4X8UL

Factor viia in complex with the inhibitor 5-chloro-1h-indole-2-carboxylic acid
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
ICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Novel P1 Groups for Coagulation Factor VIIa Inhibition Using Fragment-Based Screening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Factor VIIa (Heavy Chain)
total genus 10
structure length 55
sequence length 55
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 2014-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4x8uL00
2XBVL 5CKNA 2H9EL 2YGPA 3KQCL 2MHPA 1HCGB 2J94B 1APOA 1EZQB 2BQWA 1NZIA 4BTTA 1HRFA 4MMXB 4MMYB 2P28B 3LN0A 2W3KB 1WHEA 4JYVL 2FLGA 4COXA 1EMNA 4BDWA 2W2ME 3KCGL 2J95B 2WPKE 1PGEA 3ZYJB 1TLEA 2GD4A 4D0FA 2BOUA 2PR3B 1PRHA 4FM5A 2K2TA 2P3UA 2UWPB 2MGPA 1HZ8A 1IGZA 4LMFA 2VWMK 1G2MB 5I46L 4BTUA 1K36A 1G1SA 2WPME 1EQHA 3F1SB 2FLBL 2P26A 2VJ3A 1IGXA 2J38B 2BQ7A 3V65B 4RRXA 1EAIC 2BO2A 5IKRA 1IQML 4ZXYL 2WPJE 4Z0LA 1UZQA 5IKTA 3NJPC 1W8BL 2Y5FL 1QFKL 4RRYA 3HS7A 1I0UA 3ZYIB 1FSBA 1F0RB 2BOKL 4A7IA 1LQDA 2W2QE 4OTJA 4BXWA 2J34B 4LORA 3FCSB 3Q7DA 1X7AL 3U73A 1OB1C 1DDXA 5IKQA 1EQGA 1KSNB 2UWOB 2P3TA 4D0EA 3F6UL 3N8WA 1FAKL 3Q3KB 1F7MA 2I9BA 3LC5B 4AQTA 1JV2B 1N7DA 1WU1B 2FZZL 3IJEB 1GK5A 3QCWA 5JBBE 4JZEL 5CKMA 2Y82B 2PUQL 3R05A 3M37L 5CISA 3KK6A 4O02B 1L3YA 2XC4L 3LC3B 1PFXL 3LTGD 2G00L 2VVVL 4Y76B 1APQA 1G1TA 3KRKA 1HT5A 2W2OE 1JL9A 2TGFA 4RRZA 1XFEA 4RRWA 2ADXA 1V3XB 3TH3L 1A3PA 3LN1A 4X8VL 2WYGB 2J4IB 2UWLB 6COXA 1IQIL 1W7XL 1MQ5L 1CEJA 1AUTL 4Y7BB 4XBMA 1K37A 4MMZB 1FFMA 1DQBA 1URKA 4X8UL 2YGOA 1CQEA 2J2UB 3QH0A 1YO8A 1NFYB 3H5CB 1KLIL 1IP0A 2F9BL 4Y7AB 1IOXA 4Y79B 3ZYGA 3CA7A 4CUFA 3GISX 2Y80B 1Z6EL 4M11A 2VWOL 4JYUL 5E8DA 1IJQA 1TOZA 2VH6B 1CVWL 2I9AA 2Y5HL 1EPJA 1IOEL 5L30L 2OYEP 2Y7XB 1DIYA 2VWNL 1ADXA 5L2ZL 1ATBA 2NPRA 2B7DL 4PH9A 5JBAE 3TGFA 1UZPA 5JB8E 3CFWA 1NPEB 4X8SL 3HO4A 2RNLA 4Y71B 2WPHE 1U8CB 3RR3A 2W2NE 2XBXL 1FJSL 2KV4A 4YZUB 3QMOA 2FLRL 4G1MB 4ZH8B 1XKBA 1YUFA 4BTIA 3FFGL 1NFXB 3ENSA 3GCWE 2VH0B 3GCXE 1BF9A 1EMOA 1C5MF 1IQNL 1CCFA 1LPZA 2BMGA 2BZ6L 4TGFA 2WG3C 1XDTR 1Z6CA 2BOXA 3CS7L 4NA9L 1PXXA 4RS0A 1HAEA 2W3IB 3C9AC 2JKHL 4ISIL 2XC5L 1IQKL 4NG9L 1NT0A 1U67A 4BXSA 5F19A 2M74A 3ELAL 1XKAL 2P3FN 2P94L 3HS5A 2P95L 5CKQA 1Q4GA 2RHPA 3HO3A 3LTFB 3N8YB 4OTYA 2VVUL 3LIWB 3TK6B 3BT2A 4Z0KB 1G1RA 3HPTA 1EPIA 2CJIB 3TK5B 3NT1A 1L5GB 2XBYL 1P9JA 1CX2A 1MOXC 2RA0L 2OYUP 1UZJA 2W86A 2AYLA 2WPLE 2EI8B 5FDQA 1EGFA 1EPHA 2MGRA 3N8VA 4RUTA 1G2LB 1UZKA 2KB9A 3MQEA 3SOBB 4ZHAB 2EI7B 4ISHL 2FD6A 2EI6B 3OLUA 2W2PE 3SOVA 1WHFA 1HAFA 1DX5I 4C16A 1IVOC 3KQEL 5L2YL 4JZFL 3K9XA 4CSYA 3KL6B 1EBVA 2XC0L 3HO5A 2WPIE 3TZIA 1P0SL 2D1JB 2Y7ZB 2PHBB 2DDUA 5JW1A 3N8YA 4CUDA 5JB9E 3N8WB 4ZXXL 1HT8A 1O5DL 4D90A 1ZAQA 5JBCE 3N8XA 5KN5C 1F0SB 3KQBL 1F7EA 1LMJA 5EGMB 1B9WA 2WG4B 3PGHA 2WYJB 2K2SB 3KQDL 3BT1A 1PTHA 2KL7A 4YT6L 1LPGA 3U7UG 1KIGL 1G1QA 1EPGA 2BQ6A 