;  4ONY A;  1A99 A;  1NL5 A;  3A3C A;  4QBA A;  1MQH A;  1B52 A;  5ELV A;  3SES A;  1LGB C;  1ATG A;  4NF8 A;  4GXA A;  3LUZ A;  2XWK A;  5KDT A;  3T66 A;  4POX A;  3N6T A;  2Y5L A;  2XHD A;  5H8H B;  3PPN A;  3K01 A;  3B6Q A;  1MXX A;  2P3V A;  4OQO A;  1POT A;  3C33 A;  1URG A;  3EPE A;  4WKM A;  4H0W A;  2RC8 A;  5ICT A;  3G7W A;  2DXY A;  2FNC A;  1B46 A;  1UQW A;  2XWO A;  4N6D A;  4DCY A;  4YMB A;  4XTC Q;  4KPT A;  2RC7 A;  3KC1 A;  4GWO A;  4OEV A;  1I69 A;  4BDR A;  1D9V A;  4PGN A;  3UN6 A;  3PV0 E;  5A5X B;  3HV1 A;  5FHM A;  1RDZ A;  3KSX A;  3FXB A;  2HZL A;  3HCQ A;  2RF1 A;  2QPQ A;  1TFA A;  3O66 A;  3PMX A;  1MPD A;  1FTJ A;  3K1M A;  3TTR A;  3T96 B;  1FBC A;  4ELQ A;  3VVD A;  3RTW B;  3M3F A;  4ZEI A;  3RLF E;  4DI3 D;  3C31 A;  1FQC A;  4PCD A;  3PGF A;  2HPG A;  1BTJ A;  1OLC A;  3KJT A;  4YB7 A;  1MM7 A;  1JEU A;  1US4 A;  3AXF A;  4HS7 A;  3EHS A;  4KYS A;  4XKN A;  4BDL A;  3IB1 A;  1OVB A;  4HCW A;  3U65 A;  3U8Q A;  1NKX A;  4OVT A;  3RPL B;  4KQP A;  1UTH B;  3CG1 A;  4EDP A;  1KZ8 A;  4QFP A;  5B70 A;  5L9S A;  3MP6 A;  3MPL A;  4XKP A;  2XXH A;  4DDD A;  3OD7 A;  3MP8 A;  4F2Q A;  1QJM A;  1S50 A;  2GHB A;  2QMW A;  5H8H A;  3BFT A;  3E4R A;  3IOR A;  2Y84 A;  2WYP A;  3WAE A;  3C34 A;  4GX3 A;  2FVZ A;  4EUO A;  2O51 A;  2QFL A;  4NE4 A;  2F36 A;  3FUZ A;  1JW1 A;  2PMS A;  4UA8 A;  2WKY A;  3OO8 A;  1NMU A;  1SW2 A;  1PEB A;  4GWS A;  2A5T A;  3G3H A;  4RPO A;  1B32 A;  2YPN A;  1DBZ A;  2XXT A;  2F3B A;  1MY2 A;  1MXV A;  1AMF A;  2B65 A;  5FTI A;  4NAP A;  2UVG A;  2F97 A;  4U21 A;  1RDX A;  2WYK A;  4YMA A;  5CBS A;  3JV9 A;  2Y7I A;  2QJE A;  3FJM A;  1EYJ A;  3OEN A;  3U93 A;  4BDO A;  2B4M A;  1J1N A;  2L5V A;  1IEJ A;  1LBV A;  2XXI A;  3BKI B;  4MAG A;  1B3F A;  2HZK A;  4OAN A;  5L8D A;  4QFL A;  4NF5 A;  4XFE A;  4MNC A;  4OWD A;  2F6G A;  1LFG A;  3A29 A;  4JBZ A;  4N4U A;  1A8E A;  3MPK A;  2ZNT A;  1B9J A;  3MZ9 A;  3TCG A;  4F1U A;  3VLV A;  1LAX A;  1FQF A;  1B5H