4X8SL

Factor viia in complex with the inhibitor 4-bromo-2-methoxyphenol
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
ICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Novel P1 Groups for Coagulation Factor VIIa Inhibition Using Fragment-Based Screening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Factor VIIa (Heavy Chain)
total genus 13
structure length 55
sequence length 55
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 2014-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4x8sL00
4BXWA 2FZZL 1DX5I 4D0EA 4PH9A 2P3FN 6COXA 4LMFA 3BT1A 4ZXYL 3KL6B 4M10A 1OB1C 1MOXC 3CFWA 1EAIC 1FAXL 2UWPB 4JZFL 4XL1A 4COXA 1IQNL 1FE2A 1LPKA 3HS5A 1U67A 2RNLA 1IGXA 4CUDA 4BTUA 3NTGA 2UWLB 1JV2B 1F7MA 3KRKA 3M36L 5IKVA 2PHBB 1IQJL 3ENSA 3HPTA 1W8BL 1IQKL 2F9BL 1J9CL 1IQLL 2W2ME 1KLOA 1K37A 5K0HB 4RRYA 1HCGB 4NA9L 4FM5A 2I9AA 2XBVL 2AYLA 1EZQB 1IQGL 4RRXA 2P93L 1NFUB 4BXSA 1DIYA 1G2MB 3SOQA 3TH3L 1PRHA 4RUTA 2FLBL 3M37L 2BQ7A 2NPRA 3Q3KB 1YUFA 2WPHE 2P3UA 1G1RA 3Q7DA 1UZQA 2UWOB 4ISIL 2VWNL 2VWOL 4XBMA 4Z0LA 3OLUA 1X7AL 1A3PA 4CUEA 2VH0B 3HO3A 1F0RB 2EI7B 5KN5C 5JVZA 4D90A 1F7EA 4JZEL 2WG4B 2WPIE 4C16A 1HZ8A 2P26A 1WHEA 1HX2A 1XFEA 2BOKL 1UZPA 3LC5B 5IKRA 3RR3A 1YUKB 1G1SA 3HO4A 3CENL 4AQTA 1Z6EL 4OTYA 2WYJB 1HRFA 2Y7XB 2JKHL 4NGAL 1AUTL 2G00L 2XC4L 1GK5A 2W2PE 5CISA 2BQ6A 1G2LB 4X8UL 1EMNA 2PUQL 3KK6A 3HO5A 4BTTA 1APOA 1LMJA 3N8ZA 1YO8A 3P5BL 3N8XA 1HREA 2K2TA 1V3XB 1P0SL 3OLTA 2VWMK 3QH0A 1CCVA 1EPJA 1ATAA 5F19A 1WU1B 2WG3C 2K2SB 2KV4A 1EQHA 3TK6B 2WPKE 5JBCE 4E1GA 1EPGA 3ZYJB 2XC0L 1KIGL 3HS7A 5I46L 1ATDA 1IOEL 1BF9A 4YT7L 3N8VA 1HJ7A 1CX2A 4M11A 2J95B 5CKNA 2WYGB 2Q1JB 4ZXXL 1SZBA 1ATBA 3POYA 3IITB 4Y71B 3LTGD 4Y79B 4JZDL 2KL7A 4Y7AB 1L3YA 3NT1A 4G1MB 3NTBA 5JW1A 2WPLE 3KQCL 1FFMA 1IVOC 4LORA 2B7DL 2TGFA 3GCWE 1EMOA 1DQBA 5EGMB 2P95L 1PGEA 5L2ZL 3QMOA 3DEMA 3H5CB 1LPGA 2XBWL 1NZIA 3LTFB 2WFTA 1N1IA 2YGOA 2EI6B 3NJPC 1F0SB 3KQDL 1IOXA 2Y82B 1TLEA 2P3FL 1PTHA 2H9EL 2J38B 5FDQA 4MMZB 2WPJE 1FF7A 2I9BA 4O02B 4X8SL 2Y5GL 4Y7BB 3V65B 5IKQA 2PR3B 1RFNB 2WPME 3R05A 1UZKA 3LC3B 2VWLL 1FAKL 1NFYB 2RHPA 2BMGA 1EBVA 1CEJA 2Y81B 1TPGA 1CVUA 1B9WA 1G1QA 1NT0A 1DDXA 2W26B 1PFXL 1LPZA 1IP0A 4CSYA 2EI8B 3PGHA 4D0FA 4MMXB 2MGRA 4BDXA 2BOUA 3ELAL 4NG9L 1NFXB 3C9AC 4OTJA 4MMYB 1FJSL 2J4IB 5L2YL 1I0UA 1MQ6L 2OYEP 5JVYA 2P94L 3GCXE 3N8YB 1EGFA 1Z6CA 4JYUL 1HAFA 3U7UG 3GISX 2BO2A 4CUFA 1IQFL 2P16L 3MDLA 4YT6L 3TGFA 4RRWA 1FSBA 4XLWA 4ISHL 5L30L 1MQ5L 1U8CB 2DDUA 2Y38A 1APQA 3SW2A 2BZ6L 4Y6DB 1O5DL 1CQEA 4YZUB 1URKA 3N8YA 1JL9A 1HT5A 1WHFA 3N8WB 2Y5FL 4TGFA 5IKTA 1IJQA 1KLIL 1UZJA 3HS6A 2RA0L 1KSNB 4JYVL 2YGPA 1NFWB 5JBAE 5KIRA 4ZH8B 2FLRL 1HAEA 3FFGL 3U73A 1N7DA 3CS7L 3EGFA 4RS0A 2D1JB 5JB8E 3LN1A 2OYUP 2VJ3A 1C5MF 3QCWA 1IQEL 2BOXA 3CA7A 2W2QE 1NPEB 3KCGL 2VH6B 1CCFA 2GD4A 4Y76B 2M74A 1QFKL 2J2UB 3IJEB 4Z0KB 1XKBA 3V64C 4A7IA 1IQIL 3N8WA 1LQDA 3LAQA 1IQML 5COXA 2WFXB 