1DVAL 1HREA 5COXA 4XLWA 3LAQA 1KLJL 3NTGA 1COUA 3POYA 2VVCK 1CCVA 3SW2A 3DEMA 1IQEL 5JVYA 4Y6DB 2Q1JB 1IQHL 1M1XB 1NQLB 1FAXL 1HX2A 1J9CL 4M10A 2BOHA 3MDLA 3IITB 3V64C 3FBYA 1NFUB 4E1GA 1YUKB 4CUEA 1CVUA 1YUGA 1NFWB 2Y38A 3M36L 3EGFA 3NTBA 2W26B 3P5BL 1FE2A 5K0HB 5JVZA 1FF7A 3N8ZA 2WFTA 4O1ZA 5IKVA 3TBDA 4X8TL 1KLOA 3ASIA 2P16L 3CENL 1IQJL 1MQ6L 1IQFL 5KIRA 2Y5GL 1JBUL 2VWLL 1IQGL 1HJ7A 4Z6AL 4BDXA 5F1AA 4YT7L 1LPKA 3BPSE 2P3FL 1ATAA 3SOQA 1YGCL 1SZBA 4XL1A 1ATEA 2WFXB 4JZDL 2P93L 1RFNB 1ATDA 1IQLL 2Y81B 3HS6A 3OLTA 1TPGA 4NGAL 1N1IA 2XBWL 4ZAEB
chains in the Genus database with same CATH superfamily
2XBVL 5CKNA 2H9EL 2YGPA 3KQCL 2MHPA 1HCGB 2J94B 1APOA 1EZQB 2BQWA 1NZIA 4BTTA 1HRFA 4MMXB 4MMYB 2P28B 3LN0A 2W3KB 1WHEA 4JYVL 2FLGA 4COXA 1EMNA 4BDWA 2W2ME 3KCGL 2J95B 2WPKE 1PGEA 3ZYJB 1TLEA 2GD4A 4D0FA 2BOUA 2PR3B 1PRHA 4FM5A 2K2TA 2P3UA 2UWPB 2MGPA 1HZ8A 1IGZA 4LMFA 2VWMK 1G2MB 5I46L 4BTUA 1K36A 1G1SA 1V1HA 1EQHA 2WPME 3F1SB 2FLBL 2P26A 2VJ3A 1IGXA 2J38B 2BQ7A 3V65B 4RRXA 1EAIC 2BO2A 5IKRA 1IQML 4ZXYL 2WPJE 4Z0LA 1UZQA 5IKTA 3NJPC 1W8BL 2Y5FL 1QFKL 4RRYA 3HS7A 1I0UA 3ZYIB 1FSBA 1F0RB 2BOKL 4A7IA 1LQDA 2W2QE 4OTJA 4BXWA 2J34B 4LORA 3FCSB 3Q7DA 1X7AL 3U73A 1OB1C 1DDXA 5IKQA 2H9EC 1EQGA 1KSNB 2UWOB 2P3TA 4D0EA 3F6UL 3N8WA 1FAKL 3Q3KB 1F7MA 2I9BA 3LC5B 1LK9A 4AQTA 1JV2B 1N7DA 1WU1B 2VRSA 2FZZL 3IJEB 2HORA 1GK5A 3QCWA 5JBBE 4JZEL 1KKEA 5CKMA 2Y82B 2PUQL 2JJLA 3R05A 3M37L 5CISA 3KK6A 4O02B 1L3YA 2XC4L 3LC3B 1PFXL 3LTGD 2G00L 2VVVL 4Y76B 1APQA 1G1TA 3KRKA 1HT5A 2W2OE 1JL9A 2TGFA 4RRZA 1XFEA 4RRWA 2ADXA 1V3XB 3TH3L 1A3PA 3LN1A 4X8VL 2WYGB 1V1IA 2J4IB 2UWLB 6COXA 1IQIL 1W7XL 1MQ5L 1CEJA 1AUTL 4Y7BB 4XBMA 1K37A 4MMZB 4GU4A 1FFMA 1DQBA 1URKA 4X8UL 2YGOA 1CQEA 2J2UB 3QH0A 1YO8A 1NFYB 3H5CB 1KLIL 1IP0A 2F9BL 4Y7AB 1IOXA 4Y79B 3ZYGA 3CA7A 4CUFA 3GISX 2Y80B 1Z6EL 4M11A 2VWOL 4JYUL 5E8DA 1IJQA 1TOZA 2VH6B 1CVWL 2BT8A 2I9AA 2Y5HL 1EPJA 1IOEL 5L30L 2OYEP 2Y7XB 1DIYA 2VWNL 1ADXA 5L2ZL 1ATBA 2NPRA 2B7DL 4PH9A 5JBAE 4GU3A 3TGFA 1UZPA 5JB8E 3CFWA 1NPEB 4X8SL 3HO4A 2RNLA 4Y71B 2WPHE 1U8CB 3RR3A 2W2NE 2XBXL 1FJSL 2KV4A 1QIUA 3QMOA 4YZUB 2FLRL 4G1MB 4ZH8B 1XKBA 1YUFA 4BTIA 3FFGL 1NFXB 3ENSA 3GCWE 2VH0B 3GCXE 1BF9A 1EMOA 1C5MF 1IQNL 1CCFA 1LPZA 2BMGA 2BZ6L 4TGFA 2WG3C 1XDTR 1Z6CA 2BOXA 1LMMA 3CS7L 4NA9L 1PXXA 4RS0A 1HAEA 2W3IB 3C9AC 3S6XA 2JKHL 4ISIL 2XC5L 1IQKL 2YGQA 4NG9L 1NT0A 1U67A 4BXSA 5F19A 2M74A 3ELAL 1XKAL 2P3FN 2P94L 3HS5A 2P95L 5CKQA 1Q4GA 2RHPA 3HO3A 3LTFB 3N8YB 4OTYA 2VVUL 3LIWB 3TK6B 3BT2A 4Z0KB 1G1RA 3HPTA 1EPIA 2CJIB 3TK5B 3NT1A 2WZPP 1L5GB 2XBYL 2KNIA 1P9JA 1CX2A 1MOXC 2RA0L 2OYUP 1UZJA 2W86A 2AYLA 2WPLE 2EI8B 5FDQA 1EGFA 1EPHA 2MGRA 3N8VA 4RUTA 1G2LB 1UZKA 2KB9A 3MQEA 3SOBB 4ZHAB 2EI7B 4ISHL 2FD6A 2EI6B 3OLUA 2W2PE 3SOVA 1WHFA 1HAFA 1DX5I 4C16A 1IVOC 3KQEL 5L2YL 4JZFL 3K9XA 4CSYA 3KL6B 1EBVA 2XC0L 3HO5A 2WPIE 3TZIA 1P0SL 2D1JB 2Y7ZB 2PHBB 2DDUA 5JW1A 3N8YA 4CUDA 5JB9E 3N8WB 