A;  1DPE A;  1QKB A;  3TTM A;  4OFO A;  4RY1 A;  4U1Z A;  3KZG A;  4FAT A;  1B0L A;  2XX7 A;  2H98 A;  4EXL A;  2A5S A;  1FBG A;  1OMP A;  3G3F A;  1ELJ A;  2Q89 A;  3IJX B;  2HAV A;  4QHQ A;  3VLW A;  1QUL A;  4KYE A;  2P3N A;  4OXV A;  4Q5T A;  1D9Q A;  3FZV A;  2E1S A;  2I0B A;  2G29 A;  4KD5 A;  4N6K A;  3IO4 A;  4X8R A;  1QUI A;  2NVU B;  1IUD A;  1ZMG A;  4H8I A;  1HSJ A;  4HE0 A;  5DW8 A;  1UIV A;  1NNP A;  3K0V A;  5ESY A;  2DSF A;  3THI A;  1PBQ A;  2XXW A;  2DE3 A;  2P2A A;  3UP9 A;  3HHF A;  3TDJ A;  3RYD A;  3U72 A;  2DP8 A;  3DEL B;  3ONM A;  2ABH A;  1QGX A;  2MKZ A;  3N94 A;  1A55 A;  4K3F A;  3T93 B;  4ELR A;  3GXA A;  1UIU A;  5I2N B;  3I6V A;  2YLN A;  5TP9 B;  1EYI A;  1FBP A;  4F1Y A;  3OEK A;  3GBB A;  3TTL A;  1FTA A;  2FA7 A;  2O7I A;  4RXL A;  4POW A;  5B7D A;  3KG2 A;  3EF7 A;  3UOR A;  4OFJ A;  4F39 A;  1IME A;  3T9H B;  1WVJ A;  2QL3 A;  4PP0 A;  4JVD A;  2ONR A;  4JB7 A;  1B51 A;  5CMC A;  1SDX A;  4YB6 A;  4R73 A;  4MHF A;  2I0C A;  1B3L A;  1II5 A;  1MQI A;  2Q2C A;  5A5L A;  1RYO A;  3TYH A;  3IO6 A;  3VDF A;  1MG1 A;  4EF1 A;  2FIX A;  5IGA A;  1CNQ A;  5EHM A;  4F18 A;  2ZYM A;  4OVP A;  1LCF A;  1YAE A;  1A7L A;  1NUY A;  4EQ9 A;  2OJT A;  1MPB A;  4Q30 B;  4H5G A;  3K2D A;  4GWX A;  2V93 A;  3TEP A;  2Z8F A;  3K4U A;  1N7X A;  3FV1 A;  3OMB A;  3FBP A;  3MUQ A;  3MVX A;  1TWY A;  3EKI A;  4OFL A;  1LCT A;  1AIV A;  3RY3 A;  3MST A;  1FW0 A;  1AH5 A;  5HM4 B;  3FGS A;  4Z7E A;  3CRB A;  1NI9 A;  2B4L A;  3SEW A;  4P1L A;  4G61 A;  3SKP A;  4NG7 A;  4KCC A;  1B1X A;  4PC9 A;  3M8U A;  4FIM A;  2UVI A;  4NF0 A;  3S2V A;  4C1U A;  3RPW A;  1S7Y A;  2UYF A;  1SYH A;  2V4C A;  2Q9T A;  1ZJL A;  2Y5K A;  4MCO A;  5M2V A;  1NUW A;  2CEY A;  2RCB A;  3RN8 A;  1VFD A;  5ET7 A;  4YU0 A;  5EQ9 A;  4XXU A;  1N3W A;  1UTB A;  3TPA A;  1LFH A;  3M3L A;  5CMK A;  2KLF A;  2Z8D A;  3IK6 B;  1FJ6 A;  4HXV A;  3KSJ A;  2Q2A A;  1ZLQ A;  5LOM A;  3V89 B;  1Y1Z A;  5CMM A;  4I40 A;  1GR2 A;  