3K9XA 2MGPA 2BOHA 1M1XB 2VVCK 2VVVL 3ZYIB 1IQHL 2Y7ZB 2BQWA 1G1TA 3KQEL 3LIWB 1KLJL 2W3KB 1L5GB 1YUGA 2J34B 1K36A 2Y80B 2CJIB 4X8TL 2VVUL 3KQBL 5F1AA 1W7XL 1ATEA 4BTIA 3ZYGA 1XDTR 1P9JA 3BT2A 4ZHAB 1DVAL 2FLGA 3LN0A 2P3TA 2W3IB 1HT8A 4ZAEB 1EPIA 3F6UL 3FCSB 4Z6AL 5JBBE 1COUA 1ZAQA 2ADXA 4RRZA 3SOVA 1EPHA 1ADXA 4BDWA 2Y5HL 3F1SB 3TBDA 5CKQA 1PXXA 1JBUL 3BPSE 1NQLB 3SOBB 4O1ZA 3ASIA 1IGZA 2W86A 3MQEA 2J94B 2XC5L 2XBYL 1Q4GA 3TK5B 2XBXL 4X8VL 1CVWL 1XKAL 5CKMA 5E8DA 3TZIA 2P28B 2KB9A 2FD6A 1TOZA 2W2OE 3FBYA 1YGCL 2W2NE 5JB9E 2MHPA 1EQGA
chains in the Genus database with same CATH superfamily
4BXWA 2FZZL 1DX5I 4D0EA 4PH9A 2P3FN 6COXA 4LMFA 3BT1A 4ZXYL 3KL6B 4M10A 1OB1C 1MOXC 3CFWA 1EAIC 1FAXL 2UWPB 4JZFL 4XL1A 4COXA 1IQNL 3S6XA 1FE2A 1LPKA 3HS5A 1U67A 2RNLA 2H9EC 1IGXA 4CUDA 4BTUA 3NTGA 2UWLB 1JV2B 1F7MA 3KRKA 3M36L 5IKVA 2PHBB 1IQJL 3ENSA 3HPTA 1W8BL 1IQKL 2F9BL 4GU4A 1J9CL 1IQLL 2W2ME 1KLOA 1K37A 1V1HA 5K0HB 4RRYA 1HCGB 4NA9L 4FM5A 2I9AA 2XBVL 2AYLA 1EZQB 1IQGL 4RRXA 2P93L 1NFUB 4BXSA 1DIYA 1G2MB 3SOQA 3TH3L 1PRHA 4RUTA 2FLBL 3M37L 2BQ7A 2NPRA 3Q3KB 4A94C 1YUFA 2WPHE 2P3UA 1G1RA 3Q7DA 1UZQA 2UWOB 4ISIL 2VWNL 2VWOL 4XBMA 4Z0LA 3OLUA 1X7AL 1A3PA 4CUEA 2VH0B 3HO3A 1F0RB 2EI7B 2BT8A 5KN5C 5JVZA 4D90A 1F7EA 2BSFA 2VRSA 2WG4B 2WPIE 4JZEL 4C16A 1HZ8A 2P26A 1WHEA 1HX2A 1XFEA 2BOKL 1UZPA 3LC5B 5IKRA 3RR3A 1YUKB 1G1SA 3HO4A 3CENL 4AQTA 1Z6EL 4OTYA 2WYJB 1HRFA 2Y7XB 2JKHL 4NGAL 1AUTL 2G00L 2XC4L 1GK5A 2W2PE 5CISA 2BQ6A 1G2LB 4X8UL 1EMNA 2PUQL 3KK6A 3HO5A 4BTTA 1APOA 1LMJA 3N8ZA 1YO8A 3P5BL 1QIUA 3N8XA 1HREA 2K2TA 1V3XB 1P0SL 3OLTA 2VWMK 3QH0A 1CCVA 1EPJA 1ATAA 5F19A 1WU1B 2WG3C 2K2SB 2KV4A 1EQHA 3TK6B 2WPKE 5JBCE 2BT7A 4E1GA 1EPGA 3ZYJB 2XC0L 1KIGL 3HS7A 5I46L 1ATDA 1IOEL 1BF9A 4YT7L 3N8VA 1HJ7A 1CX2A 4M11A 2J95B 5CKNA 2WYGB 2Q1JB 4ZXXL 1SZBA 1ATBA 3POYA 3IITB 4Y71B 3LTGD 4Y79B 4JZDL 2KL7A 4Y7AB 1L3YA 3NT1A 4G1MB 3NTBA 5JW1A 2WPLE 3KQCL 2JJLA 1FFMA 1IVOC 4LORA 2B7DL 2TGFA 3GCWE 1EMOA 1DQBA 5EGMB 2P95L 1PGEA 5L2ZL 3QMOA 3DEMA 3H5CB 1LPGA 2XBWL 1NZIA 3LTFB 2WFTA 1N1IA 2YGOA 2EI6B 3NJPC 1F0SB 3KQDL 1IOXA 2Y82B 1TLEA 2P3FL 1PTHA 2H9EL 2J38B 5FDQA 2HORA 4MMZB 2WPJE 1FF7A 2I9BA 4O02B 4X8SL 2Y5GL 4Y7BB 3V65B 5IKQA 2PR3B 1RFNB 2WPME 3R05A 1UZKA 3LC3B 2VWLL 1FAKL 1NFYB 2RHPA 2BMGA 1EBVA 1CEJA 2Y81B 1TPGA 1CVUA 1B9WA 1G1QA 1NT0A 1DDXA 2W26B 1PFXL 1LPZA 1IP0A 4CSYA 2EI8B 4GU3A 3PGHA 4D0FA 4MMXB 2MGRA 4BDXA 2BOUA 3ELAL 4NG9L 1NFXB 3C9AC 4OTJA 4MMYB 1FJSL 2J4IB 5L2YL 1I0UA 1MQ6L 2OYEP 5JVYA 2P94L 3GCXE 3N8YB 1EGFA 1Z6CA 1LK9A 4JYUL 1HAFA 3U7UG 3GISX 2BO2A 4CUFA 1IQFL 2P16L 3MDLA 4YT6L 3TGFA 4RRWA 1FSBA 4XLWA 4ISHL 5L30L 1MQ5L 1U8CB 2DDUA 2Y38A 1APQA 3SW2A 2BZ6L 4Y6DB 1O5DL 1CQEA 4YZUB 1URKA 3N8YA 1JL9A 1HT5A 1WHFA 3N8WB 2Y5FL 4TGFA 5IKTA 1IJQA 1KLIL 1UZJA 3HS6A 2RA0L 1KSNB 2YGPA 4JYVL 1NFWB 5JBAE 5KIRA 4ZH8B 2FLRL 1HAEA 3FFGL 3U73A 1N7DA 3CS7L 3EGFA 4RS0A 2D1JB 5JB8E 1LMMA 3LN1A 2OYUP 