4ZXXL 1HT8A 1O5DL 4D90A 1ZAQA 5JBCE 3N8XA 5KN5C 1F0SB 3KQBL 1F7EA 4A94C 1LMJA 5EGMB 1B9WA 2WG4B 3PGHA 2WYJB 2K2SB 3KQDL 3BT1A 2HOXA 1PTHA 2KL7A 4YT6L 1LPGA 3U7UG 1KIGL 1G1QA 1EPGA 2BQ6A 1DVAL 1HREA 5COXA 4XLWA 3LAQA 1KLJL 3NTGA 1COUA 3POYA 2VVCK 1CCVA 3SW2A 3DEMA 1IQEL 5JVYA 4Y6DB 2Q1JB 1IQHL 1M1XB 1NQLB 1FAXL 1HX2A 1J9CL 4M10A 2BOHA 3MDLA 3IITB 3V64C 3FBYA 1NFUB 4E1GA 1YUKB 4CUEA 1CVUA 1YUGA 1NFWB 2Y38A 3M36L 3EGFA 3NTBA 2W26B 3P5BL 1FE2A 5K0HB 5JVZA 1FF7A 3N8ZA 2WFTA 4O1ZA 5IKVA 3TBDA 2BT7A 4X8TL 1KLOA 3ASIA 2P16L 3CENL 1IQJL 1MQ6L 1IQFL 5KIRA 2Y5GL 1JBUL 2VWLL 1IQGL 1HJ7A 4Z6AL 4BDXA 5F1AA 4YT7L 1LPKA 3BPSE 2P3FL 1ATAA 3SOQA 1YGCL 1SZBA 4XL1A 1ATEA 2WFXB 2P93L 4JZDL 1RFNB 2BSFA 1ATDA 1IQLL 2Y81B 3HS6A 3OLTA 1TPGA 4NGAL 1N1IA 2XBWL 4ZAEB
chains in the Genus database with same CATH topology
2XBVL 5CKNA 2H9EL 2YGPA 3KQCL 2MHPA 1HCGB 2J94B 1APOA 1EZQB 2BQWA 1NZIA 4BTTA 1HRFA 4MMXB 4MMYB 2P28B 3LN0A 2W3KB 1WHEA 4JYVL 2FLGA 4COXA 1EMNA 4BDWA 2W2ME 3KCGL 2J95B 2WPKE 1PGEA 3ZYJB 1TLEA 2GD4A 4D0FA 2BOUA 2PR3B 1PRHA 4FM5A 2K2TA 2P3UA 2UWPB 2MGPA 1HZ8A 1IGZA 4LMFA 2VWMK 1G2MB 5I46L 4BTUA 1K36A 1G1SA 2WPME 1EQHA 3F1SB 2FLBL 2P26A 2VJ3A 1IGXA 2J38B 2BQ7A 3V65B 4RRXA 1EAIC 2BO2A 5IKRA 1IQML 4ZXYL 2WPJE 4Z0LA 1UZQA 5IKTA 3NJPC 1W8BL 2Y5FL 1QFKL 4RRYA 3HS7A 1I0UA 3ZYIB 1FSBA 1F0RB 2BOKL 4A7IA 1LQDA 2W2QE 4OTJA 4BXWA 2J34B 4LORA 3FCSB 3Q7DA 1X7AL 3U73A 1OB1C 1DDXA 5IKQA 2H9EC 1EQGA 1KSNB 2UWOB 2P3TA 4D0EA 3F6UL 3N8WA 1FAKL 3Q3KB 1F7MA 2I9BA 3LC5B 4AQTA 1JV2B 1N7DA 1WU1B 2FZZL 3IJEB 1GK5A 3QCWA 5JBBE 4JZEL 5CKMA 2Y82B 2PUQL 3R05A 3M37L 5CISA 3KK6A 4O02B 1L3YA 2XC4L 3LC3B 1PFXL 3LTGD 2G00L 2VVVL 4Y76B 1APQA 1G1TA 3KRKA 1HT5A 2W2OE 1JL9A 2TGFA 4RRZA 1XFEA 4RRWA 2ADXA 1V3XB 3TH3L 1A3PA 3LN1A 4X8VL 2WYGB 2J4IB 2UWLB 6COXA 1IQIL 1W7XL 1MQ5L 1CEJA 1AUTL 4Y7BB 4XBMA 1K37A 4MMZB 1FFMA 1DQBA 1URKA 4X8UL 2YGOA 1CQEA 2J2UB 3QH0A 1YO8A 1NFYB 3H5CB 1KLIL 1IP0A 2F9BL 4Y7AB 1IOXA 4Y79B 3ZYGA 3CA7A 4CUFA 3GISX 2Y80B 1Z6EL 4M11A 2VWOL 4JYUL 5E8DA 1IJQA 1TOZA 2VH6B 1CVWL 2I9AA 2Y5HL 1EPJA 1IOEL 5L30L 2OYEP 2Y7XB 1DIYA 2VWNL 1ADXA 5L2ZL 1ATBA 2NPRA 2B7DL 4PH9A 5JBAE 3TGFA 1UZPA 5JB8E 3CFWA 1NPEB 4X8SL 3HO4A 2RNLA 4Y71B 2WPHE 1U8CB 3RR3A 2W2NE 2XBXL 1FJSL 2KV4A 4YZUB 3QMOA 2FLRL 4G1MB 4ZH8B 1XKBA 1YUFA 4BTIA 3FFGL 1NFXB 3ENSA 3GCWE 2VH0B 3GCXE 1BF9A 1EMOA 1C5MF 1IQNL 1CCFA 1LPZA 2BMGA 2BZ6L 4TGFA 2WG3C 1XDTR 1Z6CA 2BOXA 1LMMA 3CS7L 4NA9L 1PXXA 4RS0A 1HAEA 2W3IB 3C9AC 3S6XA 2JKHL 4ISIL 2XC5L 1IQKL 2YGQA 4NG9L 1NT0A 1U67A 4BXSA 5F19A 2M74A 3ELAL 1XKAL 2P3FN 2P94L 3HS5A 2P95L 5CKQA 1Q4GA 2RHPA 3HO3A 3LTFB 3N8YB 4OTYA 2VVUL 3LIWB 3TK6B 3BT2A 4Z0KB 1G1RA 3HPTA 1EPIA 2CJIB 3TK5B 3NT1A 2WZPP 1L5GB 2XBYL 2KNIA 1P9JA 1CX2A 1MOXC 2RA0L 2OYUP 1UZJA 2W86A 2AYLA 2WPLE 2EI8B 5FDQA 1EGFA 1EPHA 2MGRA 3N8VA 4RUTA 1G2LB 1UZKA 2KB9A 3MQEA 3SOBB 4ZHAB 2EI7B 4ISHL 2FD6A 2EI6B 3OLUA 2W2PE 3SOVA 1WHFA 1HAFA 1DX5I 4C16A 