3S4U A;  4GL0 A;  5HPQ A;  1Q35 A;  1H44 A;  4PAK A;  1FBD A;  2RIN A;  1B4H A;  2PX1 A;  1GV8 A;  5DVI A;  1B7H A;  3FJ7 A;  1PB7 A;  5TPA B;  4JDF A;  4E0X A;  2PT1 A;  3TOD A;  1MXY A;  1YPN A;  5CC2 A;  1NNF A;  1LB9 A;  1TT1 A;  1H43 A;  2VPN A;  4R2B A;  3RTF B;  4OVS A;  1Y3Q A;  3DP6 A;  4MEV A;  3QUF A;  4BDN A;  1TFD A;  4GQO A;  1FCK A;  1NH8 A;  1B05 A;  4OVR A;  4XIG Q;  5AA4 B;  4DLD A;  3V83 A;  2I6E A;  1IXH A;  4RPN A;  1AL3 A;  4LN5 A;  4PE5 B;  4U2R A;  1M5E A;  4GOT A;  5I58 A;  5ITO A;  1VE4 A;  1FPB A;  4OTE A;  1SYI A;  3VVF A;  1NV5 A;  2DOJ A;  4WXJ A;  3B6T A;  4JSD A;  3E78 A;  4NHB A;  4GXS B;  1FSA A;  1D9Y A;  3C4M A;  1P1W A;  3L6G A;  3O6H A;  3R26 A;  1R1N A;  1MXZ A;  1FBF A;  1F9B A;  2M8C A;  4G68 B;  4H1X A;  4LZ7 A;  1NH7 A;  4NF5 B;  1SVX B;  2RCA A;  4L17 A;  2DE4 A;  1A8F A;  3O28 A;  2XX8 A;  5AA2 A;  4U23 A;  5I59 B;  1H45 A;  2Z22 A;  2O7U A;  1FTK A;  2Y7P A;  3D4G A;  4DIG A;  4MFI A;  4AB6 A;  2CEX A;  2RC9 A;  1IIT A;  1FPJ A;  1P99 A;  3MWB A;  2ONS A;  4O7M A;  3SEY A;  1R6Z A;  4N6P A;  4X1D A;  4N07 A;  4O3B A;  1XT8 A;  4F3G A;  4N81 A;  4ZEC A;  3BBR A;  1NV6 A;  1GTK A;  1XI6 A;  4G77 A;  1DPP A;  3HHG A;  1IQ7 A;  2GH9 A;  3UK4 A;  1B1H A;  3FD3 A;  5FHN A;  4FE8 A;  3CHG A;  1EU8 A;  4O7I A;  1UTH A;  1Y20 A;  5EYG A;  4AQ4 A;  2ONK E;  3SEU A;  5I57 A;  3CG3 A;  1B5I A;  3D1R A;  1FTO A;  2CZH A;  3T9U A;  1NUX A;  3PUV E;  3TQL A;  2H4I A;  2DYX A;  1IIW A;  1HSL A;  2FIE A;  3USD A;  4P11 A;  4F22 A;  4RYA A;  4ISU A;  2OCU A;  2ZZW A;  4PE3 A;  3FVO A;  3PPQ A;  5EYH A;  2PYY A;  2REJ A;  1DOT A;  2FBP A;  1NV0 A;  1IXG A;  4G8H A;  4JVI A;  3K1N A;  3RPL A;  2F78 A;  4NWC A;  3FAT A;  4GRK A;  5ET8 A;  1FPG A;  1MQG A;  5J1D A;  3OSQ A;  3B6W A;  4YB5 A;  3EHU A;  4YZZ A;  4GWY A;  5HBC A;  3H7M A;  4YAH X;  3N26 A;  4DXU A;  1LAF E;  4HE1 A;  4FEB A;  1N84 A;  2I3W A;  1KWH A;  2ZYK A;  4MLV A;  5H8Q B;  1QUJ A;  1S9T A;  5KDT B;  3S9E A;  4NGU A;  