2VJ3A 1C5MF 2HOXA 3QCWA 1IQEL 2YGQA 2BOXA 3CA7A 2W2QE 1NPEB 1V1IA 3KCGL 2VH6B 1CCFA 2GD4A 4Y76B 2M74A 1QFKL 2KNIA 2J2UB 3IJEB 4Z0KB 1XKBA 3V64C 4A7IA 1IQIL 3N8WA 1LQDA 3LAQA 1IQML 5COXA 2WFXB 3K9XA 2MGPA 2BOHA 1M1XB 2VVCK 2VVVL 3ZYIB 1IQHL 2Y7ZB 2BQWA 1G1TA 3KQEL 3LIWB 1KLJL 2W3KB 1L5GB 1YUGA 2J34B 1K36A 2Y80B 2CJIB 4X8TL 2VVUL 3KQBL 5F1AA 1W7XL 1ATEA 4BTIA 3ZYGA 1XDTR 1P9JA 2WZPP 3BT2A 4ZHAB 1DVAL 2FLGA 3LN0A 2P3TA 2W3IB 1HT8A 4ZAEB 1EPIA 3F6UL 3FCSB 4Z6AL 5JBBE 1COUA 1ZAQA 2ADXA 4RRZA 3SOVA 1EPHA 1ADXA 4BDWA 2Y5HL 3F1SB 3TBDA 5CKQA 1PXXA 1JBUL 3BPSE 1NQLB 3SOBB 4O1ZA 3ASIA 1IGZA 2W86A 3MQEA 2J94B 2XC5L 2XBYL 1Q4GA 3TK5B 2XBXL 4X8VL 1CVWL 1XKAL 5CKMA 5E8DA 3TZIA 2P28B 2KB9A 2FD6A 1TOZA 2W2OE 3FBYA 1YGCL 2W2NE 1KKEA 5JB9E 2MHPA 1EQGA
chains in the Genus database with same CATH topology
4BXWA 2FZZL 1DX5I 4D0EA 4PH9A 2P3FN 6COXA 4LMFA 3BT1A 4ZXYL 3KL6B 4M10A 1OB1C 1MOXC 3CFWA 1EAIC 1FAXL 2UWPB 4JZFL 4XL1A 4COXA 1IQNL 3S6XA 1FE2A 1LPKA 3HS5A 1U67A 2RNLA 2H9EC 1IGXA 4CUDA 4BTUA 3NTGA 2UWLB 1JV2B 1F7MA 3KRKA 3M36L 5IKVA 2PHBB 1IQJL 3ENSA 3HPTA 1W8BL 1IQKL 2F9BL 1J9CL 1IQLL 2W2ME 1KLOA 1K37A 5K0HB 4RRYA 1HCGB 4NA9L 4FM5A 2I9AA 2XBVL 2AYLA 1EZQB 1IQGL 4RRXA 2P93L 1NFUB 4BXSA 1DIYA 1G2MB 3SOQA 3TH3L 1PRHA 4RUTA 2FLBL 3M37L 2BQ7A 2NPRA 3Q3KB 4A94C 1YUFA 2WPHE 2P3UA 1G1RA 3Q7DA 1UZQA 2UWOB 4ISIL 2VWNL 2VWOL 4XBMA 4Z0LA 3OLUA 1X7AL 1A3PA 4CUEA 2VH0B 3HO3A 1F0RB 2EI7B 5KN5C 5JVZA 4D90A 1F7EA 4JZEL 2WG4B 2WPIE 4C16A 1HZ8A 2P26A 1WHEA 1HX2A 1XFEA 2BOKL 1UZPA 3LC5B 5IKRA 3RR3A 1YUKB 1G1SA 3HO4A 3CENL 4AQTA 1Z6EL 4OTYA 2WYJB 1HRFA 2Y7XB 2JKHL 4NGAL 1AUTL 2G00L 2XC4L 1GK5A 2W2PE 5CISA 2BQ6A 1G2LB 4X8UL 1EMNA 2PUQL 3KK6A 3HO5A 4BTTA 1APOA 1LMJA 3N8ZA 1YO8A 3P5BL 3N8XA 1HREA 2K2TA 1V3XB 1P0SL 3OLTA 2VWMK 3QH0A 1CCVA 1EPJA 1ATAA 5F19A 1WU1B 2WG3C 2K2SB 2KV4A 1EQHA 3TK6B 2WPKE 5JBCE 4E1GA 1EPGA 3ZYJB 2XC0L 1KIGL 3HS7A 5I46L 1ATDA 1IOEL 1BF9A 4YT7L 3N8VA 1HJ7A 1CX2A 4M11A 2J95B 5CKNA 2WYGB 2Q1JB 4ZXXL 1SZBA 1ATBA 3POYA 3IITB 4Y71B 3LTGD 4Y79B 4JZDL 2KL7A 4Y7AB 1L3YA 3NT1A 4G1MB 3NTBA 5JW1A 2WPLE 3KQCL 1FFMA 1IVOC 4LORA 2B7DL 2TGFA 3GCWE 1EMOA 1DQBA 5EGMB 2P95L 1PGEA 5L2ZL 3QMOA 3DEMA 3H5CB 1LPGA 2XBWL 1NZIA 3LTFB 2WFTA 1N1IA 2YGOA 2EI6B 3NJPC 1F0SB 3KQDL 1IOXA 2Y82B 1TLEA 2P3FL 1PTHA 2H9EL 2J38B 5FDQA 4MMZB 2WPJE 1FF7A 2I9BA 4O02B 4X8SL 2Y5GL 4Y7BB 3V65B 5IKQA 2PR3B 1RFNB 2WPME 3R05A 1UZKA 3LC3B 2VWLL 1FAKL 1NFYB 2RHPA 2BMGA 1EBVA 1CEJA 2Y81B 1TPGA 1CVUA 1B9WA 1G1QA 1NT0A 1DDXA 2W26B 1PFXL 1LPZA 1IP0A 4CSYA 2EI8B 3PGHA 4D0FA 4MMXB 2MGRA 4BDXA 2BOUA 3ELAL 4NG9L 1NFXB 3C9AC 4OTJA 4MMYB 1FJSL 2J4IB 5L2YL 1I0UA 1MQ6L 2OYEP 5JVYA 2P94L 3GCXE 3N8YB 1EGFA 1Z6CA 4JYUL 1HAFA 3U7UG 3GISX 2BO2A 4CUFA 1IQFL 2P16L 3MDLA 4YT6L 3TGFA 4RRWA 1FSBA 4XLWA 4ISHL 5L30L 1MQ5L 1U8CB 2DDUA 2Y38A 1APQA 3SW2A 2BZ6L 4Y6DB 1O5DL 1CQEA 4YZUB 1URKA 3N8YA 1JL9A 1HT5A 1WHFA 3N8WB 2Y5FL 4TGFA 5IKTA 1IJQA 1KLIL 1UZJA 