4X92A

Crystal structure of lysosomal phospholipase a2-s165a
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
377
structure length
377
Chain Sequence
b'RHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHAMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Group XV phospholipase A2
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 132
structure length 377
sequence length 377
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x92A01
1MO2A 7YASA 2C58A 2VAXA 3F97A 2BUAA 4ZWNA 2X8BA 3DL4A 1USWA 2OCIA 2YXPX 5BOVA 1YB7A 4KRYA 3S2ZA 5A7FA 1TKRA 2QM0A 2HA6A 4DMHA 3QM1A 4B6GA 2C5GA 2JF0A 4K6HA 1QIMA 1OXMA 2HA3A 4N8DA 4BB0A 1JMYA 2X5XA 2XLBA 1LPOA 4K6GA 3WKAA 1GPLA 2WFLB 2B20A 3G9ZA 3IURA 4ZGBA 4PSUA 4FBMA 5DWDA 5T4HA 2HFKA 2O2HA 4HVTA 4Y2JA 3D59A 2I3DA 1MNAA 2RHTA 2EDAA 4OUKX 5AK4A 1JT2A 1R88A 1IVYA 2WIKA 5JIBA 5ALJA 2QVBA 3H04A 2VT6A 2OPHA 2DHEA 5SYNA 5AKIA 1CLEA 1N8SA 4RE5A 4B0PA 3GUUA 3FWHA 2YYSA 3WA6A 5JD4A 4LXGA 1W6RA 4LHEA 2VF2A 1THGA 2PU5A 1R9NA 2ACEA 3IUQA 3T4UA 1MX1A 1YS1X 2O2GA 4FLMA 2XUJA 4BRZA 5E2IA 1XZDA 1YA8A 1XFDA 1LBTA 4H7KA 5J3JA 5K3DA 3AZQA 5HF8A 2WIDA 2XUQA 4A16A 2ORYA 3HZOA 4TGLA 3LIIA 4XIIA 5BV7A 1CUVA 5CXUA 4XWGA 4FTWA 3FLAA 4AZ0A 1VLQA 2JBWA 4ZXFA 3WJ2A 2D5LA 3O4JA 1EHYA 3QPAA 3O95A 3Q8WA 3OC0A 4ZREA 3R3XA 1GZ7A 5A2GA 2HIHA 2WIGA 5ALDA 1DU4A 4PV7A 2Z5GA 4QDZA 4B80A 1Y7HA 2OXEA 5HQ3A 4AB1A 1TRHA 2VT7A 1BEEA 1W1IA 5HK9A 3FYUA 3WMRA 1MAHA 2XQFA 4RPCA 4BDSA 3ESCA 3M3DA 2WKWA 3C87A 5JAHA 3ZPXA 4QEKA 4MEAA 2ZYSA 4MYDA 1EDBA 1SOMA 5FLKA 2FX5A 1CRLA 4ARAA 2PX6A 3PFCA 1CVLA 1AC5A 3SC2A 5A6VA 2K2QB 2ZJ6A 4WY8A 3EQ9A 2XQKA 3PICA 2QTBA 4AZ3A 4ITVA 1YASA 4K5QA 5ALQA 5HF5A 1N1MA 2QJRA 4G4IA 1DT3A 3MUNA 1ODTC 5FPQA 4G8DA 1KU6A 2XMBA 3D0KA 3ZI7A 1LZKA 3E0XA 3WWCA 3A2MA 3R3WA 3WA7A 2ZYRA 3ANSA 1UZAA 2C4HA 3ICVA 3ANTA 1DWQA 5ISMA 1THTA 1HKHA 2XMGA 2C5FA 3KSRA 4J0GA 3VKFA 2C0PA 4MQMA 5YASA 5HKBA 2GYVA 2B9VA 4GECA 3ZLTA 2PPLA 1GGVA 1ODCA 2OCLA 4X94A 4C89A 5LZ2A 4OD0A 1S8OA 5ALEA 4FLFA 2V96A 1W75A 4FNGA 1YCDA 3IIIA 1XZEA 2QMQA 2XT0A 2IITA 3W05A 2R11A 3G9TA 3DNMA 3BDIA 2I3ZA 5DYYA 1SC9A 2Y1KA 2BJHA 2J3DA 4HXEB 4FKBA 1H2WA 2PSDA 5IKXA 4U2EA 4M0EA 5EGNA 4B9AA 2RIPA 2G5TA 3FSGA 4QNNA 2RAUA 5IVKA 3I1YA 4J0DA 2Y6UA 5AKGA 1XRRA 5CMLA 2HDWA 3CN7A 4I3FA 5ALWA 2I03A 4F5ZA 4KEAA 4JYPA 3BL8A 5D3ZA 5CBKA 5EI5A 5AOAA 3L1IA 5A62A 4GBGA 3QMWA 2VQ6A 2BFNA 2OQVA 3F98A 1CUWA 5EFZA 5DYWA 2ZJ7A 3I1IA 3R41A 1ISPA 2W6CX 4BTVA 3ESDA 3GELA 2WLSA 3EQ7A 1AQLA 1CUXA 5JD5A 3W2TA 4EY7A 4X6XA 1G4HA 4DIUA 4NVRA 3GFFA 2Z8ZA 2XQIA 1WPXA 2ONCA 1LLFA 3HC7A 4Q34A 5I7UA 1ACJA 2XUHA 3AIOA 4ZRDA 3GROA 1XZLA 1LPSA 1LPBB 5AM5A 5KWIA 1QIJA 3G0IA 1QO9A 1JKMA 5CH8A 1X2BA 3KDAA 3QH4A 2JEYA 3WK5A 1DWPA 3WK8A 3WQHA 3QMVA 4AX4A 1CIJA 3H1AA 4G8CA 4U2DA 1CUCA 1HDEA 1UWCA 2W22A 5C8ZA 4GI1A 1K4YA 1SCKA 3R3VA 1TK3A 3TEJA 2VSQA 4N5HX 3I2KA 5ALTA 3FYUC 4KJXA 3IA2A 2JGFA 2WTMA 1CUGA 3AUKA 5ALIA 4IH9A 4JH0A 4RNCA 2ROQA 2WU4A 4OB7A 5BWCA 3HEAA 2VA9A 3VVLA 2WJ6A 2ZJFA 1CUJA 2IIVA 2XI4A 2VAVA 4X93A 1QGED 4DGQA 4YK7A 2PBLA 1E66A 4HXFB 4UBKA 5AH0A 1YAJA 2CUTA 1U8EA 5EHQA 5JARA 3S8YA 2XMSA 3STWA 3G0DA 2CEKA 2V98A 2GBGA 4ZV7A 3C8DA 3HSSA 4DMCA 5ALKA 5AIBA 3V1NA 4Y2PA 3H2HA 4HTAA 1QIHA 2QOEA 1XKTA 2XQGA 1J2EA 4I4CA 2WJ3A 5C8VA 4IH4A 5HZGA 3QITA 3NUZA 2WJ4A 1A88A 3B5EA 1EI9A 2WG2A 4UHCA 2Z3WA 3W04A 1J07A 1Q83A 3C8HA 1JJBA 4GXNA 3FCXA 5CT6A 3DQZA 3WWEA 2BGRA 3CXUA 1O6FA 4U2GA 3I2GA 1R3DA 1CUZA 5FP0A 5IVDA 2XUIA 3FVTA 2QZPA 4HRYA 2WG0A 4XX1A 2C0QA 4CG3A 5I9IA 1DT5A 5JASA 1VXOA 2PKYX 1ZGCA 4J0CA 5LLSA 4FBLA 5AHXA 1DQYA 5LZ8A 3QBJA 1PV1A 5CT4A 5HFNA 4Z49A 5JAPA 1YB6A 3DD5A 2WILA 2ECFA 4HRXA 3D3NA 4QLAA 4H7HA 4W1QA 3QPDA 4YPVA 1M33A 3I6ZA 4MEBA 1CV2A 3KXPA 3EBLA 4NZZA 3AIMA 5KREA 2WM2A 3PE6A 3STVA 4H18A 3DLTA 1PJAA 1K8QA 1XRQA 2XUDA 1X2EA 3G0CA 3HRHA 1R50A 4B9EA 2JGLA 4X90A 4Q3KA 4ROTA 1ACLA 2AJDA 4C4ZA 3MVEA 1H2ZA 2QXUA 4H7IA 1WCYA 1JI3A 4P92A 4QDOA 3E1GA 2DQZA 2J3QA 4H77A 4Y2SA 3DS8A 1EINA 3F96A 3C6YA 1D07A 3C43A 1L7AA 2G4LA 4H7EA 4Y2YA 2OAEA 3DDUA 1WHTA 2EEPA 4Y2VA 3TGLA 3F9CA 1ZJ4A 2DHCA 4OB8A 4Y2TA 5A7HA 4AMZA 3QPCA 5JANA 5HF6A 1VE6A 2AJ8A 1QTIA 2QXTA 1VA4A 1K5PA 3LLCA 1QONA 4G9EA 5CT9A 1C7JA 5CTAA 5AI5A 3O4GA 4HZGA 3PI6A 5LP1A 3E4DA 4D9JA 3IUJA 4AO7A 3IUMA 5DTJA 4S0XA 2WUEA 2GZSA 1BCSA 3GBSA 1LPMA 4CIBA 1AMNA 5JZ9A 1QIEA 5FDFA 5DTIA 2OGSA 4XJVA 2ZYHA 1YAHA 4PO3X 5IVIA 2V9ZA 5AM3A 1DWOA 5AI9A 4GDMA 3CCBA 4KE7A 1F6WA 3FLEA 2WHQA 3FCYA 3LS2A 1BU8A 5F4ZA 3RM3A 5HQ3B 1YA4A 3STXA 4TPKA 3FYUB 2XUOA 3ESAA 3K6KA 3WZLA 2WQZA 1UKCA 3K9BA 3ZLVA 3DL7A 5K5EA 4MWTA 3O9MA 3H17A 4OSEA 3WWOA 3STYA 4QWWA 4EBBA 3R40A 4UHBA 5ALOA 4Y2XA 3BF8A 1XZKA 2XUFA 4WFIA 1CUBA 1UK8A 5ALRA 1H23A 1XZBA 1GKLA 3OPMA 2AXEA 2XE4A 3I2IA 2WUFA 3PUHA 4WFKA 1JJFA 4UHDA 4WCVA 1UXOA 5FOQA 5ALLA 1NX9A 4BVLA 4DNQA 4Q3LA 3BIWA 2WTNA 5DNUA 1EX9A 4Y7DA 3H0CA 4UBLA 1EVEA 2RONA 5ALNA 1CUSA 1K6EA 2ZYIA 2HL6A 3V1KA 2WIFA 1AUOA 5KWJA 4BCCA 3STTA 4BCDA 3AJAA 4DM7A 3QYJA 3IVMA 1LNSA 1LPAB 3WJ1A 5EIHA 4MJ3A 1VZ3A 1QIGA 2XB6A 3VISA 