4X8RA

Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
304
structure length
304
Chain Sequence
ECEVTLRSSDTHPDGYPTVEGVKFMAERAKELSNGRICIEVFPSSQLGEEKDTIEQTQFGVIDMVRASFGSFNDIVPEAQLLSLPYLFRSEEHLHNVMDGPIGDELAKAFEAKDLIAVAYYDGGSRSFYNSQKPITKVEDLKGMKFRVMQSDVFVDMMSALGANATPMPYGEVYSSIQTGVIDGAENNWPSYDSSGHFEVAKYYTLDQHLMVPELVAISKIKWDALSPEDQQVLRQAAEESEPVQRKLWAEQEKASEEKVVASGAEVVREIDKTPFIEAMAPVYEKYVTKSEYQDLVKRIQETQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title CRYSTAL STRUCTURE OF A TRAP PERIPLASMIC SOLUTE BINDING PROTEIN FROM Rhodobacter sphaeroides (Rsph17029_2138, TARGET EFI-510205) WITH BOUND Glucuronate
rcsb
source organism Rhodobacter sphaeroides (strain atcc 17029 / ath 2.4.9)
molecule tags Solute-binding protein
total genus 114
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4x8rA00
4MNPA 2CEYA 5LTCA 3GYYA 4UABA 4NAPA 4P3LA 2WX9A 4OVSA 4YZZA 2PFZA 4PGNA 4N6DA 4MAGA 4NQ8A 4MCOA 4MMPA 4O94A 2XXKA 4P9KA 5IZZA 4PE3A 2ZZXA 4PETA 4PAIA 4MHFA 4OANA 2ZZVA 4PFIA 4PFRA 3FXBA 4NGUA 2VPNA 4XF5A 5I7IA 4N6KA 4P1LA 4MX6A 4OVPA 2XWOA 4XEQA 4N4UA 2XWVA 4MIJA 4P56A 4NHBA 2HZLA 5I5PA 2CEXA 2XA5A 3B50A 4MEVA 2XWIA 4PCDA 4OA4A 2HZKA 4PDHA 4X8RA 4OVTA 4N91A 5IM2A 4PF6A 2WYKA 4N17A 5CM6A 4PFBA 4NG7A 4DI4B 4PC9A 4LN5A 5IGAA 4YICA 2ZZWA 4MNIA 4NF0A 2XWKA 4O7MA 4N8GA 4OVQA 2V4CA 2PFYA 4MNCA 4PDDA 2VPOA 4PBHA 4OVRA 3U65A 4N8YA 4P1EA 4PAKA 2HPGA 4NN3A 4N15A 4NX1A 4PF8A 4X04A 2WYPA 4PAFA 4P47A 4PGPA 4XFEA 4DI3D 4P8BA 4O8MA 4PBQA
chains in the Genus database with same CATH superfamily
2ZNUA 4WXJA 4PP0A 1FQFA 1QKBA 3JV9A 4NQ8A 3TTNA 3MBPA 3G3JA 3H06B 2F6GA 1K9ZA 2H98A 1EZOA 3E79A 5I56A 2QMXA 2OJTA 2P0SA 1XT8A 2UVJA 2ZZVA 4F39A 2DWHA 1LBYA 3C36A 3G3FA 3IJXB 1H45A 3K6WA 3EKIA 4ESWA 2WBDA 4MFIA 4POXA 3QAXA 1MQGA 3FJGA 4AB6A 1O63A 1MG1A 2Z22A 3EHUA 4GL8A 4NMYA 1B1XA 2QPQA 3HPIA 1IXHA 3W9WA 2Q74A 4GD5A 3LSFB 4FATA 1P1NA 2V3TA 4GWWA 3KOSA 1JVYA 2ZMBA 4GX3A 1Y9UA 3UP9A 1P1OA 3RUMA 3O6IA 3C35A 2X26A 3CIJA 2I58A 3PMWA 1ELJA 2AYSA 3JYRA 2B3FA 5HBCA 1G0IA 2H5YA 3L6HA 4KYDA 4NX1A 4U22A 3W9VA 4MF3A 2I0BA 1DTZA 1DBZA 3LR1A 2QS4A 4DI3D 1US4A 1GVCA 1ZU0A 2DVCA 1MXUA 3UA8A 4ZEDA 5HM4B 4BDMA 2QFLA 4OWDA 1P1WA 3U72A 2OCUA 1F9BA 5DEXB 1ZLQA 1AIVA 2X7PA 1B3HA 4AS4A 1NV3A 1Y3PA 5TU0A 3S4UA 1TFDA 4MHFA 2UYEA 4KCDA 1MY1A 4GRKA 1DPPA 3O97A 3EN3A 4ONYA 4QSEA 4R73A 1FRPA 4EQ7A 2G93A 3UK4A 2F36A 3CR9A 5I59A 1MM6A 2DP8A 4IGTA 1IIWA 1XHYA 3C32A 1Y3NA 1US5A 1POTA 2ANJA 1NV6A 3MPKA 1MS7A 2YJPA 1QW0A 3CFZA 3PMVA 3VE1B 4OESA 5I3SA 3MPLA 1H43A 3TTMA 1M5DA 2O68A 4AB5A 3HCQA 3SKPA 1MXXA 4RA1A 2E0SA 3FBPA 4YKJA 3C33A 4U1OA 2GHBA 4HE1A 2CEYA 1MXWA 3KC0A 3LBSA 4YZZA 4YMAA 2F7CA 2XX8A 2XXPA 3U93A 4BDOA 3MP1A 5F1QA 4FAJA 1B3FA 5LDZA 4DCXA 2I4CA 5I2KA 2P1SA 2WEFA 5JEIA 3ILTB 4GXAA 3Q25A 3IFCA 1MH4A 1FBPA 1FTKA 2Y7KA 4NF8B 3A3CA 3Q26A 3MZ1A 1JEUA 3A09A 3TQWA 3VVFA 2F3BA 2PYYA 4K3FA 1YCJA 2IEEA 5IZ3A 1FQBA 4C1TA 3CFLA 3HHFA 2DQVA 2A5TA 1H44A 3BFTA 2H4IA 1CB6A 3K6VA 3M8UA 3MAMA 1PC3A 3OELA 1FBDA 4RPNA 3MSTA 3RPLB 4OMBA 4YICA 1WODA 1FPFA 2OX3A 1OIBA 4MNIA 1O7TA 1RYOA 1MY3A 4KQPA 1NH7A 4MLVA 2QVVA 2FNCA 1BP5A 4G68A 3PUYE 5ICQA 3OO6A 5DVIA 2VD3A 2ZYKA 2PCRA 4O8MA 3N5LA 3OENA 5T3JA 3H6WA 3O6GA 2Q8MA 2PT1A 4G2ZA 5IAIA 1A99A 1NKXA 1Y1MA 4I3EA 5EQ9A 4U21A 5H8NA 4JVCA 4O94A 1WVJA 3ONMA 1TT1A 2R6GE 4P0GA 3TDJA 1A54A 3B6QA 5J16A 2ZNSA 3TCGA 5AE4A 2F78A 2RC7A 2FVZA 1FQDA 5ET5A 3PPQA 4YKPA 3FV2A 1BK4A 4ND9A 1LAHE 1JEVA 1Y20A 3MZBA 5I5PA 5CMMA 1SW2A 1B3GA 5M2VA 4F3BA 1B51A 1I6BA 3RT8A 2KR0A 4TOZA 4R75A 3SERA 2OWTA 2Z8DA 4PF6A 5I57B 2HXWA 2XD3A 1B05A 4C0RA 5A5XB 1M5EA 3C4MA 1TXFA 1B0LA 2XXTA 3K4UA 1SW4A 3K6XA 1RDZA 4QFLA 1XVXA 2D5WA 3T9HB 2QS1A 5AA4B 1DSNA 1B3EA 4N8YA 3OO8A 3U8QA 3KC1A 4IY5A 4NWCA 5ET7A 3R6UA 1BTJA 3RN8A 3OO9A 3KFMA 1LFGA 4U23A 1NNFA 2F6PA 3K0VA 4GQOA 3ZSFA 1QJMA 2G29A 3U1OA 3D4CA 1EYIA 3B8BA 1XC1A 2XX9A 4Q0CA 3LUZA 2O7UA 2Y7RA 1IQ7A 3KJ7A 5H8SA 3Q28A 1GR2A 3CVGA 3IX1A 3MC2A 1G0HA 1Y3QA 4F3GA 1SDXA 1MXVA 3O9PA 1B40A 1EH3A 1RDXA 4Z0IA 3KSXA 3H03A 3H4ZA 1B5HA 2XXWA 2F35A 3H7MA 2F7AA 2R8TA 3FV1A 4ZECA 1IITA 1FBHA 5ELVA 