4X93A

Crystal structure of lysosomal phospholipase a2 crystallized in the presence of methyl arachidonyl fluorophosphonate (tetragonal form)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
376
structure length
376
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Group XV phospholipase A2
total genus 128
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x93A01
1G42A 4XVCA 4UBJA 1FSSA 5AK6A 1J2EA 4RE5A 1AX9A 3WKAA 4UHFA 1USWA 5K3EA 2WFZA 3WZMA 1QIIA 1XQXA 3RK4A 4C4XA 2HA7A 4MJ3A 1CQZA 3ZV7A 3V1LA 5C81A 3JW8A 3C5VA 1XRLA 3R3WA 4J0KA 3S8YA 2O2HA 2QS9A 5E2IA 4OPMA 5E4YA 2Y2UA 3DOHA 5LZ9A 2Z8XA 4H77A 5ALRA 5IKXA 1HDEA 3HRHA 1SFRA 4Y2VA 2WG0A 3MVEA 1X70A 3QPAA 4BVJA 3FNBA 2PSEA 4DMKA 4U2FA 1CR6A 5YASA 2XMQA 4A5SA 1BN6A 2HRQA 2YXPX 5T4HA 3H17A 5JAOA 4Y2RA 1HL7A 2WIJA 1VLQA 1CUEA 3PF8A 4QE3A 2VJCA 5CT4A 3WWPA 2OCIA 3A2LA 2H7CA 4F60A 4PV7A 4RNCA 4BB0A 3ICVA 1G5FA 1L7QA 4P9NA 1ORVA 2PPLA 2WUFA 4N8DA 5JD6A 2G4LA 1DX6A 4LYEA 3H2KA 3RKSA 2YH2A 2XMRA 4MQMA 4WCVA 2XMSA 2BGNA 4AQDA 2VJDA 2B61A 4KE9A 3FYUC 1XFDA 4BYMA 1Y7HA 2BFNA 4B9EA 1QTRA 2AJDA 4X94A 3E3AA 2WG1A 2O2IA 2XUFA 3I28A 2GYWA 4LYDA 4QDOA 1QFSA 3H19A 1YB7A 3C8DA 4DGQA 5AI9A 2ZVDA 4H7HA 1XQYA 1P0MA 4K2AA 3FLBA 4Q05A 1GT6A 3MUOA 4QDZA 4QEKA 3N0TA 4LXGA 1XKTA 1N5RA 1QO7A 3M83A 1ZIXA 2JBWA 2PM8A 3LP5A 4BC1A 1K4YA 2PSJA 4N8SA 4GLBA 3IUJA 1EVEA 5T4BA 3ZLUA 4QLOA 5ALQA 5EHZA 2VJAA 5LZ8A 3NWOA 3HYSA 5JADA 4FOLA 4G4IA 4W1RA 1SCIA 1XRQA 5CT5A 3HI4A 3BJRA 4BVLA 4CCWA 4AZ3A 3F67A 2WFMA 1ODCA 1TK3A 4PQEA 1XLVA 2OG1A 5AKLA 4DSZA 3AFIA 5LLSA 1UKAA 3FVTA 1QIMA 3DKRA 1EH5A 1TCAA 4B81A 1VA4A 5AM2A 4Y2PA 4KACA 3W2TA 1JMKC 2IIVA 5AKHA 1MN6A 3FYTA 4H7IA 1QJ4A 3ANSA 1TIBA 5C8VA 1F8UA 2QXUA 1CUFA 3PFBA 4OSEA 2QKYA 1LPPA 2ZJ7A 4N5HX 1JU4A 2XUKA 2CEKA 4AX4A 4CG1A 5DNVA 1FFCA 1UOQA 3D59A 3UMJA 4AZ0A 2BJHA 3JWEA 3R3VA 2XLBA 3A2NA 1VE7A 3DS8A 3FLEA 5DTIA 4ZRDA 4Y9SA 3DJYA 2XQJA 5ALPA 4H35A 1N1MA 2B20A 2QTBA 3AZQA 1QE3A 5K3DA 1VA5A 1W76A 2R8BA 4I4CA 1A7UA 3I2GA 1QIGA 3FWHA 3BE8A 1ACJA 2PSFA 5A7FA 2WUEA 2JGIA 2WLSA 1EK1A 4LIPD 2YASA 3FBWA 5A7HA 2WUGA 2G5PA 2JGKA 4FLEA 3AJAA 3I2FA 4KRXA 1S8OA 5ALGA 3HACA 1N5MA 3HXKA 1MAHA 3BIWA 4H18A 5E4JA 2RGUA 4X00A 3M81A 4FBMA 4B0PA 2R11A 1VXRA 3OM8A 4B82A 1XZLA 4G1FA 3W05A 1WOMA 4IH9A 4F5ZA 4HRXA 5AM3A 3WWOA 2IX9A 1L7RA 1U4NA 1HQDA 4WY8A 5H3HA 1ZD3A 1N8SA 1XLUA 1ZGCA 5LP1A 2I3ZA 5AKXA 1PFQA 3G0CA 4QLAA 3HLKA 1WB6A 3D5EA 3O9VA 1WM1A 2HFKA 1IUNA 5HFAA 5AOCA 3DYIA 4ZXFA 4W9RA 1FJ2A 4MQLA 3H18A 5D6OA 1IUOA 3BDVA 4KJXA 2ZJFA 1YSCA 1L7AA 1WPXA 4B0OA 4AO7A 3QYJA 1AC5A 4H7EA 1RP1A 3O0DA 2FX5A 5JAHA 2WM2A 4BC0A 4BZZA 4QZVA 1U65A 3AIMA 5DNUA 3WYNA 1A8UA 1SCKA 2OCGA 1GQSA 1TRHA 1JMYA 2HU7A 2OGZA 5CMLA 2AJ8A 4B80A 3OTQA 4L9AA 5K3BA 3WL7A 4X93A 3K9BA 1JU3A 3C5WP 2WJ6A 2VAXA 1XROA 4MEAA 1THTA 2C58A 3CCCA 3QMVA 4U2CA 1U8EA 3FLAA 5J3JA 3X3HA 3WK6A 1CUYA 3S2ZA 4OB6A 3BIXA 3KSRA 4OU4A 3Q8WA 2BUAA 3O95A 1UWCA 2AXEA 1EB9A 1OILA 4KYVA 1K63A 3V1NA 4J0GA 3QMWA 1Q83A 5FOQA 3L1JA 1TCBA 2H7YA 5JASA 1B6GA 3I2JA 4OYLA 4G8CA 4BP9A 1DT5A 3DOIA 5JIBA 1XQWA 1LBTA 1CRLA 4B84A 1WHSA 1CUWA 2WTNA 1CFJA 1J06A 2OGSA 2HL6A 2PUHA 2XQGA 3IUMA 5AH0A 2Z3WA 4QWWA 3FYUB 3H2JA 3R41A 2HA0A 4IH4A 5KREA 1GGVA 3W9UA 2G63A 1E3QA 3M82A 2X76A 3V1MA 3PICA 2GBCA 2WIKA 3K6KA 5K5EA 1IUPA 1T4MA 2WILA 2OAEA 2WKWA 3SK0A 5LIPA 5ALTA 1QLWA 3TGLA 1W4LA 3WI7A 3SC2A 2AJCA 5AOBA 3W9BA 5ALXA 1EVQA 5AKEA 4V2IA 1O6FA 3KWJA 4U2DA 2AJBA 1A8QA 1UFOA 4YX9A 2ZJ6A 1DINA 1QIJA 1XZJA 3IDAA 1UT6A 2OCLA 5FXMA 3G7NA 1G4HA 1OCEA 5K3AA 1JJIA 3P2MA 4W1QA 4LXHA 4J7AA 3R3YA 4H7KA 3QPDA 1W75A 3WK4A 5EIHA 1EHYA 4G4GA 1QZ3A 3UUFA 2VJBA 1CUGA 1MTZA 3VISA 1LZLA 1YAJA 2ACKA 4UBKA 4Y2JA 1EDEA 2J3QA 3A6ZA 3WMRA 2WFLA 3WK7A 1EX9A 3UUEA 4EUSA 2QZPA 2H9YA 3D0KA 3C45A 2HU5A 5AIBA 3O4HA 5LKAA 4H7FA 4ZGBA 2GBFA 2GYVA 4N5IX 3WA6A 4U2EA 4WY5A 2CMFA 4ITVA 4EBBA 5C8XA 3OPMA 1UOPA 3DD5A 4JEIA 2PL5A 3DYVA 4IO0A 4Y2TA 1ETHA 4OB7A 1BRTA 2DHDA 3IUQA 2XUDA 4BCBA 3WKDA 5ALKA 2HIHA 1W52X 1HKHA 1EI9A 4I19A 4FNGA 1XZIA 5LKRA 5CT9A 3AIOA 3EF3A 4LKOA 1F6WA 2GYUA 4KEAA 4MEBA 4HXFB 4UFPA 3B5EA 3WK8A 1AUOA 3VJLA 1LPBB 3T4UA 2DQYA 1CUIA 2B4KA 2V96A 2RIPA 5EHQA 1C7JA 4BRZA 1VOTA 4O08A 3IIIA 5A6VA 4YK7A 5HQ3B 2XMCA 3I6ZA 1A88A 1R9NA 2Y6VA 5ALOA 3WWCA 4C87A 3W04A 2O7RA 3ZI7A 4M0FA 4DIUA 5FPPA 2XUAA 3OOSA 3VKFA 4OYYA 2Z8ZA 5IH7A 2WHPB 5ALHA 2BAGA 1W1IA 3IBTA 2VSQA 4BVKA 1UK6A 2PUJA 4Y2UA 2XMBA 2XUGA 3HC7A 4X91A 1XQVA 1MX9A 5K3FA 3PDCA 2X5XA 4WFJA 2XUOA 2W6CX 4KR0A 2PKYX 5CXUA 1IMJA 4QDUA 2K2QB 5AKJA 1DU4A 2X8BA 3R3XA 4JYPA 4UBIA 3QITA 4Y7DA 1H22A 4GHWA 3FCXA 4CG3A 3LIIA 4Q82A 5ALFA 5K3FB 5EHXA 2Z5GA 2OCKA 1R4ZA 2D5LA 2HA2A 2VTVA 1XRNA 4UUQA 1GPKA 3G9XA 5ALIA 4G5XA 1CUUA 1J1IA 1LPMA 5T4EA 2GZRA 4IQ4A 1DQYA 5LZ4A 2PX6A 1HPLA 3O9MA 1O6GA 2Q0XA 4DNOA 3C6YA 2QVBA 3G0DA 4J03A 5DWDA 4FLFA 4S0XA 5FUMA 3GUUA 2HHAA 4FDMA 2HDWA 4AN0A 1ZD5A 3CN9A 3O4IA 2XUQA 3I2KA 3PUIA 3T52A 4LXIA 4BTLA 2XLCA 3I6YA 2XE4A 2QUBA 1GQRA 2XUIA 4OCZA 1XRRA 2CB9A 2I03A 2HA6A 3HEAA 5DLPA 4XIIA 3RARA 1BN7A 