4X93A

Crystal structure of lysosomal phospholipase a2 crystallized in the presence of methyl arachidonyl fluorophosphonate (tetragonal form)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
376
structure length
376
Chain Sequence
b'HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Group XV phospholipase A2
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 128
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x93A01
5C8XA 5FOQA 1QO9A 1CQZA 1XRQA 2W22A 4MWSA 4LXIA 3G0BA 1F6WA 2OCKA 2WHPA 4KR0A 1N1MA 3LCRA 1Q84A 3FLBA 1K8QA 3FAKA 5FLKA 1WHTA 1MAHA 2WKWA 1EH5A 1R4ZA 5E4TA 4HTAA 4RE6A 3D4LA 3IIIA 5JAUA 2H1IA 4A5SA 3WL5A 1H2ZA 2O2IA 1XKTA 1F0PA 2BJHA 4I3FA 4HVTA 4MEBA 4PO3X 4OD0A 1ZI6A 4ROTA 2PVSA 1ZIYA 5AKYA 3AFIA 4INZA 3NWOA 1H23A 1VE6A 4G9EA 1MNAA 2CKMA 3QBJA 4EA6A 5FPPA 1XLVA 5ALPA 1EDDA 3QPAA 1UOPA 1MO2A 4CCWA 5A6VA 3FBWA 3E0XA 2WTNA 3WIOA 4WJLA 1CV2A 1MN6A 2WFZA 3S2ZA 4N8EA 2JIDA 4KAAA 3CXUA 1XZCA 1JJBA 1BU8A 4K5QA 1CUVA 1AURA 2Y2UA 3PUHA 3QMMA 5JIBA 2VJDA 4FHZA 2XMGA 1R9MA 4I19A 5FP0A 4CIBA 1XZKA 1DINA 3FVRA 4FNMA 5JADA 4IHAA 1XRLA 1CUWA 2WUGA 3AZOA 3BE8A 5D3ZA 3OTQA 3C8HA 4H18A 2AJDA 5D7BA 1XZJA 2D5LA 1QTIA 1MT3A 4C4XA 2RHWA 2WIJA 4Y2QA 3VVLA 3G8YA 1W4LA 3I2GA 3E1GA 1LPAB 1CUUA 5IVKA 1B41A 2AJLI 2QKYA 3QMWA 4QLAA 4UFNA 2HA2A 1ZI8A 3WL6A 3MGAA 1C4XA 3X3HA 1LPMA 1CVLA 4JYMA 4O08A 3VXKA 3UUEA 2XUOA 1QFMA 1VOTA 1QGED 4BAUA 3B5EA 2BUBA 5T4HA 3D5EA 4HAIA 1JMKC 4J0IA 3IUNA 5BWCA 2QS9A 2XUGA 2VF2A 3O0DA 2C4HA 2JGFA 5EFZA 5AK3A 1P0QA 5ALOA 2VQ6A 4AMYA 5HZGA 1ISPA 3RKSA 4AMZA 2EEPA 5HKBA 1IUOA 2WG1A 4UHDA 1ZD5A 2W6CX 1EK2A 2J4CA 2HA4A 1XZMA 2ZYIA 1JJFA 1R3DA 4J0JA 3N2ZB 5K3FB 3BDVA 4DLNA 1QOZA 3V1NA 3VKFA 1FFCA 1SOMA 1XQWA 3DD5A 4XVCA 5EHZA 3VJMA 1TRHA 4FBMA 5LIPA 1WB6A 1QIMA 3SWWA 3LLCA 1YAHA 1G5FA 2GZRA 4OB7A 2K2QB 1K4YA 3HEAA 3I28A 1VKHA 4QDOA 1VLQA 4AN1A 3VJKA 4ZI5A 2QM0A 2HA7A 3WMRA 2HRRA 3QMVA 4E15A 5FV4A 5HF5A 5I7UA 2XMRA 2BGNA 1L7AA 2QJRA 4W1PA 1YS1X 4DMHA 3WKCA 4KYVA 