3HS6A 2RA0L 1KSNB 4JYVL 2YGPA 1NFWB 5JBAE 5KIRA 4ZH8B 2FLRL 1HAEA 3FFGL 3U73A 1N7DA 3CS7L 3EGFA 4RS0A 2D1JB 5JB8E 1LMMA 3LN1A 2OYUP 2VJ3A 1C5MF 3QCWA 1IQEL 2YGQA 2BOXA 3CA7A 2W2QE 1NPEB 3KCGL 2VH6B 1CCFA 2GD4A 4Y76B 2M74A 1QFKL 2KNIA 2J2UB 3IJEB 4Z0KB 1XKBA 3V64C 4A7IA 1IQIL 3N8WA 1LQDA 3LAQA 1IQML 5COXA 2WFXB 3K9XA 2MGPA 2BOHA 1M1XB 2VVCK 2VVVL 3ZYIB 1IQHL 2Y7ZB 2BQWA 1G1TA 3KQEL 3LIWB 1KLJL 2W3KB 1L5GB 1YUGA 2J34B 1K36A 2Y80B 2CJIB 4X8TL 2VVUL 3KQBL 5F1AA 1W7XL 1ATEA 4BTIA 3ZYGA 1XDTR 1P9JA 2WZPP 3BT2A 4ZHAB 1DVAL 2FLGA 3LN0A 2P3TA 2W3IB 1HT8A 4ZAEB 1EPIA 3F6UL 3FCSB 4Z6AL 5JBBE 1COUA 1ZAQA 2ADXA 4RRZA 3SOVA 1EPHA 1ADXA 4BDWA 2Y5HL 3F1SB 3TBDA 5CKQA 1PXXA 1JBUL 3BPSE 1NQLB 3SOBB 4O1ZA 3ASIA 1IGZA 2W86A 3MQEA 2J94B 2XC5L 2XBYL 1Q4GA 3TK5B 2XBXL 4X8VL 1CVWL 1XKAL 5CKMA 5E8DA 3TZIA 2P28B 2KB9A 2FD6A 1TOZA 2W2OE 3FBYA 1YGCL 2W2NE 5JB9E 2MHPA 1EQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXW A;  2FZZ L;  1DX5 I;  4D0E A;  4PH9 A;  2P3F N;  6COX A;  4LMF A;  3BT1 A;  4ZXY L;  3KL6 B;  4M10 A;  1OB1 C;  1MOX C;  3CFW A;  1EAI C;  1FAX L;  2UWP B;  4JZF L;  4XL1 A;  4COX A;  1IQN L;  1FE2 A;  1LPK A;  3HS5 A;  1U67 A;  2RNL A;  1IGX A;  4CUD A;  4BTU A;  3NTG A;  2UWL B;  1JV2 B;  1F7M A;  3KRK A;  3M36 L;  5IKV A;  2PHB B;  1IQJ L;  3ENS A;  3HPT A;  1W8B L;  1IQK L;  2F9B L;  1J9C L;  1IQL L;  2W2M E;  1KLO A;  1K37 A;  5K0H B;  4RRY A;  1HCG B;  4NA9 L;  4FM5 A;  2I9A A;  2XBV L;  2AYL A;  1EZQ B;  1IQG L;  4RRX A;  2P93 L;  1NFU B;  4BXS A;  1DIY A;  1G2M B;  3SOQ A;  3TH3 L;  1PRH A;  4RUT A;  2FLB L;  3M37 L;  2BQ7 A;  2NPR A;  3Q3K B;  1YUF A;  2WPH E;  2P3U A;  1G1R A;  3Q7D A;  1UZQ A;  2UWO B;  4ISI L;  2VWN L;  2VWO L;  4XBM A;  4Z0L A;  3OLU A;  1X7A L;  1A3P A;  4CUE A;  2VH0 B;  3HO3 A;  1F0R B;  2EI7 B;  5KN5 C;  5JVZ A;  4D90 A;  1F7E A;  4JZE L;  2WG4 B;  2WPI E;  4C16 A;  1HZ8 A;  2P26 A;  1WHE A;  1HX2 A;  1XFE A;  2BOK L;  1UZP A;  3LC5 B;  5IKR A;  3RR3 A;  1YUK B;  1G1S A;  3HO4 A;  3CEN L;  4AQT A;  1Z6E L;  4OTY A;  2WYJ B;  1HRF A;  2Y7X B;  2JKH L;  4NGA L;  1AUT L;  2G00 L;  2XC4 L;  1GK5 A;  2W2P E;  5CIS A;  2BQ6 A;  1G2L B;  4X8U L;  1EMN A;  2PUQ L;  3KK6 A;  3HO5 A;  4BTT A;  1APO A;  1LMJ A;  3N8Z A;  1YO8 A;  3P5B L;  3N8X A;  1HRE A;  2K2T A;  1V3X B;  1P0S L;  3OLT A;  2VWM K;  3QH0 A;  1CCV A;  1EPJ A;  1ATA A;  5F19 A;  1WU1 B;  2WG3 C;  2K2S B;  2KV4 A;  1EQH A;  3TK6 B;  2WPK E;  5JBC E;  4E1G A;  1EPG A;  3ZYJ B;  2XC0 L;  1KIG L;  3HS7 A;  5I46 L;  1ATD A;  1IOE L;  1BF9 A;  4YT7 L;  3N8V A;  1HJ7 A;  1CX2 A;  4M11 A;  2J95 B;  5CKN A;  2WYG B;  2Q1J B;  4ZXX L;  1SZB A;  1ATB A;  3POY A;  3IIT B;  4Y71 B;  3LTG D;  4Y79 B;  4JZD L;  2KL7 A;  4Y7A B;  1L3Y A;  3NT1 A;  4G1M B;  3NTB A;  5JW1 A;  2WPL E;  3KQC L;  1FFM A;  1IVO C;  4LOR A;  2B7D L;  2TGF A;  3GCW E;  1EMO A;  1DQB A;  5EGM B;  2P95 L;  1PGE A;  5L2Z L;  