4P9NA 1QZ3A 1SFRA 1EK1A 2VEOA 4X7BA 4OB6A 3ED1A 4JYMA 5D7BA 3IDAA 4KACA 2VATA 4A23A 1P0IA 3LP5A 2PM8A 4W1SA 3WK9A 1MT3A 1ZOIA 1UOQA 3H18A 3U1TA 4H7FA 4DNOA 3A2NA 3C5WP 1F8UA 1TCCA 3WK6A 2HA4A 4UBOA 5C8XA 2H7CA 1EK2A 1MAAA 3W9BA 4LXIA 2LIPA 3BJMA 2XDWA 5AI6A 1LPPA 4EY8A 2JGEA 1GQSA 4NS4A 2HRQA 1EH5A 5CRIA 3IULA 1E8NA 3C6XA 3FYTA 3EF3A 1JU3A 2QKYA 2XMCA 2I78A 1ZD3A 3WWPA 5LKAA 4UFNA 2B61A 4BP8A 4KAJA 4OYLA 4X95A 4JEIA 4BAZA 1XZCA 2O7RA 1F0NA 3PF8A 4LXHA 1KEZA 2HA5A 4LIPD 4Y2RA 3DOHA 3AZPA 3I2FA 3TJMA 1P0QA 5K3BA 1ZD4A 3D2AA 4G5XA 1XZFA 3G7NA 4UHHA 3WK4A 4UHFA 4BTLA 1A8QA 4Q3OA 2JGIA 1CFJA 3T52A 2WFZA 1UK9A 5ALVA 4W63A 3KWJA 3R0VA 3MUOA 2HADA 2YASA 4AXBA 3O4IA 5EIAA 2J4CA 1E8MA 1R4ZA 1J06A 1XQVA 3D2BA 4J0HA 2OGZA 4LYEA 3WL7A 3AFIA 2HHAA 4KAAA 3M81A 2HA0A 4F0JA 5FRDA 4BP9A 2WHRA 1E89A 1NU8A 4OU4A 4G8BA 4HAIA 4PNZA 4L9AA 5AKZA 5JZBA 3F8SA 1XZHA 4WDQA 1B6GA 1Q0ZA 2OG1A 4X3CA 3UMJA 1EDDA 4DTCA 4BVKA 3EIOA 2XMRA 1AKNA 5K3CA 2JEZA 5AM1A 5LZ9A 4BZZA 4FFVA 4P93A 2QUAA 1LBSA 1UK7A 1VJ5A 3X3HA 1HL7A 1KU0A 1WPRA 4EUSA 4FHZA 2UZ0A 4DNPA 3FAKA 5AKEA 4DYHA 5AP9A 5ALHA 1VOTA 1TQHA 4X6UA 2RHWA 3PUIA 4BAUA 1BS9A 1U65A 4KYVA 2BCEA 4BCBA 5AM4A 1JMKC 5HCUA 4H7JA 4IQ4A 3PDCA 1IUOA 3AILA 1MPXA 1E5TA 3BDVA 4C88A 1ZI9A 4EY4A 1EXWA 3KD2A 3CN9A 2PSJA 3DYVA 2VJCA 1DX6A 3KOOA 4XVCA 5CXXA 1U2EA 1XRNA 2HRRA 4NMWA 3BF7A 3SK0A 4EY5A 1QO7A 1ZGBA 3WL5A 3WL8A 1QIKA 3WKDA 1HBJA 4ZI5A 5AK3A 1CUEA 3R3ZA 2O7VA 1J1IA 2X76A 1ZD5A 3WI7A 2DCMA 1WHSA 5LYYA 1CUDA 4C4YA 3DYIA 1MJ5A 1CUAA 1GPNA 3D2CA 3QZUA 1XZGA 5AJHA 2VJBA 5CURA 4V2IA 1EB9A 4W1RA 5FXMA 1VA5A 2QT9A 2NW6A 5AKXA 3V9AA 2XUKA 2WIJA 4DLNA 1P0PA 2RI6A 2VJDA 5AKJA 5T4FA 3WKBA 2Q0XA 4Q05A 1CQZA 4DNFA 3OG9A 3YASA 5JATA 3H2KA 4FMPA 1FFAA 1SCIA 1NU6A 4J0KA 2OQIA 4IO0A 4UPDA 1DINA 2XMQA 1TIBA 5AICA 4OCZA 3AZOA 1ZI8A 3F67A 3G0GA 3DKKA 5DNVA 4UHEA 4B83A 5ESRA 5IH7A 5ALYA 3A6ZA 3Q0TA 2XUPA 1Z68A 1VZ2A 2VTVA 2QJWA 3H2JA 2WUDA 2WHPA 1PFQA 2BKLA 4M0FA 2G63A 5DLPA 4U2CA 3WL6A 5LZ4A 1GKKA 2EDCA 4N8EA 1BN6A 1CEXA 3WKEA 4DSZA 2QS9A 5AI0A 1WB4A 3R3YA 4BAGA 3WYDA 3N0TA 1RWQA 4RE6A 1QOZA 1QTRA 3BJRA 4X92A 1XROA 3BWXA 4O08A 5K3FA 5K3EA 1E3QA 1GXSA 3WIOA 1EA5A 5H3HA 1U4NA 1Q0RA 1QIDA 1W76A 3R3UA 2OCGA 5AM2A 3C6ZA 1SCQA 4OU5A 4KE8A 1O6GA 1Q84A 5JD6A 4Y2UA 3G9UA 2Z8XA 4U2FA 2RGUA 4YX9A 1CUUA 2J4FA 3D4LA 3BXPA 1FFCA 5K3AA 1GPKA 3FVRA 1BROA 5A71A 1EVQA 2QUBA 4J03A 1F0PA 1G42A 4N5IX 4PSCA 1UK6A 4L0CA 1XQYA 1AURA 1MX9A 3K2IA 4FOLA 1FFDA 3WK7A 5CH3A 1OCEA 2CKMA 3PFBA 1L7QA 3D7RA 3JYHA 1XZMA 4WFJA 2H9YA 2Y6VA 3RLIA 5AOCA 4CCWA 5A7GA 3ZWQA 4K6KA 1LPNA 1BE0A 1AZWA 3B3QA 4A5SA 3WWDA 3VDXA 1QFMA 4PQEA 1P0MA 5AKHA 2B4KA 4BYMA 3FLBA 5SYMA 1XLWA 1CQWA 4UUQA 4G4GA 1YR2A 3I28A 3V48A 3BE8A 1A7UA 1QE3A 3VXKA 4BATA 1UFOA 1GT6A 4X71A 5AKYA 4P08A 4G1FA 4F21A 2HA2A 3I6MA 5EIEA 4N8SA 3DCNA 3C5VA 4MYSA 2HU7A 2FJPA 3H1BA 5ALGA 4DMKA 3G9XA 2BAGA 2CMFA 4QDXA 3VJLA 2JIDA 2PSHA 1H22A 3RK4A 3WIBA 5ALMA 1ETHA 4J0IA 1TCBA 4CI9A 5DNWA 5AKLA 2OAGA 2ZVDA 1UKBA 5JALA 1QJ4A 3A70A 2Y2VA 4F60A 1C7IA 3G8YA 4QE3A 2JGJA 1JFRA 4LYDA 2HU5A 4BE4A 4PW0A 4AO8A 1EDEA 2PUJA 1ZICA 1IMJA 4IHAA 6YASA 2CZQA 2DQYA 1XQXA 4PF1A 4H7DA 1IUNA 5CT5A 5E4TA 2G5PA 4EHBA 5EHXA 4GHWA 4KR0A 1G5FA 1QIFA 5C81A 1XRLA 4L72A 3FNBA 4ARBA 4B84A 2PSEA 1C4XA 4GWLA 1T4MA 1TAHA 3H2IA 5HFAA 3VJKA 1XZAA 4EY6A 3TRDA 4FFWA 3ZV7A 2WFLA 5D6OA 2PU7A 4G9GA 3CCCA 1MNQA 4FLEA 4C87A 4EZIA 4KAFA 5LZ7A 1YS2X 4BC0A 3M82A 4QLOA 2WG1A 4B0OA 1DQZA 5I8PA 4INZA 5DJ5A 4YASA 1R1DA 2WFMA 4UBMA 3O0DA 5E4JA 3B12A 3ESBA 2XUGA 1CUIA 2HFJA 4E15A 4U2BA 3OOSA 3SWWA 5CT8A 3D5EA 4JUIA 4ZV9A 4GEGA 4ETWA 3ZLUA 3W9UA 4Y9SA 2PL5A 4DSAA 1FJ2A 4IH1A 2YH2A 4X97A 4X00A 4C6HA 2GYUA 3LCRA 3EQ8A 3GZJA 1ZJ5A 4UBJA 1CUFA 4J0JA 4TVKA 4AO6A 4H35A 3P2MA 3UUFA 5HK8A 2FJ0A 3HJUA 1MN6A 2GBIA 3AINA 1FSSA 1W4LA 4CG2A 1XZIA 4Y2QA 5AI4A 2PUHA 4JNCA 5EHZA 1QLWA 4AQDA 5T4EA 5AI8A 1QFSA 4E46A 4HXGA 2R8BA 4DMFA 4C01A 1CPYA 4KRXA 1QIIA 1WB5A 3PF9A 2DSNA 1H2YA 5LKRA 5JYCA 3IB3A 2BUBA 1BEZA 2AJCA 2HA7A 1VKHA 3N2ZB 4BZWA 2DHDA 2E3JA 5T4BA 5ALXA 4I19A 5LZ5A 5JAUA 4G4JA 2OCKA 3C70A 1ORWA 1ZI6A 1ZIXA 2AJLI 5ALSA 4RGYA 3I2JA 1ZIYA 3FOBA 3OM8A 2C7BA 3HXKA 2Y2UA 5EHNA 3FSGD 4OYYA 1BRTA 4B81A 2BGNA 5D3KA 5BWBA 4WDRA 4W1PA 3DKRA 1K63A 5CW2A 1ZD2P 1X70A 5AK6A 4H0CA 5AM0A 3JW8A 1N5MA 1W52X 4BVJA 1EB8A 1CR6A 2BUCA 4E14A 3I6YA 1MU0A 3U0VA 3G0BA 4B7ZA 1IUPA 1A8UA 2HU8A 4BE9A 3HYSA 5C7YA 3H19A 1N5RA 2DFPA 4K2AA 1GQRA 4QDUA 2H7YA 5ALFA 1ORVA 3UUEA 5FPPA 5ALPA 2WU3A 4Q82A 2AJBA 4BC1A 1IZ8A 3V1MA 3WZMA 3HACA 4GLBA 4X91A 1WB6A 2D0DA 3W06A 4AN0A 1XKLA 2ZSHA 1B41A 2HM7A 1UT6A 5IVHA 2WSLA 3JWEA 1E8DA 3H2GA 1LGYA 1I6WA 3MGAA 4PSDA 3RKSA 4AMYA 1FFBA 1G66A 3O9VA 4LKOA 3M83A 1UOOA 4QZVA 5ALZA 5FKJA 3STUA 4GW3A 1UKAA 1AX9A 4CCYB 4M0MA 1WOMA 3QVMA 3VJMA 4CFSA 1HLGA 3IUNA 2CBGA 2WHPB 3NOXA 2GBFA 4UFOA 1YSCA 2OGTA 5ALUA 2XQJA 4BDTA 2OLEA 2GBCA 2CB9A 3AIKA 1XLUA 4QWMA 2IX9A 3DJYA 3ICWA 3WKCA 3HI4A 5E4YA 1VXRA 1XLVA 1ODSA 4UFPA 4CIAA 4AN1A 4X6YA 5HF9A 1RP1A 5JZSA 4HS9A 4QDTA 5K3FB 2ES4A 3GA7A 