5KWJA 2D0DA 1BCSA 3R3ZA 1EB8A 4LYEA 5HK8A 3C5VA 4WY5A 5HKAA 2GBCA 3A2MA 1QO7A 3G9XA 2OCGA 2PU5A 2WHPB 2C0QA 4GHWA 4QEKA 1EDBA 2YYSA 4J0GA 5ALRA 1XQYA 5AI8A 2HFJA 2XUJA 4J0DA 2G63A 4RE5A 1CUZA 1TKRA 3I2JA 2QXUA 2ZJFA 2DHCA 1AQLA 3FCXA 4F0JA 1DQZA 3G0DA 1EHYA 3ZLUA 3I1IA 5LZ4A 5AK5A 3F96A 4JNCA 4X85A 4EUSA 5JAPA 1MTZA 2ES4A 1ORWA 4BBZA 3DNMA 3KXPA 3O4HA 3R3VA 2JGMA 2PM8A 2XMSA 4C88A 3PE6A 3OC0A 2OQVA 3WK7A 5ALEA 1YA4A 1EDEA 4F21A 3F9CA 3GELA 4AZ0A 1EXWA 2OQIA 4AO6A 2CEKA 4QDTA 4K6KA 3HC7A 5K3AA 3P2MA 5ALJA 1ZD4A 2WM2A 2XT0A 3HYSA 3C43A 4ZREA 4C01A 3R3WA 2HFKA 5AKGA 5FKJA 5DTIA 4YX9A 3PI6A 3GBSA 5AJHA 2QMQA 1W1IA 3D7RA 5CT9A 1THGA 4X00A 3IDAA 3DDUA 4E11A 1BN6A 2C58A 1DU4A 5AI6A 1E8NA 1UKCA 3QVMA 1Z68A 4IH1A 4LXGA 4HXEB 4GECA 3HXKA 5A71A 3FNBA 4U2EA 2WQZA 1MNQA 3IVMA 5LZ7A 2XUQA 1TK3A 3M83A 3M81A 1QJ4A 2ZJ7A 1K6EA 3ICWA 4BAZA 3VJLA 4GW3A 5AH0A 1XZDA 1OILA 1EINA 3ZLTA 1P0MA 3DLTA 3PDCA 1A7UA 5IVIA 4X3CA 5A7FA 2Z8XA 3HJUA 3WKAA 3FSGD 4NMWA 4EY7A 2XE4A 2XI4A 5BWBA 4B6GA 2OGZA 3W9BA 4B0OA 4HZGA 4GEGA 3C87A 1VXOA 2XQJA 2O2HA 4BP8A 2HM7A 2OPHA 3SC2A 5AM4A 3DS8A 3LIPA 2OGSA 4DMCA 5CH5A 4BZWA 2HADA 1Y7IA 3OG9A 3C6BA 1C7IA 2JGJA 2HU8A 3V48A 4Y2YA 5K5EA 2PX6A 4E46A 5ALLA 1UKBA 3SX4A 1LZKA 3IUJA 1TCBA 3OOSA 4FKBA 1T2NA 4JYPA 5IVHA 3A2NA 1CUBA 4LIPD 1UOQA 4QWWA 5AKEA 1MX1A 3ESAA 2JGLA 5JASA 4PNZA 5ALFA 5BV7A 1IZ7A 3K6KA 4N8SA 4LHEA 3STXA 3O9VA 5CBKA 4UHEA 2DFPA 2QUAA 1ZICA 2YH2A 5ALIA 5E2IA 3TRDA 4FOLA 3R3XA 3AZPA 4X91A 3WK9A 5CT6A 5LZ8A 3PF8A 3AILA 2CUTA 3KD2A 1XROA 2GYUA 1HKHA 3BWXA 2XUAA 2WLSA 2R8BA 3EF3A 1GPKA 2HU5A 5T4FA 3G0GA 2PSJA 1UZAA 5EIHA 5CXUA 4W1RA 3DEAA 2PSFA 3OPMA 1XRPA 3HZOA 2VJCA 2XDWA 1LZLA 1IUNA 3WK8A 1CEXA 1QIJA 1Q0ZA 1AGYA 3PF9A 5F4ZA 5CT4A 5DJ5A 5FUMA 1EVQA 2XUHA 1H22A 3WKBA 4BC1A 1YS2X 4B9AA 2ACKA 1U65A 4XWGA 1YB7A 1OCEA 1THTA 2ZSHA 5A7HA 2QZPA 1W52X 4N5IX 1R1DA 3RM3A 2GYVA 4G8DA 5JZ9A 2YASA 2V96A 5ALMA 1O6FA 3C70A 1F8UA 4GXNA 4TVKA 4B84A 4BVLA 1CIJA 2PSEA 4PSDA 4Y2PA 1GQRA 2WIFA 