3QMO A;  3DEM A;  3H5C B;  1LPG A;  2XBW L;  1NZI A;  3LTF B;  2WFT A;  1N1I A;  2YGO A;  2EI6 B;  3NJP C;  1F0S B;  3KQD L;  1IOX A;  2Y82 B;  1TLE A;  2P3F L;  1PTH A;  2H9E L;  2J38 B;  5FDQ A;  4MMZ B;  2WPJ E;  1FF7 A;  2I9B A;  4O02 B;  4X8S L;  2Y5G L;  4Y7B B;  3V65 B;  5IKQ A;  2PR3 B;  1RFN B;  2WPM E;  3R05 A;  1UZK A;  3LC3 B;  2VWL L;  1FAK L;  1NFY B;  2RHP A;  2BMG A;  1EBV A;  1CEJ A;  2Y81 B;  1TPG A;  1CVU A;  1B9W A;  1G1Q A;  1NT0 A;  1DDX A;  2W26 B;  1PFX L;  1LPZ A;  1IP0 A;  4CSY A;  2EI8 B;  3PGH A;  4D0F A;  4MMX B;  2MGR A;  4BDX A;  2BOU A;  3ELA L;  4NG9 L;  1NFX B;  3C9A C;  4OTJ A;  4MMY B;  1FJS L;  2J4I B;  5L2Y L;  1I0U A;  1MQ6 L;  2OYE P;  5JVY A;  2P94 L;  3GCX E;  3N8Y B;  1EGF A;  1Z6C A;  4JYU L;  1HAF A;  3U7U G;  3GIS X;  2BO2 A;  4CUF A;  1IQF L;  2P16 L;  3MDL A;  4YT6 L;  3TGF A;  4RRW A;  1FSB A;  4XLW A;  4ISH L;  5L30 L;  1MQ5 L;  1U8C B;  2DDU A;  2Y38 A;  1APQ A;  3SW2 A;  2BZ6 L;  4Y6D B;  1O5D L;  1CQE A;  4YZU B;  1URK A;  3N8Y A;  1JL9 A;  1HT5 A;  1WHF A;  3N8W B;  2Y5F L;  4TGF A;  5IKT A;  1IJQ A;  1KLI L;  1UZJ A;  3HS6 A;  2RA0 L;  1KSN B;  4JYV L;  2YGP A;  1NFW B;  5JBA E;  5KIR A;  4ZH8 B;  2FLR L;  1HAE A;  3FFG L;  3U73 A;  1N7D A;  3CS7 L;  3EGF A;  4RS0 A;  2D1J B;  5JB8 E;  3LN1 A;  2OYU P;  2VJ3 A;  1C5M F;  3QCW A;  1IQE L;  2BOX A;  3CA7 A;  2W2Q E;  1NPE B;  3KCG L;  2VH6 B;  1CCF A;  2GD4 A;  4Y76 B;  2M74 A;  1QFK L;  2J2U B;  3IJE B;  4Z0K B;  1XKB A;  3V64 C;  4A7I A;  1IQI L;  3N8W A;  1LQD A;  3LAQ A;  1IQM L;  5COX A;  2WFX B;  3K9X A;  2MGP A;  2BOH A;  1M1X B;  2VVC K;  2VVV L;  3ZYI B;  1IQH L;  2Y7Z B;  2BQW A;  1G1T A;  3KQE L;  3LIW B;  1KLJ L;  2W3K B;  1L5G B;  1YUG A;  2J34 B;  1K36 A;  2Y80 B;  2CJI B;  4X8T L;  2VVU L;  3KQB L;  5F1A A;  1W7X L;  1ATE A;  4BTI A;  3ZYG A;  1XDT R;  1P9J A;  3BT2 A;  4ZHA B;  1DVA L;  2FLG A;  3LN0 A;  2P3T A;  2W3I B;  1HT8 A;  4ZAE B;  1EPI A;  3F6U L;  3FCS B;  4Z6A L;  5JBB E;  1COU A;  1ZAQ A;  2ADX A;  4RRZ A;  3SOV A;  1EPH A;  1ADX A;  4BDW A;  2Y5H L;  3F1S B;  3TBD A;  5CKQ A;  1PXX A;  1JBU L;  3BPS E;  1NQL B;  3SOB B;  4O1Z A;  3ASI A;  1IGZ A;  2W86 A;  3MQE A;  2J94 B;  2XC5 L;  2XBY L;  1Q4G A;  3TK5 B;  2XBX L;  4X8V L;  1CVW L;  1XKA L;  5CKM A;  5E8D A;  3TZI A;  2P28 B;  2KB9 A;  2FD6 A;  1TOZ A;  2W2O E;  3FBY A;  1YGC L;  2W2N E;  5JB9 E;  2MHP A;  1EQG A; 
#chains in the Genus database with same CATH topology
