4X92A

Crystal structure of lysosomal phospholipase a2-s165a
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
377
structure length
377
Chain Sequence
RHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHAMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Group XV phospholipase A2
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 132
structure length 377
sequence length 377
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x92A01
3I2IA 2WU4A 3WWCA 5I7UA 3KWJA 4AO7A 5K3DA 3WK5A 1VOTA 3KDAA 5LZ8A 2X76A 1JT2A 5CXUA 5D3KA 2DSNA 1QOZA 4F21A 2JGLA 2PSEA 1XLWA 4IHAA 4BZWA 4GECA 4AN1A 1X2EA 3FAKA 1JU3A 5LZ2A 2B9VA 2FJ0A 4IO0A 5HF6A 3K9BA 2XT0A 4Y2JA 1U8EA 1VXRA 3H1BA 4Y9SA 3DYIA 2WTNA 2OQIA 1C7JA 1XZIA 4QDTA 2WQZA 3LCRA 1XRQA 4BATA 4UHDA 1OILA 2QM0A 5CURA 4LIPD 1DTEA 4C88A 4X00A 1FFEA 1BROA 5IKXA 4KR0A 2DQZA 5AICA 5C8ZA 3GBSA 2G4LA 2PL5A 2XUJA 5BWBA 1Y37A 2VJAA 1IUOA 2V97A 3WIOA 3WWDA 1XZGA 1NU8A 3L1JA 1HLGA 4QDXA 4QE3A 2XI4A 4BCDA 1UZAA 3C8HA 2JBWA 5CBKA 1VKHA 1CUSA 5LYYA 3W04A 1LZLA 1R4ZA 4WY8A 5ALQA 5A7FA 3UUFA 1AQLA 3QMMA 2QR5A 1CUEA 3E1GA 3VJLA 2E3JA 3YASA 1XZDA 3SWWA 4N8EA 3AZQA 3D4LA 2PU5A 3VKFA 1K4YA 4MWSA 4KAJA 3FVRA 4AZ3A 4FWBA 2BCEA 3ZLTA 2IITA 5HKAA 5CRIA 4C4YA 4PO3X 2VAVA 2PUJA 1QONA 5K3FB 2I03A 1LGYA 1YR2A 4EY6A 3QZUA 2WHQA 3G02A 1E5TA 5K3CA 5CTAA 1QZ3A 1AGYA 4BE9A 3D2AA 1FFCA 4EY7A 2HA6A 1MAAA 3G9XA 3RKSA 4J0KA 1HBJA 3SC2A 4FNMA 4ZREA 4AMZA 1CUFA 1XFDA 4S0XA 3DLTA 4GEGA 4RGYA 4BAGA 2WG1A 3FWHA 2WHPB 5AK6A 5ALGA 2O7VA 5ALWA 5C8VA 2GYUA 3HZOA 3FCXA 3BIXA 3H2GA 3HJUA 1G4HA 4W63A 3E4DA 2WIKA 1X2BA 2WIJA 3FVTA 3WK4A 1F0NA 4BVJA 2AXEA 3BJMA 3AUKA 4AO6A 2AJCA 1M33A 5ALRA 3G8YA 2BUCA 2QT9A 4FDMA 1L7AA 5BWCA 5C8XA 1WB4A 5CH8A 5EHZA 5EHXA 2OCGA 4DMKA 4ROTA 4UHHA 4MWTA 4X85A 2PPLA 5AM5A 4H7JA 3I1IA 3WL5A 3Q8WA 4FNGA 1LLFA 3FNBA 3HACA 1TQHA 4ZI5A 1ETHA 1CR6A 3CCCA 4X6UA 4X94A 2VF2A 1GGVA 3D3NA 3O0DA 2QTBA 4MQLA 4ZV9A 1A8QA 4CG1A 5AI4A 5E2IA 5AKJA 4W1RA 1H2ZA 4X7BA 2HFJA 5AI6A 3WL6A 1JMYA 2CEKA 4G8BA 4K6KA 3V48A 4ZRDA 4DMFA 3ZLUA 4L3WA 1KU6A 1CUZA 1IZ8A 4JYMA 4Y2RA 2VT7A 5K5EA 5CH3A 1DQZA 4HRXA 1WHTA 1G5FA 5ALFA 2RGUA 3WQHA 4P9NA 4RPCA 2O2GA 3BJRA 4OCZA 3OM8A 4G9GA 3LIIA 2XUHA 5FDFA 3L1IA 1ZD3A 3DYVA 1THTA 4XWGA 3T4UA 1J07A 4GBGA 4B81A 1GPKA 4ARAA 1Y7HA 2JIDA 1QIGA 4AX4A 1T4MA 1FFBA 4U2DA 4GXNA 4H0CA 3FLEA 2Z5GA 5F4ZA 1RYYA 3F96A 2XMSA 5JARA 1F0PA 4PW0A 1YB7A 1UK7A 1E3QA 1F8UA 1MPXA 1CLEA 2AJLI 4M0FA 2VJDA 4LYDA 3R3WA 3I2GA 3FSGA 3GELA 3LS2A 3C43A 4QZVA 4H7DA 1HKHA 1LPBB 3BF8A 4QA9A 2H7XA 4BB0A 4BCBA 4UBJA 4KE6A 5FOQA 4G4IA 2FJPA 4G4GA 2HA2A 5CT9A 3A70A 5JAPA 2ROQA 1QIFA 1MAHA 4HXFB 4UHEA 5FUMA 5CT5A 3MVEA 5A2GA 1XLVA 1GZ7A 3OOSA 4H7FA 5HQ3A 5ALHA 5ISMA 4QEKA 4HS9A 5AM1A 2WHRA 7YASA 3D7RA 5I9IA 2ECFA 3O9MA 4B6GA 1W75A 1EDBA 3PF9A 2VJBA 4KE7A 2OPHA 4Q34A 1X70A 4FLFA 3MGAA 4P92A 3PFBA 1UFOA 3BE8A 4GWLA 3G9ZA 5JD5A 5ALPA 4Q05A 3DS8A 4HAIA 1R9NA 2GZRA 3NGMA 4H7IA 1YCDA 2QUBA 1LBSA 1YB6A 4INZA 4EZIA 1NU6A 1EDEA 3EBLA 4AQDA 4K6HA 4QLAA 1QTRA 2B61A 1QO7A 2OG1A 4ZWNA 2O2HA 3PICA 2XMBA 1FFDA 5JAUA 1ZI6A 3QPAA 3H17A 1XZFA 3JYHA 5AM4A 1XRMA 3NWOA 1UT6A 2H9YA 3I6YA 3M83A 4MEAA 4E15A 2C0QA 3I2FA 3S2ZA 2PBLA 3HI4A 1JJBA 4WFIA 4XJVA 4N8DA 2B20A 2VJCA 4QLOA 4BC1A 3WK8A 4LXHA 4AMYA 1CVLA 3G9TA 5YASA 2RHWA 2OGSA 4LHEA 3CN7A 2CKMA 2JGJA 2DHEA 4CIBA 1JKMA 1DX4A 5AKEA 1CUBA 2OQVA 3W2TA 2JEZA 4NS4A 2XE4A 4ZXFA 3QM1A 3VJMA 3QYJA 1UOOA 3O4IA 3KD2A 5AI8A 4J0CA 4X6XA 2GBIA 4PNZA 1AX9A 3RM3A 5JYCA 4EY8A 5JAOA 2XMQA 2VAXA 3V1MA 4P08A 1XZKA 3D2CA 3QMWA 1UOPA 2Y2VA 4U2EA 1TCAA 3AILA 4W1PA 2WU3A 3PF8A 3HLKA 5E4TA 4G8DA 1N5MA 1XROA 3ICVA 2GBFA 1BE0A 1XZEA 1CUYA 2EEPA 1TAHA 3E3AA 1SCKA 2D0DA 2I3DA 2YYSA 1AUOA 2G63A 4OD0A 5JASA 4OB8A 1JFRA 3O4HA 1XZAA 1MNQA 1W4LA 2X5XA 1SC9A 3DKKA 2RIPA 2ACKA 4JH0A 2WKWA 1ORVA 1RP1A 2Y1KA 1CV2A 4EY4A 4B0OA 1THGA 3JW8A 1E89A 3DKRA 1PFQA 4LKOA 4B82A 4H77A 1ODSA 5JZ9A 2X8BA 3WA6A 3WWPA 4L0CA 1LBTA 4QDOA 3FCYA 5AKLA 1EVQA 3PUIA 1XZCA 3WL7A 4KACA 5FPPA 4W1SA 1CIJA 2HU5A 1ODCA 1GT6A 3BDVA 5LP1A 5LKAA 3HXKA 1AZWA 4X3CA 4B84A 3FLBA 4FLMA 1WB5A 5AKGA 4B83A 1ACJA 2Y6VA 3WZMA 3AZOA 4MYSA 2WUDA 1QFSA 3DL4A 5A71A 2WIGA 1IUPA 1ZIYA 1CFJA 4A23A 5HF5A 4MXDA 3ESBA 4FHZA 2QS9A 5FV4A 3H18A 1CRLA 3WWEA 3M3DA 5AP9A 5AKKA 5D3ZA 2V9ZA 2ZJFA 3A2LA 4C6HA 1R88A 3BIWA 4NZZA 3RARA 1UWCA 4G5XA 4EB0A 3WKDA 4GHWA 4BAUA 3W05A 2WG2A 1QIEA 4BYMA 1VLQA 4Z49A 1Q84A 4WCVA 2BJHA 4K5QA 5HZGA 1WHSA 1AKNA 1UK6A 3I2HA 3IUJA 2WSLA 4YASA 3VVMA 5EIAA 1USWA 5JD4A 4PSCA 1N5RA 2EDAA 3C8DA 1ZJ5A 2QKYA 2OCKA 1QJ4A 4EY5A 4CCWA 3R3UA 4G4JA 1D07A 3VVLA 3FYUA 4J0DA 4DM7A 3B5EA 1A8UA 1UKAA 3H1AA 3OTQA 5KWJA 3IIIA 3K6KA 4JYPA 1DWOA 3WYDA 4LYEA 1IMJA 3N0TA 4X92A 3T52A 1MTZA 5ALUA 4H7HA 2XMDA 3ZV7A 3D2BA 1C7IA 1TK3A 5K3FA 2QUAA 4G1FA 1MT3A 3EF3A 3GUUA 1G66A 1DQYA 3EQ8A 2JGEA 1VE6A 2W22A 1CUHA 3ZLVA 3OURA 5ALTA 1ZJ4A 3H04A 4Y2YA 3TJMA 2OGZA 5IVHA 2XDWA 4B9AA 4ZV7A 1MN6A 2HA4A 1CQZA 1YA4A 1EK1A 4G8CA 3C6XA 2WILA 1LPOA 5HFAA 5K3AA 2WHPA 4Y7DA 4DNFA 3E0XA 4CI9A 4KRXA 