3AINA 1E8DA 1CUXA 5A2GA 3W2TA 1CUCA 1LNSA 2XQKA 1CUIA 2XQGA 4G4IA 2VJAA 3I2KA 4DNFA 2Z8ZA 5D3KA 1G4HA 3BIWA 5HF6A 4X94A 1NU6A 2WTMA 5ISMA 1AMNA 1TQHA 4EY6A 3QPDA 4H35A 3FCYA 1BROA 2IITA 2QUBA 4H7DA 4DGQA 1W75A 4MJ3A 4Q3KA 3IB3A 1SFRA 4YPVA 3KWFA 4Y2VA 1ODCA 4M0FA 1XZFA 1S8OA 3C6ZA 3CN9A 3D2AA 2OAGA 2XLCA 4PV7A 3ED1A 4ZRDA 1X2EA 1OXMA 2HA0A 4P92A 1WM1A 4N8DA 4H7JA 1ZGCA 1A8UA 1PV1A 1ZOIA 3FYUC 3WK5A 3WL7A 4X92A 1XRRA 5LZ9A 2B61A 3RK4A 1DT3A 4W9RA 3WWEA 1IUPA 4AX4A 4PSUA 4ZWNA 1WPRA 3R41A 5AO9A 3H04A 1GPNA 3JW8A 4TPKA 5JYCA 1WOMA 2PSDA 4X93A 1XZIA 3ANTA 4C6HA 5AP9A 3GZJA 4OPMA 2Y6VA 3QH4A 2HU7A 5J3JA 1CUJA 2B20A 1FJ2A 1GGVA 4B7ZA 1EK1A 2X76A 3AIMA 5E4YA 3VDXA 2J3QA 3HABA 4CCYA 5ALGA 4J0KA 3DQZA 4QDXA 1XLWA 4FLEA 4MQLA 4PQEA 3I2IA 4UFOA 1D07A 4X95A 5AKLA 3WK4A 1CR6A 5AKZA 4QWMA 1W76A 3BXPA 3FLAA 3KOOA 4GI1A 1GZ7A 6YASA 4KE8A 4EB0A 1JU3A 4IO0A 4ZXFA 3D2BA 4UFPA 4TGLA 2GZSA 1XKLA 2HA6A 5ALHA 3ZPXA 2OXEA 4H7IA 4ZGBA 5AOAA 1AC5A 4CFSA 1QIGA 3G0IA 1MPXA 2Z3WA 2QXTA 2AJ8A 2WIGA 1HPLA 2QT9A 4Y2TA 3RARA 5DLPA 4QDUA 5JD6A 2Y1KA 2WIKA 2I03A 1CUSA 4J0CA 3STYA 1UKAA 5AKJA 3BF8A 4QE3A 4Q34A 2B9VA 2O2GA 3LIIA 2O7VA 4X6YA 2DHEA 1CRLA 2HL6A 4I4CA 4Q82A 2WHQA 1USWA 2BUCA 2ZSIA 3I2HA 2WUFA 4BVKA 3C45A 2Y6UA 3O95A 4YK7A 3E3AA 3SK0A 2VATA 1YB6A 3AIKA 3T52A 4WCVA 4EZIA 3WZMA 2BKLA 3A6ZA 2JGEA 4U2DA 3WA7A 2I3DA 1B6GA 3I6MA 1BN7A 1E8MA 3ESBA 4ARAA 1R9NA 2JEZA 3WKDA 1QIDA 4QA9A 7YASA 5FDFA 3DL7A 4FMPA 3H19A 2QJWA 4H0CA 5CMLA 4G5XA 1PFQA 3GROA 5C8ZA 1GPLA 5I8PA 3RLIA 4Y2JA 3N0TA 3F67A 5JARA 2C7BA 4BAGA 3AIOA 1CPYA 3KDAA 2XQIA 3H18A 4BE4A 4IH9A 3JYHA 2CZQA 3D0KA 4BCCA 1YA8A 5JAOA 2VT7A 3UUFA 5EIAA 1UK8A 1UOOA 3FWHA 4G9GA 1ZD3A 4NS4A 4DIUA 2C5FA 1SCQA 3R0VA 3IURA 1XZGA 2YXPX 5AI9A 2BCEA 2RHTA 5AHXA 5AM3A 3FYTA 4OB6A 4DMKA 4U2BA 2JGIA 2ZJ6A 2EDCA 1N8SA 5ALQA 5HQ3A 4G1FA 1X70A 2BAGA 3H2IA 4ZV9A 3W9UA 4BDTA 4E14A 3CCBA 1A8QA 1QE3A 4OYLA 4OU4A 5EHNA 3TGLA 1LPOA 1J1IA 5AICA 1HBJA 3W05A 3R40A 2XUKA 3I2FA 4H7FA 5K3DA 4KE9A 