4MQLA 3NGMA 5AK5A 5AKKA 3A2LA 3L1JA 2ACKA 2PSFA 5JADA 1MTZA 2VJAA 5LIPA 2XMZA 5DYTA 2ZSIA 3DEAA 2QRUA 3L1HA 1UOPA 1CUHA 3OTQA 1T2NA 3QMMA 3LIPA 4J7AA 1XQWA 5JAOA 2CJPA 4KE6A 2Z3ZA 1DTEA 3RARA 2JGMA 4J3JA 4X85A 1CUYA 3KWFA 4UBIA 3ILSA 3NWOA 4B85A 3FBWA 4BRSA 3E3AA 4EA6A 4OPMA 2H7XA 2PVSA 2P8SA 4UBNA 3DOIA 4EB0A 4FNMA 1VE7A 4FWBA 1BCRA 1HQDA 5FV4A 3WYNA 2GZRA 4CCYA 1JJIA 2O2IA 5CH5A 3O4HA 1TCAA 1L7RA 1XRPA 4E11A 5AOBA 1DX4A 4W9RA 1Y37A 2GYWA 3G02A 2JGKA 1OILA 2XMDA 4Q1VA 5HKAA 1MX5A 4MWSA 1FFEA 4B82A 1R9MA 1A8SA 1WM1A 2XUAA 4KE9A 5AO9A 2FUKA 2H1IA 3BIXA 3HLKA 4WY5A 1H2XA 1RYYA 5FUMA 3C45A 3I2HA 1JU4A 5AIAA 2DR0A 1XZJA 3SX4A 3OURA 4CG1A 3WLAA 1AGYA 1IZ7A 2V97A 4WJLA 4MXDA 3V1LA 2WUGA 1LZLA 4BBZA 3HABA 1XRMA 1HPLA 4L3WA 1BN7A 4FDMA 3VVMA 5KBYA 3IBTA 1Y7IA 4C4XA 4QA9A 3C6BA 2XLCA 2QR5A
chains in the Genus database with same CATH superfamily
3VPBA 3O3NB 3GPBA 1E5QA 2C58A 2IU3A 1SUWA 5FOWA 4G0XA 3GRAA 1I1OA 2BEVA 4L9WA 2VAXA 3RWMB 1NT2A 3L0SA 3PJDA 4ENWA 5BR4A 1H66A 4KIWA 1ZN8A 1A71A 3IXQA 3SFTA 3UYLA 1ISGA 5AMXA 2PDAA 3U1VA 1LX7A 1YV9A 4HQKA 1LDBA 3BXEA 3JV7A 2DUNA 3JALB 1USWA 1BG6A 4XWKA 1L8QA 4PZUA 1E94E 2CLIB 5ENZA 2XD9A 1UANA 3TLCA 1I3LA 1I7SB 1MJGM 4CUZA 1Q19A 3ZDCA 3DL0A 1C1HA 9LDBA 4OHFA 1LDEA 3REQB 2QM0A 2AFRA 2IPAB 3UFXA 1JH9A 1G8GA 2NADA 3OESA 4DMHA 2XCOA 3QM1A 4EGFA 1AD2A 1J33A 5IJAA 1TMKA 3TXYA 1IUKA 3LT2A 3L7CA 3SBEA 3UW1A 3ZDYB 3TOVA 1V1JA 1C9YA 1WABA 2C5GA 4WZBE 1ZVKA 3GYBA 1OXMA 4ENVA 3OZRA 3LX6A 5TLSA 3SXJA 5FTKA 1S8NA 2AI3A 1AK9A 5E6RA 1RE1A 1O87A 1ZL0A 2E7ZA 2ODNA 1BX1A 3BGWA 3MMNA 4NKRA 1TEHA 2J5BA 1K3UB 1YUBA 3FWNA 4DT1B 2PMKA 2CGEA 3B3AA 1D2RA 3DB1A 4XLLA 1QK5A 3AR4A 2ZDGA 3WBKA 5AESA 4RYLA 3N86A 3ZHXA 1SKQA 1KKLA 2WFLB 4E4YA 3GLIB 4MDFA 4HNHA 2IOFK 1QO0D 3IURA 1Z2CA 4PSKA 4ZGBA 3PL5A 3DOOA 3HHEA 1VP3A 2NXWA 1CJSA 4P3OA 3SR3A 2PWYA 4CCSA 4DB4A 1KOJA 3IE2A 2HFKA 1PWXA 4F3YA 4PGMA 1T3TA 5GJVC 3GFTA 4Y2JA 2BMEA 1J8VA 2I3DA 3QWBA 2PR2A 2RHTA 4LOJA 4OUKX 3PC7A 5DGIA 3SS9X 3DWFA 4AS1A 3H4VA 3KUXA 3OE5A 1NZJA 1D4AA 4QO8A 3DPUA 3ZNOA 3PCXA 3R7LA 2G1AA 1CY4A 3MOSA 3BE5A 3D0QA 3PVZA 4LK3A 1IQUA 1GA4A 3ITEA 5J58A 4B79A 3WGUA 2WT9A 4CMIB 3GEPA 3HL0A 4MV5A 2YIMA 2PKQP 2ZE5A 3ZWNA 2REQB 2DQKA 5LYJA 3KV3O 1KJ9A 1B3RA 3RIYA 4BQQA 4D2IA 4QLBA 2DEUA 2HF2A 2FDCA 2WD9A 2DHEA 3MJDA 3AM1A 5BSVA 2G70A 4US2R 1SBTA 1JHDA 5K0TA 5EZ5A 2PFSA 5AKIA 3KVOA 3LHFA 4KUEA 4RE5A 4EPVA 4ZIRA 1CYEA 5KYWB 4CDGA 4B0PA 4V1CB 1N5DA 4DDWA 2VP3A 3Q3EA 4ZKEA 5M2QA 3SJCA 3RIMA 2YYSA 1P73A 3RT7A 3WGYA 4WXRA 1LTQA 2FUG6 4MUMA 1I4WA 2WMDA 1VDMA 2R62A 3CH7A 1X0XA 3R5SA 2PL9A 2A0KA 3D1LA 4L0MA 5H02A 2Q07A 2VF2A 1Z74A 1PS9A 4PNHA 1THGA 4RPIA 3V7YA 2HEIA 1NN1A 1UMDB 1FFXA 1U8CB 3TGWA 1AJEA 3EB9A 4R7TA 1R9NA 3C3CA 4MKZA 4NARA 2ACEA 3OFSA 1JR3A 1MX1A 5JU6A 2Q3LA 3DH0A 5CFNA 2JLVA 3U31A 2TYSB 4PZAA 2KM1A 1N9ZA 1D1PA 3GX1A 5DXJA 5F1PA 4YQEA 5LP6B 4AURA 4ZDKA 4GX1A 2MSEB 2WYVA 5T64A 1G291 3G0OA 4GOXA 4CMEC 4BZXA 2ZYDA 4BRZA 5E2IA 2GAOA 1P3Y1 2HXYA 2VSFA 2Z0MA 2J3EA 1XOIA 4N6GA 1XFDA 4QPJC 3HKCA 4I50A 2YJZA 4UZSA 4FYHA 5J3JA 1QWSA 2FGKA 1XK7A 4M9RA 2EL7A 4GR9A 5K3DA 5LA6F 3RDPA 2VJMB 4WN3A 4CM9A 2DFDA 1Z73A 1IK6A 3OCUA 3QVXA 2ZUFA 4H16A 1OUMA 3LIIA 2R8YA 1QSGA 2CLEB 3F90A 3SYLA 3TTUA 4B2PA 1TQ4A 2WSIA 2CNBA 3L0OA 3ET5A 4DR3B 3HFJA 3CRRA 1VL5A 4IPTA 5D84A 1AGXA 3OEEA 1K75A 4FTWA 1ODKA 1NQVA 4JODA 5JHGB 2GERA 1QGYA 4E1VA 2CCJA 5I51A 1GAWA 1R8JA 3QFTA 1QH9A 3KBOA 3DF7A 1QYIA 1JQ5A 3GEGA 5BRAA 2PH5A 2BFDB 1ZA2A 4O4JF 3SC3A 4YLEA 4K9NA 4ZXFA 3QPAA 3WFZA 3A26A 1XTQA 3O95A 3OC0A 1GTG1 3Q8WA 3TUJC 1XFAA 3K0HA 2XKAA 3E7DA 3CY6A 3UXHA 1V5IA 1V96A 1XQ9A 5ICMA 4NABA 1ZWLA 4DJAA 5B36A 1UJCA 3R3XA 1GZ7A 3EMDA 3THYB 2A5JA 5ALDA 2WIGA 5F2KA 2GEJA 4RGVA 1VJTA 1MGOA 4WXYB 2IXFA 1CXZA 4B80A 4MZDA 1DSSG 3NEPX 3BD9A 4K3UA 1KYVA 2PRZA 1IAVA 3N0WA 2JDID 3H65A 5B7NA 5MFZA 1W1IA 4ZQCB 3UV3A 4HDNA 2EIHA 3FNHA 1J2JA 3KPYA 3O82A 4K40A 4N54A 2IXGA 1RABA 3ZE1B 3CLTC 4QATA 3DV2A 1U0TA 5JXHA 2PX4A 3M3DA 3R6LA 4HP8A 3U3ZA 2WKWA 5IDQA 4IIHA 5KSWB 1Z28A 3AM3A 4KPEC 1G60A 1XYVA 1G2PA 2RK4A 1JPUA 2HQ1A 2QD3A 2ZUBA 1N6RA 2D0PB 3EWNA 1NW3A 1SOMA 3HGTA 2QE7A 1LBIA 1KMCA 4OQLA 4P33A 3G3EA 2O2YA 2XJ9A 4K03A 2JATA 1JNYA 4XSVA 2BM9A 3KZCA 4K6MA 2GCPA 3RK0A 2LR0A 3E9EA 1Q7CA 3L06A 4DOMA 2QMOA 1ZJYA 3B1YA 3FYCA 3VPFA 3L43A 2E21A 1M8FA 1XCOA 3SNKA 3AEZA 3U49A 5I4IA 3B9BA 4LV6A 4TV8F 3FOFC 3GIDA 2LDXA 4CMBA 2O07A 2FAXA 3K92A 1W8IA 1IOZA 2DG2A 4HDRA 1J25A 4ITVA 1YQXA 3GAAA 4HNAA 1MQ9A 4K5QA 2W83A 5ALQA 5E7MA 4Q4CA 2ZJ1A 4NYMR 5DSXA 4I2NA 3OQPA 3QA3E 4M49A 3EARA 3ZDBA 1K4KA 4ZCIA 3NWPA 4RD6A 3RUHA 2QJRA 4YMHA 5HM8A 5LJIA 1A27A 1DAMA 4X1YA 5JAZA 4FILA 1A9TA 1DT3A 1P0FA 2I2FA 3MUNA 3VTFA 1UKZA 2BFCA 1J1UA 3B36A 1P5HA 2QPTA 1Q1QA 2JLCA 2X3FA 4E03A 4RKFA 4CM3A 4EPXA 1U8FO 1O97D 2I1LA 2W0SA 4ESEA 1F8YA 1WA5A 2JC3A 1QNLA 2ZTHA 3Q2OA 4K9MA 2RGEA 1V8PA 3KPJA 1RQ7A 4Q93A 1IIBA 5CJ2A 4EPYA 3HJRA 1L5RA 3WS7A 3UC9A 3QSYA 1NKSA 3VOAA 3E9RA 1EXNA 1PSZA 2FXIA 4ITRC 1M9NA 3R3WA 3UMSA 1UQTA 3I45A 2OKCA 3LY5A 2JBHA 5F21A 