4Y2XA 4AN1A 1H2WA 4TGLA 4Q3KA 2VATA 2XMGA 5HF8A 5JD4A 2NW6A 1CUJA 1P0PA 5FRDA 4FHZA 2XQFA 1IVYA 1XKLA 1KU6A 2ORYA 4UFOA 1WHTA 3F8SA 4FWBA 4C01A 4ZREA 1B41A 2FJ0A 6YASA 5AKZA 4CCYB 3IULA 3AILA 1QTIA 3EQ7A 2DFPA 3ESCA 2HADA 1YA8A 3H1BA 3DL4A 3R40A 2CZQA 4X92A 1UKCA 2ES4A 1BEZA 4INZA 3V1KA 3QPCA 1SC9A 4XWGA 1NU8A 1QIKA 2HU8A 4FLMA 4HVTA 2V9ZA 2YYSA 5FLKA 1MX1A 1TQHA 2WQZA 4UBLA 4EA6A 4DNQA 4WFIA 2BKLA 1PV1A 4B83A 5JAUA 2PBLA 3GA7A 3CXUA 1G66A 4K6KA 1GPNA 1RWQA 3OURA 1YS1X 3E4DA 3TJMA 2FUKA 3I6MA 4QDXA 4GWLA 3L1IA 5HZGA 3LLCA 4ZV9A 3G0GA 5E4TA 1BE0A 1XRPA 3G0BA 5HKBA 3NOXA 5SYMA 3WLAA 3I1IA 2WUDA 4ETWA 5A7GA 4FFVA 5JZ9A 2H1IA 4BE4A 4BE9A 3W06A 5HK8A 5C8ZA 2VF2A 1CUBA 1CUXA 2C0QA 4UHCA 1VZ2A 3WKCA 2XB6A 3D2CA 2OXEA 1W6RA 4GW3A 5AO9A 4B6GA 3HJUA 1E66A 1DQZA 2BUCA 5CBKA 2OAGA 4UHHA 1E8MA 5HFNA 5CT8A 5CT6A 4XX1A 1JJBA 3VVMA 4XJVA 1VJ5A 2DHCA 1K8QA 5ALDA 1EXWA 2C5GA 1CUZA 3ZPXA 3FAKA 5A2GA 4KAAA 1EB8A 5DYYA 2JF0A 3CCBA 5CH8A 5IVKA 1UK8A 1CEXA 5LZ2A 3WL6A 5HK9A 2ZSHA 1PJAA 5I7UA 2QMQA 2ZYIA 1EK2A 4B7ZA 3C8HA 2ZYSA 3QBJA 4BATA 1EINA 2ACEA 4ARAA 4IHAA 1YCDA 3ESAA 3WA7A 4CIAA 1BS9A 3WK9A 3KDAA 3U0VA 1THGA 4YPVA 1TAHA 5LYYA 1NU6A 2W22A 5EHNA 1CUDA 1YA4A 2ROQA 1JT2A 3BF8A 3IUNA 4QDTA 1K5PA 4AO6A 2JGMA 4KE7A 4OD0A 2HM7A 3GZJA 2Y2VA 5HF9A 3D3NA 4PW0A 4F21A 4AO8A 5CRIA 3AZOA 5KBYA 4MWSA 1JJFA 2WHPA 4J0JA 1F0PA 3G9TA 3K2IA 4X85A 5DJ5A 4JUIA 3TEJA 1XZDA 1FFAA 4BCCA 5ALYA 1YAHA 2OQIA 5AK3A 3VXKA 3H2IA 4J0HA 3OG9A 1TKRA 3HABA 3U1TA 1E5TA 4B9AA 4AMYA 4UPDA 5IVDA 1DWQA 1XZAA 3BF7A 1Q0RA 3BWXA 1QOZA 5EGNA 3WZLA 4C88A 4C6HA 1ZD4A 5DNWA 3KOOA 4Y2QA 3ZLTA 2HA5A 1AKNA 1HLGA 1XZHA 5BV7A 1ZJ4A 1SCQA 1GKKA 1DWOA 4DM7A 5LZ7A 3AINA 5DYWA 2JGEA 2J3DA 5ALSA 2XQIA 1MJ5A 5JZSA 4BTVA 1X2BA 3DL7A 1QFMA 2DSNA 3HSSA 4B85A 4A23A 2PSHA 3R3UA 4EB0A 4C89A 3STWA 4P92A 3D2BA 4BZWA 4K6GA 1VXOA 4DMFA 1EDDA 2CKMA 1C7IA 4X71A 5AIAA 1GXSA 5ALVA 2EDAA 3FOBA 2C4HA 3G8YA 1GZ7A 5HF5A 2O7VA 3AIKA 4ROTA 4NMWA 4QNNA 1ZIYA 3G9ZA 4FBLA 2B9VA 4AXBA 3BL8A 5D3ZA 4TPKA 5AK4A 1D07A 2UZ0A 2JGJA 2BUBA 3STVA 1LNSA 2PVSA 5AI4A 4J0DA 3MUNA 1ORWA 2J4CA 3B3QA 3QH4A 4U2BA 4NS4A 4RPCA 3F97A 3V9AA 1EA5A 2OPHA 1Q0ZA 1ZGBA 2QJWA 1UXOA 1JFRA 1MT3A 4HZGA 3AUKA 1DTEA 2Y6UA 4M0MA 3EBLA 3H2GA 2VAVA 1JI3A 1UZAA 4K6HA 1BEEA 3KWFA 1J07A 1ZI9A 5AM4A 4BRSA 2WHQA 1H2XA 3C6BA 3FSGA 2GZSA 2JIDA 2C0PA 1M33A 2RHWA 5AI5A 4UBOA 3LCRA 1ZOIA 3F96A 1YASA 2DCMA 1XZCA 3WIBA 2EEPA 5AI8A 4GECA 5AM0A 2XQKA 4HRYA 5D3KA 4ZI5A 2WTMA 5ALZA 3AZPA 2HFJA 2DQZA 5DYTA 4EY4A 2CUTA 2I3DA 3DKKA 5ISMA 4IH1A 3WKEA 4WDQA 4MYSA 2QXTA 1P0IA 2QRUA 2VT7A 4ZWNA 2XT0A 3HZOA 3EQ9A 3A70A 4PSDA 5AK5A 1AURA 1WB5A 3I2IA 4DNPA 1AMNA 4J3JA 4OB8A 4KRYA 1UOOA 5AP9A 4CG2A 1LLFA 2PU7A 5ALLA 4DYHA 5AOAA 4QA9A 3H0CA 2IITA 4GXNA 4GBGA 4UHEA 1LPOA 2Z3ZA 1CUAA 2QT9A 2P8SA 2WIDA 3G02A 1CUHA 2WJ4A 5ALWA 2ZSIA 2JGFA 5JD5A 4KAJA 1VKHA 1QO9A 3IB3A 2ONCA 1IZ7A 2OGTA 4I3FA 4K5QA 4OU5A 5FPQA 3C6ZA 5CXXA 4HAIA 3WJ1A 1E8DA 1CIJA 5AKYA 5EFZA 1EDBA 2RAUA 3BDIA 3MGAA 4A16A 3M3DA 2V97A 4CI9A 3ZLVA 2VQ6A 1CQWA 3H1AA 5CH3A 3DQZA 5FDFA 3DNMA 1XZKA 2JGLA 3RM3A 5CW2A 3WWDA 3D2AA 2D0DA 5CURA 5SYNA 1A8SA 4PO3X 4Q3OA 3RLIA 4BDSA 2WIGA 2XMDA 4W1PA 3EQ8A 3IA2A 5AKKA 5JZBA 1BCSA 4Y2SA 4M0EA 5HF6A 1DX4A 1R88A 3CN7A 3BJMA 5HKAA 4BDTA 4PSCA 3C43A 4G9EA 1F0NA 1MNQA 1FFEA 5JARA 1CLEA 4WDRA 5F4ZA 4DMHA 3R3ZA 4E11A 1XRMA 4D9JA 2Y1KA 4J0IA 1QIDA 1BROA 3DEAA 3LS2A 3FSGD 2XDWA 2QR5A 3ESBA 4P93A 1Y37A 5HQ3A 5ALMA 1LPSA 4FTWA 2LIPA 3G9UA 3H2HA 1ACLA 5A71A 3I1YA 3QMMA 1GKLA 1H23A 4Q1VA 3WWEA 4GI1A 4FFWA 4CFSA 2WJ3A 3ED1A 4Q34A 1VE6A 1ZICA 5BOVA 3O4JA 2OQVA 5ALUA 2WHRA 3IVMA 5JAPA 3V48A 3FCYA 4H7DA 2G5TA 1KU0A 1NX9A 1MPXA 1QIEA 1XLWA 2V98A 3WYDA 4G8DA 1Q84A 4EY5A 1R9MA 3DLTA 1TCCA 4DSAA 1C4XA 5BWCA 2WSLA 1XZEA 4GDMA 4MWTA 3KXPA 4L72A 4FMPA 4X7BA 4AMZA 5KWJA 2OLEA 1KEZA 4JYMA 4UHBA 3DDUA 1MU0A 1ZJ5A 5AI0A 4KE8A 1AGYA 1R3DA 1K6EA 4FKBA 3IURA 3WQHA 5JANA 4HXGA 3R0VA 1LBSA 3ANTA 5I9IA 1CPYA 2WIFA 2C5FA 1MX5A 2JEYA 3FVRA 5AHXA 4F0JA 4OUKX 4JH0A 1U2EA 4N8EA 5A62A 1MAAA 5ALEA 3SX4A 3PFCA 3ILSA 5JALA 5AKIA 2WU3A 2WU4A 3STYA 5JATA 4DMCA 1YB6A 2ZYHA 2RI6A 3WIOA 1X2EA 1GPLA 1DWPA 5FKJA 2QM0A 2VEOA 3WJ2A 1XZFA 4CCYA 1XZMA 1ZI6A 3LIPA 4MYDA 3F98A 4PNZA 5LZ5A 2DR0A 2VT6A 1BU8A 2HRRA 5D7BA 4PSUA 5BWBA 4X97A 4E15A 1WB4A 5FP0A 5DTJA 1I6WA 2PU5A 3F9CA 5ESRA 1FFBA 4Z49A 2RHTA 4HTAA 1ODTC 1H2YA 1P0QA 3FYUA 2GBGA 3SWWA 4W63A 2O2GA 1LZKA 3STUA 4ZV7A 2QOEA 4LHEA 1MNAA 4EHBA 2I78A 4G4JA 1WPRA 4H0CA 4L3WA 5AI6A 3ZWQA 3WKBA 1CUVA 4P08A 3D4LA 1UK9A 4Q3LA 1UKBA 5CH5A 2ZYRA 4HS9A 1LGYA 1XZBA 4NZZA 4QWMA 4DLNA 5AJHA 1CV2A 3E0XA 5AICA 5FV4A 5I8PA 1ISPA 1E8NA 4FNMA 1SOMA 4C4ZA 5AKGA 4J0CA 3OC0A 2H7XA 5K3CA 2GBIA 1LPNA 1IZ8A 5IVIA 5T4FA 4UHDA 1DT3A 4DTCA 3GBSA 1FFDA 5EIAA 2RONA 4BCDA 5EIEA 4L0CA 2XUHA 4HXEB 4BAGA 2AJLI 3QZUA 4E46A 3PE6A 3C70A 5AM5A 3D7RA 1ODSA 4NVRA 3GFFA 1H2ZA 2BGRA 2WFLB 1Y7IA 3NGMA 1XZGA 4G9GA 2QJRA 4BAZA 2ECFA 4X6YA 3ICWA 1CUSA 3EIOA 3VJMA 1QIFA 4BBZA 3L1HA 1T2NA 1MO2A 1YR2A 3PUHA 4H7JA 7YASA 3JYHA 4GEGA 4EY8A 4EY6A 4X6XA 3G0IA 4UFNA 2CBGA 1AZWA 4DNFA 3A2MA 4G8BA 2DHEA 4YASA 3WL8A 4ARBA 1VZ3A 2HA4A 5HCUA 1R50A 3STTA 2XUPA 1OXMA 1RYYA 2EDCA 1E89A 4W1SA 4C4YA 1BCRA 1AQLA 1LPAB 1ZI8A 2E3JA 5JYCA 5KWIA 3KD2A 4E14A 3B12A 5CTAA 3BXPA 2VA9A 3NUZA 3WL5A 1QIHA 3GELA 3WK5A 4PF1A 4RGYA 3C87A 4BP8A 4EY7A 2XMZA 4X95A 3QM1A 5EI5A 5ALJA 1QGED 4WJLA 5IVHA 4EZIA 4TVKA 4KE6A 2J4FA 5C7YA 4AB1A 3PI6A 2HA3A 2WG2A 2BCEA 3DCNA 4WFKA 4KAFA 3VJKA 2QUAA 3H04A 5AM1A 3TRDA 2XI4A 4X6UA 1CVLA 1CUCA 1WCYA 3O4GA 3PF9A 4X90A 3YASA 1HBJA 3VDXA 4MXDA 3Q0TA 4UBNA 4RE6A 1Z68A 2FJPA 3E1GA 2JEZA 2XUJA 1UK7A 3QVMA 4JNCA 3ESDA 4U2GA 4BAUA 2PSDA 4Y2YA 3I2HA 1ZD2P 2C7BA 1YS2X 3STXA 3VVLA 5ALNA 3C6XA 4UBMA 3N2ZB 3GROA 1QONA 1R1DA 2CJPA 4X3CA 1JKMA 4CIBA