1IVOC 3KQEL 5L2YL 4JZFL 3K9XA 4CSYA 3KL6B 1EBVA 2XC0L 3HO5A 2WPIE 3TZIA 1P0SL 2D1JB 2Y7ZB 2PHBB 2DDUA 5JW1A 3N8YA 4CUDA 5JB9E 3N8WB 4ZXXL 1HT8A 1O5DL 4D90A 1ZAQA 5JBCE 3N8XA 5KN5C 1F0SB 3KQBL 1F7EA 4A94C 1LMJA 5EGMB 1B9WA 2WG4B 3PGHA 2WYJB 2K2SB 3KQDL 3BT1A 1PTHA 2KL7A 4YT6L 1LPGA 3U7UG 1KIGL 1G1QA 1EPGA 2BQ6A 1DVAL 1HREA 5COXA 4XLWA 3LAQA 1KLJL 3NTGA 1COUA 3POYA 2VVCK 1CCVA 3SW2A 3DEMA 1IQEL 5JVYA 4Y6DB 2Q1JB 1IQHL 1M1XB 1NQLB 1FAXL 1HX2A 1J9CL 4M10A 2BOHA 3MDLA 3IITB 3V64C 3FBYA 1NFUB 4E1GA 1YUKB 4CUEA 1CVUA 1YUGA 1NFWB 2Y38A 3M36L 3EGFA 3NTBA 2W26B 3P5BL 1FE2A 5K0HB 5JVZA 1FF7A 3N8ZA 2WFTA 4O1ZA 5IKVA 3TBDA 4X8TL 1KLOA 3ASIA 2P16L 3CENL 1IQJL 1MQ6L 1IQFL 5KIRA 2Y5GL 1JBUL 2VWLL 1IQGL 1HJ7A 4Z6AL 4BDXA 5F1AA 4YT7L 1LPKA 3BPSE 2P3FL 1ATAA 3SOQA 1YGCL 1SZBA 4XL1A 1ATEA 2WFXB 4JZDL 2P93L 1RFNB 1ATDA 1IQLL 2Y81B 3HS6A 3OLTA 1TPGA 4NGAL 1N1IA 2XBWL 4ZAEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XBV L;  5CKN A;  2H9E L;  2YGP A;  3KQC L;  2MHP A;  1HCG B;  2J94 B;  1APO A;  1EZQ B;  2BQW A;  1NZI A;  4BTT A;  1HRF A;  4MMX B;  4MMY B;  2P28 B;  3LN0 A;  2W3K B;  1WHE A;  4JYV L;  2FLG A;  4COX A;  1EMN A;  4BDW A;  2W2M E;  3KCG L;  2J95 B;  2WPK E;  1PGE A;  3ZYJ B;  1TLE A;  2GD4 A;  4D0F A;  2BOU A;  2PR3 B;  1PRH A;  4FM5 A;  2K2T A;  2P3U A;  2UWP B;  2MGP A;  1HZ8 A;  1IGZ A;  4LMF A;  2VWM K;  1G2M B;  5I46 L;  4BTU A;  1K36 A;  1G1S A;  2WPM E;  1EQH A;  3F1S B;  2FLB L;  2P26 A;  2VJ3 A;  1IGX A;  2J38 B;  2BQ7 A;  3V65 B;  4RRX A;  1EAI C;  2BO2 A;  5IKR A;  1IQM L;  4ZXY L;  2WPJ E;  4Z0L A;  1UZQ A;  5IKT A;  3NJP C;  1W8B L;  2Y5F L;  1QFK L;  4RRY A;  3HS7 A;  1I0U A;  3ZYI B;  1FSB A;  1F0R B;  2BOK L;  4A7I A;  1LQD A;  2W2Q E;  4OTJ A;  4BXW A;  2J34 B;  4LOR A;  3FCS B;  3Q7D A;  1X7A L;  3U73 A;  1OB1 C;  1DDX A;  5IKQ A;  1EQG A;  1KSN B;  2UWO B;  2P3T A;  4D0E A;  3F6U L;  3N8W A;  1FAK L;  3Q3K B;  1F7M A;  2I9B A;  3LC5 B;  4AQT A;  1JV2 B;  1N7D A;  1WU1 B;  2FZZ L;  3IJE B;  1GK5 A;  3QCW A;  5JBB E;  4JZE L;  5CKM A;  2Y82 B;  2PUQ L;  3R05 A;  3M37 L;  5CIS A;  3KK6 A;  4O02 B;  1L3Y A;  2XC4 L;  3LC3 B;  1PFX L;  3LTG D;  2G00 L;  2VVV L;  4Y76 B;  1APQ A;  1G1T A;  3KRK A;  1HT5 A;  2W2O E;  1JL9 A;  2TGF A;  4RRZ A;  1XFE A;  4RRW A;  2ADX A;  1V3X B;  3TH3 L;  1A3P A;  3LN1 A;  4X8V L;  2WYG B;  2J4I B;  2UWL B;  6COX A;  1IQI L;  1W7X L;  1MQ5 L;  1CEJ A;  1AUT L;  4Y7B B;  4XBM A;  1K37 A;  4MMZ B;  1FFM A;  1DQB A;  1URK A;  4X8U L;  2YGO A;  1CQE A;  2J2U B;  3QH0 A;  1YO8 A;  1NFY B;  3H5C B;  1KLI L;  1IP0 A;  2F9B L;  4Y7A B;  1IOX A;  4Y79 B;  3ZYG A;  3CA7 A;  4CUF A;  3GIS X;  2Y80 B;  1Z6E L;  4M11 A;  2VWO L;  4JYU L;  5E8D A;  1IJQ A;  1TOZ A;  2VH6 B;  1CVW L;  2I9A A;  2Y5H L;  1EPJ A;  1IOE L;  5L30 L;  2OYE P;  2Y7X B;  1DIY A;  2VWN L;  1ADX A;  5L2Z L;  1ATB A;  2NPR A;  2B7D L;  4PH9 A;  5JBA E;  3TGF A;  