3PPOA 4MEVA 2E1SA 4ZE9A 2H99A 3F11A 1NUYA 3CFXA 1MPDA 3PV0E 1UTHB 2DS9A 4O3AA 4JWOA 3HV1A 3KGCA 5IZ1A 1GV8A 1MQIA 4G8MA 1B46A 1LAXA 4FORA 4JSDA 3PU5A 1N04A 3H6VA 4TLLB 4MNCA 3TAJA 3IK6B 2O6AA 3E4RA 1MY0A 4HTGA 3VV5A 2LAOA 2UVHA 1OLAA 4KI0E 3R7XA 4EF1A 1B6HA 4R9GA 3SEXA 2HAUA 4O3CA 1B5JA 2ZXTA 5H8QB 4PBQA 1B3LA 3VLUA 3GYYA 2I6EA 2WX9A 1D9VA 1OQGA 3MVYA 1D9QA 2DWJA 4HCWA 5DVJA 4P9KA 1QULA 1NV0A 3K02A 1LFHA 1NV2A 1XOCA 5L9SA 4PETA 5L9MA 3L6GA 4N6PA 4GWUA 1POY1 4GWYA 5H8HB 1MDP1 5JK4A 1Q1KA 1FTJA 5TPAB 1LBXA 5ITOA 1FBFA 2VGQA 4IO5A 4LUBA 4JDFA 1FTMA 2BJIA 5KZTA 5I58B 4R74A 4X1BA 1IUDA 3I3VA 3USDA 1MRPA 1NV5A 3G3HA 1LBWA 1SYHA 3E3KA 1D9YA 1L5TA 2CZKA 4DI4B 2VT5A 3PUWE 5H8FA 4FJPA 1R6ZA 4IO6A 4ZEBA 3VLVA 4HE0A 2D3IA 4N8GA 3TYHA 1FQCA 3RQTA 3PD9A 4OZ9A 2XXHA 1YTVA 1ZBMA 2XX7A 4FBPA 4GOTA 2Y84A 2I3WA 3HFUA 3FVGA 1NH8A 1B7HA 1MQDA 3TTKA 3CHGA 3FIRA 4XFEA 3IB0A 2NUVA 4G8NA 4ZS9A 4NE4A 5ESYA 3SEYA 1LCTA 4JVDA 4ELOA 4P3LA 2FYIA 3FVKA 3QYTA 1OLCA 1HSEA 4ZZEA 2QS3A 3CRBA 4C1UA 4GBWA 4QXDA 4I3YA 3TMGA 3O6HA 3FVNA 4G61A 3KJTA 3TFLA 4OANA 4F31B 4POWA 3RGYA 2GH9A 4NGUA 4H1XA 2RF1A 3MJNA 1FPGA 4ZDMA 3EF7A 4ELQA 4WKMA 2O7IA 5I84A 3ILUB 1PB7A 3HSTA 2DXYA 4G8HA 3T96B 4L17A 3MP8A 3TCHA 3TKDA 3LV0A 1KZ8A 4YMBA 4NF8A 2DWIA 1SI0A 4ELRA 4OVJA 4IGRA 1NNPA 5CMBA 4IO4A 2O69A 2Y5LA 3MP6A 2F34A 1D3KA 2QJEA 3SZPA 4F1YA 1PEBA 2M8CA 3IR1A 3PMXA 4FEBA 3RPLA 4H8IA 3BFUA 3S9MC 3H3GA 3PTYA 1OQHA 4MBPA 2CZLA 3M3LA 3IOTA 4EXLA 4NEDA 5TP9A 2MKZA 4RXLA 1FQAA 3RPWA 5CBRA 2OBGA 1URGA 5EYGA 4OVSA 1I69A 2PFZA 3B6TA 4WEDA 4YU0A 2DE4A 4QFKA 4MLQA 2DOJA 2I49A 3VVEA 3QSLA 3S2VA 3TTRA 3IJOB 4F2OA 2V3QA 3GLBA 1HSJA 1S50A 4IO2A 2FA7A 5KDTB 3PPNA 1H76A 4N13A 4NF5B 1QVSA 3PUVE 4HS7A 3SEVA 4N4UA 1B32A 2I48A 4NF6B 3A3UA 2F8DA 1NUXA 2ZYOA 1JQFA 4AQ4A 2ABHA 2Q88A 3D1RA 3TCFA 2FIXA 1Q35A 3T9UA 1JVXA 1NL5A 4MH5A 1SVXB 1RDYA 4R6HA 3KN8A 4DXCA 3T22A 5DT6A 1FPBA 4LZ8A 1QUJA 4LVQA 5L8DA 3P7IA 1YAEA 2ESNA 4PFYA 1FBGA 5I57A 4PDDA 3VLWA 1R1NA 1Y4TA 3B6WA 3KN7A 5FHNA 4JXIA 4FEDA 3AXFA 2R71A 4DLDA 4BDQA 2Q9TA 3M3FA 1IEJA 1UIVA 5AA4A 3W15C 2B65A 2RCAA 3TTLA 1IMAA 1NV1A 1FPDA 4H5FA 3N6UA 5FTIA 5K2YA 3V5AA 3MZ9A 4KCCA 3OSQA 2QL3A 2QS2A 4JVIA 4MCOA 2DXRA 4U2RA 5AA3A 2XXKA 3GXAA 1ZMGA 1UQWA 3K00A 4ELPA 1FCKA 4FE8A 4EQ9A 4KR5A 1FTLA 3VDFA 2FIEA 4PAIA 2DDKA 1NNTA 4PFIA 3LC8A 2HHMA 4N6KA 1MPCA 4MX6A 3HN0A 4MIJA 1I6QA 3OEKA 2NWJA 3G3KA 1IZ1A 1FPJA 3DP4A 1VSOA 1N84A 1CNQA 3FXRA 2Y7IA 5EQ7A 3T93B 4QSCA 2NXOA 2HZKA 1A7LA 4PFTA 4PDHA 2AL4A 5DVFA 5IM2A 5KCJA 4NF4B 4PFBA 1N3WA 4H65A 4IO7A 5JTYA 3PUZE 3A29A 4PC9A 3K1MA 5AA2A 1M5FA 4XXUA 3UIFA 1LSTA 2QVUA 2I0CA 1UTHA 3DLNA 3N26A 4LP2B 2VD2A 1PBPA 4OVRA 2HAVA 4P1EA 1GGGA 1MXYA 4N15A 4OTEA 4H45A 4X48A 4XIGQ 4R72A 4LQ5A 2OZZA 4PAFA 3FZVA 4HE2A 1XS5A 3EHSA 1VE4A 4GVOA 4GWZA 3UORA 2FBPA 3CG1A 3MQ9A 1EU8A 5AA1A 4RK2A 3M3KA 1FTAA 2QRYA 4OENA 4GIZA 5H8QA 1B7UA 1VR5A 1LCFA 2YPNA 1QUIA 1DPEA 3ODBA 4RYAA 3FXBA 1QUKA 1T0KA 4ZE8A 4LA9A 5I7IA 1B58A 1K9YA 4F3SA 3RNNA 3S9EA 1JETA 2DE3A 1OVTA 2V93A 4GXSB 4QFOA 4OEVA 2XA5A 2F5XA 4PE5B 3BIGA 1GTKA 4F3PA 2OK2A 5H8HA 5TPAA 1VFDA 3BBRA 1BIYA 4H0WA 3SESA 4KXPA 4YB5A 4R2BA 5F24A 4KPTA 3E78A 1FTOA 3OXNA 3THIA 3IORA 5I2NB 5CC2A 1O64A 4H67A 4GWSA 3ISPA 5I58A 4XKRA 3MVXA 1IMBA 5H8NB 3LSWA 2F7BA 4JSOA 3RYDA 4NF0A 1IMFA 2L5VA 4OXVA 1Q9DA 4JB7A 4N07A 5CI5A 2F97A 1ZIUA 3S9NC 4H8JA 4PAKA 3C31A 1A8EA 4XKQA 3MUQA 3MVWA 2O1LA 4X04A 4OERA 4BDNA 2FHYA 4TLMB 1AWBA 5CMCA 3IL1B 1LEVA 5ET6A 2XHDA 4MNPA 2GRVA 4IY6A 5DYHA 4G4PA 4NAPA 2W7YA 1TWYA 4HXVA 5EQ8A 4DZ1A 2Q8JA 5DW8A 4F29A 4E0WA 4XKPA 3T9VA 4I1DA 3BKIB 1PDAA 3IB1A 4THIA 3IB2A 4U1ZA 3CSGA 1OVBA 1USYE 1FPEA 5ET8A 3IOWA 3ECRA 1IXGA 1Y1ZA 4GF8A 1H3DA 1A40A 3KOTA 4OHNA 4M1VA 2THIA 4GBVA 4OVPA 4XEQA 3SEWA 5FHOA 2Y5KA 4H46A 3KZGA 2HZLA 2WKYA 3OMBA 1TFAA 3TQLA 3H6UA 5CBSA 4PFWA 2QSXA 4QSDA 1QKAA 3ROJA 1LBCA 2Z23A 5K2XA 4DIGA 5DEXA 4N91A 4LQ2A 2RKMA 2H9BA 1NNKA 3MWBA 2ZYNA 3FXUA 4GX6A 1S7YA 2ONRA 1YXIA 1D4NA 4F18A 4ZEIA 1FW0A 2JJKA 1XVYA 2VOZA 4IR8A 1Z7NE 3QXMA 2XXXA 3O29A 2ZYMA 1FBCA 1LFIA 1PB9A 1VFEA 4GWXA 2QMWA 1UTBB 1SI1A 4RK9A 