chains in the Genus database with same CATH superfamily
2W71A 3UMCA 5K0NA 1FQJA 3PDHA 1N3YA 2E18A 4HZIA 1BQ3A 4M37A 3SHOA 4RE5A 3HGMA 3AMVA 2PYIA 1K8YB 5H7XA 3WKAA 2D1FA 1USWA 1EJ6A 2HWKA 1RJGA 5F4BA 5GV7A 5K3EA 2PD3A 2ZYGA 2Y27A 1XQ6A 4NZMA 2F8MA 3CPHA 2D7JA 2EW2A 2BD0A 4JBNA 3BFJA 2H18A 4KC0A 4MI1A 2HA7A 4JEMA 3VR6H 1NYLA 1CQZA 3WBBA 4QO7A 3CEPB 3ZV7A 4EHHA 1SRRA 4YJ3F 3LBYA 4TRRA 4V0RA 2X5NA 3ZNOA 1L4EA 2O8FB 4REMA 1ZMXA 1Y3IA 5FOVA 2C31A 4AKGA 2HEGA 2WT9A 3MFQA 1SA0B 3LFUA 4QL3A 1ZZGA 1XRLA 4L1KA 3PC2A 4ABYA 3CBQA 4J0KA 2O2HA 4ZVLA 2DZDA 5F98A 3UJAA 1RHMA 1SOUA 2O20A 3E8SA 4OPMA 5JVDB 4GPD1 5B3LA 4G0VA 2R48A 1U8FO 3VPSA 2VDKB 3DB2A 5LUAA 1W96A 1JQAA 3GLIE 3CLRC 4NV3A 3PPWA 5LZ9A 1PU2A 3HU2A 1G8GA 3LLSA 4YI5A 3GA0A 5JPDA 2C2OA 2ZTUA 4JT2A 5ALRA 3F6BX 4Q3AA 1WCIA 4OHCA 2MR5A 1PUJA 3E5NA 4QQKA 3I3SR 3LYUA 2ZB7A 3KQOA 3DMTA 1U1CA 2COEA 4M36A 4Q3NA 3CZAA 4IUDS 4KK3A 1SFRA 2NPFA 3SE7A 1X9GA 5ILQA 2WG0A 4P7KA 2VSXA 1JUDA 1UANA 3KCQA 4HLUC 3RUEA 2W2QA 1GDHA 3EXEA 1P1KA 1ZKDA 3UXYA 2PGLA 1WEKA 3QU2A 3HFGA 3QPAA 5DGTA 1UC9A 4JP8A 4K9OA 5EE9A 2HZ7A 1LWOA 1J9EA 1K5GA 8LDHA 3EFHA 1SVUA 1XGKA 2G5GX 2X1MA 2RE8A 3OEWA 4TLAA 2KBFA 3DDWA 1G16A 2Y71A 1JB1A 1T5HX 1C9JA 4LSGA 3B51X 1OGIA 2P6OA 3L0BA 3G5TA 4M0PA 5KDDA 2Q5HA 4K1LA 1XVTA 5K9ZA 1R18A 3CLUC 1O7JA 2JA2A 2VBGA 3NT4A 3NPMA 3T0GA 5K05A 3HSYA 3FTFA 2Q6LA 3SJUA 1MB9A 1MZVA 2BRUC 2PLAA 3V8QA 4AF6A 5MN5A 5KOYA 1ODLA 4YR7A 2YXPX 4UNQA 1YE8A 5T4HA 2FI1A 3DL0A 1EHIA 5JAOA 4AG5A 2R96A 3SBOA 1IAQA 1JI0A 4IIBA 1LS6A 1Z8HA 1JDUA 4J9VA 3QI7A 4B79A 4MDFA 3I8SA 5IWCA 3O31A 4J16C 1UAAA 3A2LA 2Z43A 1DXQA 3FDZA 1B8OA 1O4VA 3RS9A 3VO2A 2CE2X 4F60A 1M2VA 4PV7A 3FNFA 5I9TA 3NBKA 4BB0A 1ZN9A 1G98A 3AP3A 1SB9A 5FI5A 1R8QA 5FBLB 2JKZA 2QPTA 1ORVA 1UJ5A 3FHCB 2O23A 3H8VA 1HYHA 2V7QD 2PPLA 3IAS6 3WHIA 1Q95A 2ZUFA 4GYWA 4JKIA 3R5KA 2V7EA 1LJ8A 1PDOA 1DX6A 3BZWA 4LYEA 5TMEA 1W6UA 3H2KA 2VK4A 3RKSA 2XF2A 2D0PB 2QVCA 1KFEB 2YH2A 4OUDB 4DV2B 2XMRA 3RF6A 3TQTA 3ZE9A 4UE3S 4F5EA 5CBPB 3ZBUA 3G7SA 1STOA 1B42A 4NU5A 1ZVKA 3A9TA 3G1UA 3DE0X 4W5HA 4WCVA 2VJDA 5B2ZA 4XD2A 3FSEA 5IYZF 1RBQA 2XGMA 1FCJA 3OQHA 4GPAA 4ZJUA 2YJZA 1UBUS 1BFDA 2ZIAA 5I6DA 4WVFA 5EJ9A 1BD3A 221PA 3KUXA 4ZYUA 2C83A 4BYMA 2J32A 4PSVA 1EESA 2EHDA 2LE0A 1V95A 5G4KB 4QDKA 2I8LA 1ZXXA 3LUGA 4OYRA 1KGDA 1QTRA 4DN6A 5IJ9A 4TZ6A 1YI8A 2ZETA 3GARA 4OQNA 3E3AA 5IW8A 1VHDA 4GS5A 2IGBA 1S2IA 4E6EA 3EPKA 2O2IA 4JLBA 4MQUA 1KDZA 5ED4A 1EUZA 1MV5A 3FR7A 2WVAA 4WBNB 1TEVA 1XDZA 3L06A 5K1ZA 4D44A 2B99A 2OMEA 5AJWA 1EGMB 5B64A 3RHSA 4DCMA 4WV3A 3WE7A 4LYDA 2Q6VA 4S1NA 1QFSA 1H2HA 1NN1A 1LKZA 3TNFA 1W85B 1I7PA 5H9WA 3CE6A 1JTFA 1FUEA 2GFIA 2QTWB 4H7HA 1XQYA 4YCBA 1EVYA 2AUNA 2I1WA 2FUCA 1JPVA 3GBVA 4NK4A 3OX2A 5EIFA 1Y3AA 3MUOA 5LBTA 4KUEA 1T3HA 4GX0A 5AVTA 3R9WA 4HQ0A 5JYDA 1YJCA 1C3LA 1CRZA 3DHEA 1XKTA 1NVXQ 1P2TA 4LXGA 4YJGA 1P4AA 2QP3A 2W6MA 1P62B 2XA1A 3UQYS 4HZUA 3M83A 4YAFA 1ZIXA 4MGYR 2H3EA 3A7EA 3W4IA 2EJTA 3PI7A 2RGCA 2ZTLA 3FNEA 4JB8A 4QG3A 1NXSA 2Q3HA 3TW0A 1DE0A 2L17A 3RROA 3DV2A 1OE0A 2LV8A 2PG3A 2PSJA 4C5CA 2IF0A 4UOZA 4RKWA 2EBFX 4JD5A 4N8SA 3S2GA 4EEZA 4GLBA 5H8WA 5C8ZA 5GOTA 2VQSA 2VL7A 1Y4UA 1EVEA 2XE7A 3HLYA 3OUZA 4ZO7A 2P75A 4FIDA 1QCCA 5GQSA 1QHFA 1KZ7B 5IAEA 2QHXA 2B98A 5LZ8A 2FGJA 1A9XA 5JQGB 3GOHA 4CTOA 2D3WA 4IYJA 5COBA 4Z4FA 1RRVA 1NF8A 3IUSA 2IIPA 3Q2KA 1JU9A 4C2BA 2ZK7A 1NUPA 3H8JA 1JWBB 3RR2A 2SICE 3CZMA 3O3OB 1CK4A 2OB2A 3OU2A 1BIFA 1KI3A 2KSQA 1PJCA 1PD0A 2PMCA 4JJAA 4E51A 4XB1A 5CT5A 4BVGA 5A06A 1W5TA 4BVLA 5E2BA 4XWTA 2W6QA 2I8CA 3EAFA 5IMBA 2WPDA 4C4PA 1XAHA 4LX0A 4URWR 4JZKA 5FOTA 1ODCA 3E22A 4LX8A 2AVDA 3KAJA 4FGUA 4RK6A 4YP0A 1XLVA 1GFZA 2OG1A 3RHTA 3ZTYA 1GPJA 4CT5A 1GQFA 1UP6A 4DSZA 3KBOA 3OCVA 1T4GA 1N34B 3PPXA 2NT4A 2BFCB 4HQOA 1XC7A 4RPIA 3U4AA 1MABA 5IDWA 1E2BA 4XAQA 1G3QA 5BXYA 4QU5A 3TRFA 4F4DA 1QIMA 4CEIA 2XZDA 1EH5A 1TCAA 3I6BA 4INPA 5TMBA 3MJRA 1FDIA 5C1OA 1V8PA 3OJLA 4WNCA 4JROA 4L16A 3C7TA 3AF1A 2WWGA 3QE0A 1VIMA 4EEKA 2QRNA 3M4ZA 1GPWB 1IB0A 3L07A 5JISA 3LOUA 5B6IA 4WACA 4EM6A 1P2UA 3NRCA 1JMKC 3K09C 2IIVA 5AKHA 5F3DA 1NPDA 4MK4A 3LQYA 1LDEA 3BQNB 1E1YA 1EFAA 3K0EA 1OB2A 2X8LA 5A05A 4A10A 4DYDA 3MBOA 3WNZA 2VQDA 4CQJA 5BRJA 2PX4A 5ESXA 1EX7A 3MSXA 1TK2A 2BEVB 2X9VA 3UB4A 3WL3A 5CNMA 3WBJA 3U44B 