3ANSA 1POWA 3E9YA 5KOJB 4CM7A 5IBCA 1ODJA 1V4NA 2WC1A 3A3NA 4L28A 2H3HA 4KGDA 2PS0A 3K1AA 1X0VA 3M6AA 4C0QC 1UFVA 4DZZA 4L78A 2GWHA 5JXJA 3IAHA 5ISMA 1THTA 2VYVD 1FS4A 3IHTA 3KSRA 1M34A 4CIYA 3ME5A 2CHGA 2WYUA 3FZQA 4Q9HA 3SMQA 1KVQA 2QTAA 5YASA 5HKBA 3BSYA 3WYBA 5KHLB 2QN1A 2OHVA 3RHZA 4DHEA 3RBXA 2OMEA 4DJFC 5LUAA 4EMSA 2AYZA 2G36A 3K9QO 4EABA 1NF9A 1JDSA 1QYXA 2RAPA 2FPSA 2PPLA 1GGVA 5DNUA 2W42A 4DN6A 4UE3S 3KRTA 3UA3A 1GSIA 1KO5A 3HY4A 4OD0A 4EKIA 3K6SA 2YWRA 4JB8A 2V96A 1O77A 4FNGA 1LQUA 5EJGA 4AN4A 4EP1A 4XVUA 2PWBA 1YCDA 4DCJA 4AQYB 1NUTA 1RCTE 1EM8B 2QMQA 1P2TA 4JQCA 3DNMA 1RP7A 2I3ZA 3GA0A 5EL0A 3VZDA 2Q49A 4H08A 2YN4A 1P33A 1FTNA 1P4HA 3OM1A 4DRXA 5I4BA 2Q9AA 4PX3A 4BLVA 1GZHB 4V0KA 4UCXA 1EUCB 2P7IA 3K0FA 3ORQA 4MUYA 4M0EA 4Z9BA 4KOEC 3CEPB 1NBMD 1XVLA 2HJGA 2RIPA 2BGMA 2Q9UA 4DS3A 2BGLA 3H42B 3P4UA 3UF0A 4LQCA 2Y6UA 1JHAA 3BD8A 2WTAA 4N5NA 5KKNB 2HBQA 3H3FA 2FP4B 3CN7A 3TRJA 3DT6A 4E5PA 2EP8A 4ZARA 3JQFC 3GP5A 1Z6QA 1V3UA 4UHJA 2VO1A 1RW4A 5KNDH 4XQ9A 1PV4A 2O8EB 2PKEA 4IGIA 1FVXA 3PC6A 2VCEA 3SLKA 2VLIA 4W5WA 1U1IA 5D3ZA 2R8OA 1YGYA 2BMDA 2IYRA 4US0R 3TPFA 3ZQ6A 4E5UA 3EASA 4BMNA 4PTYA 1AQJA 1V9SA 2ERXA 4MS1B 3QWHA 2VQ6A 2BFNA 3NEYA 4KNWA 2ZROA 4Q4JB 4TXHA 5EFZA 3WR5A 2XAAA 1GDHA 3I1IA 3QE3A 5DYWA 3Q41A 2Q3CA 2Y1GA 2W6CX 3M4XA 2D1YA 4ZZ3A 3DLPX 1NBWB 2OFOA 1WDMA 3ISJA 3QYFA 3BEOA 2JA2A 2CK3D 1NONA 3EQ7A 1AQLA 1B2RA 5K01A 2VRCA 3PHLA 3OETA 5JD5A 1C1YA 3KHKA 5FWXA 3AUYA 4UCQA 2YTZA 4BNFA 3E27A 2G9VA 3B6IA 2XA1A 1M6NA 1G98A 3JAKB 2GESA 3EGXB 3HDJA 2GEFA 5TEWA 2J0UB 3WAJA 4CJXA 2L18A 3EXAA 4LJSA 5JJ5A 2HV8A 2IHTA 1ECFA 1QRSA 5GINE 2YUIA 2TS1A 5JCPA 1F9AA 1ZXLA 4S1PA 1PEDA 4G0MA 2VN8A 2XYQA 3UK2A 4OQDA 3WTBA 2YWCA 2CFCA 1NSFA 4ZEWA 5B64A 3F4BA 4JEHA 4HTFB 4TN1A 2YS7A 1P77A 2VXCA 1W36D 1U3CA 3PV0A 1VHDA 2E85A 4UUMA 1VKJA 3DO8A 1LW6E 3FTEA 4ZRMA 2R8ZA 2H29A 3B1XA 3PGXA 1DUIA 1EBBA 1YS6A 3P45A 1U3FA 2CL6X 3T15A 1T8SA 1UZUA 2JCYA 2PX3A 3LLUA 2WWFA 3P0FA 2V45A 3KQPA 4YDSA 1I80A 1LA2A 3SBOA 4R9UC 3WK5A 1GU7A 2ZGVA 5IBQA 1NE2A 1JJ7A 2BF7A 3NH9A 3HVUA 1OFVA 3H1AA 1ORHA 5LD2B 2IELA 3V4LA 5JRJA 4U2DA 4CEJA 3HCNA 1CUCA 2GAJA 1D2MA 3ZYCA 3EEBA 1HYEA 2PHZA 3FPAA 1O2DA 1UWCA 4QUHA 1Z5VA 4RM2A 1V3TA 3ICCA 3MPOA 1T1SA 3LY7A 3PGKA 4XIYA 4GI1A 5ECYA 1ZCJA 1K4YA 1MDFA 3DDZX 2NSDA 1HKUA 4FZJA 3JAMA 5HNKA 1YL5A 3V8PA 3JCZA 2W2LA 4ASUD 2XNHA 1Z4JA 3EVNA 4KFRA 1LSOA 3UWSA 4JI5B 5A2QA 1Z7BA 3AYZB 4S2UA 2OBBA 2QI9C 1KOGA 3I2KA 3DP9A 2SKEA 3LC7O 3WRVA 4JP8A 1BA3A 1N6OA 1SIWA 2F1IA 2IT1A 2JGFA 4ANFA 1VE9A 4D6XA 4IZHA 4U8HA 3JS5A 5CB4F 1BOOA 1NW7A 1K08A 1S01A 1BTOA 1WMFA 2FW6A 4UUPA 5CVTA 4ZEVA 2PY6A 5TMBA 4EG6A 3QI2A 3GG9A 2VF8A 4JH0A 5EWMA 2VJNA 2FWMX 2BGWA 2UUCB 2ROQA 1QGUB 4FCCA 2P8JA 3VR3A 1L3IA 2WU4A 2CWWA 4OB7A 1IMOA 2F1HA 2MHCA 3FMGA 1CS0B 5TMDA 2VA9A 2PMBA 5EQFA 2MJLA 3OPNA 4A6PA 1CUJA 3L07A 4OGKA 4E7OA 3QOXA 1B6SA 4KXQA 4XR4A 4AKEA 5J47A 1SZJG 3ZWWA 2IV2X 5A1JA 4BS9A 4DGQA 4DE5A 3GEHA 3R9IA 2WWVD 1JLLB 2ONKA 3LZDA 1N5OX 1SU7A 4FGLA 2VHTA 3DZBA 2PBLA 3WHLA 5CEEA 2C7PA 1R4MB 4UBKA 1N78A 1XT6A 3KR1A 5A3RA 3NYRA 3AKYA 3QVTA 5E9WA 4QYTA 4Q7LA 1O9GA 2XMSA 4DCUA 2IS1A 4Q1BA 2BLLA 3RS0A 1NT4A 1BMDA 1UBLS 1SB8A 2CD7A 3WSTA 4LF9B 1U1DA 1TM3E 2Q5LA 2GBGA 3R5TA 3QMPA 1LI4A 4WBNA 2D5IA 1IDN1 5BWLA 1UJ6A 5HJ7A 1F5NA 2N1MA 2ZKIA 3JVVA 1Y3BE 5D3QA 3JY6A 1Q6ZA 3M5WA 1BVHA 1D6SA 4GX5A 4DMCA 1P6XA 3HN7A 3NNNA 4LHWA 5ALKA 2X0NA 3GA5A 5F9MA 3V1NA 2DPYA 2JFYA 3N0XA 3ZQJA 4C1BA 4DJ5X 4LJRA 5LOVA 1D03A 1HA3A 3HB5X 1YJBA 3JQ6A 4XIJA 4TXNA 3M6WA 5BYJA 3LRXA 4Z6KA 1T8WA 4ZOCA 3I09A 3IPLA 1G8YA 5K09A 3GN2A 5A5VA 1GZDA 1I4EB 4LBYA 1KSHA 2XE7A 3SYTA 1RKXA 2JI6A 1QKKA 1D4OA 4YV0A 1Y3CE 1KHHA 4R2KA 2IYNA 2AE1A 3NUGA 1FNBA 2FG5A 4IH4A 7AT1A 1QR2A 4A8TA 4ZHQF 3PQDA 2P91A 3QVKA 2QLJA 3L9XA 3QITA 1V26A 3SXUB 3EIFA 3FIUA 3V4ZA 4D9CA 4Q37A 3DFKA 5FA6A 1VKRA 2WG2A 2RI1A 4BO2A 1OXXK 4BL5A 4Y6QA 4O1MA 1J07A 1IK4A 1M8GA 1U81A 4RVDA 4IWNA 3KSAC 2QTWB 2ZRLA 2D5AA 3C8HA 1JDJA 1AF4A 3NT5A 4ZN6A 3H3JA 3FCXA 5CT6A 5GPBA 1QP8A 3WWEA 4HX5A 3CXUA 1NVVR 1WCIB 1MFPA 1GGKA 3DBHB 4QG7A 1RU3A 2VG8A 2ZIAA 3I2GA 3K9WA 3QE4A 1CUZA 1DG3A 2Q6KA 2UKDA 3QEKA 5CM2Z 4ZRNA 3K20A 2IU4A 2ZAGA 4GPTA 1I1NA 4RF4A 3K8ZA 2TRSB 4NDNE 3RADC 5HPYB 2VQSA 4GL4A 3I9JA 2NTJA 3E8MA 5E2BA 4ZEXA 2ONZA 3EA5A 3HXQA 4I7EA 4GP6A 2VYNA 3VV3A 3DGFC 5A0VA 2JIPA 2H3EA 1EGVB 1VXOA 3H6HA 4LDAA 4J0CA 3IIMA 3FMOB 4FBLA 1W2WB 1ZMTA 4N12A 3VH1A 2Y92A 3KQMA 1ISJA 3LHKA 5C1OA 1DQYA 1JR3E 2ILVA 3NO4A 4Z4IA 3KLNA 1R6AA 1P1FA 4RWEA 3O7MA 4OP2A 1QRAA 3A7DA 2VPYA 2NVOA 1KHTA 3CF6R 3LD9A 2V6JA 4J9UE 1Z13A 1PG5A 5FOSA 1ANKA 3GUCA 4ZO8A 2Q21A 4Z49A 4UHKA 2YJGA 1AUVA 2GFHA 4LDPA 1E3SA 3UQZA 5HDBB 4L4UA 4FS3A 4UU8A 4NR0A 4R9VA 2GI4A 4G5YA 5D7NA 3FBTA 2M6RA 4X65B 1NUSA 1KK0A 1F60A 4EI7A 1KPHA 1RYEA 3W7BA 4EJ2A 3NDJA 3ZV6A 1TD9A 2M2IA 4NP6A 4D1YA 5KTTA 3RAJA 3QPDA 4Y7CA 1TI7A 3BUSA 3OQIA 3WNBA 1GTVA 2CYAA 3CLTD 4KXFB 4F84A 3K09C 2ORVA 3H9BA 4XSHA 4KR6A 2Z4TA 1O94A 5ITZB 2Q5HA 3DEJA 3JARB 3QJGA 4JJ4A 3PE6A 2J6IA 1QC5B 2XYGA 4H18A 4OJKA 