2XLCA 2PUHA 4OB7A 1EA5A 2J4CA 5DYTA 2OLEA 2OCIA 1J2EA 5A62A 5IVDA 4UFPA 2WJ4A 2I78A 1EH5A 3K2IA 5H3HA 4YPVA 5AHXA 4AB1A 5E4YA 4UBLA 3STTA 2Y6UA 3O9VA 1BU8A 1LNSA 5IH7A 4YK7A 4X71A 1UOQA 3STYA 3KSRA 5AKXA 4CCYA 2Z8XA 3ZI7A 3M82A 3IB3A 4KEAA 3A2NA 3I6ZA 1ZD4A 3STVA 3PUHA 4ETWA 2H7YA 2AJ8A 2YH2A 4N5IX 1JU4A 3WK6A 2CBGA 5DYYA 1UK9A 4B9EA 2XQJA 1MNAA 4LXGA 4J7AA 3M81A 4DNOA 2Q0XA 4X95A 4WDRA 1A8SA 1W52X 5BOVA 3WK9A 2K2QB 5HK9A 1HL7A 3RK4A 5HF8A 2GBCA 3G0DA 2HU7A 1MX9A 1BRTA 5JZBA 4F0JA 4OUKX 2DQYA 3X3HA 1VE7A 2PSHA 3IUMA 1XRRA 2H7CA 1QGED 3FYUC 1IZ7A 2FUKA 3BWXA 1H2XA 3DD5A 3HRHA 5SYMA 5AIAA 1EK2A 5EIEA 4GLBA 4CFSA 1EI9A 4J3JA 5EFZA 2VA9A 1FFAA 3ICWA 3DQZA 3I6MA 3V1LA 2WIFA 4BBZA 4DSZA 1DT3A 3R3VA 3LIPA 4ZGBA 1L7QA 1EB8A 1XQVA 2XB6A 3QVMA 2C58A 2BAGA 4DNQA 1L7RA 4NVRA 3LP5A 1P0PA 1I6WA 5FP0A 3CCBA 5LLSA 3F98A 2IIVA 1CUIA 5I8PA 1DINA 5FRDA 2XMGA 2G5TA 4X93A 4MJ3A 3UMJA 2VTVA 1YSCA 6YASA 5ALXA 1OCEA 3WI7A 4BVLA 4PF1A 3DDUA 2ZYSA 1O6GA 1GKLA 1J1IA 3ANSA 5LIPA 4WFJA 1WPRA 2O7RA 1XQWA 2XUAA 5AKHA 1IUNA 2DHCA 5EGNA 5K3BA 3A2MA 3WKAA 5ALZA 4PSUA 1XQXA 4E46A 4MEBA 4TPKA 4B80A 1XZHA 4BCCA 4XIIA 5CT6A 5SYNA 4PV7A 4DYHA 4WJLA 3DEAA 5DWDA 2W6CX 1AMNA 1AC5A 3H2JA 1R3DA 2ONCA 1ACLA 1XRLA 2DFPA 1ZIXA 3ESDA 4XX1A 1R50A 4GI1A 3F97A 3Q0TA 5A7GA 1XZLA 1YAJA 1MX5A 1ZI8A 3V1NA 1QTIA 1CUGA 4HRYA 1RWQA 4Q82A 2C4HA 4KE8A 1SOMA 4TGLA 4UFOA 4UBKA 4B85A 2HHAA 2WFLB 1SFRA 3KWFA 2PSJA 5LKRA 2XUDA 4Q1VA 3C5VA 3AINA 2VQ6A 4BTVA 5JALA 1UKCA 3EQ7A 5ALDA 4Y2XA 1DX6A 2HA0A 4OU5A 4Q3LA 3DOIA 3FLAA 3ESCA 1CEXA 1HPLA 4F60A 5AH0A 1H23A 1QIMA 4AXBA 5EIHA 3PI6A 2ZSHA 4IH1A 4C89A 4U2CA 1DWPA 3H0CA 1DWQA 4KAFA 2WFZA 4UPDA 1JI3A 5CT4A 1JMKC 4MYDA 5ESRA 3IA2A 4X97A 3BDIA 3ZPXA 4AN0A 2WUFA 4RNCA 3IURA 1XRNA 3TEJA 3AFIA 5DTIA 3W9UA 3I1YA 1CUAA 5DJ5A 4OU4A 4KE9A 1EDDA 2CUTA 4B7ZA 5T4FA 4I4CA 4BRZA 2D5LA 5HK8A 4UFNA 2HFKA 3ZWQA 2Y2UA 5EHNA 2GYWA 1CUCA 1WPXA 3STWA 3SX4A 4BDTA 3O4GA 3WK7A 4BVKA 4FBLA 4Y2QA 5ALYA 1BN7A 4BC0A 3TGLA 5AKYA 2XLBA 2Z3ZA 1EB9A 3BL8A 4PSDA 1ZD2P 5CH5A 3ESAA 1XLUA 3KXPA 2PKYX 1WM1A 4C87A 3D5EA 1LPAB 1ZI9A 2R11A 5AOAA 1TKRA 2BGRA 1UK8A 2CMFA 3STUA 3L1HA 1CUWA 3QH4A 4UBNA 5AI5A 3ANTA 5AM0A 5AOCA 4BE4A 5BV7A 3WJ2A 4JNCA 4OYLA 2Z3WA 3I2JA 1MJ5A 1N1MA 1K6EA 5AKZA 3IDAA 4Y2UA 5K3EA 1U4NA 5AK4A 3IULA 4UHBA 2QXTA 4F5ZA 1TRHA 1OXMA 4U2FA 2UZ0A 5DTJA 4QDZA 3VDXA 1ZOIA 1E66A 5DLPA 1P0IA 3R41A 1WOMA 1CUVA 3C6YA 1YAHA 2JGIA 3G7NA 5EHQA 3AIKA 4UBMA 4UBIA 2PVSA 2XUGA 4HTAA 1K5PA 2HDWA 3WL8A 2ACEA 3BXPA 2B4KA 2OAEA 2BKLA 3PFCA 1J06A 4U2GA 5ALNA 4QWWA 1XZMA 1TCBA 1AURA 4J0JA 3N2ZB 4CG3A 5AIBA 4G9EA 3R3YA 5AM3A 3MUOA 3LLCA 1EVEA 2AJDA 3PDCA 5AJHA 5AI0A 3CN9A 4KAAA 2WUGA 2HRRA 1QE3A 3C70A 4DGQA 3F9CA 3HABA 4ARBA 1R9MA 4WY5A 5ALLA 3F67A 1E8DA 2IX9A 1XZBA 2XMRA 1KEZA 4FTWA 2ZVDA 4JEIA 1IVYA 2WJ6A 3JWEA 4I19A 2PU7A 1U2EA 1FSSA 1LZKA 2JF0A 2XQIA 4E11A 1HDEA 3FSGD 4K6GA 5JATA 3FYUB 3OC0A 3QPCA 4K2AA 4AZ0A 3EIOA 2PSFA 1YA8A 3VISA 1LPMA 4IH4A 2PX6A 1LPPA 3NOXA 3WLAA 2ZJ6A 5JANA 1K8QA 1QIIA 5A6VA 2QVBA 3O95A 2BUAA 1BN6A 4H7KA 3WKEA 2WTMA 5KBYA 4RE6A 1GKKA 2XUPA 2YXPX 2H1IA 1E8MA 2GZSA 1MX1A 4H35A 1GQRA 2GYVA 4NMWA 1LPSA 1FJ2A 2ZYIA 4YX9A 1E8NA 3C6BA 2WUEA 1GXSA 1HQDA 3FYTA 2RAUA 2J4FA 2C7BA 1YASA 3OPMA 5DNUA 5JD6A 1CUXA 5E4JA 3WWOA 2VEOA 1VZ2A 2RHTA 5HKBA 1QIJA 1GQSA 1MO2A 1QFMA 3DL7A 3R40A 1VXOA 4BRSA 4UHCA 5KWIA 1QIHA 2XQKA 3HC7A 5IVIA 3IBTA 1YS2X 1EINA 4EA6A 1A88A 4QNNA 2OGTA 4J0GA 4P93A 3AIMA 5D7BA 2XMCA 5C7YA 2BFNA 2QZPA 2HM7A 3DOHA 3GZJA 5FXMA 5ALOA 3WKBA 4N8SA 3B3QA 5IVKA 3G9UA 4OPMA 4CCYB 2V98A 5T4EA 4XVCA 3C45A 1BEZA 4DNPA 3C87A 5HFNA 4HVTA 3VXKA 2PM8A 1QIKA 5CXXA 4LXIA 3QMVA 2AJBA 2JGFA 4E14A 3S8YA 4J03A 5ALSA 4HXEB 5AM2A 1QO9A 2CB9A 1H22A 2DCMA 2HA5A 2ZYHA 5FKJA 2ZJ7A 3BF7A 3AJAA 3RLIA 2JGKA 2XUQA 1BS9A 4N5HX 1K63A 2ES4A 1R1DA 3OG9A 2JGMA 4DIUA 2QMQA 3H2HA 1UXOA 2V96A 3IUQA 4RE5A 1GPLA 4A16A 4ITVA 3V1KA 2WFMA 2CJPA 3WIBA 4Y2TA 2XUIA 1B41A 1XZJA 1P0QA 2XQGA 4GW3A 1F6WA 2C0PA 4H7EA 1SCQA 1VZ3A 4Y2VA 1DU4A 5DYWA 5ALKA 2OAGA 5ALMA 4X90A 2HL6A 2ZSIA 5CMLA 3QITA 5DNVA 5CT8A 4EUSA 5JAHA 1CUUA 1H2WA 1ODTC 3A6ZA 5LZ5A 3ED1A 5AOBA 1BCSA 1BEEA 1EXWA 3R0VA 4BAZA 4MQMA 3WA7A 4HZGA 3DNMA 2XMZA 1NX9A 3HSSA 4BZZA 1UKBA 4OSEA 2FX5A 2HADA 1XRPA 4WFKA 3C5WP 2QOEA 4D9JA 1CQWA 1EHYA 2BGNA 5CW2A 4I3FA 3DCNA 5ALIA 4FFWA 1XKTA 2ORYA 1G42A 5T4BA 4JUIA 5JADA 1CUJA 2PSDA 5LZ9A 4IH9A 1Q0RA 4Q3OA 4FLEA 1QIDA 5D6OA 3STXA 2HIHA 1PJAA 4C4ZA 1MU0A 3U1TA 5A7HA 2BUBA 4DMCA 1PV1A 4AO8A 3IVMA 5HCUA 4V2IA 1ISPA 3G0CA 3IUNA 2GBGA 3W06A 2WJ3A 2RONA 3HYSA 5ALEA 5AKIA 5EI5A 5HQ3B 1ZGCA 3QPDA 3I28A 1U65A 1CPYA 4C4XA 4W1QA 4TVKA 2XUKA 4DMHA 3H2IA 2YASA 4BDSA 2J3QA 3R3ZA 5JZSA 4BP9A 4QDUA 3WZLA 1B6GA 2VATA 5AI9A 4IQ4A 3CXUA 1TIBA 5FPQA 1ZGBA 2VSQA 4O08A 4C01A 2RI6A 1C4XA 5HF9A 2DHDA 3FBWA 2C5GA 2XQFA 1SCIA 4KJXA 1TCCA 2OCLA 3H19A 4Y2SA 1XKLA 4BP8A 1VA4A 1YS1X 2WG0A 4L72A 4UHFA 4UUQA 1O6FA 3W9BA 1P0MA 2XUOA 1H2YA 3V9AA 1VJ5A 3WJ1A 1CUDA 5ALJA 4Y2PA 3TRDA 4FBMA 3F8SA 3PE6A 5T4HA 2O2IA 2QXUA 1Q83A 2J3DA 2P8SA 