5I4CA 4BEVA 5B12A 2YHUA 1E0KA 1L3CA 1P6XA 3U7IA 5KEIA 2QNIA 3A1VA 3ZQJA 4Z4GA 3F6EX 2EQAA 1ZJZA 4CF5A 2Z2KA 5KNBA 3DO8A 1L4UA 3FRJA 3ZGXA 4L4RA 5DEOA 1PBNA 1O5IA 1YZYA 2IHJA 2PCLA 1RP7A 3DSRA 2PQ0A 4CV1A 2XUKA 5C51B 4ZCTA 2CEKA 1E7SA 1Z25A 2OV6A 4UJ3A 5B1DA 2XCUA 4LYGA 5DNVA 3HKEB 1ZK0A 3ND6A 2YWFA 4B2IA 3HDJA 3NUQA 2XCOA 3WHPA 5IAAA 4JI2B 1UOQA 3E15A 3WMEA 1XX6A 4DMRA 5BR1A 3GQBB 1JYSA 2I2BA 2O8CA 4RS4A 4YMUA 3UMJA 2ATXA 2B2CA 4OGWA 4LRWA 1H4QA 3FN4A 3VAZA 4RBNA 1FJXA 3AVXA 2ADFA 3UT6A 3AOEC 3PEFA 4B3JA 1BHO1 3VPGA 2HQ1A 1CD5A 3TF5A 5HMMA 4K7JA 3UG7A 4DUYB 4Y9SA 2RK4A 3IH5A 4MW7A 4C1BA 1KYIA 1IH8A 3TI7A 1JLMA 4FE3A 1D6NA 3AF0A 3V7WA 1Z7EA 3DDZX 4LDZA 4EP1A 1BH2A 3GP8A 2P0AA 2JBAA 4X24A 3KQMA 1VFPA 1KEEA 1QE3A 3WNVA 5IZ4A 4LSMA 2IZ6A 3R4CA 4B6QA 5KNCH 4I4CA 1MB3A 3EXFA 1MX3A 2QIPA 3GAMA 3FWHA 3RRNA 1GL7A 2CW5A 2XAUA 3AEKB 3DEZA 3OJ0A 3KTOA 4MZDA 4Z7OB 3ZDDA 4GZ6A 3NKFA 2PSFA 2GLUA 5HJ5A 2FWIA 1MDFA 5A7FA 4J7UA 2JGIA 5IKEA 2QRLA 1R4NA 3CRRA 4LHZA 1XA3A 3QVGA 4L7QA 4J2TA 1Q77A 3H97A 1QRRA 2VT2A 3K73O 4GL4A 4JLAA 1YQWA 3CIOA 4LIPD 4D9MA 4DW8A 4XRGA 3KR2A 1Y5IA 4XA8A 2ZIXB 2PGJA 4KRXA 1W5AA 4KGZA 3FHLA 5HW0A 1Z33A 5HIMA 4BX9A 3S27A 4P0PB 5ALGA 3HXOA 1DTWB 1QYRA 3K05A 5T3UA 1C9EA 3HACA 4C7JA 1F2UB 2EFCB 4XIJA 3BIWA 5A4JA 2O7QA 5LLDA 2QDKA 2IS4A 5TVGA 2WU0A 1SBYA 2FW9A 5E4JA 2ZAGA 2FAXA 2HMVA 4Q93A 4Q1CA 4QBFA 2QZ4A 4LHVA 4QLBA 3GFPA 3VR6A 2ON6A 2C9DA 3BMXA 4EHNA 3DVLA 1CF4A 3C7KA 5H4HA 1SY7A 3M8KA 4OLHA 3M9XA 3MJFA 1F1BA 4TKZA 2JIRA 1WMAA 3SS9X 5KTRA 2HMSA 1PWZA 1GG9A 1VXRA 3CF2A 1RCFA 1R4NB 2F90A 2CFOA 3L7KA 1GG2A 4IRXA 4BEWA 1SKMA 2GJ9A 2NYUA 1NE2A 1RHUA 2EFJA 3C5CA 1W7AA 1MAWA 5H16A 3I23A 1ZAKA 4TMZA 5TQ2A 1GGFA 3NAZA 3RIYA 1WOMA 3W05A 4YRMA 2C1XA 5BNIA 1EFRD 4AP5A 4IHJB 1YUNA 4XOIA 3WRYC 1BC5A 4IKEA 2IX9A 2C5AA 3WGJA 4KX3A 2P9FA 4ZZ0A 1H2FA 3WBFA 3EDYA 1O8BA 4WY8A 2AUMA 1XD8A 2P9YA 4C7KA 3N0WA 1QP0A 4S12A 3T9FA 4KCGA 4JB0A 5M29A 5L9AA 3RS5A 1NR7A 4NYJR 1QZZA 1TUBA 3AEUB 3FH0A 4CCAA 5LP1A 2I3ZA 2PXCA 3LYAA 3O73A 5AKXA 1PFQA 1UXHA 1CVIA 3G0CA 2F1HA 1GUZA 3HLKA 3UK1A 3ZE7A 4CL0A 1I0IA 4JVSB 4RFSB 2NPIA 3CWCA 1ES9A 1KS9A 3ER9A 2JATA 4EJSB 1FYFA 1GCOA 3ABSB 4PR0A 2QAGC 2I34A 1IUNA 2P4HX 5A04A 3K0CC 3K16A 2YZ2A 2QUZA 1Y1LA 2J5KA 2R8XA 5AOCA 2E49A 5HSGA 1XVAA 3KOWA 2G04A 2ZROA 4NJEB 1S9HA 3FIJA 4W9RA 1FJ2A 1QPGA 5DIFA 4EMSA 3H18A 1RI4A 1IUOA 3BDVA 4KFSA 4LSZA 4KJXA 2OO5A 4JC8A 4LGMA 4Y6RA 4PGHA 3DT9A 4WK6A 4YQFA 5I7VA 1C7EA 1V45E 1AKQA 1XHEA 2IXDA 3K31A 3QJYA 1NXOA 2IOYA 1QYIA 4PGMA 5FL7A 2FLKA 4OVKA 2ZUTA 3DVRX 1AD2A 4AO7A 4I0WB 2WMNB 2WJYA 1D03A 3LY7A 5DM2A 1VSVA 4E09A 1T8PA 1T2FA 1Q2UA 5IT5A 5LMCA 3H42B 1NV9A 1ULTA 5E6RA 4RETA 4ZYWA 1NW8A 1USUA 5EGSA 4E12A 3FMIA 3ZDZB 4ZK6A 3AIMA 4RTRA 4ENPA 5KSPA 5HJ2A 5DNUA 5JVDA 3T3GA 3FUUA 5IXSA 3DZ8A 1RW4A 1GQSA 1TRHA 3AKCA 3PFNA 1XAJA 3NHMA 2OGZA 1Y7LA 2R86A 5CMLA 4EB6A 5HP4A 2AJ8A 1BWRA 5F35A 4ZHQB 3O8RA 5HKOA 2C2GA 3O3MB 3OTQA 3NWJA 1YBHA 1QLJA 3UK6A 4B2PA 2HCJB 4LF8B 1W94A 1NVMB 3OQMA 3DTVA 3L4BC 3QU9A 5K3BA 1Y5RA 1Z37A 4IZHA 4YRBA 2GJSA 2BGIA 1T4DA 3K9BA 5B37A 1VIYA 3UM9A 3RADC 4X44A 1JU3A 2H63A 5DSZA 1FLDA 4Y0AA 1RZ3A 2F8LA 3C5WP 1BDIA 1EFLA 2JJ2D 2TSYB 1S6YA 3I30X 5FR1A 4EA7A 4F93B 1W0JD 5EIWA 2DY1A 1MBZA 2V8OA 3BAZA 1FTGA 4YMGA 4TYWA 1XJWA 3MMPA 1K4KA 3P71T 4RADA 4TLMB 1GGHA 4D3FA 3CCCA 3K0CA 621PA 2CJXA 3UH1A 1KNQA 1Z4OA 2F4NA 3L6RA 4WX2B 4CLOA 2CWDA 1WQ1R 1WBJB 4ES6A 4OB6A 4IMIB 4KYTA 4RF5A 4EG5A 2BFFA 5HUJA 2REQB 3PK0A 2B34A 2I5PO 3P9SA 3MILA 2R47A 3MUEA 4GLJA 3QU7A 3EQZA 4ACBA 2VSOA 5EQDA 5EKXA 3L7OA 2JFOA 1H4SA 2PT9A 4CKCA 1U99A 5BN5A 3ACCA 1YQUA 1MA0A 2MSLA 2UYGA 2HRZA 3FWYA 2JASA 1UWCA 2HBZA 1YZLA 5AHKA 3U3MA 2AXEA 1EB9A 3NCTA 2R5NA 1F2UA 2X41A 5C18A 3NO4A 3PV0A 2J8ZA 4M1MA 3WXBA 2FEAA 3RC2A 4U3JB 1HV8A 3GJRA 5CEJA 2O3RA 5ICGA 4J0GA 3A6JA 3K92A 2HCTA 4M8NE 1WV0A 3FFWA 4N6OA 4Q3BA 3WGZA 4RDHA 1YDWA 3L1JA 3H2SA 5C0OE 1IWOA 1KMCA 4Q7QA 1B6GA 1KRHA 5ITSA 2WWYA 4HB2A 2QRQA 3NP7A 4YJHA 4OYLA 2GAIA 4CLRB 5AVJA 3ZXYA 1P8AA 4TV8B 5KPJA 3BK1A 2H2GA 3DOIA 4RCZA 4OXQA 5JIBA 4GGPA 3EXHC 5LDHA 2NZVG 4B84A 4NBSA 3IL2A 3AW9A 4EG0A 1CUWA 4UREA 4MVJE 3KVNA 5TGZA 1D04A 3OM9A 3N5CA 1OB5A 1KEEB 2HHLA 2HNKA 1J06A 2QJFA 3IUPA 5B4UA 2G36A 5KOJA 2OGSA 1I4OA 4L6IA 1HEUA 4I1YA 2EXXA 3GNLA 1EDOA 2JVJA 2BL4A 1UBKS 4XUEA 5KQMA 2P1DA 3M6FA 3AGQA 4W5WA 4MUYA 3CSSA 1K06A 3O47A 2H07A 1RE0A 2GEJA 1NA5A 3M3HA 2O0HA 4UMFA 5CVEA 4RF4A 2BF7A 1OROA 1Y82A 1M66A 1GRRA 1RHRA 1PJLA 3QK7A 4QWWA 5AH0A 3PLNA 3TUZC 3NIBA 3P2OA 2GCEA 2LW7A 4MKGA 2QGNA 2WWTA 3LLMA 4XCQA 1FMTA 3KUKA 3W9UA 1U0GA 4EG8A 1RFLA 3M82A 1EZ1A 2EFGA 4CXMA 5IX8A 4E7PA 5AXBA 1Z4QA 4BO1A 2QVGA 3E23A 2VNKA 2GZ1A 1MVOA 1USVA 2F9MA 3LY5A 3N76A 4CCYA 3L7JA 4O2AB 4QGHA 3TSCA 5K8CA 3U3OA 3OD5A 4KPYA 1UPTA 1Z45A 3RUHA 3PHLA 2WKWA 3THYA 5DI3B 3JARB 2FEOA 4ZARA 4B76A 3WWZA 1HC7A 2YJ5A 2Q3CA 4RIGA 421PA 2ZJ2A 3LX6A 2EX1A 3WFJA 2OC9A 3A0RB 5BRNA 5ALTA 4F3RA 2XD4A 4C0WA 1FE8A 1QLWA 1U04A 3EIWA 3EXG2 1EFVB 4FIZA 4HEQA 4OG2A 3Q5GA 2YZMA 4QOGA 3DE5X 1IOWA 3O3NB 