 4BXW A;  2FZZ L;  1DX5 I;  4D0E A;  4PH9 A;  2P3F N;  6COX A;  4LMF A;  3BT1 A;  4ZXY L;  3KL6 B;  4M10 A;  1OB1 C;  1MOX C;  3CFW A;  1EAI C;  1FAX L;  2UWP B;  4JZF L;  4XL1 A;  4COX A;  1IQN L;  3S6X A;  1FE2 A;  1LPK A;  3HS5 A;  1U67 A;  2RNL A;  2H9E C;  1IGX A;  4CUD A;  4BTU A;  3NTG A;  2UWL B;  1JV2 B;  1F7M A;  3KRK A;  3M36 L;  5IKV A;  2PHB B;  1IQJ L;  3ENS A;  3HPT A;  1W8B L;  1IQK L;  2F9B L;  4GU4 A;  1J9C L;  1IQL L;  2W2M E;  1KLO A;  1K37 A;  1V1H A;  5K0H B;  4RRY A;  1HCG B;  4NA9 L;  4FM5 A;  2I9A A;  2XBV L;  2AYL A;  1EZQ B;  1IQG L;  4RRX A;  2P93 L;  1NFU B;  4BXS A;  1DIY A;  1G2M B;  3SOQ A;  3TH3 L;  1PRH A;  4RUT A;  2FLB L;  3M37 L;  2BQ7 A;  2NPR A;  3Q3K B;  4A94 C;  1YUF A;  2WPH E;  2P3U A;  1G1R A;  3Q7D A;  1UZQ A;  2UWO B;  4ISI L;  2VWN L;  2VWO L;  4XBM A;  4Z0L A;  3OLU A;  1X7A L;  1A3P A;  4CUE A;  2VH0 B;  3HO3 A;  1F0R B;  2EI7 B;  2BT8 A;  5KN5 C;  5JVZ A;  4D90 A;  1F7E A;  2BSF A;  2VRS A;  2WG4 B;  2WPI E;  4JZE L;  4C16 A;  1HZ8 A;  2P26 A;  1WHE A;  1HX2 A;  1XFE A;  2BOK L;  1UZP A;  3LC5 B;  5IKR A;  3RR3 A;  1YUK B;  1G1S A;  3HO4 A;  3CEN L;  4AQT A;  1Z6E L;  4OTY A;  2WYJ B;  1HRF A;  2Y7X B;  2JKH L;  4NGA L;  1AUT L;  2G00 L;  2XC4 L;  1GK5 A;  2W2P E;  5CIS A;  2BQ6 A;  1G2L B;  4X8U L;  1EMN A;  2PUQ L;  3KK6 A;  3HO5 A;  4BTT A;  1APO A;  1LMJ A;  3N8Z A;  1YO8 A;  3P5B L;  1QIU A;  3N8X A;  1HRE A;  2K2T A;  1V3X B;  1P0S L;  3OLT A;  2VWM K;  3QH0 A;  1CCV A;  1EPJ A;  1ATA A;  5F19 A;  1WU1 B;  2WG3 C;  2K2S B;  2KV4 A;  1EQH A;  3TK6 B;  2WPK E;  5JBC E;  2BT7 A;  4E1G A;  1EPG A;  3ZYJ B;  2XC0 L;  1KIG L;  3HS7 A;  5I46 L;  1ATD A;  1IOE L;  1BF9 A;  4YT7 L;  3N8V A;  1HJ7 A;  1CX2 A;  4M11 A;  2J95 B;  5CKN A;  2WYG B;  2Q1J B;  4ZXX L;  1SZB A;  1ATB A;  3POY A;  3IIT B;  4Y71 B;  3LTG D;  4Y79 B;  4JZD L;  2KL7 A;  4Y7A B;  1L3Y A;  3NT1 A;  4G1M B;  3NTB A;  5JW1 A;  2WPL E;  3KQC L;  2JJL A;  1FFM A;  1IVO C;  4LOR A;  2B7D L;  2TGF A;  3GCW E;  1EMO A;  1DQB A;  5EGM B;  2P95 L;  1PGE A;  5L2Z L;  3QMO A;  3DEM A;  3H5C B;  1LPG A;  2XBW L;  1NZI A;  3LTF B;  2WFT A;  1N1I A;  2YGO A;  2EI6 B;  3NJP C;  1F0S B;  3KQD L;  1IOX A;  2Y82 B;  1TLE A;  2P3F L;  1PTH A;  2H9E L;  2J38 B;  5FDQ A;  2HOR A;  4MMZ B;  2WPJ E;  1FF7 A;  2I9B A;  4O02 B;  4X8S L;  2Y5G L;  4Y7B B;  3V65 B;  5IKQ A;  2PR3 B;  1RFN B;  2WPM E;  3R05 A;  1UZK A;  3LC3 B;  2VWL L;  1FAK L;  1NFY B;  2RHP A;  2BMG A;  1EBV A;  1CEJ A;  2Y81 B;  1TPG A;  1CVU A;  1B9W A;  1G1Q A;  1NT0 A;  1DDX A;  2W26 B;  1PFX L;  1LPZ A;  1IP0 A;  4CSY A;  2EI8 B;  4GU3 A;  3PGH A;  4D0F A;  4MMX B;  2MGR A;  4BDX A;  2BOU A;  3ELA L;  4NG9 L;  1NFX B;  3C9A C;  4OTJ A;  4MMY B;  1FJS L;  2J4I B;  5L2Y L;  1I0U A;  1MQ6 L;  2OYE P;  5JVY A;  2P94 L;  3GCX E;  3N8Y B;  1EGF A;  1Z6C A;  1LK9 A;  4JYU L;  1HAF A;  3U7U G;  3GIS X;  2BO2 A;  4CUF A;  1IQF L;  2P16 L;  3MDL A;  4YT6 L;  3TGF A;  4RRW A;  1FSB A;  4XLW A;  4ISH L;  5L30 L;  1MQ5 L;  1U8C B;  2DDU A;  2Y38 A;  1APQ A;  3SW2 A;  2BZ6 L;  4Y6D B;  1O5D L;  1CQE A;  4YZU B;  1URK A;  3N8Y A;  1JL9 A;  1HT5 A;  1WHF A;  3N8W B;  2Y5F L;  4TGF A;  5IKT A;  1IJQ A;  1KLI L;  1UZJ A;  3HS6 A;  2RA0 L;  1KSN B;  2YGP A;  4JYV L;  1NFW B;  5JBA E;  5KIR A;  4ZH8 B;  2FLR L;  1HAE A;  3FFG