3TEPA 1LAGE 3RTFB 4PBHA 5BUUA 1II5A 4F1VA 4UA8A 3K2DA 1B9JA 3KEIA 2ALUA 3QMFA 2PBWA 1A55A 1ZJLA 3HO7A 2WYPA 2AIXA 1YYZA 4PQJA 4LZ7A 3SEUA 4BDLA 3RY3A 1P99A 3PD8A 4PGNA 4YAHX 4QRZA 1M5CA 2H25A 4EF2A 3IOVA 4UACA 1DTGA 2ONSA 1FBEA 3PUXE 1Z7ME 3G3IA 3ZKLA 1DCUA 4YKKA 4KYSA 3TZAA 2B4MA 2PT2A 4N81A 3Q27A 5EQAA 3LSXA 1RKMA 2XWVA 3E9XA 2RC9A 3UGWA 4Q8RA 4QF9A 2CZHA 1LBZA 1EYKA 1JNFA 4PCDA 1B52A 5KDTA 2Y7PA 2ZNTA 4LATA 4NF5A 3O66A 5EHMA 4OQOA 4OVTA 2UXAA 4NF6A 1AH5A 1IMDA 4R6YA 1FSAA 2UYFA 3RTWB 2RINA 1KA0A 1CE2A 3G3GA 3V83A 5DTBA 2I4BA 1N76A 4Q5TA 3SETA 5FBPA 4O7MA 4OVQA 2ONKE 3JZJA 1YPNA 4I9DA 2HQ0A 2R9JA 1RYXA 5B70A 4ZEKA 4NTLA 2V3UA 4G77A 3QUJA 4RPOA 2OLBA 3IAZA 3IO6A 1NV7A 4F19A 3QIMA 3N6TA 2Z8FA 1HSLA 4PF8A 3LSLA 3EPEA 4F2QA 3GBAA 2XXIA 1NUZA 4P47A 3TUSA 5EHSA 1NUWA 1OMPA 2A5SA 2UVGA 3R26A 2BJJX 5I56B 2WBBA 2DYXA 2REGA 4FIMA 3PGFA 4QFNA 3WAFA 2XD2A 4X9TA 1S9TA 2Z8EA 1SW5A 1JW5A 1LBBA 4NWDA 3NOHA 5H8FB 4KHZE 4X1DA 4PFRA 3FASA 3PPRA 4I40A 4GX4A 1WDNA 4PFUA 1FJ9A 3HHGA 4DXBA 4NHBA 1MH3A 3VVDA 3TPAA 3K01A 3KBZA 3U94A 3KSJA 4JBZA 4X8RA 4ZZAA 2CMOA 3TODA 1JW4A 1P1QA 5ITPA 3O28A 1MXZA 1B7ZA 1MPBA 3CI8A 3MYUA 3LUYA 4M4GA 3WAEA 2KQZA 1NFTA 4OYVA 1FJ6A 2AL5A 4OFLA 1N7WA 4ECFA 1SW1A 2RC8A 1B4HA 1B1HA 4NF4A 2I3VA 1KA1A 3BIHA 1EYJA 5B7DA 1URDA 1LB9A 2YLNA 3U65A 4F1UA 3V89B 5IKBA 1B5IA 3RT6B 2QVRA 1A8FA 4XKNA 2Q2CA 1IMEA 3VXCA 4PGPA 2UVIA 3N94A 3GBBA 5BWJA 2V84A 1DOTA 5EYHA 1N7XA 2GHAA 5A5XA 4JWYA 1DK4A 1Y4CA 1LBVA 1ATGA 2IA4A 4MAGA 4P0IA 4MMPA 1B0HA 4QFPA 1MY4A 4PTKA 4H6DA 4I62A 1N0TA 2P2AA 4LZ5A 2XXRA 1LLSA 5I59B 3I6VA 2X7QA 4ZEFA 2XWOA 3VXBA 1NMUA 2D21A 2DWAA 4IO3A 4MJOA 1MM7A 2CEXA 2XXQA 2KLFA 5FHMA 1LGBC 5LOMA 1INPA 2HXRA 3VFJA 3FUZA 1PB8A 4Z7EA 1AOVA 5EYFA 3KG2A 2OWZA 4OEUA 4OFJA 4N17A 5TP9B 1FPLA 1FPIA 5FTHA 2REJA 4GFRA 3IFAA 1LB8A 1BKAA 5IGAA 4EQBA 1BLFA 4F22A 2XWKA 3DM0A 4RJZA 2V4CA 2Q89A 1NV4A 3FD3A 5I2NA 1USYH 4R6KA 2VHAA 3FJ7A 1R9LA 3DP6A 4GLIA 3EHTA 4EUOA 2CZIA 2XXUA 3PPPA 4P8BA 1IXIA 2B4LA 1ANFA 3T1BA 5ISUA 4IB2A 3ZKKA 3FXQA 5I2KB 1VDWA 1JP4A 2NOOA 4O7IA 4DDDA 3FJMA 1DMBA 5IZZA 1EZPA 2ZZXA 3H6TA 3OOAA 4GL0A 1MY2A 1EZ9A 3GZGA 3MVZA 3K6UA 5CRYA 2P3NA 4KFQA 5IZ3B 3RLFE 4P1LA 1ZTYA 5F7VA 1PBQA 4BDRA 2A5TB 2F3DA 2XXYA 2NVUB 4P56A 1LAFE 5HPQA 1XI6A 2O84X 4XTCQ 2P3VA 1KWHA 2DSFA 2HCAA 1AMFA 3FVOA 4LONB 1M5BA 4WEPA 2WYKA 5CM6A 4HCYA 1SD3A 2DE2A 3CG3A 1NI9A 3S9LC 4NG7A 1YZ0A 1URSA 3B7DA 2PMSA 4EDPA 1UIUA 3DELB 4G68B 2OWSA 4FECA 4YKIA 3O2AA 2Q2AA 3MW0A 1SPIA 4ISUA 3ZS6A 1AL3A 4QBAA 1R9QA 3Q29A 4I8CA 4RNSA 1MDQA 5J1DA 2Y7WA 3KN3A 4HW8A 4O3BA 1ZKBA 4DCYA 1N3XA 2B3BA 2XXVA 1UTBA 4R2FA 4P11A 4DXUA 3B50A 3T66A 4AS5A 4ESXA 5LTCA 4UABA 3QUFA 4KYEA 3C34A 3QK6A 2O1MA 4N6DA 4EXKA 3I5OA 5KCJB 5AA2D 5L9OA 2HFBA 1MQHA 1B4ZA 3E13X 4PE3A 5JTYB 2VP1A 5AA2B 3V8XB 4OETA 3SDFA 3D4GA 4H5GA 2VPNA 4JWXA 1SYIA 4XF5A 5A5LA 1JW1A 3T0JA 4TQUQ 1B2HA 3FATA 2O51A 4OFOA 2XWIA 2V25A 3DP8A 3OSRA 4OA4A 2DVZA 3KBRA 4E0XA 2PVUA 3K1PA 4KD5A 3T9XB 4BLAA 5ICTA 2GFEA 1J1NA 3U92A 2GQ1A 4G68C 3OO7A 1MQJA 3G7WA 2HEUA 4QHQA 3C9HA 1FQEA 2PX1A 4LN5A 1IMCA 3IO4A 1SQYA 2ZZWA 4YB7A 1QGXA 4U4XA 1IXCA 2PFYA 2RCBA 1SBPA 1P1UA 3CSBA 3OEMA 2VPOA 3K1NA 3FGSA 4GWOA 4DE8A 1FPKA 4Q30B 2HPGA 4NN3A 4RY1A 4YB6A 3OD7A 3EQ1A 4U4SA 3TELA 5CMKA 1I6AA 4R9FA 3IOUA 3UN6A
chains in the Genus database with same CATH topology
1NV1A 3B8BA 1FPDA 3LUZA 2WBBA 4JVIA 4NQ8A 4MCOA 4X9TA 2XXKA 1G0HA 1K9ZA 3NOHA 3E79A 2FIEA 4PAIA 1RDXA 2DDKA 2ZZVA 4PFIA 4PFRA 4I40A 2HHMA 4GX4A 4N6KA 4MX6A 1LBYA 4MIJA 2R8TA 1FJ9A 1FPJA 3EKIA 4NHBA 1FBHA 2WBDA 1CNQA 4MEVA 5EQ7A 3KBZA 1NUYA 2HZKA 4PDHA 4X8RA 5IM2A 4PFBA 2QPQA 5IZ1A 3W9WA 2Q74A 3MYUA 3A29A 4PC9A 4GWWA 2KQZA 1FJ6A 4GX3A 2QVUA 4MNCA 1KA1A 3BIHA 1EYJA 4OVRA 3U65A 4F1UA 4P1EA 1G0IA 4N15A 4H45A 2QVRA 4NX1A 3W9VA 1IMEA 4PAFA 1DBZA 4PGPA 4DI3D 4HE2A 4PBQA 4GWZA 5EYHA 2FBPA 3GYYA 2QFLA 1DK4A 2WX9A 1LBVA 1D9QA 1FTAA 4HCWA 4MAGA 4MMPA 4AS4A 4P9KA 1NV0A 1NV3A 1NV2A 4PETA 4PTKA 4MHFA 4GWUA 4GWYA 3FXBA 5JK4A 5I7IA 1K9YA 1LBXA 1FBFA 2XWOA 2DE3A 4MJOA 2CEXA 2BJIA 2F5XA 2XA5A 3BIGA 1FRPA 1INPA 2HXRA 1NV5A 2OWZA 4KXPA 