3NUZA 3AIOA 4QWMA 1W1IA 3P2MA 4DTCA 1Z68A 2R8BA 3VJKA 3GFFA 3G0BA 2DR0A 2Z8ZA 5JIBA 4KRYA 4FFVA 2WFLA 2LIPA 1S8OA 3DJYA 3EQ9A 1JJFA 2VT6A 1BCRA 3WKCA 4H18A 3U0VA 3R3XA 2QJRA 4U2BA 3UUEA 1T2NA 2I3ZA 3FOBA 2HA3A 3AZPA 1LPNA 4WDQA 4J0IA 1Y7IA 3B12A 1KU0A 5KREA 4A5SA 3G0GA 4OB6A 1DT5A 4KYVA 1WCYA 4M0EA 1VA5A 1XQYA 1ORWA 1W76A 4FMPA 4L9AA 4EBBA 1EX9A 4DSAA 2QRUA 3MUNA 3G0IA 1GPNA 2HRQA 3I2KA 3WMRA 2C5FA 4HXGA 5AK5A 2NW6A 4W9RA 2OXEA 1Q0ZA 3D0KA 3HEAA 3GROA 4FOLA 5J3JA 5AK3A 2HU8A 4OYYA 3WYNA 1ZD5A 3QBJA 4M0MA 4PQEA 4EHBA 4DLNA 5FLKA 5ALVA 2WIDA 2CZQA 3O4JA 4B0PA 2WLSA 3KOOA 2QJWA 1QLWA 5DNWA 2XUFA 4J0HA 4BTLA 1ZICA 3C6ZA 4X6YA 2HA7A 2JEYA 5LZ7A 4UBOA 2G5PA 3SK0A 5LZ4A 3D59A 3ILSA 2WM2A 4X91A 4CIAA 4FKBA 1W6RA 3H2KA 4CG2A 1WB6A 2EDCA 4GDMA 4Q3KA 2ZYRA 1N8SA 1JJIA 5C81A 5AO9A 1A7UA 3GA7A
chains in the Genus database with same CATH superfamily
2UV8A 4G97A 2H2AA 2WU4A 4I6GA 3L9WA 3RUPA 2QV0A 1IY9A 5C5CA 2FFRA 2CHEA 3WK5A 1PBTA 2PL9A 2DY0A 3B3AA 1E6MA 1JT2A 1NP3A 4QJBA 5TQ0A 3U60B 4OGWA 4OAQA 3KZOA 1MA0A 1QO0D 4ML3A 3SZ3A 5JNTA 2O8EA 1KOLA 4MR8A 3PGJA 1QOZA 3ASZA 5D5QA 2XVMA 3WGUA 1VJ1A 1VPTA 1PD0A 4R1PA 4F21A 1P60A 1PSWA 2NXEA 2I87A 1SGWA 1P1HA 1QNFA 1WAMA 2OR3A 3EC7A 2DPYA 3FPCA 2BBTA 4P3XA 4BZWA 4GECA 3HFJA 2YBEA 1MBZA 2FPUA 4HJRA 4AN1A 1KEKA 2G4CA 1X2EA 4OP2A 2O8VA 4OGGA 4HQ0A 3ROGA 3WMWA 4URVR 5KTTA 3GFOA 2GM4A 3L7NA 4IO0A 5B2EA 3IKTA 3P2IA 3BEDA 3DKVA 2QRGA 3C7AA 2PWPA 4J9VA 3K9BA 1T10A 2D62A 3VTAA 4NRDA 1DJNA 2XT0A 3EJWA 4TV9B 4XPIA 3NNSA 4MI6A 3LGXA 2YYZA 1I1OA 5DX0A 2HXYA 3FPKA 1U7PA 3DYIA 1RPNA 2QROA 4S2UA 3WR5A 1TT5A 2AE1A 2H18A 4KWCA 1C7JA 1OT5A 4C5CA 4R2JA 1FFXB 1HE1C 2HLPA 3CY6A 4E5UA 1EFKA 1G3UA 1XRQA 4BATA 1NQXA 4RS4A 2XTNA 1C9JA 2DZDA 1E2BA 1OILA 2P5TB 4JBNA 1E3SA 2BOVA 2OHJA 3B1WA 4A6DA 4D3YA 4EATA 4WOPA 1BROA 1Y4DE 2A0YA 3WMXA 4PYLA 3W5VA 3VPCA 1QPBA 1U0OC 3GBSA 4PLWA 5CBPA 5INTA 1EFHA 1INLA 4RKEA 3GK3A 3LKDA 2IBMA 5ITZB 3NDBB 3AVQA 2AG5A 2QL7A 2B9EA 1J8YF 2NSJA 2R1TB 4Z4HA 1JZTA 3KNZA 1HLGA 4DV4B 5LSAA 4KPUA 4K9KA 1GIAA 5BQ3A 1KKUA 4NOLA 4AKIA 1E2NA 5AVOA 4MS1B 4C0SA 2DU8A 4ZO4A 1OLUA 5TGTA 5IC4A 2ZRBA 1KZ9A 5KQPA 2P9CA 3EAFA 2JBWA 3WGIA 1J0BA 1TW2A 5TS2A 3BJIC 3PFNA 5DWQA 1CUSA 3W04A 2XZPA 5EQFA 2VCHA 2VSYA 4QYIA 3U3XA 2V6GA 3IEUA 2A7QA 1R4ZA 1UOEA 5TNXA 1ZXXA 1I51A 2O8DB 1XQ6A 3DF7A 1QYCA 1JXMA 1C30B 2J9FA 1B23P 3UUFA 3QMMA 1MX3A 1P3DA 3JAKB 3OQ1A 4WLOA 2P4SA 4I1UA 1FC0A 3QXGA 4OLFA 3AR7A 4QUHA 3R8XA 4DR5B 2DC1A 3F8WA 5KNBD 5TPWA 4BS9A 4YAOA 1QRUA 3VUFA 1T1RA 4MWBA 2BGLA 5IN4A 2E3JA 3MB8A 3KQTA 1HF3A 1KC1A 1XTSA 1XZDA 4OHYA 1RNLA 2Q6TA 4K0RA 1L5VA 3QF4B 2D2EA 4D4HA 2YDYA 3LDUA 1T3ZA 5CLQA 4DN6A 5CPFA 2C03A 2WKSA 4DMGA 1EFPB 4X8LA 3AZQA 4PLHA 1ZVQA 1JHUA 3P4UA 5ARDA 4B3DA 1H3FA 1J7KA 4K46A 2FKAA 4GP6A 4OL9A 3GAAA 3IUPA 5JMTA 2W98A 2E5LB 1OSNA 2I0FA 3EIEA 2W9XA 2I34A 4F3YA 5IT9A 3WYEA 4HZUA 4RHYA 5K09A 4FFPA 4NESA 4QGGA 3MTDA 3TQQA 1QH0A 1PR0A 5A03A 2FSVC 5ES3A 5HKAA 4B6SA 1G1MA 2PUJA 3DMTA 3D43A 4ESOA 2X9QA 5B6IA 4OYHA 5REQA 5B3KA 2I03A 1V6AA 4YAFA 3SQWA 1ZESA 3HUEA 2B1IA 4TS9A 3U17A 2CXRA 5B6PA 4L4XA 2WHQA 3DTNA 4YO7A 1AG9A 1LI4A 1T5SA 3IMEA 4ETMA 3KB1A 2QIOA 4PZ9A 4ER0A 1NVXQ 2J0SA 2PGIA 3IYLW 5K3CA 2SKCA 2Z4TA 1QZ3A 3RUDA 2FCAA 3VSEA 3WAKA 4BE9A 4DJFC 5A1JA 1QQAA 1Z07A 5EXXA 2UYCA 3CNLA 3D2AA 4HUTA 5JXJA 4LY6A 2EQAA 1AY0A 1OC2A 1O5IA 3O47A 3P9PA 1MAAA 1AKEA 3H1PA 4RK4A 3ZBUA 1TCVA 3TLJA 2XBMA 1TIKA 4YCDA 1SR8A 1OU0A 1XYGA 1Z17A 2HUNA 4J0KA 4M49A 3VU9B 5ILQA 3E61A 4DRXA 2OYSA 3BORA 4LECA 1L5ZA 1O3YA 3S81A 4A15A 5BNWA 3ZWKA 4ZYTA 2JFPA 4W82A 3TIFA 4NXNB 1CUFA 1ML4A 1E5LA 4MWEA 2A9QA 4KODA 3SJUA 2NNWB 4GP7A 1JG1A 4PC1A 5FA5A 3TK1A 5JSHA 1E4VA 1V39A 4HNRA 1G8YA 1Q7TA 3K1ZA 3D6HA 3RHSA 4D41A 5JPIA 1MOQA 5B1HA 5IJ0B 4IM7A 1JFVA 1DOAA 4C0QC 2OM2A 1MVLA 3L6UA 2CFTA 3ANLA 4CQNA 1T5HX 4JFRA 1W4RA 4WIAA 5ALGA 2O7VA 3EA0A 1N0VC 4C7BA 5GGYA 2PHZA 1F0KA 4GRIA 4HAXA 5H82A 4BLPA 3G2IA 1FUEA 3FXAA 4OQDA 4K1LA 3U4MA 2SKEA 2HSEA 4CM9A 1JYSA 5C8VA 1J2UA 3GF4A 3HZOA 3EXG1 3PPXA 5LQMA 4AUNA 1IL0A 1UPXA 3KOMA 3P52A 2FX3A 2ZIFA 3ZU6A 2QN1A 2NACA 4L8VA 4E6EA 3VM6A 3DT6A 3E4DA 4AKGA 5I8ZA 2KI5A 4F92B 2VPZA 2HUPA 5I7WA 5B3JC 2JPDA 3R2JA 1FJXA 2R6R1 3EWSA 3FVTA 1QCDA 4FGKA 2R84A 1JR2A 1I4EB 1W48A 1X7WB 4M9QA 2C3YA 3AUKA 1E20A 3EXEA 2WWVD 3T5TA 3ER9A 4CEJB 3PQEA 3NV9A 4KQEA 1TYAE 4UVIA 1MR3F 1NJ1A 1A9RA 1EK5A 1S02A 1R4MA 1U2DA 2ZFUA 4HWPA 4ICIA 3ZWAA 5EMNA 2AOWA 1ZAKA 2D2IA 3TNLA 1GU7A 3RU3A 4QVKA 1NPYA 1TD9A 4JYBA 3T3PB 4AN4A 5BRJA 1YR7A 2BUCA 2FR8C 2NN3C 3EISA 3DNFA 1X8JA 3ABZA 3M33A 3MYYA 2HCBA 3C85A 4FDMA 2IHYA 4MCAA 3GLFA 1L7AA 1OX4B 3AW8A 2QU8A 4CQMA 5L45A 5C8XA 1E3DA 1X87A 4R2LA 4DLWA 2G28A 2W58A 4MV4A 1DGQA 2ZB7A 5DBOA 3A4MA 5IC5A 3K15A 3ZIAD 2BM1A 4MWTA 4MWZA 1X1QA 2DM6A 2PPLA 3QKSB 3PC6A 4IIUA 4PC2A 4CM8B 3TNFA 4Y1EA 4BNZA 1PG2A 3WL5A 4GLLA 1DAKA 4FNGA 2VHQA 4CM5A 4OKIA 3OPVA 1VHLA 4MYTA 1LLFA 1YJBA 3EG5A 3U1BA 4LFBB 1NDUA 2ABWA 3HACA 3W7BA 4JVOA 3ADCA 2NO5A 3JQ8A 5BW8A 1V47A 2JAQA 2R2AA 2G07A 1XB2A 4MKGA 3A9RA 2JFNA 1MIOB 