L;  3U73 A;  1N7D A;  3CS7 L;  3EGF A;  4RS0 A;  2D1J B;  5JB8 E;  1LMM A;  3LN1 A;  2OYU P;  2VJ3 A;  1C5M F;  2HOX A;  3QCW A;  1IQE L;  2YGQ A;  2BOX A;  3CA7 A;  2W2Q E;  1NPE B;  1V1I A;  3KCG L;  2VH6 B;  1CCF A;  2GD4 A;  4Y76 B;  2M74 A;  1QFK L;  2KNI A;  2J2U B;  3IJE B;  4Z0K B;  1XKB A;  3V64 C;  4A7I A;  1IQI L;  3N8W A;  1LQD A;  3LAQ A;  1IQM L;  5COX A;  2WFX B;  3K9X A;  2MGP A;  2BOH A;  1M1X B;  2VVC K;  2VVV L;  3ZYI B;  1IQH L;  2Y7Z B;  2BQW A;  1G1T A;  3KQE L;  3LIW B;  1KLJ L;  2W3K B;  1L5G B;  1YUG A;  2J34 B;  1K36 A;  2Y80 B;  2CJI B;  4X8T L;  2VVU L;  3KQB L;  5F1A A;  1W7X L;  1ATE A;  4BTI A;  3ZYG A;  1XDT R;  1P9J A;  2WZP P;  3BT2 A;  4ZHA B;  1DVA L;  2FLG A;  3LN0 A;  2P3T A;  2W3I B;  1HT8 A;  4ZAE B;  1EPI A;  3F6U L;  3FCS B;  4Z6A L;  5JBB E;  1COU A;  1ZAQ A;  2ADX A;  4RRZ A;  3SOV A;  1EPH A;  1ADX A;  4BDW A;  2Y5H L;  3F1S B;  3TBD A;  5CKQ A;  1PXX A;  1JBU L;  3BPS E;  1NQL B;  3SOB B;  4O1Z A;  3ASI A;  1IGZ A;  2W86 A;  3MQE A;  2J94 B;  2XC5 L;  2XBY L;  1Q4G A;  3TK5 B;  2XBX L;  4X8V L;  1CVW L;  1XKA L;  5CKM A;  5E8D A;  3TZI A;  2P28 B;  2KB9 A;  2FD6 A;  1TOZ A;  2W2O E;  3FBY A;  1YGC L;  2W2N E;  1KKE A;  5JB9 E;  2MHP A;  1EQG A; 
#chains in the Genus database with same CATH homology
 4BXW A;  2FZZ L;  1DX5 I;  4D0E A;  4PH9 A;  2P3F N;  6COX A;  4LMF A;  3BT1 A;  4ZXY L;  3KL6 B;  4M10 A;  1OB1 C;  1MOX C;  3CFW A;  1EAI C;  1FAX L;  2UWP B;  4JZF L;  4XL1 A;  4COX A;  1IQN L;  3S6X A;  1FE2 A;  1LPK A;  3HS5 A;  1U67 A;  2RNL A;  2H9E C;  1IGX A;  4CUD A;  4BTU A;  3NTG A;  2UWL B;  1JV2 B;  1F7M A;  3KRK A;  3M36 L;  5IKV A;  2PHB B;  1IQJ L;  3ENS A;  3HPT A;  1W8B L;  1IQK L;  2F9B L;  1J9C L;  1IQL L;  2W2M E;  1KLO A;  1K37 A;  5K0H B;  4RRY A;  1HCG B;  4NA9 L;  4FM5 A;  2I9A A;  2XBV L;  2AYL A;  1EZQ B;  1IQG L;  4RRX A;  2P93 L;  1NFU B;  4BXS A;  1DIY A;  1G2M B;  3SOQ A;  3TH3 L;  1PRH A;  4RUT A;  2FLB L;  3M37 L;  2BQ7 A;  2NPR A;  3Q3K B;  4A94 C;  1YUF A;  2WPH E;  2P3U A;  1G1R A;  3Q7D A;  1UZQ A;  2UWO B;  4ISI L;  2VWN L;  2VWO L;  4XBM A;  4Z0L A;  3OLU A;  1X7A L;  1A3P A;  4CUE A;  2VH0 B;  3HO3 A;  1F0R B;  2EI7 B;  5KN5 C;  5JVZ A;  4D90 A;  1F7E A;  4JZE L;  2WG4 B;  2WPI E;  4C16 A;  1HZ8 A;  2P26 A;  1WHE A;  1HX2 A;  1XFE A;  2BOK L;  1UZP A;  3LC5 B;  5IKR A;  3RR3 A;  1YUK B;  1G1S A;  3HO4 A;  3CEN L;  4AQT A;  1Z6E L;  4OTY A;  2WYJ B;  1HRF A;  2Y7X B;  2JKH L;  4NGA L;  1AUT L;  2G00 L;  2XC4 L;  1GK5 A;  2W2P E;  5CIS A;  2BQ6 A;  1G2L B;  4X8U L;  1EMN A;  2PUQ L;  3KK6 A;  3HO5 A;  4BTT A;  1APO A;  1LMJ A;  3N8Z A;  1YO8 A;  3P5B L;  3N8X A;  1HRE A;  2K2T A;  1V3X B;  1P0S L;  3OLT A;  2VWM K;  3QH0 A;  1CCV A;  1EPJ A;  1ATA A;  5F19 A;  1WU1 B;  2WG3 C;  2K2S B;  2KV4 A;  1EQH A;  3TK6 B;  2WPK E;  5JBC E;  4E1G A;  1EPG A;  3ZYJ B;  2XC0 L;  1KIG L;  3HS7 A;  