2V55B 1JFLA 5ELLA 5F1KA 1O89A 3EZ6A 3LP8A 1WB9A 2RHMA 3SM3A 3JD1A 4KFCA 3ZE1B 1RXIA 2VNHA 5AOBA 3W9BA 4JY7A 4KSCA 5IUJC 4ZD6A 1XDBA 3OX1A 4D3XA 1T26A 3IT1A 3QX7A 3R7WA 1MT0A 1F60A 2ZT7A 4J1TC 4B7CA 1YRBA 3DDHA 4X64B 4ZN6A 3NHPA 1A8QA 3K9NA 5K6RA 4TLDA 1JG4A 1JLLA 2MWMA 4R1LA 3ZN2A 2I1QA 5C80A 2UYQA 4F97A 4MLZA 5A5FA 2R85A 5C4MA 1QIJA 1K97A 3DBRB 3G89A 1XZJA 3OPYB 1OD6A 4Q9LA 4NXMB 1P2GA 1ZESA 2PGOA 4PHCA 5DXJA 4JBGA 3EE6A 3L2OB 1YHZA 2P2ZA 2QTFA 4JKYA 4K0KB 3WLQA 1N7JA 4QVGA 1GUYA 3ZCTA 3P2MA 2HTFA 1N6KA 2UXDB 3K6JA 2V0CA 3E5RA 3KUCA 3R3YA 3KHUA 4H31A 4L07A 3CEMA 4ALMA 3GXBA 4IIUA 1O0CA 2P3SA 3B7WA 3D6TB 4I81A 3BWMA 1NW3A 1JS1X 3MJSA 3R6WA 3JQAD 2B4TO 4H4CA 3PUZA 2HDOA 3O1LA 1QZ3A 2YUTA 4MA0A 4DR1B 1G2PA 4CEIB 3ESQA 3U16A 1CUGA 1KI6B 4NE2A 1P9LA 4CUKA 4UZSA 5IJZA 3GH1A 1KQNA 1KGSA 3BE4A 3KUUA 4Z3OA 1LJLA 4J9UE 3BEOA 3CLVA 1SHKA 3C3JA 3ETJA 3RYHB 3OZVA 3UG6A 4AN4A 4B3RB 2JPDA 3VKGA 2OYSA 3NLLA 1EDEA 2UUPA 1LVUA 4K0RA 4AL4A 3WMRA 4UTOA 5EHGA 4Y98A 2QB5A 4OQLA 3V8RA 4UATA 5E6UB 1SXJD 5HILA 4MRMB 4FFBB 3CUUA 4GMKA 3UUEA 4C4AA 1CX9B 5I4IA 1NRIA 3DMYA 4X61A 2H9YA 3H84A 3EOAI 3FGNA 1AVTA 2GD1O 3LVRE 5KHAA 1BA3A 1DVRA 1YJAA 4HFNA 3S4YA 4HVLA 2B8TA 2IUSA 2BFAA 4OV6B 1KQGA 4PCUA 4EHKA 5LKAA 4BJ1A 2Q4BA 1AUXA 4F2HA 2GBFA 4D79A 1FJGB 1Y4AE 2KBEA 2VDOB 4UPVA 3S8MA 4ZZIA 5C35A 3C1UA 1GP2A 4KNWA 5F77A 1K08A 1RADA 1X8XA 3INYA 4E31A 3E9CA 3QKTA 4YHHB 1XVIA 1U2RA 4X41A 1BKDR 4R1MA 2CE7A 4B1FA 1ZC3A 3EG9B 1UOPA 3KQYA 4K9KA 1I7QB 1K86A 3CRNA 3RWBA 2VJLA 4LOHA 4F1KA 2RGYA 4YR9A 1M0EA 4D9BA 1FU8A 4Y67A 2BISA 1E0AA 5C34B 4BIIA 3GT3A 2AFIE 4OB7A 3TSAA 5JSUA 4ZDIA 4K26A 2B8JA 1X3SA 4ZTBA 4FT2A 1BJKA 1RU3A 3IUQA 1J09A 4UM8B 2YW2A 1FU7A 4L6CA 3QXHA 1HNXB 2Q1WA 1YV9A 2IXAA 5HGJA 2ZXEA 1H8ED 1TZKA 1UEJA 3JATA 4D92A 1G8SA 3LCJA 3NBYC 2QX8A 4O02B 1W52X 5BN5B 4DUZB 1DTWA 2GK4A 3CZ9A 2ZI6A 4I19A 4J1NA 1E6LA 4JJZA 1RWXA 4M22A 2VXYA 3BCHA 1XZIA 2Y9PB 4FNGA 3SD7A 2GPYA 4AF7A 2GAJA 1EHCA 5A3JA 5C7IO 2A0FA 4CM3A 3EXFB 5BUZA 3ETEA 2WYVA 3AIOA 3O8OA 4I50B 4ENWA 3UPDA 4LKOA 3RVDA 2C9BA 1O4WA 2OV2A 4XH9B 4IJWA 1A0OA 1JIJA 4NARA 2IGTA 3KD3A 3KEQA 4NQZA 3B5EA 4Y0VA 2WICA 1UBLS 1QO0D 3LAWA 1E6EA 3QWFA 3R6GA 4GC9A 4WD3A 4ZAXA 1Z36A 4PO9A 4TWRA 3ROXA 1TEXA 2RG7A 4CG0A 2XCSB 2H08A 3PXGA 3HJFA 5G1PA 2AHOA 1P5RA 4EG1A 1NN3A 3PITA 1YZTA 5JZOA 5L3ZA 5JZMA 3H13A 1NOJA 1O1YA 3DMPA 4KXFB 1PYGA 3WLPA 4TXMA 2ZJ8A 2KJQA 5EHQA 2D7CA 3QIAA 3R7SA 4NBKA 1B1AA 3JASA 3DZGA 4JI6B 2GN2A 4EECA 3B3JA 1VOTA 1JFFB 2YMMA 5KYUB 1E3WA 3GLHB 1T9ZA 4F3KA 3E53A 3I6ZA 1A88A 1R9NA 1Z29A 3B6JA 1YQDA 3BGVA 4LQLA 2VTBA 1SCUB 1U1DA 4IWXA 1Z34A 2NU8A 4WLVA 1CYEA 1TW3A 4OLFA 5FOWA 1NURA 1Q21A 2H1LA 5FBZA 1NY6A 1RQLA 1U2ZA 3B82A 3BB1A 1KOFA 2PRYA 3I5AA 2ZCUA 4KFUA 5IH7A 1KBZA 2CL7X 1Q7BA 1Z88A 2FH5B 4HLCA 1NVEA 3HBFA 4R9VA 4EG4A 1SXIA 3E9DA 1W1IA 2GXAA 3HHPA 1L5LA 1AGXA 4YGYA 1OFUA 1XTTA 5C8DA 4YROA 1ZJYA 4EB3A 5LIRA 3IBGA 1UBTS 5AUNB 3SYMA 1DRJA 1KJNA 4Y2UA 3RUAA 2PKXA 2XUGA 4Q9IA 1A9XB 4TZKA 4I55F 2ZRKA 1E69A 3FA2A 4L0DA 2R7LA 1Y0BA 5JJ5A 2XUOA 2W6CX 3IBYA 4P86A 4TWJA 4HUTA 3ZUPA 2Q2NA 3KJIA 3LW8A 1JWAB 4EX6A 2RHRA 2YNMC 3DT6A 3JQ8B 4FMBB 5ESDA 5BYBA 3VH4A 4BJ6A 5E2AA 1YBMA 4EJSA 4US1R 5AVQA 2QVZX 5ENZA 2BEWB 2OHJA 1Z2AA 3CX3A 3EHDA 1SRQA 4RXUA 3WAKA 2XBLA 1HDRA 2WNIA 3GEPA 4G26A 1E92A 1NONA 3R3XA 4BMSA 1E3IA 1ZEJA 2D3TA 2J48A 5EP3A 3FOAA 3LXMA 4Y7DA 1TQ6A 1H22A 3WMWA 3VZPA 4J6EA 4AURA 2ODPA 4B3IA 4YQEA 3QWBA 3EUEA 2V6FA 3OO0A 3RUDA 4LGCA 1HUQA 4C76A 2GRAA 2JI9A 3NAMA 5IFLA 3Q3EA 4YS6A 4A2WA 3NDPA 3PL5A 4Q9JA 1KR5A 3NS7A 2X19A 3GNTA 1DCFA 1XRNA 1A5TA 2XEDA 4MMZB 2HF7A 4DJJA 3ZDCA 4OFZA 1OZAA 1RMTA 1FEZA 3W5BA 1KVUA 1NUAA 1HT0A 2ZJ1A 4XJXA 2GEDA 1NVAA 2HWUA 3C3YA 3L8FA 3C3CA 4G5XA 4U0JA 4DHEA 2IVFA 2DWOA 3SY8A 3OWHA 4N3NA 1NMSA 3MOGA 3OECA 2WHXA 4FILA 2J0EA 2IL1A 2RKBA 3W7BA 1UDXA 2CXPA 4P7BA 3TBHA 3MLEA 3AHFA 1EP3B 2GD0A 1EM6A 3R76A 1CY7A 1C3XA 1BOOA 3DBHA 4H4EA 2DUUA 1DQYA 1W4RA 5DX8A 3SSNA 1A95A 1SUCA 1G19A 1HPLA 3THRA 1FMLA 4JR1A 3OTGA 1BCSB 1R6BX 1RYBA 2QN2A 3R9KA 2N1MA 3GGJA 3CW9A 3TVTA 4BHTA 4YDQA 3K0HA 1E2IA 3C6YA 3C1AA 1SKYE 1IATA 4ZHQF 5JYEA 4E94A 5JXJA 1HI9A 5E7QA 5EJIA 3X1YA 4S1OA 4EHLA 2HHHB 2B4YA 4DMGA 2DUWA 1L5FA 1I5RA 1O95C 4S0XA 3V34A 3OIUA 4O59O 1F0KA 1U98A 2Q3EA 2HHAA 3M6IA 2HYIC 1NT2A 2QX9A 2R6FA 4GLLA 5TQ0A 5JV5A 2VVTA 5C4IA 1W29A 4F8YA 4G09A 3BSFA 4UU1A 4PSKA 4Q19A 1M0TA 1VCHA 3VO1A 9ABPA 3I9OA 3EUAA 3W7AA 3U80A 4HAYA 1E64A 4LXIA 1ABBA 4CF6A 1TF7A 2WF6A 3N7TA 1XCOA 5LWQA 1G6Q1 2R87A 3NT2A 4RY9A 4JC0A 2O8NA 1V3TA 4TTJA 3U2QA 4CMEA 1V4NA 3FNQA 4JOBA 1SG9A 2ZBGA 4Y6OA 1U9CA 3DH0A 1ADFA 4PE5B 3HWWA 1TOAA 5LFAA 5LQKA 1E5XA 3WFZA 2IYUA 1BN7A 3COYA 1KO1A 3CRMA 4EYOA 4Y2XA 3OFNA 3DAHA 1W49A 5JI2E 1IEXA 2JFWA 3ONEA 5CA0A 4QYIA 4G0QA 1D1SA 3PFHA 5BPFA 1U8TA 1RLTA 4TGLA 2D00A 2VATA 1E1CB 2BTOA 4HUQA 5J5AA 3W2EA 4WT7A 3VNUA 1TO6A 1YOBA 2JLBA 5LN1A 4ITUA 2HJSA 4H2DA 3IRUA 2Q9AA 4JLJA 4OI0A 3EY9A 4M7WA 2YOHA 1PG2A 2HW8A 3G8CA 1IVYA 2VLIA 3ST7A 4EG7A 1MRSA 4INAA 3F74A 3IB6A 2D1QA 1KU6A 2X2PA 