1LBWA 4N17A 5F24A 3E78A 1FPLA 2CZKA 1FPIA 4DI4B 3ISPA 2VT5A 1NV6A 4GWSA 3IFAA 5IGAA 1IMBA 3RYDA 4NF0A 2XWKA 4HE0A 4N8GA 5I3SA 1IMFA 2L5VA 2V4CA 1Q9DA 1NV4A 4PAKA 4FBPA 3HFUA 4X04A 2FHYA 3CHGA 2CZIA 4XFEA 4P8BA 1AWBA 3FBPA 1LEVA 5ET6A 5ESYA 2B4LA 4HE1A 4MNPA 2CEYA 3T1BA 4JVDA 4NAPA 3KC0A 4P3LA 1VDWA 4YZZA 1JP4A 4O7IA 4HXVA 5EQ8A 5DW8A 5IZZA 2ZZXA 4GBWA 4QXDA 4I3YA 4G61A 5LDZA 1FPEA 4OANA 5ET8A 2WEFA 4NGUA 2P3NA 5IZ3B 4P1LA 4M1VA 2F3DA 3IFCA 1FPGA 4GBVA 4OVPA 1FBPA 4XEQA 2Y5KA 4H46A 4P56A 2HZLA 2F3BA 1XI6A 2P3VA 5IZ3A 3LV0A 3ROJA 1KZ8A 4N91A 2WYKA 5CM6A 4HCYA 2DE2A 4GX6A 1NI9A 4NG7A 1YXIA 1FBDA 4F18A 1YZ0A 2Y5LA 2JJKA 3MSTA 3RPLB 4IR8A 4YICA 1FPFA 2OX3A 3SZPA 4MNIA 1FBCA 4GWXA 1SPIA 4PBHA 4QBAA 4F1VA 3RPLA 2QVVA 5J1DA 3QMFA 3PTYA 2WYPA 2PCRA 1YYZA 4O8MA 3B50A 5T3JA 4AS5A 2Q8MA 5LTCA 2MKZA 4UABA 5EYGA 4OVSA 4I3EA 2PFZA 4PGNA 4N6DA 5EQ9A 4JVCA 4O94A 2DE4A 4PE3A 1FBEA 1DCUA 1IMAA 2V3QA 5J16A 2B4MA 2FVZA 2VPNA 4XF5A 4N81A 5A5LA 5EQAA 5ET5A 3T0JA 4N4UA 2XWVA 1BK4A 2CZHA 1LBZA 5I5PA 1EYKA 1NUXA 2XWIA 4PCDA 4OA4A 2KR0A 3D1RA 2DVZA 2FIXA 4OVTA 1IMDA 1FSAA 4PF6A 2GQ1A 1RDYA 1KA0A 1FPBA 4LN5A 1IMCA 1RDZA 2ZZWA 5FBPA 1QGXA 4O7MA 4OVQA 2PFYA 1FBGA 4PDDA 2VPOA 4N8YA 1FPKA 2HPGA 4NN3A 4F19A 1NV7A 3KC1A 5ET7A 4PF8A 2Q9TA 1NUZA 4P47A 1NUWA 1EYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MNP A;  2CEY A;  5LTC A;  3GYY A;  4UAB A;  4NAP A;  4P3L A;  2WX9 A;  4OVS A;  4YZZ A;  2PFZ A;  4PGN A;  4N6D A;  4MAG A;  4NQ8 A;  4MCO A;  4MMP A;  4O94 A;  2XXK A;  4P9K A;  5IZZ A;  4PE3 A;  2ZZX A;  4PET A;  4PAI A;  4MHF A;  4OAN A;  2ZZV A;  4PFI A;  4PFR A;  3FXB A;  4NGU A;  2VPN A;  4XF5 A;  5I7I A;  4N6K A;  4P1L A;  4MX6 A;  4OVP A;  2XWO A;  4XEQ A;  4N4U A;  2XWV A;  4MIJ A;  4P56 A;  4NHB A;  2HZL A;  5I5P A;  2CEX A;  2XA5 A;  3B50 A;  4MEV A;  2XWI A;  4PCD A;  4OA4 A;  2HZK A;  4PDH A;  4X8R A;  4OVT A;  4N91 A;  5IM2 A;  4PF6 A;  2WYK A;  4N17 A;  5CM6 A;  4PFB A;  4NG7 A;  4DI4 B;  4PC9 A;  4LN5 A;  5IGA A;  4YIC A;  2ZZW A;  4MNI A;  4NF0 A;  2XWK A;  4O7M A;  4N8G A;  4OVQ A;  2V4C A;  2PFY A;  4MNC A;  4PDD A;  2VPO A;  4PBH A;  4OVR A;  3U65 A;  4N8Y A;  4P1E A;  4PAK A;  2HPG A;  4NN3 A;  4N15 A;  4NX1 A;  4PF8 A;  4X04 A;  2WYP A;  4PAF A;  4P47 A;  4PGP A;  4XFE A;  4DI3 D;  4P8B A;  4O8M A;  4PBQ A; 
#chains in the Genus database with same CATH topology
 2ZNU A;  4WXJ A;  4PP0 A;  1FQF A;  1QKB A;  3JV9 A;  4NQ8 A;  3TTN A;  3MBP A;  3G3J A;  3H06 B;  2F6G A;  1K9Z A;  2H98 A;  1EZO A;  3E79 A;  5I56 A;  2QMX A;  2OJT A;  2P0S A;  1XT8 A;  2UVJ A;  2ZZV A;  4F39 A;  2DWH A;  1LBY A;  3C36 A;  3G3F A;  3IJX B;  1H45 A;  3K6W A;  3EKI A;  4ESW A;  2WBD A;  4MFI A;  4POX A;  3QAX A;  1MQG A;  3FJG A;  4AB6 A;  1O63 A;  1MG1 A;  2Z22 A;  3EHU A;  4GL8 A;  4NMY A;  1B1X A;  2QPQ A;  3HPI A;  1IXH A;  3W9W A;  2Q74 A;  4GD5 A;  3LSF B;  4FAT A;  1P1N A;  2V3T A;  4GWW A;  3KOS A;  1JVY A;  2ZMB A;  4GX3 A;  1Y9U A;  3UP9 A;  1P1O A;  3RUM A;  3O6I A;  3C35 A;  2X26 A;  3CIJ A;  2I58 A;  3PMW A;  1ELJ A;  2AYS A;  3JYR A;  2B3F A;  5HBC A;  1G0I A;  2H5Y A;  3L6H A;  4KYD A;  4NX1 A;  4U22 A;  3W9V A;  4MF3 A;  2I0B A;  1DTZ A;  1DBZ A;  3LR1 A;  2QS4 A;  4DI3 D;  1US4 A;  1GVC A;  1ZU0 A;  2DVC A;  1MXU A;  3UA8 A;  4ZED A;  5HM4 B;  4BDM A;  2QFL A;  4OWD A;  1P1W A;  3U72 A;  2OCU A;  1F9B A;  5DEX B;  1ZLQ A;  1AIV A;  2X7P A;  1B3H A;  4AS4 A;  1NV3 A;  1Y3P A;  5TU0 A;  3S4U A;  1TFD A;  4MHF A;  2UYE A;  4KCD A;  1MY1 A;  4GRK A;  1DPP A;  3O97 A;  3EN3 A;  4ONY A;  4QSE A;  4R73 A;  1FRP A;  4EQ7 A;  2G93 A;  3UK4 A;  2F36 A;  3CR9 A;  5I59 A;  1MM6 A;  2DP8 A;  4IGT A;  1IIW A;  1XHY A;  3C32 A;  1Y3N A;  1US5 A;  1POT A;  2ANJ A;  1NV6 A;  3MPK A;  1MS7 A;  2YJP A;  1QW0 A;  3CFZ A;  3PMV A;  3VE1 B;  4OES A;  5I3S A;  3MPL A;  1H43 A;  3TTM A;  1M5D A;  2O68 A;  4AB5 A;  3HCQ A;  3SKP A;  1MXX A;  4RA1 A;  2E0S A;  3FBP A;  4YKJ A;  3C33 A;  4U1O A;  2GHB A;  4HE1 A;  2CEY A;  1MXW A;  3KC0 A;  3LBS A;  4YZZ A;  4YMA A;  2F7C A;  2XX8 A;  2XXP