1UZP A;  5JB8 E;  3CFW A;  1NPE B;  4X8S L;  3HO4 A;  2RNL A;  4Y71 B;  2WPH E;  1U8C B;  3RR3 A;  2W2N E;  2XBX L;  1FJS L;  2KV4 A;  4YZU B;  3QMO A;  2FLR L;  4G1M B;  4ZH8 B;  1XKB A;  1YUF A;  4BTI A;  3FFG L;  1NFX B;  3ENS A;  3GCW E;  2VH0 B;  3GCX E;  1BF9 A;  1EMO A;  1C5M F;  1IQN L;  1CCF A;  1LPZ A;  2BMG A;  2BZ6 L;  4TGF A;  2WG3 C;  1XDT R;  1Z6C A;  2BOX A;  3CS7 L;  4NA9 L;  1PXX A;  4RS0 A;  1HAE A;  2W3I B;  3C9A C;  2JKH L;  4ISI L;  2XC5 L;  1IQK L;  4NG9 L;  1NT0 A;  1U67 A;  4BXS A;  5F19 A;  2M74 A;  3ELA L;  1XKA L;  2P3F N;  2P94 L;  3HS5 A;  2P95 L;  5CKQ A;  1Q4G A;  2RHP A;  3HO3 A;  3LTF B;  3N8Y B;  4OTY A;  2VVU L;  3LIW B;  3TK6 B;  3BT2 A;  4Z0K B;  1G1R A;  3HPT A;  1EPI A;  2CJI B;  3TK5 B;  3NT1 A;  1L5G B;  2XBY L;  1P9J A;  1CX2 A;  1MOX C;  2RA0 L;  2OYU P;  1UZJ A;  2W86 A;  2AYL A;  2WPL E;  2EI8 B;  5FDQ A;  1EGF A;  1EPH A;  2MGR A;  3N8V A;  4RUT A;  1G2L B;  1UZK A;  2KB9 A;  3MQE A;  3SOB B;  4ZHA B;  2EI7 B;  4ISH L;  2FD6 A;  2EI6 B;  3OLU A;  2W2P E;  3SOV A;  1WHF A;  1HAF A;  1DX5 I;  4C16 A;  1IVO C;  3KQE L;  5L2Y L;  4JZF L;  3K9X A;  4CSY A;  3KL6 B;  1EBV A;  2XC0 L;  3HO5 A;  2WPI E;  3TZI A;  1P0S L;  2D1J B;  2Y7Z B;  2PHB B;  2DDU A;  5JW1 A;  3N8Y A;  4CUD A;  5JB9 E;  3N8W B;  4ZXX L;  1HT8 A;  1O5D L;  4D90 A;  1ZAQ A;  5JBC E;  3N8X A;  5KN5 C;  1F0S B;  3KQB L;  1F7E A;  1LMJ A;  5EGM B;  1B9W A;  2WG4 B;  3PGH A;  2WYJ B;  2K2S B;  3KQD L;  3BT1 A;  1PTH A;  2KL7 A;  4YT6 L;  1LPG A;  3U7U G;  1KIG L;  1G1Q A;  1EPG A;  2BQ6 A;  1DVA L;  1HRE A;  5COX A;  4XLW A;  3LAQ A;  1KLJ L;  3NTG A;  1COU A;  3POY A;  2VVC K;  1CCV A;  3SW2 A;  3DEM A;  1IQE L;  5JVY A;  4Y6D B;  2Q1J B;  1IQH L;  1M1X B;  1NQL B;  1FAX L;  1HX2 A;  1J9C L;  4M10 A;  2BOH A;  3MDL A;  3IIT B;  3V64 C;  3FBY A;  1NFU B;  4E1G A;  1YUK B;  4CUE A;  1CVU A;  1YUG A;  1NFW B;  2Y38 A;  3M36 L;  3EGF A;  3NTB A;  2W26 B;  3P5B L;  1FE2 A;  5K0H B;  5JVZ A;  1FF7 A;  3N8Z A;  2WFT A;  4O1Z A;  5IKV A;  3TBD A;  4X8T L;  1KLO A;  3ASI A;  2P16 L;  3CEN L;  1IQJ L;  1MQ6 L;  1IQF L;  5KIR A;  2Y5G L;  1JBU L;  2VWL L;  1IQG L;  1HJ7 A;  4Z6A L;  4BDX A;  5F1A A;  4YT7 L;  1LPK A;  3BPS E;  2P3F L;  1ATA A;  3SOQ A;  1YGC L;  1SZB A;  4XL1 A;  1ATE A;  2WFX B;  4JZD L;  2P93 L;  1RFN B;  1ATD A;  1IQL L;  2Y81 B;  3HS6 A;  3OLT A;  1TPG A;  4NGA L;  1N1I A;  2XBW L;  4ZAE B; 
#chains in the Genus database with same CATH topology