4P9K A;  4NF8 B;  4KI0 E;  1FRP A;  5K2X A;  5H8N B;  4X04 A;  2H25 A;  4THI A;  3E13 X;  1MDP 1;  3HST A;  3DP4 A;  3RUM A;  1NV2 A;  4GWW A;  4UAC A;  4PF6 A;  3Q28 A;  3EN3 A;  3O6G A;  2D5W A;  1M5D A;  2KQZ A;  1O7T A;  4QSE A;  2F5X A;  3OEL A;  1SQY A;  3OSR A;  2WEF A;  3P7I A;  1L5T A;  4F3P A;  4M4G A;  2QS2 A;  5H8S A;  2YJP A;  1FQD A;  3K6W A;  5H8F A;  1CB6 A;  1FBE A;  5I59 A;  3I5O A;  5EHS A;  3B8B A;  5CM6 A;  5AA2 D;  1T0K A;  3CFZ A;  4KYD A;  1DCU A;  4PTK A;  4JWO A;  2I48 A;  3IJO B;  2QS3 A;  2Q8J A;  2ZNS A;  4PF8 A;  3IOW A;  3MQ9 A;  4R2F A;  1EYK A;  3I3V A;  2NWJ A;  2R8T A;  2VPO A;  5H8N A;  1IMC A;  4MMP A;  1P1N A;  4QXD A;  1AWB A;  5CI5 A;  2DWI A;  2XD2 A;  2KR0 A;  4KXP A;  2O1M A;  1LEV A;  1B3E A;  4MIJ A;  2P0S A;  3KFM A;  2F8D A;  2X7P A;  3IFC A;  4ZEF A;  1B58 A;  1Y3P A;  5H8Q A;  4RK9 A;  1JET A;  1N3X A;  1YCJ A;  1MXU A;  2F7B A;  4NWD A;  1B3H A;  4GL8 A;  4MNI A;  4NF4 A;  4N91 A;  2XA5 A;  2OK2 A;  4MNP A;  1NUZ A;  1Y3N A;  4ND9 A;  4P0I A;  3K02 A;  5IZZ A;  4YKP A;  1ZBM A;  3MP1 A;  3PU5 A;  5T3J A;  2X7Q A;  4TLL B;  3SEV A;  1K9Z A;  3FVG A;  2R9J A;  2QRY A;  1YXI A;  1JQF A;  5ICQ A;  1FBH A;  1RYX A;  3FVN A;  4NN3 A;  4FBP A;  3T9V A;  1VDW A;  4F19 A;  4PET A;  3H6V A;  3K6V A;  1MPC A;  1FQE A;  4GBV A;  2VP1 A;  5JK4 A;  1B2H A;  2I3V A;  4R72 A;  4YKK A;  1A54 A;  3OO6 A;  3OEM A;  4IO4 A;  4MBP A;  3PUZ E;  3TTK A;  1UTB B;  1KA0 A;  4ZE9 A;  3ILU B;  5J16 A;  4GWZ A;  4DCX A;  4ZZE A;  2VT5 A;  1PC3 A;  2XXY A;  1LLS A;  2ANJ A;  3B7D A;  4P56 A;  1MY3 A;  4KCD A;  4LVQ A;  4U1O A;  4IY5 A;  2OZZ A;  4R9G A;  1IXI A;  2LAO A;  2DS9 A;  3HFU A;  3IR1 A;  4DI4 B;  4FED A;  4N17 A;  3FIR A;  3IAZ A;  1N04 A;  4OVQ A;  1BKA A;  4HW8 A;  2O6A A;  2REG A;  1QKA A;  1JVX A;  2HAU A;  4E0W A;  1LAG E;  3IX1 A;  4OEU A;  3O9P A;  4TLM B;  3RT6 B;  1FPI A;  3V5A A;  1AOV A;  1MQD A;  3C32 A;  1Z7N E;  2B3F A;  4ZS9 A;  1NV1 A;  1USY E;  2OBG A;  3HO7 