3JRWA 4QGHA 1B3RA 2IUYA 3EVEA 1KMMA 3ROXA 1GGVA 2IXFA 1B6SA 3DDCA 2JRCA 1G7SA 4JX9A 4UKDA 4BU0A 1MRZA 1P7WA 4KO8A 3D3NA 1Y6ZA 4D1YA 1N77A 3H1FA 1DMSA 3HKCA 4RVNA 2UXCB 3I8OA 2HLHA 1HORA 1I2ZA 3AF5A 4NYJQ 4CG1A 3U7HB 1NURA 4A7PA 2P7HA 1RC0A 2R8OA 1R10A 2C2YA 3ELWA 4BV2A 4E5YA 3MMPA 4PIMA 4WT7A 4C3VA 1G55A 4DCJA 5FYDA 4LV5B 4AC9A 1SBQA 4LN1A 3PEEA 4JOQA 3TLCA 4CKYA 4BWFB 3HXLA 1S2OA 2QGNA 2PTHA 3DZIA 3P0HA 5PNTA 1YK1A 4JI6B 2XTMA 1JMYA 1XT6A 1YZTA 1NNI1 2GT1A 2CEKA 2W37A 3PNPA 5B7PA 3SAJA 2G17A 4NBWA 1CCWA 1YNOA 2NVUA 3DP7A 2KM1A 1PEYA 4DMFA 4I8IA 5AJXA 2RHBA 1IOWA 1KYZA 2RBEA 1P1BA 1Z3CA 2ZSDA 4I3GA 2Z30A 4UTOA 1GYQA 1HFKA 1WMFA 2DFKB 1IZ0A 1U7HA 2W2MA 3KSUA 1BHJA 1N6NA 2QPTA 3HB0A 4M3NA 3QV1A 2PZAA 3BQMB 1NBEA 1DQZA 2CJFA 3K5IA 3OVMA 4WKPA 3RFVA 3SMVA 4M7OA 3GHYA 3WNZA 2FQ1A 2XOEA 4TYPA 3HMKA 4ZVQA 4KQCA 3KKOA 1A50B 1VIDA 1KZ4A 2P5UA 4YBZA 4B47A 4D44A 4YJ3A 4ZOLB 2TRSB 4LCEA 4RPCA 1Q15A 3BTOA 1EGVB 2GJ9A 3ITKA 2O2GA 4ZOLF 3T3HA 1S2LA 2V74B 4NR0A 1WD7A 1AS2A 1QQTA 4OCZA 5H3LA 1ZD8A 5DBIA 2F8MA 3TZBA 3TLEA 1BS2A 3PC4A 3VJRA 4CIDA 3PIIA 4HGQA 4QVGA 4UUPA 3WGMA 3IDOA 2BR3A 3UK7A 3W6OA 1VKJA 1FX1A 4HLNA 4OHWA 2O4CA 2QTMA 2Y9PB 3OA0A 3L0YA 4IJ5A 5H9VA 1JFSA 1T3HA 4PBTA 2CLCX 2IU4A 4Z3KA 3PEFA 2NP6A 3M49A 1XN1A 1ZD3A 3J81k 4YT8A 3V7WA 1I30A 4YN3A 2FZEA 1OF1A 1PL7A 2KW5A 2RHDA 1J07A 2XVAA 4AYWA 4DCNA 1ZZGA 1PQWA 2JIDA 1N9GA 5LU9A 1I4DD 2B8EA 2P3SA 1BXRB 4RY2A 4UDYX 1T4MA 3WIEA 5K4HA 1QRAA 1E1CB 3A3PA 2VWPA 3MWDA 3MCVA 2Z5GA 1SC6A 4LJ8A 5I7VA 2FW6A 4KDEA 5EJ5A 3AP3A 1QH1A 1ZM7A 2PX8A 3IQDB 2LVBA 1JWLA 5JY6A 1L2TA 1R8JA 4QSHA 5AVRA 4HB4A 1XCJA 2H5JA 1JFFA 3OZSA 1KY5A 4GU5A 4MARA 3U4CA 1FTYA 4F4DA 1CJVC 3CGGA 1XUOA 2C4VA 1AF7A 3MT0A 4NBTA 4LMAA 3I9NA 5B6JA 5MN6A 3HR8A 1CLEA 5JVDA 2AJLI 2FZGA 4FB5A 2R6HA 1CZKA 2J3IA 3AKZA 5EXDA 1CW2B 2Q07A 4IWXA 4L6AA 2AZDA 3R3WA 3FTCA 4XGIA 5EJEA 2P1ZA 1J5PA 1BA3A 1G3MA 3LK7A 5HFJA 4HD8A 1KJZA 5SICE 3K9HA 3B3FA 4BVHA 1XVLA 4QZVA 1HKHA 1MGPA 1V5GA 2Q0QA 4QA9A 4EO9A 1WVGA 1LLQA 2H7XA 3K3PA 1UBHS 1JPJA 3P4XA 4CF4A 4FDLA 4BFZA 5CB6A 1U2DC 5IT5A 3WMFA 1Y8AA 1FFSA 1P19A 2H85A 4UBJA 3GJ7A 4BO6A 2ZREA 3NTQA 1MW8X 4LY3A 4KE6A 4KITB 4RK1A 4RD1A 1AS3A 1PJBA 3P0FA 2HSWA 2X77A 4QHTA 1J8DA 1N6KA 4LW8A 4DBVO 4AWXA 1I6LA 4IDGA 3DQPA 1WWKA 3PHJA 2ROQA 1QIFA 5LQKA 1OBHA 3TQSA 4A9AA 4HXFB 1X92A 4ITUA 1Q7EA 5CT5A 3V8PA 3N2YA 5CLFA 2P77A 1GZ7A 4P84A 4BMZA 4RIEA 4C6TA 5TX7A 1NULA 3KKPA 5FH9A 3AEKB 2BT4A 1KAOA 2YV1A 2J3MA 5DEIA 3ONDA 3E9RA 5HQ3A 2IHNA 1E3IA 2DLDA 3A1SA 5ALHA 2WVHA 4JBWA 5ISMA 2GCGA 4QEKA 5D8DA 3VR0A 5EJAA 1TNDA 1K97A 3H5RA 4UTXA 4DSUA 5B7NA 7YASA 4OOFA 5EVCA 2W0SA 1W75A 1KK2A 1GZHB 4EG8A 2QI9F 2XOKD 4RENA 1P1RA 1V1RB 2BMFA 3LK6A 4BLTA 2C2BA 3RBAA 1X70A 2JFVA 3EUEA 3LHFA 1XEXB 4PSAA 3PFBA 3B38A 3ZYCA 2MJLA 3BE8A 4OP3A 3T7EA 3MC1A 4KVFA 1VHDA 2NSDA 3C6MA 1CJBA 4M46A 4Q05A 1RXWA 1FS4A 4MRVA 3DS8A 5CLGA 1NUPA 3ZGZA 3MAJA 1LK7A 2X1VA 3GN2A 4LHWA 1NIJA 3C1AA 1A9TA 4H7IA 1AV6A 3L6RA 1PGJA 2YJ3A 1YB6A 2G72A 3DEJA 3ELBA 5MDHA 1F4PA 1BVUA 2JI7A 2W42A 1MUUA 2YNMC 3Q3HA 1EBBA 1EDEA 1EX6A 4AQDA 3I12A 4KTTE 1ZRSA 3IP1A 1P62B 4E5SA 1QTRA 2JNWA 2B61A 1QH8A 2CLHB 3FUXA 4TTJA 2OG1A 4ZWNA 1O87A 3CZCA 4D9HA 1PNOA 3TIGA 2XMBA 3SS7X 2XKAA 1NI3A 2FAXA 2ACVA 2X3UA 3RS9A 5KOHB 5GV7A 3O4FA 3B8EA 1QF9A 1SVWA 2FZWA 3C7TA 3H2YA 2OO3A 1VLVA 4E13A 4UEOA 2UAGA 4ZCQA 2PR2A 4KVZA 2IZZA 2AQIA 3SLRA 1RTTA 1YRQA 3LTNC 1FRFS 2B4QA 5E6UB 2C9OA 4R81A 1XA3A 3SBDA 1YZUA 2Q4OA 3JQ7B 4TTSA 1X7XB 4HEA1 1EWTA 1WKBA 3KPYA 1O77A 3T61A 4L4ZA 2F9FA 1RHQA 4HGOA 2HAEA 3FDJA 2H9YA 3M5PA 3GBPA 3PRKE 3R44A 3OKAA 2RB4A 3I6YA 3M83A 4RAOA 3P9SA 4NF2A 4PQRA 4DLBA 2C2OA 3PQ7A 1KO1A 2VH1A 2XVYA 2RSLA 3U4AA 3FZYA 2QRKA 3IEPA 2QZJA 1E6KA 5DN9A 5CXQA 2GN8A 2Z1MA 1PKXA 2WAMA 3ZZ0A 1J0XO 1GGKA 4DJTA 1Y1QA 1AVTA 1YQXA 4U9IS 3OHPA 4LF9B 1KVQA 4MAAA 1M83A 1Q57A 2IFTA 3RTBA 1XF1A 4HFMA 2P6NA 4TUYB 1UQUA 2Q5LA 2BFBB 3ONEA 4JUDX 3RYIB 3KB6A 3SZUA 4NXMB 4TUYF 5F78A 4QRIA 5CJJA 3VNAA 1SPXA 2BELA 4OK5A 2B20A 2VJCA 3OQJA 3LC7O 3WK8A 3DWGA 1XVIA 3H5OA 1Z6GA 4O59O 4UC0A 4W5HA 3RIHA 1DAIA 1PV4A 5G0SA 4Q9AA 3FVQA 2OGSA 2HZBA 3RD5A 4RACA 3ROMA 3TD2A 3WHPA 3IMCA 2Y4OA 1YMVA 3OU2A 1CULC 3O90A 4XD7A 1D9XA 1KYQA 3MBOA 2G5GX 2Y0BA 3R9XA 1JBQA 2JH9A 4AD8A 1YE8A 4M9RA 1OU4A 1YOVB 2ZP1A 1JKMA 1WG8A 1N2CE 5GONA 4JYZA 1M72A 4G24A 2KX7A 1CQXA 3EIHA 2QG6A 2HWWA 2NTEA 3I4LA 3X2SA 2YCLA 2V58A 3IQZA 1MH9A 3HWWA 3NAGA 1CHNA 3H2BA 3IP9A 3C3JA 3ZY4A 1DX4A 13PKA 2QPAA 4Y6LA 4PZYA 2LZ0A 4TXLA 5DM2A 3K0SA 1G6OA 1CUBA 1IC6A 2E49A 2OQVA 2AFHE 3DZKA 1EA7A 1ZIDA 2A3NA 4WKOA 1Q14A 1P5RA 1C7EA 5DZSA 2E48A 1PS0A 4JCOA 1UP7A 2HJHA 1YB2A 4WZAA 2Y1LA 4R3UC 3VJMA 4F5YA 3K70B 5AI8A 4Z53A 3BWVA 3VYRB 1D1PA 1NASA 1DTWB 4PNZA 3U44A 2GSDA 1AJEA 2NO0A 2ZE7A 2JIZA 2NO1A 4D43A 1N9KA 3LUFA 4EO4A 2AWNA 3ZD8A 3GUYA 2X0NA 4YXWD 5B4TA 1ZR2A 2XMQA 3LX6A 3RF7A 2E85A 1PFKA 4R5HA 1DKOA 2CMDA 4DLYA 1IN1A 4QU8A 1KH3A 2ZT6A 4PPGA 1VRCA 4KPYA 3Q7SA 3K8OE 3M3PA 4U1RA 1UOPA 3WHKA 2H5EA 3INYA 3NHMA 5K6TA 4OQLA 1BMDA 1TCAA 3AILA 2J85A 