 2XBV L;  5CKN A;  2H9E L;  2YGP A;  3KQC L;  2MHP A;  1HCG B;  2J94 B;  1APO A;  1EZQ B;  2BQW A;  1NZI A;  4BTT A;  1HRF A;  4MMX B;  4MMY B;  2P28 B;  3LN0 A;  2W3K B;  1WHE A;  4JYV L;  2FLG A;  4COX A;  1EMN A;  4BDW A;  2W2M E;  3KCG L;  2J95 B;  2WPK E;  1PGE A;  3ZYJ B;  1TLE A;  2GD4 A;  4D0F A;  2BOU A;  2PR3 B;  1PRH A;  4FM5 A;  2K2T A;  2P3U A;  2UWP B;  2MGP A;  1HZ8 A;  1IGZ A;  4LMF A;  2VWM K;  1G2M B;  5I46 L;  4BTU A;  1K36 A;  1G1S A;  1V1H A;  1EQH A;  2WPM E;  3F1S B;  2FLB L;  2P26 A;  2VJ3 A;  1IGX A;  2J38 B;  2BQ7 A;  3V65 B;  4RRX A;  1EAI C;  2BO2 A;  5IKR A;  1IQM L;  4ZXY L;  2WPJ E;  4Z0L A;  1UZQ A;  5IKT A;  3NJP C;  1W8B L;  2Y5F L;  1QFK L;  4RRY A;  3HS7 A;  1I0U A;  3ZYI B;  1FSB A;  1F0R B;  2BOK L;  4A7I A;  1LQD A;  2W2Q E;  4OTJ A;  4BXW A;  2J34 B;  4LOR A;  3FCS B;  3Q7D A;  1X7A L;  3U73 A;  1OB1 C;  1DDX A;  5IKQ A;  2H9E C;  1EQG A;  1KSN B;  2UWO B;  2P3T A;  4D0E A;  3F6U L;  3N8W A;  1FAK L;  3Q3K B;  1F7M A;  2I9B A;  3LC5 B;  1LK9 A;  4AQT A;  1JV2 B;  1N7D A;  1WU1 B;  2VRS A;  2FZZ L;  3IJE B;  2HOR A;  1GK5 A;  3QCW A;  5JBB E;  4JZE L;  1KKE A;  5CKM A;  2Y82 B;  2PUQ L;  2JJL A;  3R05 A;  3M37 L;  5CIS A;  3KK6 A;  4O02 B;  1L3Y A;  2XC4 L;  3LC3 B;  1PFX L;  3LTG D;  2G00 L;  2VVV L;  4Y76 B;  1APQ A;  1G1T A;  3KRK A;  1HT5 A;  2W2O E;  1JL9 A;  2TGF A;  4RRZ A;  1XFE A;  4RRW A;  2ADX A;  1V3X B;  3TH3 L;  1A3P A;  3LN1 A;  4X8V L;  2WYG B;  1V1I A;  2J4I B;  2UWL B;  6COX A;  1IQI L;  1W7X L;  1MQ5 L;  1CEJ A;  1AUT L;  4Y7B B;  4XBM A;  1K37 A;  4MMZ B;  4GU4 A;  1FFM A;  1DQB A;  1URK A;  4X8U L;  2YGO A;  1CQE A;  2J2U B;  3QH0 A;  1YO8 A;  1NFY B;  3H5C B;  1KLI L;  1IP0 A;  2F9B L;  4Y7A B;  1IOX A;  4Y79 B;  3ZYG A;  3CA7 A;  4CUF A;  3GIS X;  2Y80 B;  1Z6E L;  4M11 A;  2VWO L;  4JYU L;  5E8D A;  1IJQ A;  1TOZ A;  2VH6 B;  1CVW L;  2BT8 A;  2I9A A;  2Y5H L;  1EPJ A;  1IOE L;  5L30 L;  2OYE P;  2Y7X B;  1DIY A;  2VWN L;  1ADX A;  5L2Z L;  1ATB A;  2NPR A;  2B7D L;  4PH9 A;  5JBA E;  4GU3 A;  3TGF A;  1UZP A;  5JB8 E;  3CFW A;  1NPE B;  4X8S L;  3HO4 A;  2RNL A;  4Y71 B;  2WPH E;  1U8C B;  3RR3 A;  2W2N E;  2XBX L;  1FJS L;  2KV4 A;  1QIU A;  3QMO A;  4YZU B;  2FLR L;  4G1M B;  4ZH8 B;  1XKB A;  1YUF A;  4BTI A;  3FFG L;  1NFX B;  3ENS A;  3GCW E;  2VH0 B;  3GCX E;  1BF9 A;  1EMO A;  1C5M F;  1IQN L;  1CCF A;  1LPZ A;  2BMG A;  2BZ6 L;  4TGF A;  2WG3 C;  1XDT R;  1Z6C A;  2BOX A;  1LMM A;  3CS7 L;  4NA9 L;  1PXX A;  4RS0 A;  1HAE A;  2W3I B;  3C9A C;  3S6X A;  2JKH L;  4ISI L;  2XC5 L;  1IQK L;  2YGQ A;  4NG9 L;  1NT0 A;  1U67 A;  4BXS A;  5F19 A;  2M74 A;  3ELA L;  1XKA L;  2P3F N;  2P94 L;  3HS5 A;  2P95 L;  5CKQ A;  1Q4G A;  2RHP A;  3HO3 A;  3LTF B;  3N8Y B;  4OTY A;  2VVU L;  3LIW B;  3TK6 B;  3BT2 A;  4Z0K B;  1G1R A;  3HPT A;  1EPI A;  2CJI B;  3TK5 B;  3NT1 A;  2WZP P;  1L5G B;  2XBY L;  2KNI A;  1P9J A;  1CX2 A;  1MOX C;  2RA0 L;  2OYU P;  1UZJ A;  2W86 A;  2AYL A;  2WPL E;  2EI8 B;  5FDQ A;  1EGF A;  1EPH A;  2MGR A;  3N8V A;  4RUT A;  1G2L B;  1UZK A;  2KB9 A;  3MQE A;  3SOB B;  4ZHA B;  2EI7 B;  4ISH L;  2FD6 A;  2EI6 B;  3OLU A;  2W2P E;  3SOV A;  1WHF A;  1HAF A;  1DX5 I;  4C16 A;  1IVO C;  3KQE L;  5L2Y L;  4JZF L;  3K9X A;  4CSY A;  3KL6 B;  1EBV A;  2XC0 L;  3HO5 A;  2WPI E;  3TZI A;  1P0S