A;  1WDN A;  4AS5 A;  4OMB A;  2NUV A;  4LUB A;  5CRY A;  2THI A;  3IOT A;  2F35 A;  2XXV A;  2I4B A;  1CE2 A;  3TMG A;  2HCA A;  2JJK A;  2ZXT A;  4R9F A;  5KCJ B;  1BIY A;  2UXA A;  4GWU A;  5AA4 A;  1MS7 A;  3OOA A;  4ZZA A;  2UVH A;  3CFL A;  5AA1 A;  4F2O A;  2Y7W A;  3SZP A;  3S9N C;  3KN3 A;  3DP8 A;  2I4C A;  1LB8 A;  5IZ3 B;  3LBS A;  4PFW A;  4F3S A;  4RNS A;  3QMF A;  3NOH A;  2ALU A;  4MJO A;  2FYI A;  2O68 A;  2DWH A;  1YTV A;  2H99 A;  2PT2 A;  3O6I A;  3U94 A;  5TPA A;  5I5P A;  3KOS A;  2ZNU A;  2WBB A;  1Y4C A;  2R6G E;  1URD A;  3ECR A;  4FEC A;  2Z23 A;  3TKD A;  3VVE A;  4I62 A;  1I6B A;  3RGY A;  3SEX A;  4AS4 A;  1FPK A;  4F29 A;  1FTL A;  2DWA A;  4C0R A;  4XKR A;  5AE4 A;  5I56 B;  5IKB A;  1I6A A;  4LON B;  2E0S A;  3KC0 A;  4OET A;  4G68 C;  2X26 A;  3PPR A;  4X1B A;  5FBP A;  2O69 A;  1BP5 A;  3FVK A;  1MH4 A;  3MJN A;  3K6U A;  1MDQ A;  3CVG A;  1A40 A;  5EQ8 A;  3TCH A;  4O8M A;  1EH3 A;  1PBP A;  4M1V A;  5I84 A;  4LA9 A;  4ELP A;  4QFK A;  4Q8R A;  4P0G A;  5F7V A;  1MY1 A;  1LBZ A;  4QSC A;  4QFO A;  4ZEB A;  1P1Q A;  2HQ0 A;  5FTH A;  4IO6 A;  5JTY B;  5L9O A;  3FXR A;  2AIX A;  4N15 A;  5K2Y A;  1IXC A;  2GHA A;  1VR5 A;  1NV7 A;  4JXI A;  1LBB A;  1LAH E;  3H06 B;  1USY H;  3K6X A;  2NOO A;  3MVZ A;  4GBW A;  4NF6 A;  4Z0I A;  3R7X A;  1SD3 A;  1ZU0 A;  2DDK A;  1I6Q A;  2HEU A;  3TEL A;  1KA1 A;  3LSX A;  3MW0 A;  1OLA A;  1Y9U A;  5IZ1 A;  4DE8 A;  3A09 A;  2XXU A;  2QVV A;  3DM0 A;  1NFT A;  2AL5 A;  4R75 A;  4OA4 A;  4PQJ A;  3QSL A;  2B3B A;  2HXR A;  4PFU A;  1FPF A;  3PD9 A;  2XWV A;  1YZ0 A;  2P1S A;  4JVC A;  2RKM A;  3C9H A;  4PAI A;  4G2Z A;  5I2K A;  1B5J A;  3ZS6 A;  1SPI A;  3ISP A;  2DXR A;  3BIH A;  2D21 A;  1ZTY A;  2XXP A;  1NV4 A;  4JWX A;  4HTG A;  3IFA A;  3KBR A;  2VD3 A;  4IGR A;  3GLB A;  2F7A A;  4PFY A;  5TP9 A;  1RDY A;  2CZK A;  1B0H A;  4GX6 A;  2WX9 A;  3IOU A;  3K00 A;  3RNN A;  3QK6 A;  4PFT A;  4F3B A;  3H6T A;  5I2K B;  1GVC A;  3PUW E;  4P47 