4UQPA 2QB5A 3T5GA 9GPBA 4JJIA 4M0LA 3IUBA 4D4GA 2XUDA 3HRHA 4CL3A 1R50A 4N7JA 2JGLA 4KQ1A 1KQFA 4X90A 2YFHA 2WZCA 3QXHA 5JV5A 1SXHA 4CKWA 2ISSD 3DLAA 1H2ZA 5ARCA 4KDRA 3QOWA 3GEIA 4HVAA 3TK1A 2ZE6A 4P92A 1OBOA 3VR5A 1E6CA 1U3WA 3IKVA 2DF8A 2PX8A 2Q6VA 5CM9C 3BGSA 4FE3A 3O1JC 1NMEA 3FFWA 1TYEB 3KNZA 5K45A 2F7SA 1GR1A 3QLVC 2O2XA 4KQIA 4V0LA 3AYXB 2WJYA 2ONJA 4UQLA 1NULA 3FOWA 3FPLA 3F73A 1D8AA 1R16A 1OX5A 1YVDA 2Q46A 2XEXA 3BSWA 3LQ4A 4LXUA 4P4GA 3QVJA 4PAQA 1OLSA 5EINA 1V1RA 2CCGA 3L4EA 3C43A 1L7AA 2VZ9A 3PI7A 3EXHB 4Q1EA 1WTCA 3R7FA 2GARA 3T7JA 3WGTA 4D80A 3PEYA 2OAEA 3RJTA 1WU7A 1NXPA 3HB9A 2ZJ0A 1WHTA 2I8LA 2MCFA 1PJ2A 3VNAA 2DY0A 3WLRA 2I4NA 1QP4A 1TUEA 2ECQA 1K7XB 2NTEA 1KJJA 1R2QA 2IPMA 3F9CA 4GXTA 4ZT2A 3PFGA 4MEJA 3RIXA 3MWEA 4AMZA 2VP4A 1TLFA 2ZYWX 3TSCA 1OXVA 1SQGA 3HO6A 3Q7RA 5HE9A 3I73A 4Z4EA 4WN9A 4O2AF 3GJ7A 4WNCA 1IJBA 3CG4A 1YZFA 1EGQA 4GS5A 4M36A 3NRBA 4RQTA 1U3UA 3IPCA 1GILA 3O73A 4G9EA 1EK5A 2V5AA 1UAYA 4WLOA 4EAQA 5E6UA 1XBTA 4HZGA 4OUDA 1Z26A 3TIVA 3VO9A 3X1MA 4MNTA 1L3CA 4A1FA 3B89A 2O59A 3RS3A 4AO7A 3HFSA 4EEKA 3SQNA 2ADFA 1IPHA 4NNPA 3OKAA 4HMOA 5F4BA 2QVCA 5EMJA 3ADDA 1E2IA 1HC7A 3MMZA 3PK0A 1NAHA 1NXQA 2WUEA 2ZRJA 2V7GA 3GR6A 3NT4A 3S99A 2JIOA 5JCXA 4RDCA 5FIUA 2DB3A 1R00A 3V4PB 2D1FA 5E1BA 4CIBA 4MUIA 2K7FA 2BFPA 4QICA 4COOA 2FZ5A 1SXGA 2YWBA 1SVWA 2ZG6A 3FRJA 2C9ZA 1N6HA 4G3XA 4AYXA 1DAIA 2OGSA 5H3LA 2G06A 1YAHA 1BOFA 4WJZA 4XXHA 1Q0LA 1HLFA 3GW8A 4M9ZA 1B14A 1GTJ1 1SUSA 2GF0A 2NV2B 4MRRA 5FQOA 4MVJI 2W2VA 4MVCA 5LWHA 3P9QA 2Y3IA 5AI9A 4FDUA 4GDMA 2Z4SA 3UZUA 1L7XA 3OX3A 4ILKA 2P41A 4LQ4A 4O4HF 3T5MA 4FZ5A 2PRJA 3SICE 4GWGA 3BD6A 1F6WA 3FLEA 3N2IA 4KX3A 4UAJA 2EJCA 3OQVA 2WHQA 4BBJA 3FCYA 3PP8A 1YQ9A 4F97A 4U7GA 2C5EA 5EZSA 1G7RA 2I1VB 5TF4A 2XCSB 3BWVA 4U0JA 1KZ6A 1PT6A 1SXJB 4HGOA 2C9MA 3BXGA 3G8CA 4Y6PA 3OFND 4TPKA 1W8DA 5HIMA 5CLJA 3CSSA 5KYUA 2IQIA 5KTYA 3UVEA 3VZRA 2VEDA 3K6KA 4IGKA 4RESA 5CW1A 1IG3A 1M7BA 3D8TA 4BNJA 5MF6A 4RTOA 4IHJA 1T1IA 1M34E 2CE2X 2GNPA 4KN8A 1O5TA 5DHSA 1V43A 1SBIA 2JI9A 1GZ5A 4A6XA 3BHNA 1K88A 3H17A 1WXWA 3WWOA 5EJ9A 2WDZA 3BXZA 4RZ3A 4EBBA 1VL1A 1K68A 3VGJA 5B1YA 2ZRHA 2FFQA 3QLUC 4LDRA 3ADKA 3BF8A 4Y2XA 4FFMA 4DMMA 2X1MA 1B76A 4DCCA 1AMUA 4LZOA 3P0JA 1UK8A 1ZGHA 2P27A 1RPNA 3UT5A 5CCEA 1S8AA 4TXJA 3SC2B 5BSFA 2N0SA 2ZYAA 1E0DA 4HSEA 3P5BA 4P4TA 3W8NA 1J22A 5ERXA 3RG2A 3T99A 1NE7A 3TSYA 2HUPA 4HYTA 1GKLA 1M1UA 3G2JA 3PKIA 4YJKA 2ZRCA 5KVVA 3A7EA 3U5TA 3LQ1A 3JYPA 1LBEA 3L77A 1R5JA 1U9IA 1CR0A 4YXWA 2XXAB 5EWLA 1DKMA 4IUBS 4KWIA 2X0EA 2I80A 3A28A 3FCAA 5G3ZA 4ZOLB 2GDJA 4ZOEA 3TBHA 4QT4A 3S7ZA 2BI4A 3CNOA 3IV6A 3NAZA 3AUAA 4BMZA 1AK2A 1EQAA 1KDVA 1EFRA 5EQJB 5ALLA 4CE6A 4DNQA 4Q3LA 3ZNQA 2N46A 1MCZA 3DDOA 4B2YA 1U4SA 4D25A 1UBSB 4KFUA 4ZVLA 1GFWA 3H0CA 4L4XA 3M5CA 4PLWA 4GZ5A 2QRQA 2IYOA 1X14A 2D1SA 5JFOA 1PHRA 3E2IA 2OQRA 2ZYIA 3IAM1 5BSTA 4Q03A 3V1KA 5DW3A 3MQ2A 2WJWA 1CFZA 3T4XA 3TZEA 3U9LA 1XVVA 2P9BA 4LW8A 5AUQA 1EFVB 2VP2A 4RS4A 3TE7A 5IYZB 3QUCA 2GPBA 1IAQA 1SVOA 2V7QA 1YU9A 1YR8A 3E3LA 4IOMA 3INTA 4IS2A 1L4MA 2NAPA 4LTNA 1ZW6A 3ZW9A 4XAQA 1WDTA 1H5UA 5F35A 1N32B 4FP9A 4QD3A 1GRNA 2RGRA 3Q8XB 1GN9A 2WYOA 1E3MA 2AN3A 1UIMA 1G6Q1 2QEQA 2XB6A 3HKEB 3HWSA 4H2DA 6PFKA 3IMKA 4ZO4A 1E4OA 1E1MA 2AB0A 4P9NA 1QZ3A 3MTGA 4LOAA 4XX0B 2NT3A 2VEOA 5DNDA 3UJNA 4L95C 4OB6A 4B3BA 1MABB 3T7EA 2FLWA 1TIPA 2FOXA 2FRDA 1NRIA 2PGNA 2IY7A 3B70A 1QTNA 1R8QA 1CJUC 3HU1A 3PPXA 4EF6A 3FI9A 3K32A 4U7HA 1P0IA 2XNDA 3E9DA 4HC4A 4NYJQ 4CKEB 2X77A 4RIIA 1GA6A 1NFFA 3A6GA 3UTCA 3A1VA 2PM8A 4MRPA 4W1SA 1I7QB 1J8FA 1GVHA 3GAFA 3RS8A 1Y82A 1MT3A 1SK8A 5IF3A 5JSZA 1J5PA 5FPHA 2DY1A 3SHTA 2FN7A 3H18A 1RRGA 4JC4A 4II7A 3QP9A 1JR2A 1EBFA 1H2EA 3HVIA 5KS2A 1QP0A 2HDNB 3LPNA 1PR5A 5KNBA 2CVFA 3OLXA 4ZMRA 3MGGA 4UBOA 1U3GA 5C8XA 2XXJA 1D7OA 1MOQA 4YRZA 4D3DA 4GYWA 1MAAA 2F3QA 1BVYF 3LTEA 5EXPA 3IOCA 5KUTA 4D45A 4Z7QB 2JA1A 2KYRA 2JW5A 2V9PA 3TWOA 4AMUA 2CZCA 4KRFA 1PJLA 2BRUA 2WYIA 3M2TA 1GQSA 4NS4A 5CG2A 4RNDB 1EH5A 1LDGA 2OV4A 2YY7A 2W70A 3JZAA 3AFOA 1AUPA 2JAPA 3FYTA 4X54A 4AIRA 1JU3A 5KYYB 2COKA 4BN5A 3ZWBA 3AL3A 2XMCA 1QAOA 2QRVB 2GDZA 2QYSA 1ZD3A 3TBKA 4DYDA 3MJSA 2ZZNA 4FMBB 1JJVA 3LM8A 4CLHA 5C5EA 2WSYB 4X9XA 3MS7A 5JECA 1R12A 4JI2B 4CN9A 3ZD7A 2QHXA 4KAJA 3ANMA 3VU9B 3CNBA 4FMCB 4KB5A 1Y81A 1YQDA 4MQEB 3AV3A 4JJEA 1KWGA 3BIJA 1DRKA 2C2XA 4ZEOA 3K0CA 4YCCA 2IPOA 1GJRA 5H9VA 1G8FA 2BEJA 4UE2A 1J0AA 4YGXB 3DO5A 3ND5A 3PF8A 1FDIA 2ZITA 2YHIA 4HPWA 4LIPD 4YMUA 5CDHA 4JWTA 4Y2RA 5L3QA 2O5CA 1DRUA 2LE0A 1DRJA 3IERA 3ZNNA 2BEWA 1JIUA 3GUVA 1MX3A 2FW8A 4BKUA 3KB8A 3BB1A 3SKYA 1OPXA 3SJAA 5K0JA 1I5RA 2O8DA 4LISA 5ECGC 4MP3A 5I4CA 2HZBA 1WBDA 1E9FA 2VHQA 2X4LA 1R10A 1AKUA 3LSTA 2QR2A 3NLLA 1QFJA 5K05A 1P2FA 3B2NA 4QNRA 1KZ1A 2Q4OA 3DD1A 1RZRA 4UHHA 3WK4A 1ZXXA 4D81A 4UHFA 3WLLA 621PA 1CFJA 5K3SA 4QRIA 2TMDA 3A4IA 3DPIA 3PXDA 3QXCA 1X80B 5CGQB 4AG6A 2IHJA 5K6AA 4W63A 4FKZA 3R0VA 2EBUA 3K31A 2B94A 4W5HA 1TU3A 1Z2OX 3E4CA 5MN4A 1Y1SA 2ZREA 1RACA 2DR2A 4MP8A 3MUOA 2HADA 2YZ2A 1QH1A 2YASA 3EN0A 3Q87B 4MVJM 