5K20A 5JJLA 1V5EA 5FPTA 4MW0A 4RH1A 4REOA 5IFLA 2EW8A 2A9VA 5KYNA 2O2DA 1FLDA 3KTOA 1BE6A 4OIMA 3H4TA 3K0HA 3MHTA 1AUVA 1PRYA 1GG8A 4IDEA 4N6OA 3TZCA 1BE0A 5KTOA 1BE1A 1CUYA 1QHYA 5CCBA 1YE5A 1AHNA 1CEQA 3W8NA 4UUNA 1PBNA 3ADOA 3DV9A 2H06A 3K30A 4M8SA 3E3AA 2QMHA 4WKBA 1M76A 2FR0A 3LH5A 5A4FS 3IDZA 4Z4QA 3QY0A 1LWNA 2I3DA 1RWBA 3I04M 2C83A 4MW5A 1BJRE 1AUOA 4R69A 2UVPB 1NDHA 4BJ6A 2D8MA 4YT2A 2C0CA 4OD0A 2VDWB 4KXYA 4YRSA 3U7FB 1RI4A 4E5NA 1VJTA 3V97A 3ZHVA 2IYZA 4M1OA 3F49S 2PGNA 4TQ9A 4FGLA 3VDMA 3C48A 2CFIA 5GV8A 1AKRA 1MNQA 2RHLA 4G0NA 4CT5A 2I6FA 3FOWA 1KJYA 3LFUA 1Y1KE 3JYNA 1V9CA 3A3OA 1SC9A 4WKNA 3L7JA 2D2VA 1Y3IA 3DKKA 3JPYA 4HDRA 4G5FA 4A8TA 1PR3A 3EFOB 4JH0A 4WZBE 2Q5FA 5HW0A 3L43A 2CF6A 1DE0A 4I9HA 3TB6A 1KSHA 2WKWA 3X44A 3H5LA 1A8IA 2B83A 2VPYA 3KPWA 2BPOA 4JEHA 3DFFA 3HY3A 1SU7A 3IDSA 4OFBA 3JW8A 1E89A 2C8LA 3DKRA 2BKEA 4Z9FA 1JIQA 4OHCA 3VR5A 2XNHA 2XGGA 2J6HA 4CV2A 1N6OA 4BQRA 1QRDA 3DPIA 1LSOA 3H11B 4PAQA 3ZGOA 1DUIA 1F9AA 1Y7LA 1ISSA 1DQNA 2PD6A 1N8TA 3EA4A 1HRKA 3I8XA 4FZVA 4OHZA 4DBZA 2R1ZA 3C3CA 4JL5A 5H02A 5JQGB 1LBTA 4AWBA 4IMPA 1J21A 5BRAA 4H60A 4ZVLA 3ZE9A 4LTDA 4QBIA 2RAFA 3S44A 4QHYA 3VV2A 1UPAA 4XUEA 2ZW9A 1BOFA 1XZCA 5IU6A 1T9CA 1ZSNA 3RV4A 2GHQA 4KACA 5B57C 1P81A 5DPMA 2UU9B 4MVJA 4W1SA 5FI0B 3USES 1QKJA 1SQ0A 1C0KA 1CIJA 1TZKA 1FNCA 2CXPA 1ODCA 2HU5A 2IYUA 3GCDA 1L1QA 4AG6A 5BN3B 2WJIA 2Z04A 1M0SA 4UUMA 5LKAA 3FF4A 1GVHA 3W9SA 3PJFA 3HXKA 5E9QA 1D0IA 2NO7A 3EZ2A 4B84A 3N86A 1G5HA 4OQMA 1Q1NA 2IPXA 5AKGA 1SO8A 1ACJA 5MN4A 5CB4F 2CV2A 2X6QA 2Y6VA 4FT4A 3ONFA 3B7PA 3QFCA 5DTQA 2NP7A 3MLAA 4J1TA 1TA0A 4RMGA 3GLHE 3I0ZA 4KCGA 3HADA 1EYZA 1AGNA 3BSWA 5TT0A 2YL2A 4RLFA 1CT9A 1U0JA 2ORIA 3F2VA 4FWIB 4Y6RA 1DXHA 3ORYA 3MGBA 4OXKA 4C1NA 4ZMBA 1SN7A 1FFXA 2B3TA 4I14A 3U26A 4KREA 1IN8A 4FHZA 2QS9A 1G8GA 3L0CA 3CFYA 3U40A 4E4RA 4KN8A 4NZYA 3WWEA 1JIVA 3M3DA 4HH1A 2NZWA 3ZHZA 3ZEAA 2XGMA 4B6JA 2O20A 5AKKA 2BI4A 4M55A 5D3ZA 4FDTA 3CVJA 2GM3A 5EQDA 3ZXIA 3A2LA 1Z0SA 4TWZA 1VYTA 1V0JA 2BBSA 1A76A 5EEGA 3P32A 1Y42X 4I50B 2FN7A 1AA6A 2K87A 3BIWA 4NZZA 4I50F 5EIXA 3TRFA 3TLAA 1U9CA 3USZA 4HDCA 1F4LA 1K9VF 4GHWA 2R1TA 2PRJA 2C2GA 2D54A 5F33A 4BAUA 1QCZA 1QIEA 1M34B 4AZ0B 1J8FA 2FN4A 1SD1A 1P61B 3HJCA 4J43A 1EFRD 4F4CA 1SXQA 3ZTYA 2YXDA 3PQ3A 2GM9A 3BRWD 3CINA 5HZGA 3PJEA 1WBBA 4MPJA 4FB4A 3GD5A 3KZMA 2QTZA 3I3SR 4MS1A 4GE3A 5LC1A 4B2LA 4GGPA 4DEXA 3SHTA 4L78A 3AK4A 5K4GA 1QGUB 5I45A 5DISB 4Q9HA 4UNIA 4NEQA 5D7NA 5BV1A 1A8HA 4Y0NA 4KLCA 3GFRA 1XEWX 2QDKA 3O4RA 4C4YA 3W7AA 5HIKA 2PEYA 2WM8A 1S5PA 1OLSB 1JQKA 3IMKA 2O8DA 1F4VA 1FPQA 1S96A 4IDCA 4FKZA 4LRWA 3U3KA 8ADHA 1O6CA 2QMUA 4LX8A 3KKMA 3NWJA 1C30A 3L7BA 2OKGA 4IUYA 1USIA 1D4ZA 2YV5A 3E5RA 2OZVA 3JAKA 1RI1A 2VTEA 3OFND 1MC1A 1B14A 1CJSA 3JR7A 3EULA 3IAUA 3A6GA 1KHHA 3DBLB 3GVHA 3IELA 3JQEA 5EMJA 2ORVA 2P5SA 4RM3A 3U19A 1SQGA 4LC9A 3TIVA 4Z0TA 2B8WA 3QF4A 3UWMA 3BGDA 4W5JA 1RCTE 3CRVA 5EUMA 3CNNA 3K6KA 3NYQA 5CFOA 4HBZA 3S5UA 5A4IS 1EFPA 2BMVA 3ZHSA 1H2FA 4FFSA 2YC4C 1NLFA 4PR0A 1UAAA 3T52A 2PA0A 2P9GA 4MP8A 1YBVA 2JD0A 1MTZA 3LCMA 2C2MA 1HEUA 1Z4QA 2Y0CA 3F6CA 4OXNA 5ALUA 3Q7RA 5EN4A 4BEWA 4H7HA 2C04A 2XMDA 3D6VA 4DCUA 3ZHXA 3IS3A 2XR1A 1UQRA 3FG9A 5EZYB 3AY0A 1E3MA 5F7ZA 2QUAA 5EZYF 1PTKA 3MINB 5IDWA 2EW2A 3REGA 1EXDA 2BFEB 1A9ZA 4NH0A 3M2PA 2HF8A 2O3JA 4PTZA 1YE3A 5LA6F 1HDOA 1PD1A 5HM8A 3HKDB 4JD5A 3GLSA 2IIQA 3JD2A 1SUEA 1JXOA 4KP7A 3U9LA 3BERA 3RFFA 4JJZA 5A05A 3CLHA 3DCIA 3AI3A 1VE6A 1Y1RA 3A7DA 4G89A 4K05A 2VDKB 2XE6A 3QE9Y 1Q1GA 4QELA 3BK7A 1EPUA 3KR1A 3MMSA 3ESXA 4ZVNA 3AHCA 1N6PA 1PS8A 3P0EA 4XI9A 1BVRA 4MYRA 1Z35A 4LOKA 5ALTA 3BE5A 1YJ5A 2FFJA 4II3A 5D3MB 1YR1A 3WGJA 3ICCA 1H2HA 5BP7A 1WABA 2OGZA 3VU9A 3ILXA 2O3UA 3UGJA 2B36A 5CW1A 1A9QA 1AMOA 4EB3A 3C6QA 2PVCA 1R15A 2ZAYA 4HN2A 1MN6A 4XRGA 4NCBA 1DSSG 3CE6A 4KI7A 1CQZA 1YA4A 4G8CA 1V7CA 4I36A 3UFXB 2GPJA 2GEUA 1JKJA 3KR2A 4JI0B 1NPTO 4Q4DA 4UMFA 1CF9A 3C6XA 3K4HA 1KXZA 4KH0A 4CHTA 1LPOA 5HFAA 4QGFA 1KO7A 1P17A 1SRRA 1XJQA 1ZGZA 2FU5C 3EHEA 3ODGA 4Y7DA 2UUPA 2F9MA 5IKPA 3ZCRA 3MT9A 5IP5A 5J4HA 4W5QA 3WRYC 3JQGB 5TMBA 5KNDD 2C2KA 4I46A 1ZRMA 1TK9A 3SSOA 4ZVSA 1EA5A 1BG6A 3U3JA 1C4OA 3OE7D 5A62A 5KVVA 4YR9A 3EVCA 3AW9A 4NPCA 2ANBA 5J2UB 2TMKA 4B43A 4IIXA 2I78A 4IQ8A 3EVFA 4F8YA 5J2UF 1PR5A 3KR9A 5AHXA 2E0IA 5E4YA 4YPVA 4NCKA 2PTGA 4J1TC 4YV2A 3VC7A 4ZCMA 1OPRA 1GYRA 3ZE2B 4ZOQI 2WICA 1LNSA 4FHGA 4I0WB 3T7SA 4E30A 5BQOA 1IHDA 1UT5A 6REQB 2BL4A 1K0UA 4O33A 2JI8A 3VHLB 1QQ6A 1UOQA 2GXUA 1MO3A 3CONA 2EBFX 5CVCA 2WB2A 3EZ7A 1F2TB 4M1SA 1M1UA 2BFPA 4ATNA 5DK6A 3DMHA 5I4IA 1X7WA 2J31A 5KMGA 3D4IA 3NOOA 2OT3B 3OPQA 4CEJA 1CY7A 4F71A 3WADA 3SYMA 5D1NA 3G2HA 1JG4A 1NQTA 2ZG6A 4IZHA 2CFCA 4FYWA 2PMCA 4AUMA 1XX6A 2H08A 3AYZB 1Z4KA 4NJMA 2AJ8A 4RTMA 1JU4A 2YOFA 3KALA 4HPWA 4P4TA 1Y3BE 3T1VA 2BONA 1QRSA 2KYRA 2P9EA 2VHWA 3IQFA 2RD2A 5DYYA 1UK9A 2CHFA 4B9EA 2ZM6B 2HMYB 2YYAA 3PNMA 1XU7A 3TJRA 2FF5A 4QPNA 4G01B 4RFSB 1NF3A 4Z3DA 3EK2A 3VNQA 2HMSA 5B2FA 3ZK9A 3EWIA 1VGRA 4GZ6A 1W5EA 1GARA 4GOOD 2NQ8A 1A5AB 2Q0XA 