2RB5A 1JR6A 3I9V1 2H1SA 1YIDA 5JXWA 1JKJB 5AUQA 1WXEA 3I0ZA 3PC3A 3UMYA 4M98A 1SKAA 1TCUA 2I4RA 3HQ4O 4ZREA 1KZ6A 4YLYA 4DSTA 4YUYA 5L4SA 5EKUA 4WHMA 5DBGA 5LB4A 4I6JA 1CP3A 1Z83A 4Z8XA 4XYEA 3G5MA 3QVTA 4MUXA 3CONA 2HHJA 2YN2A 4DJFC 4DLKA 2GK6A 1SUFA 3QEBZ 3FWKA 3LA8A 3ZBPA 1G20A 4IJ6A 4LE1A 1Y80A 3LPMA 3EMVA 1QTIA 2BZ1A 2WRZA 4K6FA 4UAGA 1V41E 5BV1A 1T0BA 2EZTA 3A04A 4JJ6A 2VH2A 3TQRA 3HDTA 3QFHA 4RD6A 4IJVA 3PT9A 2OE2A 5KX5B 3L7AA 1PL7A 2QPLA 2J3IA 2YCLA 2Q2VA 3R3HA 4DIDA 1MR3F 1ZRHA 3F4KA 1YA8A 4N3GA 3S5UA 3VR4D 4NBWA 5BN3A 1U63A 4JB2A 2QL5A 2BMFA 4M9SA 4QGSA 1ZC4A 3KAPA 3DMFA 3F46A 4G3XA 5FX2A 4EO4A 5JEDA 3NIGB 4QGAA 2G08A 1CULC 3FR8A 4HEHA 4RMHA 2JARA 5J2UA 1Q7CA 4RLSA 1RBYA 3VOAA 2XYHA 3KJNA 1Y8ZA 4R0MA 4LF5B 1QIKA 3I8OA 4L5JA 5EINA 5CLHA 5COQA 2ZJBA 3GOQA 1TXGA 4PYKA 5FLKA 4GQIA 4RV4A 1DOAA 1OZFA 4JIMA 3USES 2C7PA 2WC1A 5HTOA 1DO0A 1GKIA 1URPA 1W19A 2XNDA 2WUWE 4MNTA 4UBLA 4Y1FA 3OY2A 1Z7YA 3U40A 1G4AE 2GWHA 1LV8A 4N40A 1GPH1 3E5HA 5KYKA 121PA 3EFBA 2C42A 4LE0A 2N1BA 4N3BA 5SZIA 5JAUA 2HF2A 4JP5A 4MGEA 4IOLA 4K6KA 4L85A 1ZQ1A 4PC7A 3W0LB 1GPNA 3EDOA 3K8YA 2FA9A 1UBJS 2P9GA 2M6LA 5JDIA 3SJAA 1E3TA 3OIFA 3E3NA 4YRGA 2WKPA 4W9MC 5GY7A 4WNYA 1B73A 5K3SA 5CDUA 1OPXA 1ZNQO 4ZV9A 3G0GA 1PT8A 2Z98A 1X86B 5H3LA 1XOIA 1FSFA 4RX1A 3FRHA 1IOLA 3UAWA 3IR7A 4MGHA 3CR7A 4RZ2A 4CCSA 4CIVA 3CNEA 1Z6AA 2HBYA 1I3MA 2BFCA 1KOGA 1GIAA 2EJCA 4M1KA 3T34A 3WB9A 4D96A 4GOJA 3UV3A 4CVNA 4ECEA 3ZK9A 5JZ9A 2H1IA 1CNFA 4V38A 4BE4A 4DXAA 2FWRA 1WF3A 3NHYA 5JVDF 1PT9A 3MQ4A 1ZIOA 2ZTVA 3W06A 4DC9A 1OQAA 4IEEA 3TE6A 3G1WA 3ISVA 3WDKA 2UZ3A 4TYPA 2EFHB 4UHCA 2IH4A 2XXAB 2CVPA 1CQIA 1U0LA 4F45A 4L6AA 3UT5B 1YZ3A 2OT3B 4HL6A 2Q3JA 5LOVB 2ZVJA 2XWSA 3AF4A 4GF5A 1PJTA 4D4JA 3RNLA 1W6RA 2YZKA 1EWRA 3PQ3A 4GW3A 4D02A 1R66A 1FUUA 4MMXB 1M2VB 1U2GA 5FT9A 1JHUA 2C2YA 4IQGA 1TA0A 3HJUA 4B6GA 5KQSA 3V4RA 5TQVA 2GHQA 4E2WA 5LU9A 1G55A 1R6AA 4YCLA 3FBGA 1PF7E 4KLNA 3WGVA 4YUZA 3IKLA 4XJSA 1NF2A 3TL3A 1YF3A 5D3MA 5A9TA 3S1SA 2HSWA 1WXWA 2OAGA 4MKHA 2ZR9A 4C03A 5LXTB 4MWGA 2IDZA 1Y1RA 3LBNA 3B9QA 2GEBA 2Y05A 1NIJA 4HB3A 5HFNA 1I36A 1ZU4A 3RSFA 2NX2A 5CT8A 4BO5A 3L41A 4RJTA 4XWKA 4E5UA 4XRRA 4XX1A 2PQMA 1DO8A 1RI5A 2QROA 4BU0A 4JT8A 2AMLA 3TIIA 1NULA 1U7TA 4KFTA 1PW7A 4FW8A 1T6BY 4N39A 1K8QA 1HT3A 3LV8A 4YRJA 1P73A 2QQGA 5KJ6A 2POCA 1E9FA 2HNAA 1JE0A 2FSHA 1I2DA 4DUPA 2Q6IA 2IYZA 5ICEA 4P8RA 5SY9A 4QUJA 1YR6A 2BFFB 3GLQA 4EQ6A 1YA6A 2JF0A 4GR4A 4JMLA 5LCXA 3WB0A 1YDGA 1GDTA 5CH8A 2ACVA 2DMRA 3LGAA 4W8HA 1JQ3A 2BSXA 2X0RA 5LZ2A 1MC5A 2DE0X 1E58A 1LV7A 2Y66A 3EG5A 5CDFE 3AHJA 3VVBA 2WJHA 4KIFA 4F84A 3OA0A 5EJAA 3I01M 2GR9A 1AKWA 1ZIPA 4DIBA 1T0PA 4E5PA 1EUDA 2X0KA 3SSOA 5I7UA 3EZ2A 2EJVA 5DGIA 4BNYA 3E58A 1LWNA 2AOUB 2NUPB 2ZYIA 2XA9A 1AG9A 4KHZA 5F64A 3VUEA 4CM5A 3OPQA 1VLLA 2IQ5A 4QPDA 5T67A 5C8YB 1Z75A 2AZTA 3TQOA 4FN5A 4BATA 2O59A 5DHUA 3UA4A 5EWJB 2AEFA 4ARAA 5JFGA 1W1WA 2ISCA 2QM8A 4PLZA 1U3GA 2O9JA 4QT0A 1YCDA 2DP4E 2PNFA 3ESAA 4CDMA 3C6MA 1E4EA 4MR9A 4RIIA 4TL8A 4CETA 4N3AA 3TQIA 4CE6A 2XZLA 2Q3DA 5J2UB 3W2GA 2EERA 4YPVA 4WN9B 4M9RA 3L4JA 3MWDB 4M8KA 5EHNA 3CNOA 1CUDA 3G13A 2OCYC 1ISJA 1U6IA 2BHNA 1JT2A 2WTBA 3DCIA 4U00A 4U0KA 4X63A 4B09A 4EELA 4QUBA 5FFFA 3CH4B 4YCSA 1AQIA 4CM8A 2JGMA 1J56A 1JV2B 2DOKA 1C30A 3D8TA 3I9MA 1ZSYA 3DXZA 1G8YA 2NTJA 4PW0A 4G0UA 1EK5A 3ZHTA 3CPEA 3MS2A 1G1MA 4YV2A 4DNXA 2QR2A 4K87A 4JLOA 3L0PA 4GI2A 1P17A 1YUMA 3N2GA 5KBYA 1JJFA 1E62A 3V1TC 1J0AA 5E0OA 7AT1A 1DRUA 3ASVA 3EVNA 4CR6A 2A1TS 5JTTA 1Q91A 2O7SA 1WIWA 4E07A 3C3AA 3G9TA 3KZKA 3UTCA 2YXEA 1ZGAA 3FPEA 2H1RA 2LR0A 1ZJJA 2CLDX 1MO6A 4Z0HO 2EKBA 4X85A 3GLHA 3HJTA 5DT9A 5AXAA 4D9KA 1V7CA 1M8PA 2QMUA 1A5AB 2NNWB 4MKRA 1GM5A 2DWQA 4PLYA 3WTBA 3LOQA 4NV0A 3EPRA 4KO4S 3DNFA 4AF8A 1FFAA 3GXOA 5I45A 2OQIA 1G2IA 1YZKA 2NACA 2NWQA 3KZMA 4L51A 4AULA 2Q6OA 4MVJD 2PS0A 4UE2A 2CZCA 1AJEA 2FR8A 1AO3A 3KEMA 1R2QA 2XRFA 3HABA 2QRVB 4A2QA 2AB0A 4EF4A 2ZIGA 4LVUA 1U9JA 3JD2A 1E6MA 3I3OA 5FOXA 3RFXA 4UM9B 3SZGA 5CVCA 1D8AA 1T6YA 1DIRA 1XZAA 2VYVD 1KF0A 1P31A 4HGRA 1RYDA 4QQ8A 4Q3DA 5BSGA 5IU6A 4TUYA 2IUEA 4YCAA 2VHTA 3CO0S 4G8JA 1FRVA 3BWXA 1C9NA 3F8WA 3GG9A 3HB5X 5CM9C 3PYLA 4DZZA 1JHYA 5ARBA 5JQWA 3HU1A 2IBTA 4JI8B 2VCYA 1E6KA 1J8VA 1F3OA 1MIOB 3NBQA 4GO1A 4KMOA 1BAPA 1JLHA 2NVUB 1CB0A 2ASVA 3IAS1 4YCMA 1GL6A 3BL6A 1JR3D 1TYCA 3M5DA 4Y2QA 3QUCA 1D0VA 2EJWA 2IU3A 4DG5A 2VPIA 1HLGA 4LPSA 1JAZA 1JR3E 1N2CA 3DFFA 4A5SA 1GAJA 2F59A 2B5WA 4OXXA 3TGWA 3BWVA 4KQCA 4RC9A 3MAAC 5C7LO 1YC5A 3HKEA 3SLGA 2CJWB 3N8IA 1KFKB 3KAQA 3ESRA 5C3MA 1YUBA 1DC3A 2WF5A 5ALSA 4LXUA 4ZCPA 2XQIA 1DJMA 2OQRA 3I52A 1O58A 2ZI4A 4I1RA 10MHA 4D42A 3WYFA 3EA4A 2VDQB 4DCOA 1CB7A 4OLAA 4CFZA 2ZRPA 4I55B 1O0BA 1Z06A 4FFSA 1XSEA 4A23A 5DGDA 2PSHA 1QUFA 3WNCA 3DTYA 1TVEA 2FQQA 3GVIA 4ZCIA 4QVKA 7MHTA 3DM5A 4EKNB 3D2BA 1BGXT 5CFNA 2DX7A 2O0MA 1PO7A 2EWVA 3H5VA 4K6GA 2EZUA 2WPDD 4DMFA 1XI2A 2LPMA 2BGGA 4Q16A 2PLRA 5LA6F 1TQ2A 2SCUA 5CVDA 5HXAA 2P62A 4CRWB 2JZCA 1FSGA 1MC8A 2XYGA 4IIGA 2EDAA 2X6RA 1B2LA 1IHYA 3FOBA 3NJ4A 