3MELA 4WZ6A 3UCXA 3O4IA 4I5FA 4ENUA 5LQCA 5EIAA 2WE7A 3CE6A 1E8MA 1R8YA 4MQ6A 3JATB 1R27A 4O29A 3ZV3A 2QAJA 5CA0F 4IDGA 4OBBA 1J06A 1Q2XA 1XQVA 3D2BA 3K71B 4J0HA 5SY6A 5A6SA 1HTBA 3DULA 1NI5A 1NJ5A 1V2GA 2HA0A 3KJQA 4DR5B 1OKKA 2IHUA 4R2MA 1GQYA 1IDOA 1UAGA 1R9GA 4F0JA 1PQPA 5DGHA 1N2SA 4C6RA 1SQ0A 3UUGA 2C59A 1JXOA 5C8DA 1DJMA 4E2YA 1QVRA 1T8YA 2QMHA 3AH8A 4QYWA 3SOPA 3O3OB 3VR4D 4FOTA 1SWVA 4WLVA 4IX9A 1UBJS 3HA7A 3HRKA 3WBFA 3U5ZB 2CV1A 1ECCA 2OECA 1QYDA 4MWEA 2UYYA 4JQSA 5IG2A 4ALJA 5TGDA 4C76A 2OCAA 1K6JA 4PNEA 1RRPA 4F9GA 3MINB 1A0OA 3O9ZA 4QBFA 5TS3A 4UAGA 1E58A 3VAAA 4KITB 1D2CA 4CMGA 4CM1A 4BMPB 5LQUA 1JKJB 4FU0A 3EAQA 1LEHA 1RCUA 4HWRA 3RJ5A 4F1JA 4L6AA 3BULA 5L3RA 1DCTA 3GLGB 3O8QB 4TKVB 1T9GS 2DBZA 2OG1A 2FPPA 1V8ZA 2YJ4A 3AGPA 4X3CA 3SVTA 1EDDA 1OWOA 3IBCA 3B6JA 3T7KA 4BVKA 4LRQA 1RHRA 3EIOA 4XPZA 5EIWA 5FL3A 5C3MA 2E4UA 2R66A 3BK2A 1QRUA 2IIBA 3IELA 3R77A 2HT1A 5K3CA 3FBGA 3F6PA 1E7WA 1LS1A 5AJVB 1IHXA 1Y5LA 3HR8A 5AM1A 1NWHA 1GG9A 1JECA 3EOAI 5LZ9A 3P4XA 2X8WA 3INYA 4UREA 1L5HB 1L4FA 1N9GB 2WT8A 1CB7A 2A9FA 3GLRA 4JIMA 3RGWS 5PGMA 1LBSA 3UANA 1UK7A 4EW6A 3RTAA 5JYEA 4KFCA 4XQGA 2F67A 1U2GA 1MMFB 3F5DA 4IZOA 4R1SA 4LYGA 2VUTA 4EUSA 1EHIA 1PT8A 3EGWA 5KKCA 1SGWA 4IDOA 5BV8A 2VXOA 4HX2A 5E1DA 5D87A 3M70A 3WO0A 2DPGA 4QOIA 4H6VA 3G5MA 2I6TA 3CF4G 3FAKA 5H82A 5TIIA 4L15A 4ZVOA 2DTXA 5JS1A 3IAXA 5AKEA 4UPEA 3NOQA 5H0IA 2X9GA 4FYMA 1K6MA 1BGXT 2GRJA 3B1JA 4N7RA 5ETJA 3UICA 3WLMA 3HB7A 1QV6A 1U0JA 4FDVA 5FLYA 2SECE 1NHWA 4BIIA 2YJ5A 2HAEA 2AMJA 3OEHA 2HSGA 2Y93A 3ELWA 3RC7A 3FMVA 2RHWA 1QYCA 1PFGA 3AFHA 3SR0A 4AMVA 4LNUB 4QDJA 3SGLA 1Q5PA 2J5QA 3GJSA 1KIMA 1PV2A 3UCFA 1UWLA 1FPMA 1G17A 2AXPA 4IVPA 4YPFA 3OAAD 1F7VA 2J0EA 1I32A 4F2PA 2CMHA 4JXKA 4DQLA 1LLQA 3K5WA 1AKQA 4YV1A 1HNZB 2ZUCA 1MIOB 1A9ZA 3AILA 4V3BA 1PTKA 2GSDA 4NZ9A 4A26A 3HCWA 4GLOA 3BDVA 4Z53A 4C88A 2BMWA 2HCRA 1DBRA 1EXWA 3BFKA 3NPAA 4WFQA 5T57A 3FUWA 4X8MA 3VSBA 5IJ9B 2EW2A 1QQ6A 2OT3B 2ZOSA 4M1YA 4QBKA 3ROXA 3ZK8A 5KU7A 5TJ9A 2H52A 2D0OB 4GQBA 4CQMB 2OPBA 3GVXA 4RTLA 3F7MA 2PZEA 2XOXA 2Z3VA 2J31A 3COWA 4G07A 5FPYA 1L7PA 2CHQA 4B6EA 4ENRA 4XVCA 4YRMA 5L51A 4YRKA 3PSHA 1Q6YA 2UU9B 3ANLA 4DL9A 3OZUA 2I4MA 4Z86A 1K0FA 2I22A 1XTVA 2CNLA 3KLPX 4JFAA 1XNRB 1HT3A 4TX1A 5C53B 1NY5A 2H31A 1COWA 2JZNA 3EVBA 3NAQA 5E0KB 4AVYA 3ZXIA 2VYQA 3RUDA 5CNJA 1O6ZA 2FUG1 1DQRA 3Q9UA 3HJBA 1KEWA 4DJDC 3E5MA 4Z99A 2EYUA 3OZBA 1R18A 2FEMA 4JR0A 3VNQA 4HQRA 3BGOS 2CNDA 2A67A 3X1XA 4BV9A 3MCWA 4KXMA 4AKIA 4C0HA 1MW9X 3GCDA 1E9DA 2W6PA 3T9BA 4U63A 4F8YA 1VIAA 3WKDA 3TOZA 5GIPE 1X7WB 1FVFA 5FV7A 4EMUA 2A1UB 4ZI5A 4IIXA 5ES3A 5IC6A 3WLTA 4YMLA 4D3ZA 1BFKA 2ZATA 1F0KA 3TW8B 1HGXA 2VWGA 3C15C 3QKSA 1BHJA 1RRCA 1ZD5A 4PCVA 2B83A 2ECKA 5F3DA 4M37A 4D9BA 4DB2A 3CUKA 1OJLA 2C4TA 2WUVA 1PYOA 4PLFA 3U7QA 3U4MA 4KHPB 1CUDA 1JKXA 2AI1A 4TT3A 3RSHA 3BHMA 4C4YA 5TQ2B 2RGGA 2V6BA 3RYIA 3BS4A 4YO7A 4BGDA 1E0KA 3UMGA 1CUAA 1GPNA 2NYRA 4MR8B 3A4VA 4HWOA 1R8XA 4YIKA 2P3OA 4G89A 2VS1A 2J9FA 4X71A 4HK4A 1QANA 1A9RA 4EZEA 5LWQA 3V2GA 1EB9A 1IBMB 1K3FA 3U48A 4PYNA 2JFOA 3C1OA 3GFPA 3E7WA 2Z6AA 5FXMA 4ZU6X 4U7WA 5REQA 3NQ41 3K3PA 5EJIA 2QT9A 3W6ZA 3L3BA 3V9AA 2O2DA 1H8ED 1BO6A 2UZ1B 2WIJA 1TKAA 1OE0A 3BCUA 3C3BA 3KAJA 1HMPA 4OJYA 3ZD9A 5A3JA 3DEKA 3FMIA 1DV2A 2CZGA 1T2DA 3FDXA 5B1EA 1GZVA 3CRZA 2GTIA 2CFOA 2GCGA 4Q05A 1CQZA 2RFLA 5HFJA 3CKLA 4LK2A 5AVJA 4DNFA 5DE3A 4HNUA 1ESNA 1XQ6A 2QYOA 3L18A 5EEGA 3QVGA 2H2DA 1ADBA 2LKDA 4GOOD 4IF4A 2DXIA 2PGIA 2P7HA 4ARCA 5CYOA 4MYRA 3N8KA 2VF7A 2OQIA 1NAIA 1KMNA 3COSA 4W6QA 5J4YA 1PNRA 3G1UA 2XYPA 3OTHA 1P4GA 1DINA 1TZKA 2G1JA 4UPDA 9MHTA 3OD1A 4WOKA 5DHPA 4GDFA 4B43A 5K20A 3QY9A 5FUQA 3EY4A 2QM7A 1GAJA 1P4JA 3MLAA 4FGKA 2AOTB 3GQBB 4GLLA 4IFEA 1ZI8A 5HRAA 3AEQA 4QEDA 4PLVA 1EKXA 1DKLA 4E5VA 3AUUA 3IMEA 4O2BA 4PIVA 3KCNA 3VYVA 3KT6A 3B13B 2ZS7A 3GUZA 2GZ3A 3LUPA 4FEEA 5AWFC 3WB9A 5ESRA 1P7PA 1VMEA 2G0TA 3LT5A 4QBGB 1FTSA 2P65A 1E5LA 4M1QA 1H69A 5FO1A 1J97A 1OX6A 3PC8A 5ERYA 2Z8YA 3TB6A 1JHYA 2IVFA 4O8ZA 3AB7A 2QSJA 4WWHA 4JJAA 2AFIB 3UKJA 4X1KA 5BWNA 1MVLA 1Y9EA 1GRRA 1VPDA 2VTVA 4JOBA 5HE8A 3AJDA 3I4CA 3SYMA 5IU6A 2WTBA 5M7EA 4ZQBA 3T7AA 2Z6QA 3BZUA 4MRMA 2ZB8A 4CQNA 2JNWA 3KO8A 3KKEA 4BFTA 3I32A 4JSTA 2O23A 2ODBA 4FGWA 4OGGA 3UH0A 1TYZA 1PQUA 2NO1A 1FSGA 2MYTA 3E05A 3T9DA 4Q3DA 3WVNA 4Q3EA 5IJXA 3I8SA 1QYVA 4B3FX 1U0EA 3I5UA 2QVXX 3UM9A 1XD2B 4N8EA 4ESVA 1PZXA 1C7FA 4DSZA 2R6R1 1DO2A 1YT5A 2N75A 2QS9A 1SBQA 2LRHA 1H42A 5J2UA 2CFRA 1WB4A 4DCGA 3PC3A 3R3YA 1BCSB 4DY4A 3DEZA 3KOYA 5AVXA 3TLXA 2C4UA 4V1CI 3KTAA 3N0TA 2ZI4A 5CYFA 1KI3A 2SNIE 4S35A 1BVRA 4MHSA 1KP3A 5BN5A 2NZJA 3THWA 1OB5A 2P90A 2HXSA 1QTRA 3M4NA 2AZ4A 1WS6A 2B92A 3KKOA 4GZ3A 4GM4A 3U4CA 1XROA 1O03A 3C8MA 4M83A 3ILYA 5DH9A 4Y1EA 4HWKA 1OTXA 5K3FA 3ND7A 4WCFB 3GPIA 1AK1A 3PWKA 4DLZA 1EA5A 3QI7A 4GQIA 3JQ7B 2QMZA 4DZRA 2QM3A 5DN6A 4YRQA 5H3HA 4BEVA 3TX6A 2RCYA 4ZAGA 2IP1A 3SD7A 3EDCA 4DEXA 4F5DA 4G4SO 2PVCA 4TT8A 1F5SA 3C48A 5AM2A 3C6ZA 3CRW1 1SCQA 4Y8VA 4ZP1A 2VQEB 4N0PA 2P4SA 4KE8A 5C32A 3DO6A 