A;  3U93 A;  4BDO A;  3MP1 A;  5F1Q A;  4FAJ A;  1B3F A;  5LDZ A;  4DCX A;  2I4C A;  5I2K A;  2P1S A;  2WEF A;  5JEI A;  3ILT B;  4GXA A;  3Q25 A;  3IFC A;  1MH4 A;  1FBP A;  1FTK A;  2Y7K A;  4NF8 B;  3A3C A;  3Q26 A;  3MZ1 A;  1JEU A;  3A09 A;  3TQW A;  3VVF A;  2F3B A;  2PYY A;  4K3F A;  1YCJ A;  2IEE A;  5IZ3 A;  1FQB A;  4C1T A;  3CFL A;  3HHF A;  2DQV A;  2A5T A;  1H44 A;  3BFT A;  2H4I A;  1CB6 A;  3K6V A;  3M8U A;  3MAM A;  1PC3 A;  3OEL A;  1FBD A;  4RPN A;  3MST A;  3RPL B;  4OMB A;  4YIC A;  1WOD A;  1FPF A;  2OX3 A;  1OIB A;  4MNI A;  1O7T A;  1RYO A;  1MY3 A;  4KQP A;  1NH7 A;  4MLV A;  2QVV A;  2FNC A;  1BP5 A;  4G68 A;  3PUY E;  5ICQ A;  3OO6 A;  5DVI A;  2VD3 A;  2ZYK A;  2PCR A;  4O8M A;  3N5L A;  3OEN A;  5T3J A;  3H6W A;  3O6G A;  2Q8M A;  2PT1 A;  4G2Z A;  5IAI A;  1A99 A;  1NKX A;  1Y1M A;  4I3E A;  5EQ9 A;  4U21 A;  5H8N A;  4JVC A;  4O94 A;  1WVJ A;  3ONM A;  1TT1 A;  2R6G E;  4P0G A;  3TDJ A;  1A54 A;  3B6Q A;  5J16 A;  2ZNS A;  3TCG A;  5AE4 A;  2F78 A;  2RC7 A;  2FVZ A;  1FQD A;  5ET5 A;  3PPQ A;  4YKP A;  3FV2 A;  1BK4 A;  4ND9 A;  1LAH E;  1JEV A;  1Y20 A;  3MZB A;  5I5P A;  5CMM A;  1SW2 A;  1B3G A;  5M2V A;  4F3B A;  1B51 A;  1I6B A;  3RT8 A;  2KR0 A;  4TOZ A;  4R75 A;  3SER A;  2OWT A;  2Z8D A;  4PF6 A;  5I57 B;  2HXW A;  2XD3 A;  1B05 A;  4C0R A;  5A5X B;  1M5E A;  3C4M A;  1TXF A;  1B0L A;  2XXT A;  3K4U A;  1SW4 A;  3K6X A;  1RDZ A;  4QFL A;  1XVX A;  2D5W A;  3T9H B;  2QS1 A;  5AA4 B;  1DSN A;  1B3E A;  4N8Y A;  3OO8 A;  3U8Q A;  3KC1 A;  4IY5 A;  4NWC A;  5ET7 A;  3R6U A;  1BTJ A;  3RN8 A;  3OO9 A;  3KFM A;  1LFG A;  4U23 A;  1NNF A;  2F6P A;  3K0V A;  4GQO A;  3ZSF A;  1QJM A;  2G29 A;  3U1O A;  3D4C A;  1EYI A;  3B8B A;  1XC1 A;  2XX9 A;  4Q0C A;  3LUZ A;  2O7U A;  2Y7R A;  1IQ7 A;  3KJ7 A;  5H8S A;  3Q28 A;  1GR2 A;  3CVG A;  3IX1 A;  3MC2 A;  1G0H A;  1Y3Q A;  4F3G A;  1SDX A;  1MXV A;  3O9P A;  1B40 A;  1EH3 A;  1RDX A;  4Z0I A;  3KSX A;  3H03 A;  3H4Z A;  1B5H A;  2XXW A;  2F35 A;  3H7M A;  2F7A A;  2R8T A;  3FV1 A;  4ZEC A;  1IIT A;  1FBH A;  5ELV A;  3PPO A;  4MEV A;  2E1S A;  4ZE9 A;  2H99 A;  3F11 A;  1NUY A;  3CFX A;  1MPD A;  3PV0 E;  1UTH B;  2DS9 A;  4O3A A;  4JWO A;  3HV1 A;  3KGC A;  5IZ1 A;  1GV8 A;  1MQI A;  4G8M A;  1B46 A;  1LAX A;  4FOR A;  4JSD A;  3PU5 A;  1N04 A;  3H6V A;  4TLL B;  4MNC A;  3TAJ A;  3IK6 B;  2O6A A;  3E4R A;  1MY0 A;  4HTG A;  3VV5 A;  2LAO A;  2UVH A;  1OLA A;  4KI0 E;  3R7X A;  4EF1 A;  1B6H A;  4R9G A;  3SEX A;  2HAU A;  4O3C A;  1B5J A;  2ZXT A;  5H8Q B;  4PBQ A;  1B3L A;  3VLU A;  3GYY A;  2I6E A;  2WX9 A;  1D9V A;  1OQG A;  3MVY A;  1D9Q A;  2DWJ A;  4HCW A;  5DVJ A;  4P9K A;  1QUL A;  1NV0 A;  3K02 A;  1LFH A;  1NV2 A;  1XOC A;  5L9S A;  4PET A;  5L9M A;  3L6G A;  4N6P A;  4GWU A;  1POY 1;  4GWY A;  5H8H B;  1MDP 1;  5JK4 A;  1Q1K A;  1FTJ A;  5TPA B;  1LBX A;  5ITO A;  1FBF A;  2VGQ A;  4IO5 A;  4LUB A;  4JDF A;  1FTM A;  2BJI A;  5KZT A;  5I58 B;  4R74 A;  4X1B A;  1IUD A;  3I3V A;  3USD A;  1MRP A;  1NV5 A;  3G3H A;  1LBW A;  1SYH A;  3E3K A;  1D9Y A;  1L5T A;  2CZK A;  4DI4 B;  2VT5 A;  3PUW E;  5H8F A;  4FJP A;  1R6Z A;  4IO6 A;  4ZEB A;  3VLV A;  4HE0 A;  2D3I A;  4N8G A;  3TYH A;  1FQC A;  3RQT A;  3PD9 A;  4OZ9 A;  2XXH A;  1YTV A;  1ZBM A;  2XX7 A;  4FBP A;  4GOT A;  2Y84 A;  2I3W A;  3HFU A;  3FVG A;  1NH8 A;  1B7H A;  1MQD A;  3TTK A;  3CHG A;  3FIR A;  4XFE A;  3IB0 A;  2NUV A;  4G8N A;  4ZS9 A;  4NE4 A;  5ESY A;  3SEY A;  1LCT A;  4JVD A;  4ELO A;  4P3L A;  2FYI A;  3FVK A;  3QYT A;  1OLC A;  1HSE A;  4ZZE A;  2QS3 A;  3CRB A;  4C1U A;  4GBW A;  4QXD A;  4I3Y A;  3TMG A;  3O6H A;  3FVN A;  4G61 A;  3KJT A;  3TFL A;  4OAN A;  4F31 B;  4POW A;  3RGY A;  2GH9 A;  4NGU A;  4H1X A;  2RF1 A;  3MJN A;  1FPG A;  4ZDM A;  3EF7 A;  4ELQ A;  4WKM A;  2O7I A;  5I84 A;  3ILU B;  1PB7 A;  3HST A;  2DXY A;  4G8H A;  3T96 B;  4L17 A;  3MP8 A;  3TCH A;  3TKD A;  3LV0 A;  1KZ8 A;  4YMB A;  4NF8 A;  2DWI A;  1SI0 A;  4ELR A;  4OVJ A;  4IGR A;  1NNP A;  5CMB A;  4IO4 A;  2O69 A;  