2JI6A 1FE8A 3UMGA 1T3SA 3QKSA 3JVUA 2GNOA 4WHMA 4CM8A 1N7JA 3EZGA 3WK9A 4ZZ3A 2FPIB 3CGWA 4HC4A 1ICEA 1AF4A 4IF6A 2DMRA 4YCSA 1ZEMA 3FX2A 4V24A 3RIEA 3OX3A 1M8KA 1QO0A 3DGFC 2CLDX 1T5BA 1ABBA 2VPPA 2RKWA 1T8UA 4XVRA 3HYCA 4CN8A 3ADBA 2QK4A 2OHGA 1WSDA 3SQXA 1B2LA 2FPPB 1MV8A 4EHAA 2K7FA 2PWAA 1MIOA 4EX6A 1PF7E 4BX2A 4HS4A 3AEXA 3CLRC 1CP3A 2PS9A 3W5SA 4AZWA 2VP2A 4GRAA 4KKVA 3BWCA 1ECCA 1H9CA 4GX0A 4JJEA 1QGED 2ZBQA 3DVQX 2J1LA 1J49A 1HYBA 3MB5A 4BJ3A 4D4JA 1LA2A 3BWXA 4DLXA 1H2XA 1SBIA 5JDCA 1FP4B 5F3DA 1IXRC 2PS3A 1EK2A 5EIEA 3K9LA 4DSNA 1DIGA 4GLBA 3M6XA 4FBGA 2WJPA 2QZSA 4J3JA 4XQGA 2RHGB 5FL3A 5CDFE 4TYNA 4YMVA 3EDQA 4AY2A 4XQ9A 1YXMA 4LF4B 3IAM1 2VA9A 2B99A 4Q16A 2GA8A 4LV8B 2W5UA 3FWPA 1Q1EA 3WDSA 4NH4A 2FG7C 4DCTA 4D25A 3UWSA 3AI7A 3V1LA 4KBGA 3NW9A 1VL1A 2WWFA 1PTJA 2QN6A 4X44A 4J94A 4G0MA 4WESB 3W8RA 4ZK2A 1G3RA 3OZIA 1L8OA 4C4AA 2QTLA 1UAGA 4A0HA 3R3VA 1MO5A 3TSCA 3GLVA 3KQSA 3L7KA 4RJKA 4X5OA 3GFPA 2I2CA 5J47A 4U3JA 4OLBA 5DXJA 2H1RA 4O2BB 3QUQA 4WBNF 2G1AA 3ZBTA 5K8IA 4ZOLA 3AQ4A 1H5UA 2Q21A 1MP0A 4F8JA 1XTIA 1E2LA 1H0KA 1QMGA 2C58A 2DBQA 2BAGA 4MP6A 1EUDA 4XYBA 3L8FA 4ZPXA 3WGOA 2H3HA 2WWIA 3COYA 3FCEA 2ZIUB 3A6EA 4TM8A 3H8VA 4D9CA 1E0DA 1XV5A 4HDOB 1K5DA 3ZXSA 2TSYB 4D80A 2H2FA 1I6WA 3PD7A 4WN9B 3NHAA 9ABPA 1LBIA 5LLSA 3F78A 3F98A 1O94D 1GL3A 4RJLA 4KNWA 3HSKA 3KHTA 2IIVA 2ZE5A 3PR1A 5LB4A 4ZP1A 3V55A 1Y3HA 1CZHA 1ZM2A 2IXEA 2Y77A 3GWGA 4DHWA 1Q1BA 3TQTA 1VB3A 3E9YA 3PXGA 4C0LA 1TEVA 4F4IA 2BP7B 2IUTA 4RFLA 2F1KA 1YMQA 2G5TA 5F3WB 5KNBA 2A9FA 1F3OA 2IS2A 3NBAA 1YKGA 2UZ1B 3PNKA 1E1CA 1FRQA 1M1NA 2GM5A 2KSQA 3Q7TA 1GUYA 3JWIA 4UMDA 4PCVA 4J1NA 2C9BA 1YSCA 3WG9A 4Q4LA 1AHPA 2VRBA 2LTAA 5KVSA 2BSAA 3V42A 3KLNA 5CYOA 3WI7A 2VDJA 1GPH1 3IVAA 4WADA 1NVUQ 2FSUA 2CNBA 2N9UA 3VOAA 3Q98A 3BXOA 4BVLA 3BMQB 4PS0A 4RZ3A 4D42A 4YXFA 1Z0AA 2FTKE 2IYRA 5EHGA 3PLAE 3RREA 2VJYA 3KJQA 5K3SA 3JV7A 3BZBA 1J1IA 4DS3A 1XDUA 2BISA 3ANSA 5LIPA 3T0FA 2GESA 3HP1A 1Z0JA 2QQGA 4C4RA 4WGFA 1C1HA 4DCVA 1NM5C 3TECE 1Y8QA 1ZL0A 1WPRA 3HCFA 2JD2A 3VR3D 2QD5A 1IUNA 2GLUA 2OV4A 2OGUA 5EGNA 1AUPA 4J29A 2FJUA 3WKAA 1QFZA 3G8CA 4NDAA 3V4ZA 3VTFA 4BB9A 5LPNA 3G1UA 3TRIA 3VDRA 1FOEB 1YVUA 1TM1E 1Y6JA 1D1SA 2BGJA 2E5WA 2PZLA 1KI9A 4JX8A 2GYYA 3IHKA 4G5YA 4MEBA 3UYKA 1C9EA 4KIWA 4M8LA 4F97A 3GJRA 4B80A 3H0KA 1KI7A 5L6LB 4UE2A 1FF9A 4PCUA 4N39A 2R8EA 1PQPA 3NDPA 2HIGA 3KT6A 4FFRA 2XJ9A 4KWIA 5EESA 1XYVA 1Q5PA 2ANCA 2ZZNA 5SYNA 2I3AA 1T3TA 3OQ6A 2YFKA 3TXYA 3VKWA 2GDZA 1P6UA 4RJIA 5DWDA 2WTEA 3F8TA 5IYZF 3FHOA 4QNRA 1B00A 3HZHA 2P4QA 3AP2A 3ZHOA 3TN7A 1G8SA 3TQRA 5B30A 4GM1A 5FF9A 1J22A 4TRRA 3UY4A 1AC5A 2HGZA 3Q11A 1EVJA 2Q1YA 2QLJA 2XCOA 1R3DA 1F48A 4I5EA 1BX0A 2AOTA 1H6BA 1QP0A 1ACLA 4YCLA 3DHYA 5E3IA 2QRLA 3TIIA 5HIMA 1DKUA 3HB5X 4B2YA 4OA8A 2F3RA 3AM3A 2DFPA 4RFVA 3AEKA 2XX3A 2IPNA 2XW6A 2FG5A 2YWRA 3GT3A 4EW2A 1WB9A 1LV7A 3QE2A 1EEXB 4R1NA 1NYRA 3ISVA 5E6RB 4MHSA 4YAEA 2W4MA 5BSKA 4QT0A 4WL0A 1CIVA 1R50A 1NQAO 2I4IA 3N58A 3UCFA 3P0IA 1VE5A 3Q0TA 4C2AA 2W4QA 2JFOA 1XXLA 4DJ5X 3V2UA 1HQYE 4KZKA 4XB2A 1V1RA 5EJ6A 1D0VA 1U3VA 3EW9A 3OCWA 1K2WA 3C2QA 5FUBA 2C4HA 2NQ2C 4KE8A 1L1EA 1ZK0A 2YUIA 4UBKA 5E9JA 4ESVA 3VZBA 1ZBDA 3SD7A 2V7QA 1SFRA 1T9AA 2OWEA 4PSKA 3A3NA 3V4RA 1GTMA 3PQCA 2Z5VA 3MS4A 4C5AA 2PSJA 3G9QA 4PZEA 1WY5A 4M6WB 3ZOZA 1XTUA 2ALJA 4Q1VA 2OXIA 1J1UA 1X77A 2ZM5A 3ZYZA 3C5VA 2G71A 5JSKA 4Y0AA 5BVGB 2CFSA 5JDCC 3RSLA 5HGJA 4MW7A 4ZC8A 1UKCA 3ZGYA 4P1ZA 5LQRA 2H9IA 3EQ7A 3OUTA 3D7KA 1RWOA 3RO7A 1B42A 3L2OB 4Y2GA 2HA0A 1FXUA 5ENZA 1DG3A 5CUQA 3PJRA 1NRIA 5CFPA 5B12A 2VPXA 2FFAA 4PPQA 4RX1A 5IH3A 3C7KA 3X1XA 3S8EA 3S2SA 5FBVB 2PBRA 1Z8NA 5GADl 1TAQA 4GMGA 4GVLA 5KOHA 5JISA 3KU4A 1YACA 4ZQIA 3UHJA 3G5MA 3NVKI 3GMIA 4F60A 1PCXA 1U3DA 3VYTB 3BTUA 3HBNA 3K92A 1PTJC 1W7AA 4LYGA 5I51A 5E6UA 4UNNA 4CGZA 3OZAA 2DPMA 5LCXA 2HN9A 3JQ7A 3HCDA 4AY5A 1X7XA 4C89A 1TUBB 3EG9B 3IEKA 4LJ5A 3CEHA 3ACDA 4BY9E 4N65A 1P9OA 2M2IA 4IIFA 5FPYA 4RF5A 2RK6A 2VPQA 1RKQA 3IOBA 5H59A 1CR4A 2OESA 2VHEA 2FMKA 3IR5A 4OO3A 4TXJA 4UEKA 4UPDA 1JI3A 2PL3A 2QRVB 3WRVA 3ZIAA 4DC0A 1WF6A 3NANA 2EERA 4MYDA 5DHRA 2Q1SA 1JDNA 3VPXA 1JA9A 4R1LA 3A37A 4F5DA 4NOMA 2X4GA 3L6EA 2CYBA 2CYAA 4ISCA 1LJUA 4AN0A 3ZE8A 2GRUA 1SUAA 2WUFA 4ZAVA 2Z8YM 1ZRHA 2O0LA 5FOSA 4QL3A 5BPHA 2I4TA 4TUYA 3CKMA 3RYIA 1B7GO 4WEOA 4KOEC 4LJYA 1UPTA 3HL0A 4QFCA 3V4PB 1OXXK 1QGYA 4OU4A 5F64A 1RSZA 3B6KA 1QF7A 1C4KA 3DMFA 2CUTA 2WD9A 4OXRA 4B7ZA 2FI1A 4H1HA 1H0RA 4XIJA 1LF0A 5LP6B 1R8QA 2O0MA 2WTXA 2GGSA 1JIJA 2V7TA 3HL4A 3QNUA 4P3YA 4TTAA 4UFNA 3X2EA 2G1UA 1N0HA 4GOKA 2BFCB 2JHCA 2A30A 5KHLB 2ZUDA 1EK6A 1H4TA 2PJDA 4M7PA 4M0DA 1LTKA 3R4CA 3TEMA 1C1DB 4Q9NA 3BMCB 1GADO 4IVQA 4DMLA 1ENYA 3GG2A 1NE7A 4FBLA 3NT2A 4Y2QA 5ALYA 1BN7A 1SC1A 2FLKA 3T99A 2VDOB 1TM5E 3BM5A 3PDJA 1LJLA 4NCXA 1GQ2A 2AZTA 3PFGA 1GPUA 1BDJA 4AJJA 1EXVA 4E88A 2G36A 1D2HA 2YWJA 1T24A 4UZEA 1U98A 3NHBA 3PQ8A 4U6QA 3WB2A 1C81A 1B4DA 3T15A 3K0FB 1DJMA 1S2MA 1U02A 1XLUA 2D6FA 1DTWA 3WC4A 2FMHA 3R6TA 2PKYX 1OH7A 4KHPB 3AG6A 2DBVO 3IDQA 1GPAA 2EWVA 