A;  2I49 A;  2BJI A;  3B50 A;  4PFR A;  3N6U A;  1JW5 A;  3OO7 A;  1D4N A;  3VLU A;  4BDM A;  4IR8 A;  3TFL A;  1YYZ A;  5ISU A;  1FJ9 A;  2V25 A;  1OVT A;  1HSE A;  5DTB A;  2GFE A;  2ZYN A;  5KZT A;  3IB0 A;  4H45 A;  2F6P A;  2Z8E A;  2GQ1 A;  1N7W A;  3UA8 A;  4C1T A;  5ET5 A;  4N8G A;  5JEI A;  3KN8 A;  4YIC A;  3BIG A;  3EQ1 A;  5I3S A;  4R6K A;  4ZE8 A;  3GZG A;  1NV3 A;  4PFB A;  3QYT A;  4NF6 B;  4OVJ A;  4Q0C A;  1P1O A;  3ZKK A;  5AA2 B;  3QAX A;  4HCY A;  2H5Y A;  1D3K A;  4N8Y A;  1FQA A;  2WBD A;  1Z7M E;  2XXK A;  4GVO A;  3G3G A;  1EZ9 A;  2Y7K A;  4XKQ A;  2ZZX A;  4G68 A;  4OEN A;  1DMB A;  3UIF A;  1B6H A;  4MH5 A;  1SW5 A;  4FAJ A;  4TOZ A;  3MYU A;  2PFY A;  4O3A A;  1RKM A;  4LP2 B;  1P1U A;  5I58 B;  4QF9 A;  3O2A A;  5CBR A;  2NXO A;  2F3D A;  1MY0 A;  3F11 A;  3KOT A;  2CZL A;  3ROJ A;  4U4X A;  2XWI A;  1JW4 A;  5LTC A;  3QXM A;  1SI0 A;  3TQW A;  1NNK A;  3VE1 B;  4I9D A;  4R6H A;  5TU0 A;  4NX1 A;  1PB8 A;  1N0T A;  3C36 A;  1B7Z A;  2CMO A;  1ZKB A;  2Q88 A;  3CR9 A;  3IB2 A;  4PFI A;  5EYF A;  1O63 A;  3MZ1 A;  3LR1 A;  3H6W A;  3IOV A;  4IY6 A;  4PDH A;  3KBZ A;  1N76 A;  3Q29 A;  4NQ8 A;  2V84 A;  3PPP A;  3QUJ A;  5CMB A;  4EF2 A;  3GBA A;  5DVJ A;  1XS5 A;  4OZ9 A;  2V3U A;  3OO9 A;  3U1O A;  3LSF B;  4H46 A;  3W9V A;  3FAS A;  1JP4 A;  1R9Q A;  5DVF A;  2XXR A;  3M3K A;  4ESX A;  3OXN A;  4DXB A;  1XOC A;  2PBW A;  4ZEK A;  3EHT A;  2ZMB A;  3KJ7 A;  1MM6 A;  4IO3 A;  1MXW A;  2OWT A;  2QVU A;  3MBP A;  3RT8 A;  1PB9 A;  2XXQ A;  3S9M C;  5L9M A;  4GF8 A;  3KN7 A;  4PDD A;  3ZSF A;  3PMW A;  1H3D A;  4KHZ E;  3H6U A;  3CSG A;  3LSW A;  1BLF A;  5DYH A;  3IL1 B;  1WOD A;  4YKI A;  3FV2 A;  1OQH A;  2O84 X;  1DK4 A;  3WAF A;  2O1L A;  5FHO A;  2BJJ X;  4IO2 A;  2DVC A;  1POY 1;  3QIM A;  3W15 C;  3FXQ A;  3MAM A;  4DZ1 A;  4EQ7 A;  4I1D A;  5JTY A;  3O29 A;  1JVY A;  3G3J A;  4DXC A;  3U92 A;  4LQ5 A;  1LBY A;  3PD8 A;  4GIZ A;  5I7I A;  3BFU A;  1DTG A;  2XD3 A;  3MC2 A;  