L;  2D1J B;  2Y7Z B;  2PHB B;  2DDU A;  5JW1 A;  3N8Y A;  4CUD A;  5JB9 E;  3N8W B;  4ZXX L;  1HT8 A;  1O5D L;  4D90 A;  1ZAQ A;  5JBC E;  3N8X A;  5KN5 C;  1F0S B;  3KQB L;  1F7E A;  4A94 C;  1LMJ A;  5EGM B;  1B9W A;  2WG4 B;  3PGH A;  2WYJ B;  2K2S B;  3KQD L;  3BT1 A;  2HOX A;  1PTH A;  2KL7 A;  4YT6 L;  1LPG A;  3U7U G;  1KIG L;  1G1Q A;  1EPG A;  2BQ6 A;  1DVA L;  1HRE A;  5COX A;  4XLW A;  3LAQ A;  1KLJ L;  3NTG A;  1COU A;  3POY A;  2VVC K;  1CCV A;  3SW2 A;  3DEM A;  1IQE L;  5JVY A;  4Y6D B;  2Q1J B;  1IQH L;  1M1X B;  1NQL B;  1FAX L;  1HX2 A;  1J9C L;  4M10 A;  2BOH A;  3MDL A;  3IIT B;  3V64 C;  3FBY A;  1NFU B;  4E1G A;  1YUK B;  4CUE A;  1CVU A;  1YUG A;  1NFW B;  2Y38 A;  3M36 L;  3EGF A;  3NTB A;  2W26 B;  3P5B L;  1FE2 A;  5K0H B;  5JVZ A;  1FF7 A;  3N8Z A;  2WFT A;  4O1Z A;  5IKV A;  3TBD A;  2BT7 A;  4X8T L;  1KLO A;  3ASI A;  2P16 L;  3CEN L;  1IQJ L;  1MQ6 L;  1IQF L;  5KIR A;  2Y5G L;  1JBU L;  2VWL L;  1IQG L;  1HJ7 A;  4Z6A L;  4BDX A;  5F1A A;  4YT7 L;  1LPK A;  3BPS E;  2P3F L;  1ATA A;  3SOQ A;  1YGC L;  1SZB A;  4XL1 A;  1ATE A;  2WFX B;  2P93 L;  4JZD L;  1RFN B;  2BSF A;  1ATD A;  1IQL L;  2Y81 B;  3HS6 A;  3OLT A;  1TPG A;  4NGA L;  1N1I A;  2XBW L;  4ZAE B; 
#chains in the Genus database with same CATH homology
 2XBV L;  5CKN A;  2H9E L;  2YGP A;  3KQC L;  2MHP A;  1HCG B;  2J94 B;  1APO A;  1EZQ B;  2BQW A;  1NZI A;  4BTT A;  1HRF A;  4MMX B;  4MMY B;  2P28 B;  3LN0 A;  2W3K B;  1WHE A;  4JYV L;  2FLG A;  4COX A;  1EMN A;  4BDW A;  2W2M E;  3KCG L;  2J95 B;  2WPK E;  1PGE A;  3ZYJ B;  1TLE A;  2GD4 A;  4D0F A;  2BOU A;  2PR3 B;  1PRH A;  4FM5 A;  2K2T A;  2P3U A;  2UWP B;  2MGP A;  1HZ8 A;  1IGZ A;  4LMF A;  2VWM K;  1G2M B;  5I46 L;  4BTU A;  1K36 A;  1G1S A;  2WPM E;  1EQH A;  3F1S B;  2FLB L;  2P26 A;  2VJ3 A;  1IGX A;  2J38 B;  2BQ7 A;  3V65 B;  4RRX A;  1EAI C;  2BO2 A;  5IKR A;  1IQM L;  4ZXY L;  2WPJ E;  4Z0L A;  1UZQ A;  5IKT A;  3NJP C;  1W8B L;  2Y5F L;  1QFK L;  4RRY A;  3HS7 A;  1I0U A;  3ZYI B;  1FSB A;  1F0R B;  2BOK L;  4A7I A;  1LQD A;  2W2Q E;  4OTJ A;  4BXW A;  2J34 B;  4LOR A;  3FCS B;  3Q7D A;  1X7A L;  3U73 A;  1OB1 C;  1DDX A;  5IKQ A;  2H9E C;  1EQG A;  1KSN B;  2UWO B;  2P3T A;  4D0E A;  3F6U L;  3N8W A;  1FAK L;  3Q3K B;  1F7M A;  2I9B A;  3LC5 B;  4AQT A;  1JV2 B;  1N7D A;  1WU1 B;  2FZZ L;  3IJE B;  1GK5 A;  3QCW A;  5JBB E;  4JZE L;  5CKM A;  2Y82 B;  2PUQ L;  3R05 A;  3M37 L;  5CIS A;  3KK6 A;  4O02 B;  1L3Y A;  2XC4 L;  3LC3 B;  1PFX L;  3LTG D;  2G00 L;  2VVV L;  4Y76 B;  1APQ A;  1G1T A;  3KRK A;  1HT5 A;  2W2O E;  1JL9 A;  2TGF A;  4RRZ A;  1XFE A;  4RRW A;  2ADX A;  1V3X B;  3TH3 L;  1A3P A;  3LN1 A;  4X8V L;  2WYG B;  2J4I B;  2UWL B;  6COX A;  1IQI L;  1W7X L;  1MQ5 L;  1CEJ A;  1AUT L;  4Y7B B;  4XBM A;  1K37 A;  4MMZ B;  1FFM A;  1DQB A;  1URK A;  4X8U L;  2YGO A;  1CQE A;  2J2U B;  3QH0 A;  