2VRCA 4KQ2A 2ZRIA 2QNRA 1LPAB 3PUWA 1EQUA 3R0QA 4JT8A 5FLEX 4ND3A 2ZBUA 4L5BA 1DV1A 1W4CA 3ZI4A 2C7PA 3KAJA 1PN3A 1D1QA 3OT1B 2R11A 721PA 3Q40A 1L7PA 3KT0A 5SZKB 3E7DA 1OFTA 3AB8A 3UYLA 1F6DA 3DDWA 1VSBA 3CBQA 1ZITA 2BHSA 1GSOA 3ANTA 1XCMA 3N74A 2M6KA 5LNK1 3FD8A 2DHQA 1SZPA 2YS7A 4I1IA 1U8CB 2VXBA 1CXZA 3UWDA 2J41A 3PVZA 1R0KA 2W70A 4WGGA 4Y6SA 3RCBA 1SQSA 2PWBA 2QUIA 4J75A 3UICA 3ZQUA 1PW7A 4ZO9A 1OKKA 1E2IA 4L76A 1K6EA 1WQ1R 4J90A 5EQTA 4EL0A 1DG1G 4TT3D 4CGYA 5FO1A 3DSRA 2QMZA 3GUVA 1JR3D 4XCVA 1FQWA 1U4NA 2B92A 5LD2B 3R5FA 2VDWA 2IDJA 4UHBA 3ETLA 4ZJPA 4F5ZA 1TRHA 2QI9C 2XT6A 4B17A 1XXHE 1ULAA 2BKXA 2WAAA 3GEMA 3OQPA 1AQ6A 2ZJ8A 1WCWA 4QDZA 2AN9A 2Z2KA 4U2FA 4V0QA 4EG6A 4DV1B 3EWNA 1Y9ZA 1ISHA 2W2VA 3UBMA 5AW1A 1J0CA 2VWGA 5EEHA 4JDPA 1MAVA 1A0OA 1FUKA 1W5FA 3GLRA 3C24A 4YP7A 5GP1A 3IJEB 2CE2X 4EA8A 1U2TA 1ICIA 2HHLA 4GOXA 4F4JA 3EFOA 4Z4CA 2VDPB 4NCNA 1YAHA 4KXVA 3OLCX 5EIFA 1JUDA 3LDHA 1PR1A 2YN2A 4RLSA 4UBMA 2JLZA 2JBAB 3RK0A 3TQCA 1CRPA 2QG9A 1WCV1 4BQEA 4TL6A 1XO1A 2AFHA 2FW9A 3L41A 2ZJYA 5K8VA 2OHVA 1GTSA 3R77A 3WL8A 1SXJB 1XP5A 2HCJB 3JAMA 3FNEA 5BSUA 2ACEA 3BXPA 1QBGA 4AYTA 4TVBA 3HN2A 2UUBB 2OAEA 4HAUA 5JQGA 3IDFA 3PFCA 4GXTA 1OWNA 2ZANA 2CZCA 3UXEA 1SUWA 3CZAA 1I2MA 4QWWA 1TK2A 1HDZA 2ZJ3A 3D6JA 3QEBZ 3O3CA 4O4HB 3RVKA 2IF0A 4J0JA 3HVKA 1QFYA 3F1LA 1KRWA 1JHQA 5HOEA 4G1UC 4MLCA 5A04A 2YIMA 3UGQA 1YCGA 2YZGA 4DE5A 5FTWA 3U80A 1NMXA 1RFLA 1MZVA 4MVXA 1I2AA 5B36A 1IHPA 5A9RA 3BWBA 5CB4A 2GD6A 3QE4A 3SSAA 1ECFA 1EVEA 4IDDA 4JLJA 4ND4A 1SXPA 3ZCQA 5ED0A 2WW8A 5EAIA 1KKMA 3W5UA 3PC8A 5AI0A 3RC9A 4B5KA 1YFLA 4QTYA 2DT5A 3H6HA 2PBFA 5KYWA 3T1TA 4CPDA 1ZD9A 1I2BA 2GFIA 3C70A 3DGEC 2DECA 2LPMA 3KSZO 4FQ7A 4MI1A 4Q7JB 4ERXA 5DM60 4Q3BA 2ZDQA 4ARBA 5KWSA 4WY5A 1E1QA 1E8DA 1U1IA 2XOKA 2YHAA 1RPTA 3DF9A 4H3SA 1XCGB 1F7UA 3AETB 5H83A 4IVNA 5KJFA 4RY8A 4L72A 2Y05A 3UHOA 3QPUA 1Y3AA 2FMFA 3PJDA 1WP4A 4YRCA 5U4XA 3JWEA 4I19A 2PU7A 1I9CA 1R6AA 5F1PA 1M7HA 1ZMRA 2XWJI 3ETEA 1RWVA 2HLDA 3O84A 5CGQB 4BB6A 2Z9BA 3OCVA 4I50A 4WCFB 1ZM3A 1GFWA 2BGKA 3OI7A 4MUEA 1HDEA 2X4DA 3WFZA 2R87A 3FSGD 4FK8A 3UKDA 3L5OA 1KZGB 4P4NA 1G0NA 1H9AA 1MFPA 4L7VA 4ENRA 3S1SA 4N9QA 3G8DA 1FYXA 3AEZA 3QPCA 4AZ0A 1M34A 2X0JA 3E8XA 1VG1A 1Z7GA 4KH1A 4MKFA 2RC5A 1E9RA 1L7DA 1T5TA 5C32A 4LCBA 5IT0A 1HK7A 3KOZA 1VKNA 4LDZA 1O97D 4LYYA 3VISA 3LCCA 4QQFA 3SY8A 3QFFA 3JASB 4EUEA 1QGUA 3FGZA 3L8HA 4NFYA 4BWVA 4UU7A 2PX6A 1HE4A 4LDPA 3TAXA 5EXPA 3G0OA 2CXXA 3BCHA 2ETXA 3UKJA 2P7IA 1XTZA 1E2EA 2QTNA 1OLSA 3SC2B 1S89A 1QIIA 2VN8A 1VBKA 2NPFA 3T1HB 2BUAA 4DA9A 3CB2A 4L2IB 5FOWA 4MTCA 5AXAA 2ERCA 3WKEA 4AP9A 3GI1A 4FFBB 2VDUE 4MW4A 3KOWA 3M4ZA 5KBYA 4XM1A 5M3BA 2Q2WA 2RBKA 1HC7A 2UYOA 4UNQA 5U9CA 2HF9A 2P6OA 4R6XA 3UOAB 4ND5A 3DBLA 1YZGA 1Z2PX 2DPXA 2X9GA 2GCIA 5LNK6 1E7MA 1L5SA 4M86A 4AXXA 1AO0A 1X7YB 2OORA 5JU6A 2XZOA 1TKAA 1QVWA 2PGLA 4TMWA 4LF5B 2JW5A 3UENA 4K6MA 4MDYA 1FY2A 4NMWA 4KPFC 4OI2A 3A6DA 3QWBA 4CR6A 4YX9A 1ZRNA 2QVCA 4JJIA 2ISSD 1M67A 3GQBA 4PHGA 1HQDA 2JKYA 3RJMA 1JR3E 2X15A 2IEIA 3G13A 4YCMA 2J45A 1MOPA 5FFFA 2Z57A 4HYEA 2J4FA 3S2YA 2H59A 5JRJA 4ZZIA 2A0KA 4WZZA 3PYMA 1A04A 1IXZA 2J3JA 4JUCA 5EZYA 3SKXA 1CBUA 1BQEA 4OQQA 5AW4A 3SZGA 3MINA 4LJ7A 2EHDA 3OQHA 5LA6A 2BFEA 2ZIVB 1XDGA 4GC5A 1JAXA 1P7CA 3HU3A 5HBGA 2YN0A 4E2YA 3GPDG 1P6XA 4PFKA 1TCUA 3HKDA 4BNTA 5CFQA 7GPBA 4TM7A 3EPHA 2ATVA 4JBIA 5FFNA 1OVGA 1SZDA 1PKEA 1QIJA 2A94A 1G63A 3OU6A 5DYIA 5F51A 5H5JA 1O08A 1TFUA 3MLBA 3VYSB 4D99A 4BPBA 1JZSA 4LZOA 5BMVB 3JATB 4WK6A 1TQDA 5IG2A 1M2EA 3KKZA 4IYJA 1IPHA 2DKNA 3RSHA 5BMVF 1E6WA 3U56A 1G64A 2Q7XA 1TPZA 1MEJA 1TB4A 1ONOA 3QKWA 4NJEB 4Y6OA 4REMA 5IVIA 5CAEB 3H87A 3IBTA 4LXXA 2HDHA 4W4TA 2LIVA 2M6LA 1FU7A 3DVAB 1EINA 3KXDA 5D3MA 5BNIA 1A88A 3D1VA 4QNNA 4HCJA 3CO0S 4TZ0A 4HLDA 3P2YA 3WYCA 4LVUA 1Y8ZA 4J0GA 1TYCA 5AXBA 5IBCA 4ZEMA 3DZFA 5LMNB 3AIMA 5D7BA 2XMCA 3VPFA 4JVMA 2P35A 3C98A 5L4NA 4R9RA 1UUFA 2QZPA 3F7MA 1PUXA 3N2LA 2BM0A 3N75A 5G3ZA 3T4EA 2DETA 4HP8A 4PNPA 1FSGA 3Q12A 2ATIA 4EFDA 5LLTA 3UFXA 2FSSA 1ESEA 4UPEA 4CCYB 1C2YA 3O21A 1JB1A 1ZK4A 1FL9A 2Y93A 2XXAA 1WTCA 1QOPB 4WZ6A 2BV3A 3DFIA 2VJOA 1BEZA 3IQEA 3KZCA 1NLYA 1SD2A 3C87A 3DE6X 2XGOA 4C0BA 1QDEA 4DR2B 4CTMA 1KFEB 2C7VA 2OO5A 4JT4A 4OGFA 3ZDRA 3PRHA 1I3LA 4LXIA 1GQYA 3RNOA 4PN3A 1Y6FA 3CX6A 1RE0A 2H5LA 3NIWA 3ZU4A 3W78A 2VZ0A 2C8JA 4E14A 3S8YA 1SKBA 1T8TA 1XMJA 2QTRA 3DL0A 2E82A 4J03A 3MJHA 4KO4S 2ZI7A 4L0DA 4ND6A 1FMTA 3ZJYA 5J2UA 1ONBA 2OCAA 1VKOA 3JARB 5AM2A 5DHAA 2WP8J 2EWWA 2CB9A 2IL1A 3DV2A 1Z4PX 1U9IA 2ZYHA 3C1UA 4HF7A 4UATA 2H92A 2HC9A 3L4BA 3BF7A 4MHTA 1CY0A 3HYRA 4DY4A 3AJAA 3C39A 3IP7A 3OF5A 5CYFA 1GNVA 1BS9A 2Z43A 4NAHA 3FRIA 4PLCA 6REQA 5J43A 4TTPA 1H4QA 4QQNA 5EVJA 1K63A 3RTCA 2ZXFA 1S9HA 2Q49A 2JGMA 2KWIA 5KSYA 2J9XB 1C50A 2B8TA 1KAHA 1UXOA 4BHTA 1SCDA 3M1YA 3K6SB 1GGEA 1X1SA 3PK0A 3IQIX 3QJ5A 1TX4B 4EOGA 2CL7X 2M98A 4IICA 2Z2YA 3R7WA 4JI1B 4ITVA 4RZIA 3TYXA 3V8VA 4EENA 3OAAD 3O2NA 5IDXA 4HK4A 1S3SA 1K68A 2UUOA 4HDMB 4Y2TA 4YUZA 1SBZA 5L4SA 1IVNA 1K0FA 4QECA 1O9BA 2AG0A 