3PT5A 5H3CA 1ID1A 3JQ8A 5GZ3A 3ZVNA 2PBFA 3M5PA 3EXIA 4Y2UA 2ZBDA 3VRHA 1QLJA 2P4QA 1SCBA 2FMKA 4FYPA 2RGXA 2RGUA 4AF8A 3NBUA 1ZVJA 2C03A 3CGWA 4LEIA 1RKBA 4Y0NA 3KELA 4BVBA 1GPKA 4GC9A 2V55B 3PFKA 1CULC 2Y66A 1AKMA 4MW0A 1VMIA 3ABZA 4MROA 2FSVC 4LMAA 2Z98A 5GJCA 3PLAE 3AETA 1AQ6A 1S1CA 3CVOA 4HZUA 4CLRA 1XV5A 2BI7A 3DV0A 4IJ5A 1W581 2VHYA 2WF9A 1F0PA 3AOEA 1KJNA 1T1JA 2FZGA 3IBSA 5LYJF 2BMAA 2YC2C 3OUZA 3T61A 1ZM4A 3VKHA 5SZIA 1Z5UA 4IDEA 4UDXX 1XQYA 1AURA 1MX9A 1VLHA 1MAVA 1WDWB 1JG6A 4UM9D 4ZJYA 2HMAA 4Z0TA 1Z38A 3WK7A 3ZCRA 5C37A 4WLEA 4WY2A 1SVIA 2ODAA 2B4QA 2EJUA 4V24A 5LN1A 2Z1MA 3LQQA 4F2HA 3KOMA 1FOEB 3PFBA 4HNGA 1RHMA 1ZINA 4GI2A 1ONSA 2H4FA 3ZE0B 3A9UA 5EZYB 3AXSA 1C29B 2WQ6A 3JYHA 5NULA 2CBXA 2WKPA 3MHTA 1UDCA 3WTCA 1DO0A 2H51A 1A95A 3NWBA 4ETNA 2C88A 1GZ3A 3I83A 3I4FA 3CNLA 2Q28A 5FBVB 2XECA 2HWXA 4K6KA 3ZDQA 3ZHOA 3MUEA 3TQRA 4MA5A 1C1DB 3E81A 3CX6A 3MF4A 1FP6A 2JS7A 4NOMA 4JFRA 1SKBA 1W0KD 2F1JA 2XGOA 1U7DA 2NSLA 5AKHA 3JQ9A 4MYUA 1FYVA 1RVV1 3ZKWA 1S2MA 1YF3A 3OF3A 3VH2A 4I6GA 3NT2A 4FFPA 2PUGA 1CQWA 1NYQA 4UUQA 4J7XA 4G4GA 3UGJA 3II6X 2WZBA 2ZR0A 3OZIA 3ECCA 4J1TA 2PBRA 4JC0A 4M0PA 4BMVA 3PNKA 4BKMA 1KXJA 4GMKA 2JFZA 5DULA 1KK3A 2WOJA 3LXRA 1IY0A 3Q3CA 4PPQA 1HFWA 3GGGA 3ZTYA 1KY4A 1XHEA 1G20B 4AC9A 1DIBA 3VXKA 3TFOA 2DM6A 2FPLA 3N5KA 1CSEE 2BBSA 2JPDA 4R2IA 1XNHA 1XDZA 3K0SA 2ANCA 4NE9A 4B31A 1IVSA 4ETMA 2C77A 3DFUA 4GI7A 4F3RA 4ZTZB 3LE8A 4RQUA 2MOKA 1E9BA 3VDRA 1SA0B 1LY1A 3GI1A 4GMXA 1S2NA 4E22A 4LNAA 4ADSG 5CITA 3DEFA 4DIKA 2HWYA 1ZPDA 1WMAA 4CV0A 1ZQ1A 2PXXA 3OM9A 1HSZA 1X1SA 4L16A 4M8KA 4A7PA 3X1DA 5IXSA 3CVVA 1DE0A 2AN9A 3MEQA 3HBAA 4DMKA 1X1DA 1O6CA 1RYFA 1RQNA 4YY3B 2Q2NA 1QH8B 4UEOA 2A5FA 1XAHA 4OA5A 4EKDA 5AHWA 1IHDA 4YYZA 4KO3S 4QDXA 2JIDA 2PSHA 4MVWA 3RK4A 3ELBA 2HLNA 4FXOA 1NOJA 3ZHUA 1E64A 3IT2A 1F2UA 4J0IA 4JB3A 1A2QA 2XB2A 1JIQA 2ZYVX 3FFBA 4R0NA 2PJZA 2WDPA 3GG2A 1GKYA 4N47A 3KSBC 4AJ9A 3MS2A 4R1PA 4HB0A 5BNWA 5JALA 1LJUA 5LA6B 2HSZA 1G5QA 2RHMA 4OHBA 1T4DA 3ANNA 4MMZB 5CLHA 3OE4A 4ZJPA 2WJAA 2BC9A 3I1JA 4LYDA 5A9RA 821PA 2BE7A 4TRNA 3MQ4A 4BTEA 3FG9A 3ZOKA 3Q6MA 1UCFA 3NXSA 2HJSA 1M8KA 4YLGA 5CJPA 1TUIA 4AMBA 4F93B 4HD8A 3MGBA 1EVIA 1OAAA 1TQ8A 1YHYA 3L8MA 2UUAB 4CR7A 1IM8A 2HMUA 3KJNA 1M2OA 2DQYA 5CDFA 3V9PA 2QDXA 3BMQA 4O4JB 3OLQA 3VZQA 1CRPA 1CR2A 1JZTA 1TVEA 3NHKA 5CT5A 4RV9A 1XCBA 1SVNA 3JQQA 4BN4A 2DWQA 2VNHA 3EEYA 4XGQA 5DHQA 1SD2A 1JX6A 4OI4A 4C7MA 5KO2A 2HBRA 1KO7A 4PS1A 5G0UA 3FNBA 2B5VA 2QTGA 1D6JA 2M6KA 1FEZA 3VSEA 4A8JB 1PNVA 2OAP1 1KYIA 4NICA 2PSEA 3NWEA 4P5PA 1JQDA 4N39A 4B84A 4CPDA 5DT2A 1T4MA 3CKYA 4GP9A 3SPXA 3VJKA 4CM9D 5I7FA 3RVMA 1XDWA 3NHMA 1T36B 1HK7A 2W98A 1HFKA 5HCIA 2GXQA 1XZAA 2O3JA 3OIDA 4F46A 4EY6A 4UULA 2GCIA 1GNLA 4ZMBA 4FFWA 2C9DA 3LPDA 5F77A 4RY2A 3ZV7A 3SX2A 1M1NB 3VC7A 1FS6A 4UARA 1FDTA 3CCCA 3UQYS 2YWXA 2V0GA 4UZFA 4C87A 4RADA 1Q2UA 5TF0A 4TTRA 1XCGB 4KIJA 1RRVA 4MS4B 4NBUA 4BO4A 1XKXA 4KAFA 2MSNA 3G2HA 3RHFA 2I33A 1QDUA 2YCBA 1V2HE 1QWOA 2Q45A 3M82A 1P9RA 1HH4A 1ZIDA 3K5PA 5ADUS 1X86B 3KB1A 2VPZA 4I46A 5I8PA 1KZYC 3CURA 4AIIA 4ZYXA 2DWCA 3O38A 1VJDA 4Y6SA 5DJ5A 1RQPA 3UYKA 4YASA 5HJ5A 3KQNA 1C1XA 5HOQA 1L2TA 2PZGA 3HYCA 4BFLA 2OD2A 4GI5A 2OUKA 2PNJA 2XUGA 4CCAA 3GJ0A 5KQPA 1ODIA 4M9XA 4BKPA 4TLAA 3DDSA 4RTSA 3I39X 3D5EA 2AHRA 3RYFA 1Q20A 3B7GA 3W2GA 4TOIA 4KR7A 1A50B 1AU9A 3WNZA 2NV0A 3NXKA 4UOZA 5DIFA 1FRNA 2WV7A 3Q1KA 2QRLA 5BW6B 2AKEA 2PUTA 3RC8A 1C0LA 2QN7A 3E9CA 4ETWA 3W9UA 3IP3A 1GL9B 4DEVA 3A10A 4QYSA 2PL5A 1W85B 3X2EA 4X24A 4LMBA 1FJ2A 1K8ZB 4RKQA 3IP8A 4HXYA 4GXQA 5DEOA 4ZVPA 2V5VA 3EIWA 4X61A 1KY5A 3TQHA 2G9ZA 4LJ4A 2W8BB 3Q5DA 5CPBA 1Y4AE 1VECA 2M1XA 3AOGA 2C2OA 1JXQA 1LV7A 2QRKA 3LCRA 4PC1A 3LX5A 3GZJA 3H4MA 4CYMA 1S3SA 5KVCA 3RLFA 4QODA 4G0PA 1E2EA 3EXG1 3OF2A 4RJJA 3W3AD 1CR4A 2DOKA 4R68A 3KSUA 4YRRA 4TVKA 4DQVA 4PLZA 4XIFA 2I55A 4LDQA 1OFUX 4BNUA 3F9IA 3VMFA 3NM5A 3QK7A 7REQB 1OZ0A 2JLYA 1M1YA 3G2IA 3UUFA 4GXRA 1RWVA 3LT4A 2Z9BA 4OK6A 2B37A 1P2DA 5IN5A 4EDFA 3GJQA 1DTWB 4TS9A 4FYKA 3ZCQA 5JPCA 3HJUA 1E9VA 1KQNA 2ZJZA 1R0KA 6REQA 4EJ0A 2GBIA 5CYGA 5AVRA 3PGLA 4OA8A 4YJGB 5JY6A 1IEQA 2CVOA 3GJYA 5KDOA 4MOWA 4GLJA 1FSSA 4EHIA 1D9XA 5EMMA 4PPGA 2FW7A 5I45A 5I9LA 3CX3A 1T5LA 4KO2S 2GPAA 3RNOA 1G2OA 2J9XB 1ENYA 4Y2QA 4AJNA 4ZGGA 4C6TB 2PUHA 4EKEA 4HWTA 1QLWA 2FE1A 4YI3A 4AQDA 1D4ZA 4M8SA 1SZDA 4RHEA 4ENPA 5J4VA 2BP7B 2PMCA 4RGBA 2IYXA 3CLRC 3HZHA 1T0JB 4ENTA 1OZFA 2OG2A 3ASVA 1IY9A 1CCWA 3L92A 3OIYA 1B23P 4O25A 4HXGA 2ERCA 2R8BA 4OKSA 4RF3A 2QA5A 3W4IA 1W36B 1QCYA 1CPYA 3V8RA 4BUCA 4G4SP 3HY6A 1WB5A 3UV6A 1N92A 2VP5A 3PF9A 3H9JA 4E3WA 4AP9A 5EE0A 1F2TA 3CRMA 4E0BA 1GGFA 2MSDB 4FR0A 3ZXXA 2IE8A 3OQ1A 1IZ0A 2JFPA 1IZ9A 1E5XA 1AKRA 3ZTTA 5EUQB 4E70A 3O2NA 2G1PA 4WT7A 4H1UA 1W4ZA 4GVLA 3ENQA 1S4MA 4Q1CA 2IODA 4XR9A 4IIUA 2AJCA 5JSQA 5JTTA 3N2ZB 2H8GA 1BX3A 3NAGA 4BZWA 3B6MA 3MJCA 1ICIA 3P7MA 2Q4TA 5T4BA 2Q5QA 4GVXA 3RQSA 2EWVA 4DIBA 2ZIXB 3EZGA 4I19A 1WKCA 2EBHX 1Y6RA 4RQAA 4F5YA 2UYHA 3NHYA 2HPZA 5EXTA 1NNUA 1H85A 2IIQA 1EFUA 2JCGA 2GOYA 