1YO8 A;  1NFY B;  3H5C B;  1KLI L;  1IP0 A;  2F9B L;  4Y7A B;  1IOX A;  4Y79 B;  3ZYG A;  3CA7 A;  4CUF A;  3GIS X;  2Y80 B;  1Z6E L;  4M11 A;  2VWO L;  4JYU L;  5E8D A;  1IJQ A;  1TOZ A;  2VH6 B;  1CVW L;  2I9A A;  2Y5H L;  1EPJ A;  1IOE L;  5L30 L;  2OYE P;  2Y7X B;  1DIY A;  2VWN L;  1ADX A;  5L2Z L;  1ATB A;  2NPR A;  2B7D L;  4PH9 A;  5JBA E;  3TGF A;  1UZP A;  5JB8 E;  3CFW A;  1NPE B;  4X8S L;  3HO4 A;  2RNL A;  4Y71 B;  2WPH E;  1U8C B;  3RR3 A;  2W2N E;  2XBX L;  1FJS L;  2KV4 A;  4YZU B;  3QMO A;  2FLR L;  4G1M B;  4ZH8 B;  1XKB A;  1YUF A;  4BTI A;  3FFG L;  1NFX B;  3ENS A;  3GCW E;  2VH0 B;  3GCX E;  1BF9 A;  1EMO A;  1C5M F;  1IQN L;  1CCF A;  1LPZ A;  2BMG A;  2BZ6 L;  4TGF A;  2WG3 C;  1XDT R;  1Z6C A;  2BOX A;  1LMM A;  3CS7 L;  4NA9 L;  1PXX A;  4RS0 A;  1HAE A;  2W3I B;  3C9A C;  3S6X A;  2JKH L;  4ISI L;  2XC5 L;  1IQK L;  2YGQ A;  4NG9 L;  1NT0 A;  1U67 A;  4BXS A;  5F19 A;  2M74 A;  3ELA L;  1XKA L;  2P3F N;  2P94 L;  3HS5 A;  2P95 L;  5CKQ A;  1Q4G A;  2RHP A;  3HO3 A;  3LTF B;  3N8Y B;  4OTY A;  2VVU L;  3LIW B;  3TK6 B;  3BT2 A;  4Z0K B;  1G1R A;  3HPT A;  1EPI A;  2CJI B;  3TK5 B;  3NT1 A;  2WZP P;  1L5G B;  2XBY L;  2KNI A;  1P9J A;  1CX2 A;  1MOX C;  2RA0 L;  2OYU P;  1UZJ A;  2W86 A;  2AYL A;  2WPL E;  2EI8 B;  5FDQ A;  1EGF A;  1EPH A;  2MGR A;  3N8V A;  4RUT A;  1G2L B;  1UZK A;  2KB9 A;  3MQE A;  3SOB B;  4ZHA B;  2EI7 B;  4ISH L;  2FD6 A;  2EI6 B;  3OLU A;  2W2P E;  3SOV A;  1WHF A;  1HAF A;  1DX5 I;  4C16 A;  1IVO C;  3KQE L;  5L2Y L;  4JZF L;  3K9X A;  4CSY A;  3KL6 B;  1EBV A;  2XC0 L;  3HO5 A;  2WPI E;  3TZI A;  1P0S L;  2D1J B;  2Y7Z B;  2PHB B;  2DDU A;  5JW1 A;  3N8Y A;  4CUD A;  5JB9 E;  3N8W B;  4ZXX L;  1HT8 A;  1O5D L;  4D90 A;  1ZAQ A;  5JBC E;  3N8X A;  5KN5 C;  1F0S B;  3KQB L;  1F7E A;  4A94 C;  1LMJ A;  5EGM B;  1B9W A;  2WG4 B;  3PGH A;  2WYJ B;  2K2S B;  3KQD L;  3BT1 A;  1PTH A;  2KL7 A;  4YT6 L;  1LPG A;  3U7U G;  1KIG L;  1G1Q A;  1EPG A;  2BQ6 A;  1DVA L;  1HRE A;  5COX A;  4XLW A;  3LAQ A;  1KLJ L;  3NTG A;  1COU A;  3POY A;  2VVC K;  1CCV A;  3SW2 A;  3DEM A;  1IQE L;  5JVY A;  4Y6D B;  2Q1J B;  1IQH L;  1M1X B;  1NQL B;  1FAX L;  1HX2 A;  1J9C L;  4M10 A;  2BOH A;  3MDL A;  3IIT B;  3V64 C;  3FBY A;  1NFU B;  4E1G A;  1YUK B;  4CUE A;  1CVU A;  1YUG A;  1NFW B;  2Y38 A;  3M36 L;  3EGF A;  3NTB A;  2W26 B;  3P5B L;  1FE2 A;  5K0H B;  5JVZ A;  1FF7 A;  3N8Z A;  2WFT A;  4O1Z A;  5IKV A;  3TBD A;  4X8T L;  1KLO A;  3ASI A;  2P16 L;  3CEN L;  1IQJ L;  1MQ6 L;  1IQF L;  5KIR A;  2Y5G L;  1JBU L;  2VWL L;  1IQG L;  1HJ7 A;  4Z6A L;  4BDX A;  5F1A A;  4YT7 L;  1LPK A;  3BPS E;  2P3F L;  1ATA A;  3SOQ A;  1YGC L;  1SZB A;  4XL1 A;  1ATE A;  2WFX B;  4JZD L;  2P93 L;  1RFN B;  1ATD A;  1IQL L;  2Y81 B;  3HS6 A;  3OLT A;  1TPG A;  4NGA L;  1N1I A;  2XBW L;  4ZAE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...