4FUQA 4FILA 4LGVA 1BWPA 3N6XA 2A9KA 4ENWA 2HXSA 1XNRB 4V0NA 3LOQA 3QFHA 5FBWB 4H7EA 3OIDA 2Y66A 3IKLA 3Q7QA 1SCQA 4JNKA 3UJBA 1I7PA 5FL7A 1DU4A 5P21A 4QJIA 2JLYA 1N4DA 2ZB2A 4PYMA 3TB4A 1JI0A 5ALKA 2PO5A 3PHLA 1J25A 4YQEA 3DLBA 3LYHA 2VTKA 2I2BA 4RMIA 2IQ5A 1EHIA 2WJGA 1BFKA 1CETA 1P73A 2FPIA 3G5AA 5EWMB 3RODA 3RVLA 4RYLA 3ZQJA 3GL9A 2ZRHA 3O8BA 4KXWA 5DNVA 2G82A 3QVTA 3CLSC 3UANA 4X7PA 4D6PA 4N0DA 4EFLA 1F60A 5K0JA 3JAWA 3C41J 4AY4A 2GH1A 2CWWA 2ADMA 3BGVA 1ODTC 2I7VA 4TWIA 3VR5H 2F64A 4K28A 3PEUA 3EH1A 2XVZA 2FPPA 3G68A 3IE2A 4EUKA 3KB2A 5KDLA 2PH1A 3O8CA 1D2MA 2X42A 2MYPA 2I99A 3G49A 3UMSA 3W5JA 5LZ5A 3TL2A 4AJNA 1LDMA 1TOAA 2Z95A 1Y9DA 1IQRA 2Z4SA 5AOBA 5JY1A 3D7NA 3B5IA 4YDHB 5LQDA 4KTVE 1V95A 4UARA 2HRZA 5KKCA 3GVXA 3GDWA 3PNVA 3AVOA 3EXAA 2OORC 4HZGA 1V26A 1JQ5A 1XD2B 4IHKA 1M0TA 2OD7A 4XDYA 1GQQA 1TJ3A 1FP4A 3NWEA 4MVJH 1QC5B 5HOQA 3Q7IA 3KVOA 4LE0A 1BGXT 1UKBA 4XVHA 4AL4A 2H07A 3IE0A 1SUSA 2FX5A 2WNIA 1ORDA 1IBCA 4RHTA 3V32A 2YQ4A 3BQ9A 2HK6A 1T9ZA 2PT7A 3WBFA 1JEYA 3AL0C 1C0LA 3NTXA 3H75A 4XASA 2VYQA 4G1EB 1OBOA 4YRTA 3SYNA 4EQZA 4L9RA 2C54A 2E6UX 2WC1A 2PPVA 4YJHB 4D9JA 1CQWA 4TMTA 4ZZ2A 4QGSA 3NGLA 2YINC 2E55A 5CW2A 2VHZA 3A31A 1T1JA 2C1XA 2RHHA 2WYWA 3CE9A 4GUAA 3K0EA 4D82A 4CETA 5I7FA 1ZH0A 2IHZA 1Y4ZA 5L7YA 3WBBA 3E4CA 5J2TB 4WESA 4QJ4A 5LBIA 3HXOA 2Y1FA 4HB0A 4MGHA 4I81A 3G23A 2ORYA 2AX3A 3GRUA 5JNUA 1VCMA 1FU8A 3OY7A 2VJQA 4IW3B 3WNVA 2I3GA 1DVRA 3QP9A 1XI2A 3SDZA 3GJXC 1HE5A 1MAWA 5BQ5A 5A6SB 4IH9A 4WBNA 1MG5A 5E4FA 1EFRA 4Q3OA 3ECCA 3F73A 1QIDA 2CLMB 3I39X 1JLSA 1CK4A 3BRWA 3GHHA 3AMVA 4XRRA 3FMOB 2J0VA 4GG1A 3UC5A 1ND6A 4Q4AA 5M34A 3UH0A 4BOYA 3II6X 1D09A 2BUBA 3K09C 4IGFA 4W99A 4EGFA 4PM4A 5HXAA 1D4OA 2JLVA 1PV1A 1Y4UA 3OCYA 4YLGA 4KAXA 3FBGA 1NQ5A 2IHJA 5DHSA 4WN9A 2OFOA 3REFA 1OXVA 2XHEA 3BBLA 4GWGA 1RQPA 1Y4AE 3ICPA 4UM5A 1ZQ1A 4EB6A 1JFTA 2EP7A 3ZHBA 4DLPA 3TZ6A 3THXB 1OBCA 3IP5A 2GBGA 3CZMA 3IUNA 4JLAA 4P2GA 5DKFA 2FCRA 2OVBA 2GBLA 2ZJZA 4UUBA 5ETJA 2E6KA 3F5FA 4GPEA 3ZWPA 4WN3A 2NQTA 4Z7QB 5IAAA 2EAUA 2CCJA 4DIKA 2IYWA 3PIRA 2Z98A 3QPDA 2UZ1A 3FETA 5COBA 3W5CA 2VYND 5JT1A 3NETA 2OO5C 1NQWA 5E2BA 1JDJA 4CKCB 1KSGA 2FHPA 5EG5A 5EUBA 3IVCA 3JVVA 4A0SA 4PBRA 4BKPA 2CUNA 3R3ZA 3I52A 1O0SA 3RANA 3AESA 4BKUA 4QDUA 3U09A 3WZLA 4Q1AA 1CZLA 5CNKA 4AK9A 3ZWBA 4WVLA 3U7EB 4WVFA 4QODA 3EXHB 1E79D 4A5OA 3CF0A 1TIBA 2OZLB 1W25A 2Y1CA 3OF2A 4AM8A 1U9IC 1GT91 3HCCA 3TDKA 5KWVA 3ZNNA 3L4BC 2A5JA 4C01A 1R0ZA 2CHVA 3GLUA 3HR7A 2VNIA 5DSXA 3MWFA 3I32A 5CDFA 2WYVA 1DJPA 2RHOA 1H2EA 2D4HA 4XKJA 1R5JA 4YCAA 1BZYA 1RHUA 1NJFA 1XTTA 2DHDA 3FBWA 4GPZA 4OHKA 4U4AA 4YHBA 2AMFA 3DQQA 2G77B 2H29A 2OCLA 4IIBA 1JAYA 5K0NA 4RDHA 1EMDA 1L4KA 2XEXA 3TCKA 1SVLA 4ZQHA 1O6FA 3L1VA 4NABA 4MV9A 4UUQA 5J5VA 3QVKA 3ZDYB 4MHOA 3GXOA 3V9AA 3PGKA 1GTVA 4EFKA 3GFVA 1SOAA 3MT8A 2G0NA 4CMJA 1KOJA 2VNSA 2PGOA 1D6JA 3HCAA 3LX8A 3BJZA 4IMIB 2O2IA 4BX8A 2DFDA 2BKUA 2WWRA 4A10A 1Q83A 3TZHA 2FOXA 3G82C 1Z4NA 1HURA 4DNXA 1BGWA 2P8SA 1K7EB 2Y1GA 3H5AA 3WTBA 3AIOA 3ONNA 4GD3Q 3P9RA 1K5GA 3P2MA 4OBEA 3PYXA 1U9JA 4QWMA 3WXBA 1CVRA 2QRZA 4V03A 3R8CA 1J6UA 1T3LA 5ITWA 1LSUA 3S70A 5JWRA 3X1DA 3U7RA 1NN5A 1R2QA 1QVRA 4GYKA 3LYAA 4BX9A 2CBZA 2VHTA 1F06A 1KYWA 2VKQA 3VJKA 3ZV4A 5HYVA 2GLXA 4F2HA 2BCGY 3IHLA 1RM0A 2XDYA 4NMMA 4QT4A 3WTCA 2DR0A 2Z8ZA 3FKSD 3UPTA 1KMNA 1WXWA 3QPWA 4HFNA 4PX9A 4XCXA 2IPOA 3CX3A 1WETA 4WNCA 4D9KA 3KJHA 4EI2A 2VXCA 3EC2A 4B40A 1DAEA 4KO3S 3PKZA 3L6DA 1S8OA 3EGDB 4GZ5A 3DJYA 1PL8A 5DP1A 2BW0A 1N2JA 3EQ9A 2WWHA 1P33A 3JYOA 2DLCX 1T9HA 4AFNA 2QAJA 4M6WA 2ZK7A 3B7WA 2ODEA 2QUKA 1ISRA 2JAXA 4RHFA 1H94A 2NXNA 4A8JC 1C3JA 4AY3A 2W2KA 5BVGA 5GOZA 1QYIA 1T29A 2K7ZA 3IODA 4BFXA 4PXAA 1RXUA 5B58T 3Q0EA 4D9NA 1GR1A 2PUFA 4U2BA 3TKLA 5AVYA 2FZCA 4E70A 1DKRA 2IEZA 2HA3A 3L6OO 4WDQA 2H63A 5F1KA 3ICOA 4BTEA 2Q6OA 3H5TA 1Y7IA 1QGAA 2CV0A 4BMCA 1E1NA 2FWBA 1J9GA 2AN4A 3EIQA 1X3LA 4O2LA 4DILA 4EK9A 1KI8A 1KRXA 2Q4BA 5DSTA 1YFJA 4IIJF 3G0GA 4QUKA 2XD4A 5KSPA 5CU7A 3N87A 1PJRA 4MVWA 5KJ1A 4IBOA 4MGKR 1NUUA 4REQB 1JVBA 3LQYA 3T5DA 4F3CA 1DT5A 1N2EA 5JOQA 4DR4B 2IHVA 4I9GA 1TUBA 1XQYA 3EG9A 1ZHFA 3MOIA 3T4XA 5LOVF 5K2OA 2HHJA 1W76A 3QBTA 3H5VA 4HAYA 3ZWVA 3TFOA 4WQMA 1BHO1 1Q22A 4DLLA 4DCGA 4DRYA 4G0OA 4EBBA 4CU2A 2FEMA 3H05A 3MELA 1V35A 6GPBA 3ZY2A 4EGCB 2QRVA 4B4UA 2O5RA 5F76A 5HTOA 2I33A 1M5RA 2GETA 1FEZA 4GVXA 1NSTA 3MJDA 3LGSA 3CMMA 4CCSA 4Q9LA 3VR4D 4EPRA 1QV7A 3LLVA 5LMZA 2VNJA 1CC1S 1SIUA 3AWDA 5J40A 4RESA 3TINA 1Q0PA 3HEAA 4LE2A 1M2FA 3U5TA 2BFDB 1JHVA 2ZYGA 3G17A 3S27A 1LB1B 5J3JA 5F2NA 3M8KA 3I04A 3GX1A 1W93A 3ORRA 4XGRA 2XB4A 1J8VA 1PFVA 3IT0A 3I6IA 2GBLC 4PSVA 1ZD5A 4KU4A 4MP3A 2YICA 4PQEA 3IUEA 3ZU5A 2R9VA 4DLNA 1YTLA 4BVEA 4PFSA 5IXJA 4C2TA 3O4JA 3EUWA 2QN2A 3TRJA 2WLSA 4CV1A 4D92A 4EKIA 2HI0A 4YPOA 2V5VA 4LYAA 5DH9A 2QG4A 1EVYA 3CF4G 4TWJA 2QENA 1KYXA 3FSEA 5AD1A 2XUFA 2H4WA 4WKGA 4J0HA 3CTPA 3C6ZA 2ZRQA 2HA7A 2ZBVA 5C3MA 5BSMA 3VI3B 2C8VA 5B3AA 1H8HD 3A36A 3DZDA 1UJNA 1C1DA 4FI3C 1AS0A 1ZHHA 3BMCA 3BICA 1G5QA 4IINA 5LZ7A 2X2FA 2X0EA