3ZCXA 1Q92A 1IN1A 1M1XB 4MVJA 5GZ6A 3NVKI 3QNWA 4Y9RA 4DJEC 4FQ8A 3NBMA 2OAQ1 4N48A 1O95C 4AT1A 4D79A 4IVNA 3C41J 1D7AA 1V8BA 3MM4A 1WDLA 2BFOA 4IOKA 4L3OA 5D6NA 3FOBA 5E3IA 3TZCA 4ZDJA 221PA 4RQBA 3I01M 2WP8J 3OM8A 3FVQA 2C7BA 3HXKA 1SR8A 1V0JA 2LVBA 2Y2UA 3EGCA 4OG2A 5LMCA 4DZTA 2BSQA 1ST3A 2UZ4A 4DWWA 1BRTA 2V4MA 2Z2YA 3A31A 3CUEF 3RSQA 4B7UA 5HTOA 3O84A 1C7QA 1P3DA 2X9NA 2XB4A 4Q66C 1H5NA 4POOA 5KX5A 2ATEA 2HOQA 4MULA 5DHFA 2FEKA 3U4DA 1PZNA 1X70A 5AK6A 5AM0A 1N5MA 1GSOA 1IONA 1TF2A 1UPCA 4IICA 4MO9A 1W52X 2GEBA 3PTZA 4HNQA 3H5NA 4N6OA 5THQA 2RHHA 3RTGA 3ZK7A 4BVJA 1FSZA 4B47A 3TZQA 4RH1A 1Q0TA 1BD3A 1FRFS 3FD8A 3D8NA 4MI9A 5JCZA 5JQWA 4G56A 1WHSB 1W0JD 2Q7XA 2CHVA 1QBKC 3U0VA 1O9HA 1Q7RA 3QXXA 4YJ3A 1NPDA 1RQRA 2GX6A 5A0FA 5JDCC 3DVQX 3SG0A 2I76A 4G5SA 1P18A 2FSHA 3W5VA 4BE9A 3U39A 1ZJ6A 2WF5A 3KQLA 5IRCD 1HEUA 3ODGA 3KR9A 3SFVA 2FPXA 4BASA 2CXTA 4IWYA 3BMOB 2GXAA 4BP3A 2VRCD 4HZIA 1GCOA 3LKVA 2B5OA 4EFDA 3QF7A 4F71A 2P77A 2E37A 3CF2A 2IDMA 3IOMA 5JJIA 2JGDA 2P9HA 2ZJ3A 4E33A 4RSMA 1SVLA 3OT5A 4WGGA 4CDRA 3BJIC 3I3OA 3DTNA 1PT7A 4TYNA 2HJHA 2PUFA 4A0FA 3UMRA 5H16A 2H9AA 2ZETA 3D7LA 1YQEA 2XTNA 4XFKA 1Y4ZA 2R7KA 5LQNA 1RJ9A 2YOGA 4X1OA 4XTRA 3PNSA 3C5EA 4RM3A 2D0DA 1FJGB 4B3IA 1QKIA 3TMKA 3W06A 1VCOA 1N2OA 4ZCTA 5CB8A 4RULA 1ZN9A 3QIAA 3U9TA 4OQEA 4YWJA 4AN0A 4YUAA 1PCXA 1WLSA 1NHGA 3A9TA 1DIHA 3B5IA 4L50A 1SCUB 2EKQA 1FRZA 1B41A 2NP7A 5CB4B 2A9PA 4MICA 4EEXA 3RUAA 2V9CA 2QG4A 4R81A 5DM70 5IVHA 5LQSA 2H1WA 1FUUA 1T5IA 3ZHZA 2VL7A 2WSLA 3JWEA 2ZZMA 2OP1A 4GOLD 4MK4A 1G7CA 1E8DA 4ZA2A 4WBNF 1E2PA 3DW3X 3S6JA 4N9WA 2VF4X 1X38A 2IGTA 2NO5A 4KXUA 5AQEA 1AN9A 1C7RA 5H5JA 3RTDA 2H54A 2H2AA 1NJ8A 2Q1UA 5ER9A 4XOIA 3RKSA 3V8QA 2PX0A 1TNDA 1LXCA 2A0UA 4URWR 1XHLA 3DE1X 3DZHA 3PKZA 4LPKA 5CNKA 3BIOA 4EPRA 3O9VA 1KI4A 4OGFA 2IV7A 2IHZA 3EH1A 4I5IA 2YS6A 5IAEA 1CDDA 4Q4LA 3OCZA 1JPJA 3RVKA 5ADHA 4RTQA 2ZRMA 5FKJA 3TIFA 4DILA 3U7HB 1P2BA 4QHTA 3O8DA 3ADPA 4KQXA 5AVYA 2Z30A 2W2LD 5AK0A 4CCYB 4M0MA 4KZPA 5MDHA 1WOMA 2CDCA 1DXOA 3WIUA 3LO8A 5I48A 4M1EA 2OSVA 2BW0A 3AHEA 4WUVA 3EXG2 4UFOA 4XUEA 1HX7A 2PJRA 5F2EA 1NW9B 1OH6A 4MS3A 5HZHA 3COYA 4FE4A 1XVIA 4JUBA 4XGNA 3RSOA 4BDTA 1T4CA 2BH9A 2PJDA 2EW1A 3ZR4B 1YZVA 5B6PA 2G40A 3I9MA 4IXWA 1PFVA 3K4PA 1E7SA 1EA7A 4OQNA 3VR3D 4QWMA 1VIYA 1R6XA 1XTJA 1IRIA 2IX9A 3OCWA 1K2VN 1HF3A 4K9LA 1TPZA 1ZUNA 4IQ8A 4KX5A 4MGZR 2IXBA 1NM5A 2XIJA 3EUFA 2XHZA 3M4YA 1WO8A 3DCYA 5E4YA 2HNKA 3M33A 3VYWA 4UDNA 4E88A 2QLFA 5HJEA 2VQ3A 4D4IA 2I65A 2PZKA 4F4FA 1OAOA 2W6ZA 5F52A 3EXFB 3IE0A 4AKSA 4EEZA 1YQQA 1ZSNA 1H9AA 1NMQA 4FFNA 4N0DA 1RP1A 1OYOA 3MJHA 5JNLA 3MTDA 1FDRA 4FN5A 1L4YA 3CB2A 5DX1A 3T41A 4ZYLA 1I7LA 2P6RA 1TK9A 4GUDA 3GA7A 1PK7A 1V11B 5LLDA 4MQLA 4ZYVA 3L6OO 5JCOC 4BV3A 2ZCJA 3NGMA 1T9AA 4OQYA 4DDKA 2ACKA 5JADA 3QEMB 5LIPA 3IAS1 5JS6A 2PZFA 2WU0A 2ZSIA 4LSMA 3TCXB 3QPUA 1T2AA 1EWKA 3BA6A 4KIGA 4NIMA 2QPLA 3BQMB 4M1ZA 4QBTA 5DYNA 2JANA 4BN0A 2B82A 3QMMA 5K0EA 4U7DA 2PUVA 1M3SA 2XR1A 3A2KA 1HYBA 4OEHA 5TE9A 4YACA 4AG3A 2CNWD 1EZZA 2J08A 5DSZA 3OIVA 5CXQA 5JC1A 1XQWA 5JAOA 2P75A 4BO9A 3P5SA 1DRVA 4HT3B 4B3SB 3NHUA 2PX2A 2JGMA 5BNZA 1K4MA 3JWIA 1U2RA 2ID8A 5IDVA 1FSPA 1ZSYA 3F4KA 3M8KA 3ILSA 3NWOA 3N8GA 3OOWA 4Z9XA 2NU8B 4CLOA 1DC7A 4X3OA 1AQNA 4DG5A 1YOBA 1TGYA 2P9CA 3BORA 4LJ8A 1E2NA 1HT0A 3WIEA 3OLYA 1JG4A 4JVLA 1H6AA 4F4IA 2IDJA 1D2NA 1O0SA 3B9QA 4XARA 2Q7OE 2C4WA 1Y5RA 2P8SA 3KZKA 2JZCA 3DOIA 3H1FA 2IYZA 4MI3A 3SU8A 1SVKA 4AULA 2ZBPA 1VE7A 1JBQA 2PR7A 3JD3A 4COKA 5B1SA 1N25A 3AKZA 2ZUWA 2ZI9A 3MAGA 4N0MA 5T7BA 3FOCA 1KH1A 3JVIA 3KQVA 2ID4A 4MHOA 3RRFA 2I1WA 4HFNA 3ZE2B 3T7CA 5GONA 4Y2HA 1TCAA 3ZLBA 2ZS8A 2ZBVA 4E11A 3WQQA 3KQWA 5C46F 3E9NA 1C0EA 2X4IA 3MWGA 4UEKA 2MR6A 2FZCA 4PO9A 5EJEA 2I9KA 2I4OA 1D1SA 1NVFA 2DETA 4WERA 1DX4A 4W9RA 5DKFA 5DTEA 5ESWA 4Q4AA 3AKDA 4BFVA 2HX1A 3G02A 3GOHA 5H9WA 1JBKA 1II8B 1JLKA 1UJMA 2H1HA 1FFGA 1TJYA 2ZRIA 1VPVA 3OZAA 3TSOA 4C4OA 1ZCAA 2W6JA 3DOUA 4Q1VA 4W9NA 3WGVA 4NZYA 3SZLA 1F6BA 4MVXA 1KMHB 4MWSA 3TLEA 4B82A 3IXLA 1R9MA 4ED9A 1AH2A 1A8SA 1WM1A 1HDYA 1Z0JA 4CF3A 3W4KA 3FR7A 2B8NA 2D8MA 2FUKA 1GUAA 3QBEA 3BH0A 2H1IA 2O5VA 1R6DA 3FGPA 3V46A 1JB9A 2JRLA 4Q1DA 5FULA 3CTMA 2PS1A 3HCRA 1BDIA 2F43A 1WSDA 3LZ6A 4WY5A 4AUMA 1FXSA 2XJ4A 3OWOA 1NI4A 1TUBA 5CDFE 3JQAA 1Z6TA 3CVJA 4R3NA 3ZCUA 1SAYA 4C3ZA 4TWZA 2PT5A 2HEGA 4M60A 4P4NA 5CVVA 5HW0A 1RJWA 1AHIA 1D9ZA 3SX4A 1C3JA 3I2YX 3UJBA 3KAQA 3KT8A 3OURA 2P67A 3N3AC 1U0BB 2VNJA 5TC4A 1EFPA 1IOWA 1F3LA 3LUFA 5CA1A 1HTWA 1FTWA 2P6MA 1UAAA 2P2GA 3E5NA 1RNLA 1RMTA 4UASA 2R00C 2WUGA 4HAYA 1S3FA 1JEQB 3I64A 3TUZC 1Q3HA 2LUOA 3NCTA 3U13A 1YXMA 4A0GA 1DUVG 3UMCA 7MDHA 4MO2A 3OJ0A 1SULA 4LOHA 3HKBA 2ZTLA 1BQ4A 3FCCA 1OI7A 1XUOA 1C9MA 1RBYA 4YUVA 2EKDA 4D0NA 4FDMA 4REQB 3HRIA 1USGA 4QFMA 3L84A 4F9EA 1XF9A 3IBTA 4H6WA 1NC1A 1Y7IA 2X2PA 4E08A 4B71A 2G04A 4O2AB 2C8LA 4HDKA 1PSWA 4D3FA 4KHZA 4YNBA 1JYEA 3FKSA 2G83A 4LBWA 1DZ3A 7YASA 3KPVA 2HPAA 5DN9A 3JD0A 3U3KA 2DGDA 3LUCA 2FZ4A 1NG1A 1SQSA 2F9FA 1SRRA 2TMGA 3RVPA 1AQUA 1TYBE 2YIVX