2Y5L A;  3MP6 A;  2F34 A;  1D3K A;  2QJE A;  3SZP A;  4F1Y A;  1PEB A;  2M8C A;  3IR1 A;  3PMX A;  4FEB A;  3RPL A;  4H8I A;  3BFU A;  3S9M C;  3H3G A;  3PTY A;  1OQH A;  4MBP A;  2CZL A;  3M3L A;  3IOT A;  4EXL A;  4NED A;  5TP9 A;  2MKZ A;  4RXL A;  1FQA A;  3RPW A;  5CBR A;  2OBG A;  1URG A;  5EYG A;  4OVS A;  1I69 A;  2PFZ A;  3B6T A;  4WED A;  4YU0 A;  2DE4 A;  4QFK A;  4MLQ A;  2DOJ A;  2I49 A;  3VVE A;  3QSL A;  3S2V A;  3TTR A;  3IJO B;  4F2O A;  2V3Q A;  3GLB A;  1HSJ A;  1S50 A;  4IO2 A;  2FA7 A;  5KDT B;  3PPN A;  1H76 A;  4N13 A;  4NF5 B;  1QVS A;  3PUV E;  4HS7 A;  3SEV A;  4N4U A;  1B32 A;  2I48 A;  4NF6 B;  3A3U A;  2F8D A;  1NUX A;  2ZYO A;  1JQF A;  4AQ4 A;  2ABH A;  2Q88 A;  3D1R A;  3TCF A;  2FIX A;  1Q35 A;  3T9U A;  1JVX A;  1NL5 A;  4MH5 A;  1SVX B;  1RDY A;  4R6H A;  3KN8 A;  4DXC A;  3T22 A;  5DT6 A;  1FPB A;  4LZ8 A;  1QUJ A;  4LVQ A;  5L8D A;  3P7I A;  1YAE A;  2ESN A;  4PFY A;  1FBG A;  5I57 A;  4PDD A;  3VLW A;  1R1N A;  1Y4T A;  3B6W A;  3KN7 A;  5FHN A;  4JXI A;  4FED A;  3AXF A;  2R71 A;  4DLD A;  4BDQ A;  2Q9T A;  3M3F A;  1IEJ A;  1UIV A;  5AA4 A;  3W15 C;  2B65 A;  2RCA A;  3TTL A;  1IMA A;  1NV1 A;  1FPD A;  4H5F A;  3N6U A;  5FTI A;  5K2Y A;  3V5A A;  3MZ9 A;  4KCC A;  3OSQ A;  2QL3 A;  2QS2 A;  4JVI A;  4MCO A;  2DXR A;  4U2R A;  5AA3 A;  2XXK A;  3GXA A;  1ZMG A;  1UQW A;  3K00 A;  4ELP A;  1FCK A;  4FE8 A;  4EQ9 A;  4KR5 A;  1FTL A;  3VDF A;  2FIE A;  4PAI A;  2DDK A;  1NNT A;  4PFI A;  3LC8 A;  2HHM A;  4N6K A;  1MPC A;  4MX6 A;  3HN0 A;  4MIJ A;  1I6Q A;  3OEK A;  2NWJ A;  3G3K A;  1IZ1 A;  1FPJ A;  3DP4 A;  1VSO A;  1N84 A;  1CNQ A;  3FXR A;  2Y7I A;  5EQ7 A;  3T93 B;  4QSC A;  2NXO A;  2HZK A;  1A7L A;  4PFT A;  4PDH A;  2AL4 A;  5DVF A;  5IM2 A;  5KCJ A;  4NF4 B;  4PFB A;  1N3W A;  4H65 A;  4IO7 A;  5JTY A;  3PUZ E;  3A29 A;  4PC9 A;  3K1M A;  5AA2 A;  1M5F A;  4XXU A;  3UIF A;  1LST A;  2QVU A;  2I0C A;  1UTH A;  3DLN A;  3N26 A;  4LP2 B;  2VD2 A;  1PBP A;  4OVR A;  2HAV A;  4P1E A;  1GGG A;  1MXY A;  4N15 A;  4OTE A;  4H45 A;  4X48 A;  4XIG Q;  4R72 A;  4LQ5 A;  2OZZ A;  4PAF A;  3FZV A;  4HE2 A;  1XS5 A;  3EHS A;  1VE4 A;  4GVO A;  4GWZ A;  3UOR A;  2FBP A;  3CG1 A;  3MQ9 A;  1EU8 A;  5AA1 A;  4RK2 A;  3M3K A;  1FTA A;  2QRY A;  4OEN A;  4GIZ A;  5H8Q A;  1B7U A;  1VR5 A;  1LCF A;  2YPN A;  1QUI A;  1DPE A;  3ODB A;  4RYA A;  3FXB A;  1QUK A;  1T0K A;  4ZE8 A;  4LA9 A;  5I7I A;  1B58 A;  1K9Y A;  4F3S A;  3RNN A;  3S9E A;  1JET A;  2DE3 A;  1OVT A;  2V93 A;  4GXS B;  4QFO A;  4OEV A;  2XA5 A;  2F5X A;  4PE5 B;  3BIG A;  1GTK A;  4F3P A;  2OK2 A;  5H8H A;  5TPA A;  1VFD A;  3BBR A;  1BIY A;  4H0W A;  3SES A;  4KXP A;  4YB5 A;  4R2B A;  5F24 A;  4KPT A;  3E78 A;  1FTO A;  3OXN A;  3THI A;  3IOR A;  5I2N B;  5CC2 A;  1O64 A;  4H67 A;  4GWS A;  3ISP A;  5I58 A;  4XKR A;  3MVX A;  1IMB A;  5H8N B;  3LSW A;  2F7B A;  4JSO A;  3RYD A;  4NF0 A;  1IMF A;  2L5V A;  4OXV A;  1Q9D A;  4JB7 A;  4N07 A;  5CI5 A;  2F97 A;  1ZIU A;  3S9N C;  4H8J A;  4PAK A;  3C31 A;  1A8E A;  4XKQ A;  3MUQ A;  3MVW A;  2O1L A;  4X04 A;  4OER A;  4BDN A;  2FHY A;  4TLM B;  1AWB A;  5CMC A;  3IL1 B;  1LEV A;  5ET6 A;  2XHD A;  4MNP A;  2GRV A;  4IY6 A;  5DYH A;  4G4P A;  4NAP A;  2W7Y A;  1TWY A;  4HXV A;  5EQ8 A;  4DZ1 A;  2Q8J A;  5DW8 A;  4F29 A;  4E0W A;  4XKP A;  3T9V A;  4I1D A;  3BKI B;  1PDA A;  3IB1 A;  4THI A;  3IB2 A;  4U1Z A;  3CSG A;  1OVB A;  1USY E;  1FPE A;  5ET8 A;  3IOW A;  3ECR A;  1IXG A;  1Y1Z A;  4GF8 A;  1H3D A;  1A40 A;  3KOT A;  4OHN A;  4M1V A;  2THI A;  4GBV A;  4OVP A;  4XEQ A;  3SEW A;  5FHO A;  2Y5K A;  4H46 A;  3KZG A;  2HZL A;  2WKY A;  3OMB A;  1TFA A;  3TQL A;  3H6U A;  5CBS A;  4PFW A;  2QSX A;  4QSD A;  1QKA A;  3ROJ A;  1LBC A;  2Z23 A;  5K2X A;  4DIG A;  5DEX A;  4N91 A;  4LQ2 A;  2RKM A;  2H9B A;  1NNK A;  3MWB A;  2ZYN A;  3FXU A;  4GX6 A;  1S7Y A;  2ONR A;  1YXI A;  1D4N A;  4F18 A;  4ZEI A;  1FW0 A;  2JJK A;  1XVY A;  2VOZ A;  4IR8 A;  1Z7N E;  3QXM A;  2XXX A;  3O29 A;  2ZYM A;  1FBC A;  1LFI A;  