4ELO A;  4ZED A;  1B7U A;  3H3G A;  4EQB A;  1IMD A;  4H65 A;  3RQT A;  3E9X A;  3JZJ A;  1IMA A;  2QVR A;  4BLA A;  2XX9 A;  1EZP A;  4TQU Q;  4QRZ A;  4G4P A;  4JWY A;  1QUK A;  5IAI A;  1US5 A;  1MY4 A;  2V3Q A;  1PDA A;  2OLB A;  4I3E A;  1VSO A;  3V8X B;  1Y4T A;  3K1P A;  5ET6 A;  4NMY A;  1B4Z A;  2PCR A;  3KEI A;  4NTL A;  3LV0 A;  3R6U A;  3A3U A;  4QSD A;  5DEX A;  3FXU A;  4H67 A;  3N5L A;  1O64 A;  2AL4 A;  1LBX A;  3PUX E;  2GRV A;  4P1E A;  1FQB A;  5I56 A;  1Y1M A;  3VXC A;  1G0H A;  1ZIU A;  3MZB A;  1K9Y A;  4IO5 A;  3MVY A;  4G8N A;  1MQJ A;  4GLI A;  2Y7R A;  3C35 A;  2AYS A;  2H9B A;  1H76 A;  1SW1 A;  5KCJ A;  3Q27 A;  1B40 A;  1IZ1 A;  1IMB A;  3VXB A;  4EXK A;  5ITP A;  4LAT A;  2IEE A;  4RK2 A;  4XF5 A;  3HPI A;  2ESN A;  3CI8 A;  4GD5 A;  3PPO A;  5IZ3 A;  4N13 A;  4RJZ A;  3O97 A; 
#chains in the Genus database with same CATH homology
 1FJ6 A;  1NV3 A;  1IMD A;  4MNC A;  4NQ8 A;  5I5P A;  1LEV A;  4PFB A;  4HCW A;  4MIJ A;  4MHF A;  3A29 A;  4HXV A;  1KA1 A;  1FPE A;  3U65 A;  4N4U A;  3IFC A;  4OVT A;  4P56 A;  3W9W A;  2WBB A;  3RPL B;  1G0I A;  1IMA A;  2QVR A;  2CEX A;  4F1U A;  5IGA A;  5A5L A;  1KZ8 A;  4I40 A;  4HE1 A;  4QBA A;  2Q8M A;  3T1B A;  5LDZ A;  4H46 A;  5IZ1 A;  3W9V A;  4PAK A;  1FPJ A;  4HCY A;  4O7M A;  5EQ7 A;  1FBD A;  2QVV A;  2FIX A;  3HFU A;  2OWZ A;  1CNQ A;  1JP4 A;  2DE2 A;  3LUZ A;  2XA5 A;  2XWK A;  4MNI A;  4N8Y A;  4N91 A;  4P3L A;  4OA4 A;  2WBD A;  4F18 A;  4N81 A;  4DI4 B;  1NV6 A;  2XXK A;  4OVP A;  4N17 A;  4AS4 A;  4MNP A;  2Y5L A;  1NUZ A;  2V3Q A;  2HXR A;  4I3E A;  1FPK A;  4OVQ A;  4PBH A;  1FPF A;  1NUY A;  2ZZX A;  5IZZ A;  1XI6 A;  3E79 A;  1FBG A;  2XWV A;  4NGU A;  4P9K A;  1YZ0 A;  4JVC A;  5ET6 A;  1FRP A;  4O94 A;  2P3V A;  4PAI A;  4GX4 A;  3MYU A;  2OX3 A;  4GWX A;  2PCR A;  3KC0 A;  4X04 A;  5T3J A;  5IM2 A;  2PFY A;  2VPN A;  2P3N A;  3LV0 A;  3CHG A;  2WYP A;  4O7I A;  1D9Q A;  5FBP A;  3FBP A;  1SPI A;  1FPI A;  2QVU A;  3ISP A;  