1H94A 3RREA 4AWAA 6ABPA 1K8RA 3P2EA 3EASA 1GZ7A 2O7VA 4AY3A 3H87A 4CDGA 4DVJA 4BY9E 3VC1A 1K2VN 3QOFA 2VPWA 2OORC 3AIKA 2C5BA 4TVBA 5HS4A 4OJNA 1QHHB 2X13A 1SBIA 2D6FA 1LF5A 2LXNA 3TKAA 3UGJA 1J8DA 2UUBB 4RSMA 1SQ0A 1SCAA 4QNNA 4RMJA 4Q4AB 1ZIYA 2HSEA 3GPCA 4FFOA 2OXIA 5LNK1 4E5VA 1ULAA 3RAJA 3P0IA 4HPJB 1OIXA 3O9ZA 4QUKA 3LOPA 4AXBA 2FX2A 3BL8A 4QYIB 4XFDA 3D8NA 1N2BA 3S1AB 1W87A 4L2IA 4B4OA 3KG2A 3NMUF 1T4CA 2HOQA 4TPKA 3W8FA 1ELOA 1PN3A 3ZXIA 3DNPA 2H4ZA 1D07A 2RBGA 4W82A 2UZ0A 2BUBA 2E55A 4IIVA 1KAHA 1V16A 4QGBA 3ZNPA 1CQJB 4ASUD 5JW6A 4JUDX 5L45A 5TLSA 4QOHA 3LT2A 4R8SA 4OL9A 3THXA 4X0EA 3CUKA 1E9CA 1KEWA 3BTUA 3KQPA 4HXYA 4RPJA 1SOVA 5AI4A 4J0DA 4EW2A 4IZ6A 2UYYA 4TM7A 1ORWA 4JWTA 4O4JA 3RS2A 3T41A 1RC8A 3TN7A 4D0GA 2EFYA 2VUSA 2ID9A 1PV2A 2X9NA 3GFOA 3I42A 4NS4A 4RPCA 4QNMA 3GB9A 1W36C 3JQEA 5GONA 3HKBB 1JWLA 2OPHA 3NALA 1Q0ZA 2PZKA 1U8AA 2IZOA 2Q5EA 3SMQA 1A5ZA 1UXOA 2VJKA 3QEKA 4V02A 4TYYA 4YY3B 4II2A 2R00C 4ND2A 4B2LA 2A7QA 3USCS 1OSNA 1Q3HA 3A4IA 1IB6A 1XWIA 1D4OA 4MH0R 1WXHA 3G5LA 3SYKA 3U3DA 5JSHA 2N9UA 5IAOA 2XZPA 4WCFB 4PS1A 2V9CA 3AQIA 1GJRA 3F73A 3MS4A 5A02A 3UJPA 1JI3A 1EP9A 3FCOA 3OQ1A 2BBOA 2DR3A 2VHWA 3QLEA 2B30A 2PH1A 3KWFA 4ZOEA 3U3KA 1KTVA 3LQKA 3VPDA 5EHIA 1HGXA 3ZD7A 3EGDA 3H3JA 2DPXA 3RVJA 4WKGA 2EP5A 4G5FA 2O3SA 2R68A 1HA3A 1D7OA 5LQNA 3O2JA 1B8PA 2W2KB 1Y81A 1JBEA 3VGJA 1DG3A 2JIDA 2D1RA 1M33A 4N0EA 2NXEA 2XOKD 3V32A 3A9SA 4G1MB 4MQ4A 3EZ9A 3UGKA 3Q5EA 2O1WA 1YI0A 3OQ6A 5CB8A 1XD2B 3WY9A 5LQAA 1B23P 1SR8A 2Z2XA 1FDSA 4OQYA 2C4WA 2YJTD 4MAAA 2BGWA 1W5BA 3LCRA 2XB8A 3F96A 5I48A 2HRDA 3JRNA 1ISIA 3IGFA 4TQAA 4MGKR 4I3HA 2XXBA 4ZT4A 5HDQA 3UWSA 3B20A 3NZEA 2JJYA 4HRYA 1F9EA 4ZI5A 4X1OA 1EQUA 3GRFA 3WGKA 3NBZC 4YJFB 2Y9MB 1H1DA 3QX3A 2RHCA 2QU7A 3R7WB 2J6BA 1NI3A 3KTDA 1W88A 3VM6A 2DQZA 2VWGA 2ZITA 2VHYA 1II8B 3IR5A 5CLGA 4D9CA 3PDIB 3UWPA 4EPVA 2P5UA 4QJ3A 3L92A 3B1YA 2WM8A 2XOKA 3OEHA 2FUNB 1E2DA 1TT7A 5M34A 2WSBA 2PUVA 4LE2A 2R6JA 3VOBA 1R9GA 3SVLA 5DTQA 4ZT3A 2QRUA 2V7XA 3DZFA 4KUGA 3USZA 1OWLA 1TZJA 3HZOA 3NH9A 4ND4A 1IBLB 3VR3D 1LI7A 4B6JA 2F1KA 1KY5A 1YNSA 3LT0A 3GPDG 5G3YA 1E1LA 4DNPA 2I62A 2YY5A 1AMNA 1QRDA 4D4HA 4J3JA 3U26A 5GADl 2IDJA 4P38A 4BGUA 5M04A 5LA6B 1KZ1A 1RM3A 1MAVA 5CFPA 3FGPA 5EJGA 3N5KA 3I04M 4J0FA 3E3MA 3QEMB 1P8JA 4ZVOA 1MFPA 4UEOA 4ZODA 4G0MA 1E1QD 2IYVA 2ZANA 1I9CA 4LDNA 1GXSB 4QFBA 3K9LA 4M1OA 2F3SA 5HYVA 1YS6A 1DIOB 1MMFB 3H0CA 4GXNA 5G0UA 1X8LA 4GBGA 1I80A 1T6NA 4UHEA 1NPYA 1DPFA 3JVDA 4NCBA 5SY4A 1VSUA 3QX8A 3U37A 3BHIA 2RHHA 5TC4A 3W1VA 3DBLB 1ID8A 4B6SA 3SNKA 2QT9A 1QHHA 4JBWA 4Z0PA 3WNQA 2P35A 1NYTA 3CE9A 1YJ8A 2P8SA 1JG6A 4BKPA 5DP1A 5K0TA 2WJ4A 3HP1A 2XVZA 4NAVA 5CLQA 5H82A 4CQLA 4CKCB 4G5GA 3ZHRA 2JGFA 3HRKA 3W2IA 2J85A 5JD5A 2B1IA 3KQVA 2BFWA 5IKOA 3JTMA 3DE7X 4L0MA 5DNDA 3X1ZA 3MCWA 1DBSA 1PEAA 2VDUE 3PPVA 4YDHB 3E48A 3FLMA 3NV9A 2QLBA 1I6KA 5I7AA 5JS2A 4CIDA 2P30A 3F5DA 4K9MA 2FPPB 2LGJA 2ZCVA 3CGWA 4WKCA 5FPQA 5L3QB 1CCWA 1NKSA 4KKVA 3V7YA 1UBOS 3DLHA 5HQJA 1CIJA 3PKJA 3HHEA 5AKYA 3HCRA 5EIBD 3PJFA 3JQFA 1U2SA 5FBVB 1NQOA 3NJ8A 1MEJA 5AJYA 4JJEA 3QE9Y 2OD9A 3HWX1 2B69A 3S68A 2DU8A 3DFUA 2CVHA 2C5LA 4CI9A 1WOYA 3MTEA 3SZUA 4MKZA 2CFTA 3GRRA 2VQ6A 3D6NB 4QBKA 3H1AA 2J0UA 4CR7A 2OP0A 4BX8A 4IGKA 3TNLA 3DQZA 4FS3A 5JCJD 2JGLA 3IPRA 1PS0A 4QECA 4EHDA 3GT4A 3GJZA 1CQXA 1EVIA 1XXLA 2V5UA 2FW0A 2BT4A 4HDMA 3ZV3A 3NT5A 4ILKA 4EKEA 5KYWB 4B7UA 4EFLA 3CMCO 5CURA 2F1RA 2Q07A 4JP2A 3T9AA 2AOWA 5BSEA 1P2BA 2F48A 3Q88A 1Z5ZA 2M6SA 4WBSA 2Q0SA 1XMPA 1EG2A 1C0EA 3CTPA 3PBKA 1L5WA 3VSDA 3HVRA 3KZOA 2ZT8A 2CCKA 1T8SA 3LK6A 1PR5A 2W43A 2WE8A 1M1XB 1HE2A 2PIAA 3KX2A 2R6HA 3D2LA 3MIZA 3MT0A 2Q27A 4LY3A 4Y2SA 4FM9A 4LZPA 5HKAA 2IPAB 3VBEA 4ZQEA 3IEMA 3RQSA 3ODGA 4IWNA 1ORIA 2FB9A 4KSYA 2F1IA 2QL7A 1Y6GA 4MCHA 4M0KA 3TUIC 3A3PA 1K3TA 2P2YA 3PKIA 3AY0A 2PZEA 4CUZA 5F4ZA 4AWBA 4EPXA 5EP2A 2ZZKA 4WE3A 2G1JA 4DMHA 4MRAA 1J21A 1MJHA 1BE8A 5J5VA 1FNSA 4D9JA 1VYVA 4MP8A 1I5EA 3OLYA 3IDZA 5AK0A 2R1VA 5LL6P 4O4HB 4WZZA 2Y1KA 4DLXA 3VZSA 2NO6A 1BROA 4FMCB 4L02A 2AG1A 2JFPA 4EWLA 1JEQB 3LWDA 3ETGA 1L0BA 1FJHA 2QR5A 4HBZA 4RAOA 5BT9A 4B3CA 3CO5A 2F1JA 2YIDA 4XGQA 3E9NA 3LT5A 4Q47A 5HQ3A 2E6KA 1QHGA 1LDNA 1TD1A 2DT5A 2GM5A 2ZSBA 2ET6A 3QUTA 2QN7A 5ALMA 4MUGA 4PLCA 1QPBA 3Q3VA 3GZTB 3VTFA 3MN1A 4LFBB 4MW0A 3INTA 2O2XA 3OUTA 2HCFA 2IYSA 2OBYA 2V6MA 3IBFA 3IT0A 3QWHA 4OKNA 2I66A 1OZ0A 2YYAA 1IRIA 1SIOA 4RTJA 1C29B 3IJPA 1NVGA 3JQ8A 4CFSA 5CDSA 3SIPA 4HI0E 2IPXA 2R60A 4UVEA 3TH5A 1C7ZA 4O2RA 5LA6A 1T8YA 3ED1A 1ILWA 4XPZA 3HYLA 3C1TA 2AXQA 1A72A 5GGXA 4GL2A 1Z4IA 4XLZA 4Q34A 1U3TA 4RFSA 5LUBA 1EX1A 3RC7A 1GUAA 1A4RA 1KVTA 1J2JA 1ZXLA 4KXLA 2OQVA 3G2LA 4CMAA 5ALUA 4CEHB 3IBCA 3OBBA 3L8HA 3RABA 1OUMA 2OXTA 4X9XA 3LH5A 2I7CA 1MHTA 1V25A 3K0FB 4UDNA 1L4BA 1APBA 1DLIA 3FCYA 1ZUWA 2I80A 3N86A 4J76A 4EPWA 3P2YA 1QG6A 1GGEA 2IUYA 2Y77A 2YZNA 3HB1A 3K30A 1KU0A 1N92A 3R0ZA 3TX6A 4B4VA 5ELXA 2X5KO 2W58A 4EKGA 3SLKA 1QIEA 4A26A 1M7BA 1R4MB 1CZRA 2W4IA 3RVBA 4C1NA 1S3FA 2WLTA 4A6XA 1ZNWA 2CFCA 3E7PA 2FLVA 