1PB9 A;  1VFE A;  4GWX A;  2QMW A;  1UTB B;  1SI1 A;  4RK9 A;  3TEP A;  1LAG E;  3RTF B;  4PBH A;  5BUU A;  1II5 A;  4F1V A;  4UA8 A;  3K2D A;  1B9J A;  3KEI A;  2ALU A;  3QMF A;  2PBW A;  1A55 A;  1ZJL A;  3HO7 A;  2WYP A;  2AIX A;  1YYZ A;  4PQJ A;  4LZ7 A;  3SEU A;  4BDL A;  3RY3 A;  1P99 A;  3PD8 A;  4PGN A;  4YAH X;  4QRZ A;  1M5C A;  2H25 A;  4EF2 A;  3IOV A;  4UAC A;  1DTG A;  2ONS A;  1FBE A;  3PUX E;  1Z7M E;  3G3I A;  3ZKL A;  1DCU A;  4YKK A;  4KYS A;  3TZA A;  2B4M A;  2PT2 A;  4N81 A;  3Q27 A;  5EQA A;  3LSX A;  1RKM A;  2XWV A;  3E9X A;  2RC9 A;  3UGW A;  4Q8R A;  4QF9 A;  2CZH A;  1LBZ A;  1EYK A;  1JNF A;  4PCD A;  1B52 A;  5KDT A;  2Y7P A;  2ZNT A;  4LAT A;  4NF5 A;  3O66 A;  5EHM A;  4OQO A;  4OVT A;  2UXA A;  4NF6 A;  1AH5 A;  1IMD A;  4R6Y A;  1FSA A;  2UYF A;  3RTW B;  2RIN A;  1KA0 A;  1CE2 A;  3G3G A;  3V83 A;  5DTB A;  2I4B A;  1N76 A;  4Q5T A;  3SET A;  5FBP A;  4O7M A;  4OVQ A;  2ONK E;  3JZJ A;  1YPN A;  4I9D A;  2HQ0 A;  2R9J A;  1RYX A;  5B70 A;  4ZEK A;  4NTL A;  2V3U A;  4G77 A;  3QUJ A;  4RPO A;  2OLB A;  3IAZ A;  3IO6 A;  1NV7 A;  4F19 A;  3QIM A;  3N6T A;  2Z8F A;  1HSL A;  4PF8 A;  3LSL A;  3EPE A;  4F2Q A;  3GBA A;  2XXI A;  1NUZ A;  4P47 A;  3TUS A;  5EHS A;  1NUW A;  1OMP A;  2A5S A;  2UVG A;  3R26 A;  2BJJ X;  5I56 B;  2WBB A;  2DYX A;  2REG A;  4FIM A;  3PGF A;  4QFN A;  3WAF A;  2XD2 A;  4X9T A;  1S9T A;  2Z8E A;  1SW5 A;  1JW5 A;  1LBB A;  4NWD A;  3NOH A;  5H8F B;  4KHZ E;  4X1D A;  4PFR A;  3FAS A;  3PPR A;  4I40 A;  4GX4 A;  1WDN A;  4PFU A;  1FJ9 A;  3HHG A;  4DXB A;  4NHB A;  1MH3 A;  3VVD A;  3TPA A;  3K01 A;  3KBZ A;  3U94 A;  3KSJ A;  4JBZ A;  4X8R A;  4ZZA A;  2CMO A;  3TOD A;  1JW4 A;  1P1Q A;  5ITP A;  3O28 A;  1MXZ A;  1B7Z A;  1MPB A;  3CI8 A;  3MYU A;  3LUY A;  4M4G A;  3WAE A;  2KQZ A;  1NFT A;  4OYV A;  1FJ6 A;  2AL5 A;  4OFL A;  1N7W A;  4ECF A;  1SW1 A;  2RC8 A;  1B4H A;  1B1H A;  4NF4 A;  2I3V A;  1KA1 A;  3BIH A;  1EYJ A;  5B7D A;  1URD A;  1LB9 A;  2YLN A;  3U65 A;  4F1U A;  3V89 B;  5IKB A;  1B5I A;  3RT6 B;  2QVR A;  1A8F A;  4XKN A;  2Q2C A;  1IME A;  3VXC A;  4PGP A;  2UVI A;  3N94 A;  3GBB A;  5BWJ A;  2V84 A;  1DOT A;  5EYH A;  1N7X A;  2GHA A;  5A5X A;  4JWY A;  1DK4 A;  1Y4C A;  1LBV A;  1ATG A;  2IA4 A;  4MAG A;  4P0I A;  4MMP A;  1B0H A;  4QFP A;  1MY4 A;  4PTK A;  4H6D A;  4I62 A;  1N0T A;  2P2A A;  4LZ5 A;  2XXR A;  1LLS A;  5I59 B;  3I6V A;  2X7Q A;  4ZEF A;  2XWO A;  3VXB A;  1NMU A;  2D21 A;  2DWA A;  4IO3 A;  4MJO A;  1MM7 A;  2CEX A;  2XXQ A;  2KLF A;  5FHM A;  1LGB C;  5LOM A;  1INP A;  2HXR A;  3VFJ A;  3FUZ A;  1PB8 A;  4Z7E A;  1AOV A;  5EYF A;  3KG2 A;  2OWZ A;  4OEU A;  4OFJ A;  4N17 A;  5TP9 B;  1FPL A;  1FPI A;  5FTH A;  2REJ A;  4GFR A;  3IFA A;  1LB8 A;  1BKA A;  5IGA A;  4EQB A;  1BLF A;  4F22 A;  2XWK A;  3DM0 A;  4RJZ A;  2V4C A;  2Q89 A;  1NV4 A;  3FD3 A;  5I2N A;  1USY H;  4R6K A;  2VHA A;  3FJ7 A;  1R9L A;  3DP6 A;  4GLI A;  3EHT A;  4EUO A;  2CZI A;  2XXU A;  3PPP A;  4P8B A;  1IXI A;  2B4L A;  1ANF A;  3T1B A;  5ISU A;  4IB2 A;  3ZKK A;  3FXQ A;  5I2K B;  1VDW A;  1JP4 A;  2NOO A;  4O7I A;  4DDD A;  3FJM A;  1DMB A;  5IZZ A;  1EZP A;  2ZZX A;  3H6T A;  3OOA A;  4GL0 A;  1MY2 A;  1EZ9 A;  3GZG A;  3MVZ A;  3K6U A;  5CRY A;  2P3N A;  4KFQ A;  5IZ3 B;  3RLF E;  4P1L A;  1ZTY A;  5F7V A;  1PBQ A;  4BDR A;  2A5T B;  2F3D A;  2XXY A;  2NVU B;  4P56 A;  1LAF E;  5HPQ A;  1XI6 A;  2O84 X;  4XTC Q;  2P3V A;  1KWH A;  2DSF A;  2HCA A;  1AMF A;  3FVO A;  4LON B;  1M5B A;  4WEP A;  2WYK A;  5CM6 A;  4HCY A;  1SD3 A;  2DE2 A;  3CG3 A;  1NI9 A;  3S9L C;  4NG7 A;  1YZ0 A;  1URS A;  3B7D A;  2PMS A;  4EDP A;  1UIU A;  3DEL B;  4G68 B;  2OWS A;  4FEC A;  4YKI A;  3O2A A;  2Q2A A;  3MW0 A;  1SPI A;  4ISU A;  3ZS6 A;  1AL3 A;  4QBA A;  1R9Q A;  3Q29 A;  4I8C A;  4RNS A;  1MDQ A;  5J1D A;  2Y7W A;  3KN3 A;  4HW8 A;  4O3B A;  1ZKB A;  4DCY A;  1N3X A;  2B3B A;  2XXV A;  1UTB A;  4R2F A;  4P11 A;  4DXU A;  3B50 A;  3T66 A;  4AS5 A;  4ESX A;  5LTC A;  4UAB A;  3QUF A;  4KYE A;  3C34 