4GX3 A;  4OVS A;  4PGP A;  1K9Z A;  2XWO A;  5EYG A;  2FVZ A;  4MEV A;  3EKI A;  4N6D A;  4N6K A;  3T0J A;  3BIH A;  1NV2 A;  2FHY A;  4GWW A;  4X8R A;  4PF6 A;  1FPL A;  1FPD A;  1LBX A;  1YXI A;  2QFL A;  3KC1 A;  4OVR A;  1NV4 A;  2Q74 A;  5EQ8 A;  4PDD A;  4AS5 A;  4F1V A;  3IFA A;  4HE0 A;  5DW8 A;  3MST A;  1FBH A;  3D1R A;  1NV1 A;  2KQZ A;  4O8M A;  2CZH A;  2HHM A;  4PAF A;  4PGN A;  2F5X A;  5ESY A;  1RDY A;  2CZK A;  4M1V A;  4FBP A;  4NN3 A;  4P1E A;  1NUX A;  4GX6 A;  4P8B A;  5EQA A;  2F3D A;  4LN5 A;  2WX9 A;  2WEF A;  1NI9 A;  4GWS A;  2DE3 A;  2B4L A;  1G0H A;  1FPB A;  1VDW A;  4F19 A;  4P1L A;  4G61 A;  4MX6 A;  4PET A;  1K9Y A;  4I3Y A;  4NG7 A;  3ROJ A;  3RYD A;  2XWI A;  1NV5 A;  2FIE A;  4PBQ A;  1DBZ A;  4PC9 A;  1LBZ A;  1DK4 A;  5LTC A;  1RDZ A;  2DVZ A;  1QGX A;  2MKZ A;  4P47 A;  2BJI A;  2F3B A;  3B50 A;  1Q9D A;  3FXB A;  4GBV A;  4NF0 A;  2HZL A;  4PFR A;  3E78 A;  4NHB A;  2ZZW A;  4PE3 A;  5EYH A;  5F24 A;  1FSA A;  4NAP A;  2FBP A;  4NX1 A;  1NV0 A;  2QPQ A;  2JJK A;  1RDX A;  5JK4 A;  1FBE A;  2WYK A;  4HE2 A;  1BK4 A;  1EYI A;  1FBP A;  1LBW A;  2V4C A;  4N15 A;  1IMF A;  2Q9T A;  1IMB A;  4IR8 A;  1YYZ A;  4GWU A;  1FJ9 A;  4JVI A;  3RPL A;  3B8B A;  1FBF A;  3GYY A;  5CM6 A;  1NV7 A;  2Y5K A;  2PFZ A;  4MCO A;  1NUW A;  2CEY A;  3PTY A;  5ET8 A;  3SZP A;  1EYJ A;  1DCU A;  4PTK A;  1KA0 A;  1FTA A;  1FBC A;  4H45 A;  5ET7 A;  1FPG A;  2B4M A;  2GQ1 A;  2ZZV A;  1LBY A;  4PF8 A;  4DI3 D;  2L5V A;  5J16 A;  4XEQ A;  4PFI A;  5IZ3 B;  4PCD A;  5EQ9 A;  1LBV A;  4GWZ A;  5I7I A;  4XF5 A;  1INP A;  1EYK A;  2DE4 A;  2HPG A;  4N8G A;  5ET5 A;  5J1D A;  2R8T A;  2VPO A;  4GBW A;  4YIC A;  2VT5 A;  3QMF A;  1IME A;  3NOH A;  1IMC A;  2HZK A;  3BIG A;  2CZI A;  4MAG A;  4MMP A;  4MJO A;  4QXD A;  4X9T A;  1AWB A;  4OAN A;  4UAB A;  4YZZ A;  4GWY A;  5I3S A;  4JVD A;  4PDH A;  3KBZ A;  2KR0 A;  5IZ3 A;  4XFE A;  2DDK A;  4KXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...