5I46 L;  1ATD A;  1IOE L;  1BF9 A;  4YT7 L;  3N8V A;  1HJ7 A;  1CX2 A;  4M11 A;  2J95 B;  5CKN A;  2WYG B;  2Q1J B;  4ZXX L;  1SZB A;  1ATB A;  3POY A;  3IIT B;  4Y71 B;  3LTG D;  4Y79 B;  4JZD L;  2KL7 A;  4Y7A B;  1L3Y A;  3NT1 A;  4G1M B;  3NTB A;  5JW1 A;  2WPL E;  3KQC L;  1FFM A;  1IVO C;  4LOR A;  2B7D L;  2TGF A;  3GCW E;  1EMO A;  1DQB A;  5EGM B;  2P95 L;  1PGE A;  5L2Z L;  3QMO A;  3DEM A;  3H5C B;  1LPG A;  2XBW L;  1NZI A;  3LTF B;  2WFT A;  1N1I A;  2YGO A;  2EI6 B;  3NJP C;  1F0S B;  3KQD L;  1IOX A;  2Y82 B;  1TLE A;  2P3F L;  1PTH A;  2H9E L;  2J38 B;  5FDQ A;  4MMZ B;  2WPJ E;  1FF7 A;  2I9B A;  4O02 B;  4X8S L;  2Y5G L;  4Y7B B;  3V65 B;  5IKQ A;  2PR3 B;  1RFN B;  2WPM E;  3R05 A;  1UZK A;  3LC3 B;  2VWL L;  1FAK L;  1NFY B;  2RHP A;  2BMG A;  1EBV A;  1CEJ A;  2Y81 B;  1TPG A;  1CVU A;  1B9W A;  1G1Q A;  1NT0 A;  1DDX A;  2W26 B;  1PFX L;  1LPZ A;  1IP0 A;  4CSY A;  2EI8 B;  3PGH A;  4D0F A;  4MMX B;  2MGR A;  4BDX A;  2BOU A;  3ELA L;  4NG9 L;  1NFX B;  3C9A C;  4OTJ A;  4MMY B;  1FJS L;  2J4I B;  5L2Y L;  1I0U A;  1MQ6 L;  2OYE P;  5JVY A;  2P94 L;  3GCX E;  3N8Y B;  1EGF A;  1Z6C A;  4JYU L;  1HAF A;  3U7U G;  3GIS X;  2BO2 A;  4CUF A;  1IQF L;  2P16 L;  3MDL A;  4YT6 L;  3TGF A;  4RRW A;  1FSB A;  4XLW A;  4ISH L;  5L30 L;  1MQ5 L;  1U8C B;  2DDU A;  2Y38 A;  1APQ A;  3SW2 A;  2BZ6 L;  4Y6D B;  1O5D L;  1CQE A;  4YZU B;  1URK A;  3N8Y A;  1JL9 A;  1HT5 A;  1WHF A;  3N8W B;  2Y5F L;  4TGF A;  5IKT A;  1IJQ A;  1KLI L;  1UZJ A;  3HS6 A;  2RA0 L;  1KSN B;  4JYV L;  2YGP A;  1NFW B;  5JBA E;  5KIR A;  4ZH8 B;  2FLR L;  1HAE A;  3FFG L;  3U73 A;  1N7D A;  3CS7 L;  3EGF A;  4RS0 A;  2D1J B;  5JB8 E;  1LMM A;  3LN1 A;  2OYU P;  2VJ3 A;  1C5M F;  3QCW A;  1IQE L;  2YGQ A;  2BOX A;  3CA7 A;  2W2Q E;  1NPE B;  3KCG L;  2VH6 B;  1CCF A;  2GD4 A;  4Y76 B;  2M74 A;  1QFK L;  2KNI A;  2J2U B;  3IJE B;  4Z0K B;  1XKB A;  3V64 C;  4A7I A;  1IQI L;  3N8W A;  1LQD A;  3LAQ A;  1IQM L;  5COX A;  2WFX B;  3K9X A;  2MGP A;  2BOH A;  1M1X B;  2VVC K;  2VVV L;  3ZYI B;  1IQH L;  2Y7Z B;  2BQW A;  1G1T A;  3KQE L;  3LIW B;  1KLJ L;  2W3K B;  1L5G B;  1YUG A;  2J34 B;  1K36 A;  2Y80 B;  2CJI B;  4X8T L;  2VVU L;  3KQB L;  5F1A A;  1W7X L;  1ATE A;  4BTI A;  3ZYG A;  1XDT R;  1P9J A;  2WZP P;  3BT2 A;  4ZHA B;  1DVA L;  2FLG A;  3LN0 A;  2P3T A;  2W3I B;  1HT8 A;  4ZAE B;  1EPI A;  3F6U L;  3FCS B;  4Z6A L;  5JBB E;  1COU A;  1ZAQ A;  2ADX A;  4RRZ A;  3SOV A;  1EPH A;  1ADX A;  4BDW A;  2Y5H L;  3F1S B;  3TBD A;  5CKQ A;  1PXX A;  1JBU L;  3BPS E;  1NQL B;  3SOB B;  4O1Z A;  3ASI A;  1IGZ A;  2W86 A;  3MQE A;  2J94 B;  2XC5 L;  2XBY L;  1Q4G A;  3TK5 B;  2XBX L;  4X8V L;  1CVW L;  1XKA L;  5CKM A;  5E8D A;  3TZI A;  2P28 B;  2KB9 A;  2FD6 A;  1TOZ A;  2W2O E;  3FBY A;  1YGC L;  2W2N E;  5JB9 E;  2MHP A;  1EQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...