3OWOA 5MN6A 3EFOA 2DLNA 4P36A 4R5MA 3Q8MA 3DONA 2GKOA 1IY0A 1E79D 3LUPA 4TQGA 4Z8YA 1UDBA 4JVNA 2YHAA 1TEHA 4X62B 1KARA 2YZGA 3WYGA 4GMDA 3M4JA 5DYNA 1QB7A 4W5NA 2IY8A 3H4VA 2CXQA 3W6OA 4NICA 5FWAA 1M8JA 2AZDA 4HDAA 4R0NA 3CT4A 5L3VA 4MWTA 3KXPA 4L72A 4FMPA 3IT3A 2QZJA 3NHBA 4UARA 4AMZA 1LTQA 2Z6UA 5PGMA 1KEZA 3KCNA 5AVRA 2FOLA 1QQ5A 3WMXA 2WTXA 1B26A 4A8TA 1JW9B 4LECA 4BNZA 3N8DA 1F4PA 1RCUA 2WD7A 4M1ZA 1K9VF 2KB0A 3IKVA 3NW9A 4KGVA 2UZAA 1FUKA 3QUSA 4FPXA 4KE8A 3I01A 3MRXA 4V0SA 1N8NA 4D4KA 2G9VA 2W6IA 1R3DA 3CRQA 3QVUA 3IURA 4DYVA 2ZPTX 2Q1XA 3BHNA 4TMXA 2R25B 4EKIA 1EVKA 1VBNA 2FE1A 1Z17A 4PN3A 4C2UA 2PUGA 2JIZD 4HXGA 3JR7A 4KO3S 4P84A 1KK0A 1LBSA 3H7IA 2GETA 4PYLA 1CETA 3FUWA 4RXTA 1W8IA 4ZVKA 1CY6A 3ZU2A 2C5FA 4GQAA 1YRWA 1N5KA 4N49A 4YAOA 4RENA 2NTNA 1MX5A 1A82A 3KTAA 4QU8A 3IPYA 3CJRA 4E2YA 2W6JA 2FK8A 3WRYA 3CGGA 1IULA 4GM0A 1ULZA 1YRQA 1EAMA 4PU0A 4A8JB 2QXYA 3A0UA 4ND8B 4UXIA 5J4KA 2CXUA 2I99A 4KBGA 1O77A 1K3FA 1M5TA 3LPDA 5FO0A 3RC9A 4JH0A 4N8EA 5A62A 4Z53A 3N07A 2EF1A 2I22A 3EFEA 3EXIA 2JRCA 4L08A 4DRZA 3CX7A 5BR4A 4PLFA 4OP3A 4Y1RA 4FZVA 3R6LA 3E9ZA 2WU3A 1L5GB 5A6SA 1Q1QA 3CU5A 4XQ0A 1A4UA 2JJMA 4PM4A 4Q7LA 4AZ0B 5IJAA 5IDXA 4L4YA 3STYA 2FV8A 2Q9UA 1ULSA 1ZCAA 4U3JA 3CUYA 2VUTA 3U13A 1KAEA 4WINA 3PR1A 2XSZA 2ZYHA 4IFTA 1JA0A 1HG1A 2Y92A 1U2PA 2IZ1A 1LI5A 1OJLA 4UD6A 3K53A 1KKMA 4IRUB 4K9RA 3UOAB 1DJNA 5LYJA 5HFJA 5E9QA 2PE5A 1GPLA 1T4CB 3CUEF 1XZFA 1E5LA 4JLNA 1ZI6A 2ANCA 3BRCA 3F98A 1JXMA 2UVDA 1N0WA 2OV8A 4YUAA 2VH5R 3OM0A 4ZAWA 1I94B 2HRRA 3PNYA 2G82A 1J39A 1J90A 4DCGA 1PCXA 1EK0A 5CB6A 4X97A 2WP8J 3QEAZ 1WB4A 3E7FA 2RG1A 4Q1BA 5FP0A 4C3VA 3DLBA 5ER6A 4WLUA 5TSDA 4PAWA 1TQ4A 5G02A 2D0IA 3DTTA 1GARA 4PAMA 8ADHA 5IAJA 3H1EA 1FW6A 3D8BA 4IIJF 4B6EA 1ODTC 4NFSA 2X58A 1P0QA 2VK1A 4M7RA 4LQ4A 4LJKA 3I0MA 4EJ0A 4IHJF 1V3VA 1SKYB 4BFWA 4NEHB 1A50B 4N48A 1OOEA 3HP7A 4W7HA 1LZKA 2FPGA 3M4XA 3A6LA 4Y8VA 2QOEA 4ZV7A 5A5GA 3U48A 1E60A 2P79A 1U0JA 3SJBA 1MNAA 3V33A 4BO6A 4EHBA 4DR4B 4H0CA 3OUUA 1PJZA 3I37X 3ZWQA 1SBHA 1QHYA 1NWHA 3WKBA 2BEUA 2GAOA 1E7YA 1WUHS 3D4LA 1DV1A 3UHJA 1UK9A 4Q3LA 1VECA 2KWIA 2DSTA 5TE9A 3UEOA 4Z3KA 3SQWA 1WXIA 2ZYRA 2OHVA 3OZRA 5C5IA 13PKA 2H1VA 3B1FA 3SAJA 2HGZA 3QSGA 4NZZA 5GM2A 1HDGO 1WHTB 2MTBA 3I9KA 2V5AA 5AJHA 3JQDA 3RUPA 2BWJA 2F3TA 3HBAA 3QQ5A 4D98A 5AICA 5B55A 1A96A 1HZZC 4YJFA 1E2QA 1PDWA 5DYGA 4HWOA 5A4AA 2JLXA 4PCLA 4CHTA 4M1SA 1W88B 4JIGA 3L6DA 4MYHA 2M9MA 4NCJA 4C4ZA 4LZWA 4IO1A 1BXZA 5JRJA 2IKQA 1QU2A 4BFCA 4RD3A 2WOOA 1A7JA 3OC0A 5ANRB 5K3CA 1IRXA 1DJQA 1LRJA 1ZR4A 2Q4TA 4U8GA 5H4GA 2RAVA 3SVTA 3T3NA 1FVXA 5IVIA 1YO6A 5T4FA 1QQ7A 1X1EA 2G1UA 1HETA 1I2ZA 1KJQA 2C54A 3D7NA 1XD9A 4N0MA 3ZVMA 3NHWA 3AR4A 2P1RA 5BQFA 3H0EA 3KB6A 4PPYA 5I7FA 5CB0A 2P6UA 1GL3A 1DRVA 3PZBA 1OT3A 1RT9A 1QC5A 2OFOA 4RVNA 4HNSA 4BAGA 1RHQA 1YZQA 2QX6A 3QZUA 3AHIA 4GOLD 5TEVA 1M2JA 4LMRA 3KVYA 4EJSC 2C97A 3DO6A 1SCNE 1D2GA 4R5HA 1IG0A 4NVRA 4JB3A 2HPZA 2HBRA 2BGRA 3BE6A 2O1SA 4Y6SA 3V4OA 3G8BA 5DNEA 2QW0X 2P3LA 4O4IB 4G9GA 4KTTE 4YUVA 1QF6A 1DHTA 2P67A 1A5SB 1DADA 2W2MA 3C3DA 1Q3TA 1I32A 2YY6A 3PFIA 4K8RB 4RJJA 2OBNA 1JJ7A 3E03A 4HNHA 4OMUA 4UUAA 4X6YA 4E5NA 1QGOA 2IHUA 1CUSA 3ICWA 5LQDA 1UBHS 2OFXA 1QIFA 4EUEA 2HSZA 3KTAB 5U9CA 1EKXA 3ULKA 4RVFA 1UBNA 4A0HA 4CMIB 4DJAA 1LB1B 1MO2A 2J5XA 2RGDA 4WNAB 3PUHA 4H7JA 2CHQA 2O0JA 1OT5A 3DULA 4F4IA 1N6PA 2RHDA 4XCXA 4BB6A 1OTHA 3RYFA 2NVOA 4NEQA 3PIIA 5FCDA 2NU9A 4F86A 5ITWA 2C98A 1QR6A 2O8DA 1LX6A 3VU1A 2QMZA 4EY6A 2O2EA 1UH5A 5FADA 4C22A 4CIYA 3ITNA 4YBRA 5T3YA 3P26A 3W4KA 1H0RA 1C41A 1E9BA 2HJGA 4R83A 3L7IA 3LI2A 1ONPA 1QMPA 4WPGA 1GCUA 2YIMA 5EMMA 5A6SB 3CF4G 4DNFA 1RS0A 1LCIA 1HYGA 1G8FA 1O6BA 3RVLA 2OCXA 2I6FA 4N0PA 3LHKA 4YASA 4AJ4A 3WL8A 2P9BA 2FRDA 4YAKA 5KC9A 3S44A 1H5UA 1P7ZA 2HA4A 1U3FA 2V8BA 3ZWXA 5JCPA 2J0UB 4LRQA 4RULA 1JVBA 3EJWA 1O0SA 2DWCA 2WMDA 1TAGA 1OXMA 4GUAA 4NH0A 1WUIS 2G0TA 2JA1A 2EDCA 4AUMA 3B1WA 1XJCA 2HMTA 1C3OB 4DJEC 3UATA 4BASA 1KO7A 5KVVA 1UODA 2FTKE 3FI9A 4W7SA 2OC4A 3NBAA 4Y1GA 1BCRA 4N5LA 4DIEA 2PJZA 3PSAA 1R10A 4OHFA 2EU8A 2RJOA 4D4IA 4A0SA 4H60A 4FB4A 4ISBA 4IM7A 3HVUA 8OHMA 3FB1A 4CM4A 2BHLA 1SBCA 3HA2A 3LPLA 3TEMA 4AJ2A 3NC4A 3PXXA 4YEDA 5TJHA 4NMXB 2E4ZA 4E14A 3BXPA 2OLKA 3BXHA 1RQ7A 1M2OA 2R8RA 2WSIA 5KWEA 2V54A 3IDQA 1DCTA 3GELA 5EIBC 3PQ6A 3WK5A 1YACA 2O7NA 1SHZA 1Y7PA 4PF1A 4MVJG 3L02A 2D2FA 3CX4A 2DBYA 1XMSA 3ONVA 4A9AA 1BFUA 1QZTA 5E95A 3P19A 3QM1A 4ZFNA 3THYB 3EGCA 4ER0A 4WJLA 1OBOA 3MGCA 4DLWA 4NCAA 2VDWB 4IVPA 2IXEA 4E1AA 3D3KA 3G85A 1VKRA 1HZJA 2WJWA 5JO9A 4AIRA 4LJ6A 3H7AA 3PI6A 4DLAA 3GAAA 2ZSAA 3OJXA 4MI3A 4QELA 4WFKA 1PZGA 3PCTA 5EZQA 1DJPA 4LYYA 2QUAA 4P98A 2ODTX 5AM1A 1JXAA 1NBMA 2PWAA 4DM4A 4KAXA 4C4TA 5TGTA 5E0KB 4CJXA 5CDGA 5CVTA 2QUKA 1CVLA 1IBRA 1VCMA 2FMIA 1WCYA 1MOSA 3T3HA 1JTEA 3G8AA 1F2TB 3I9NA 3TQSA 5K0EA 1NBIA 2BGTA 1UMKA 4DQUA 1XMIA 3VDXA 3IQGX 4NG4A 1E9EA 2J3HA 4H1UA 4QEDA 4UBNA 3BJZA 3BKWA 2JB9A 4AXXA 1XCGB 2Q9CA 1A76A 2XNHA 5C3UA 1V5EA 2FJPA 3E9RA 3QWIA 3IEXA 4TM8A 2YJ3A 3IQFA 4CM6A 3SC6A