A;  3QK6 A;  2O1M A;  4N6D A;  4EXK A;  3I5O A;  5KCJ B;  5AA2 D;  5L9O A;  2HFB A;  1MQH A;  1B4Z A;  3E13 X;  4PE3 A;  5JTY B;  2VP1 A;  5AA2 B;  3V8X B;  4OET A;  3SDF A;  3D4G A;  4H5G A;  2VPN A;  4JWX A;  1SYI A;  4XF5 A;  5A5L A;  1JW1 A;  3T0J A;  4TQU Q;  1B2H A;  3FAT A;  2O51 A;  4OFO A;  2XWI A;  2V25 A;  3DP8 A;  3OSR A;  4OA4 A;  2DVZ A;  3KBR A;  4E0X A;  2PVU A;  3K1P A;  4KD5 A;  3T9X B;  4BLA A;  5ICT A;  2GFE A;  1J1N A;  3U92 A;  2GQ1 A;  4G68 C;  3OO7 A;  1MQJ A;  3G7W A;  2HEU A;  4QHQ A;  3C9H A;  1FQE A;  2PX1 A;  4LN5 A;  1IMC A;  3IO4 A;  1SQY A;  2ZZW A;  4YB7 A;  1QGX A;  4U4X A;  1IXC A;  2PFY A;  2RCB A;  1SBP A;  1P1U A;  3CSB A;  3OEM A;  2VPO A;  3K1N A;  3FGS A;  4GWO A;  4DE8 A;  1FPK A;  4Q30 B;  2HPG A;  4NN3 A;  4RY1 A;  4YB6 A;  3OD7 A;  3EQ1 A;  4U4S A;  3TEL A;  5CMK A;  1I6A A;  4R9F A;  3IOU A;  3UN6 A; 
#chains in the Genus database with same CATH homology
 1NV1 A;  3B8B A;  1FPD A;  3LUZ A;  2WBB A;  4JVI A;  4NQ8 A;  4MCO A;  4X9T A;  2XXK A;  1G0H A;  1K9Z A;  3NOH A;  3E79 A;  2FIE A;  4PAI A;  1RDX A;  2DDK A;  2ZZV A;  4PFI A;  4PFR A;  4I40 A;  2HHM A;  4GX4 A;  4N6K A;  4MX6 A;  1LBY A;  4MIJ A;  2R8T A;  1FJ9 A;  1FPJ A;  3EKI A;  4NHB A;  1FBH A;  2WBD A;  1CNQ A;  4MEV A;  5EQ7 A;  3KBZ A;  1NUY A;  2HZK A;  4PDH A;  4X8R A;  5IM2 A;  4PFB A;  2QPQ A;  5IZ1 A;  3W9W A;  2Q74 A;  3MYU A;  3A29 A;  4PC9 A;  4GWW A;  2KQZ A;  1FJ6 A;  4GX3 A;  2QVU A;  4MNC A;  1KA1 A;  3BIH A;  1EYJ A;  4OVR A;  3U65 A;  4F1U A;  4P1E A;  1G0I A;  4N15 A;  4H45 A;  2QVR A;  4NX1 A;  3W9V A;  1IME A;  4PAF A;  1DBZ A;  4PGP A;  4DI3 D;  4HE2 A;  4PBQ A;  4GWZ A;  5EYH A;  2FBP A;  3GYY A;  2QFL A;  1DK4 A;  2WX9 A;  1LBV A;  1D9Q A;  1FTA A;  4HCW A;  4MAG A;  4MMP A;  4AS4 A;  4P9K A;  1NV0 A;  1NV3 A;  1NV2 A;  4PET A;  4PTK A;  4MHF A;  4GWU A;  4GWY A;  3FXB A;  5JK4 A;  5I7I A;  1K9Y A;  1LBX A;  1FBF A;  2XWO A;  2DE3 A;  4MJO A;  2CEX A;  2BJI A;  2F5X A;  2XA5 A;  3BIG A;  1FRP A;  1INP A;  2HXR A;  1NV5 A;  2OWZ A;  4KXP A;  1LBW A;  4N17 A;  5F24 A;  3E78 A;  1FPL A;  2CZK A;  1FPI A;  4DI4 B;  3ISP A;  2VT5 A;  1NV6 A;  4GWS A;  3IFA A;  5IGA A;  1IMB A;  3RYD A;  4NF0 A;  2XWK A;  4HE0 A;  4N8G A;  5I3S A;  1IMF A;  2L5V A;  2V4C A;  1Q9D A;  1NV4 A;  4PAK A;  4FBP A;  3HFU A;  4X04 A;  2FHY A;  3CHG A;  2CZI A;  4XFE A;  4P8B A;  1AWB A;  3FBP A;  1LEV A;  5ET6 A;  5ESY A;  2B4L A;  4HE1 A;  4MNP A;  2CEY A;  3T1B A;  4JVD A;  4NAP A;  3KC0 A;  4P3L A;  1VDW A;  4YZZ A;  1JP4 A;  4O7I A;  4HXV A;  5EQ8 A;  5DW8 A;  5IZZ A;  2ZZX A;  4GBW A;  4QXD A;  4I3Y A;  4G61 A;  5LDZ A;  1FPE A;  4OAN A;  5ET8 A;  2WEF A;  4NGU A;  2P3N A;  5IZ3 B;  4P1L A;  4M1V A;  2F3D A;  3IFC A;  1FPG A;  4GBV A;  4OVP A;  1FBP A;  4XEQ A;  2Y5K A;  4H46 A;  4P56 A;  2HZL A;  2F3B A;  1XI6 A;  2P3V A;  5IZ3 A;  3LV0 A;  3ROJ A;  1KZ8 A;  4N91 A;  2WYK A;  5CM6 A;  4HCY A;  2DE2 A;  4GX6 A;  1NI9 A;  4NG7 A;  1YXI A;  1FBD A;  4F18 A;  1YZ0 A;  2Y5L A;  2JJK A;  3MST A;  3RPL B;  4IR8 A;  4YIC A;  1FPF A;  2OX3 A;  3SZP A;  4MNI A;  1FBC A;  4GWX A;  1SPI A;  4PBH A;  4QBA A;  4F1V A;  3RPL A;  2QVV A;  5J1D A;  3QMF A;  3PTY A;  2WYP A;  2PCR A;  1YYZ A;  4O8M A;  3B50 A;  5T3J A;  4AS5 A;  2Q8M A;  5LTC A;  2MKZ A;  4UAB A;  5EYG A;  4OVS A;  4I3E A;  2PFZ A;  4PGN A;  4N6D A;  5EQ9 A;  4JVC A;  4O94 A;  2DE4 A;  4PE3 A;  1FBE A;  1DCU A;  1IMA A;  2V3Q A;  5J16 A;  2B4M A;  2FVZ A;  2VPN A;  4XF5 A;  4N81 A;  5A5L A;  5EQA A;  5ET5 A;  3T0J A;  4N4U A;  2XWV A;  1BK4 A;  2CZH A;  1LBZ A;  5I5P A;  1EYK A;  1NUX A;  2XWI A;  4PCD A;  4OA4 A;  2KR0 A;  3D1R A;  2DVZ A;  2FIX A;  4OVT A;  1IMD A;  1FSA A;  4PF6 A;  2GQ1 A;  1RDY A;  1KA0 A;  1FPB A;  4LN5 A;  1IMC A;  1RDZ A;  2ZZW A;  5FBP A;  1QGX A;  4O7M A;  4OVQ A;  2PFY A;  1FBG A;  4PDD A;  2VPO A;  4N8Y A;  1FPK A;  2HPG A;  4NN3 A;  4F19 A;  1NV7 A;  3KC1 A;  5ET7 A;  4PF8 A;  2Q9T A;  1NUZ A;  4P47 A;  1NUW A;  1EYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...