4CIAA 1LLFA 3EQ9A 2BGRA 4Q3LA 4J3JA 4L3WA 1MJ5A 3CN7A 4KACA 3STUA 1DX6A 4WFJA 1P0PA 4V2IA 1J07A 1XZAA 3VISA 1JKMA 2C0PA 3WLAA 4QNNA 2JF0A 2G4LA 1VZ2A 1XZEA 1QIEA 3WL8A 1LBSA 4G4GA 2OLEA 1TAHA 3H2GA 4X6UA 5CXXA 3LS2A 3BJRA 4B0PA 2VSQA 2GBFA 3Q8WA 5FPQA 5DYYA 1XZLA 3DL4A 2RI6A 4W1QA 4GWLA 5DNVA 4B81A 4UHCA 2G5PA 2ACEA 4B83A 1ZJ5A 4CCYB 2GYWA 5CURA 3H1BA 2DCMA 3BL8A 1ZGBA 2RONA 5D6OA 3QITA 3YASA 2HIHA 5T4EA 5DNUA 2DR0A 3C6YA 2ORYA 2HDWA 5CH3A 1QZ3A 1W6RA 3A2LA 4Q1VA 3WJ2A 3OM8A 1Q83A 1LPPA 1UK6A 4G8BA 1EB9A 3DKRA 1DTEA 1LBTA 1ZD2P 4WDQA 1VE7A 4MQMA 3ILSA 5A62A 2Z3ZA 3IUMA 3IBTA 4UHFA 3HLKA 3PUIA 4FBLA 3EBLA 1HLGA 5ALKA 1ETHA 4OB8A 5EHQA 4X97A 1AUOA 1AX9A 1EA5A 2OCLA 2PL5A 2CBGA 2E3JA 5A7GA 2CMFA 1BE0A 5AI5A 5AM0A 3MUNA 3E4DA 1FSSA 2AXEA 1H2WA 1CUFA 5HCUA 1GKLA 1Y7HA 4Y2RA 3L1JA 4UPDA 4MYSA 5ALSA 4JH0A 3WJ1A 1UT6A 1WPXA 2X5XA 3IULA 1R88A 1BRTA 4YASA 1GXSA 4BATA 3H1AA 1QIIA 5SYNA 1UWCA 3I1YA 5JANA 1H2YA 4UBIA 3B3QA 1QLWA 4UBKA 2BFNA 2Q0XA 3QZUA 5K3CA 4ZV7A 4BTVA 1J2EA 1KU6A 1U4NA 3M82A 3DJYA 1LPNA 4KJXA 4Y2UA 2GBGA 4CI9A 1L7RA 4XJVA 4C87A 4C89A 5AIBA 4ARBA 5AK6A 2XUDA 1YCDA 1XLUA 3C5WP 3KSRA 5EHXA 2FJPA 2ONCA 4KE6A 1DWPA 4DSZA 4WFIA 4U2CA 1DWQA 5IKXA 2HA5A 1N5MA 4AO8A 5C81A 2WFLA 1ODTC 4H7EA 4KE7A 4K6HA 3V1KA 2ZYRA 4L0CA 2O7RA 4EY5A 5SYMA 4CG3A 4MXDA 2RGUA 2R11A 3IA2A 1QONA 3TEJA 3ZLVA 2V9ZA 1FFAA 4MWTA 4S0XA 1K63A 1L7QA 4XIIA 5HQ3B 2ECFA 3D2CA 5CW2A 1ORVA 4B80A 4RNCA 3I6YA 1XQXA 1O6GA 1UXOA 2WU3A 5JD4A 3ICVA 4W63A 5DTJA 4K6GA 5AOBA 3NGMA 1MX9A 2HHAA 5CTAA 5C8VA 4F60A 1J06A 4UHHA 1CUDA 2NW6A 4UBLA 3H0CA 5YASA 2DQYA 2PUJA 4L72A 1LPSA 5FXMA 3V1LA 1EI9A 3AJAA 3G9ZA 4QZVA 4OCZA 4B82A 1R50A 2XUFA 3STVA 2JBWA 4AQDA 4J0HA 3WKEA 2WHRA 1RWQA 2XMBA 5LP1A 4C4ZA 2WJ3A 1FFDA 1QIKA 4PF1A 4KAFA 5LZ2A 4F5ZA 1H2XA 2QVBA 2Z5GA 1XZBA 1VJ5A 1BEZA 5ALVA 4FDMA 3WI7A 1E5TA 1QIHA 1F0NA 1QTRA 4X7BA 4UUQA 3AZQA 3WYDA 5AM1A 4G8CA 2WU4A 1G66A 5AI0A 1JJIA 4JUIA 2J4FA 4Y2SA 3L1HA 3NOXA 4P93A 1VZ3A 4WY8A 1WB4A 1CUAA 1CUGA 2OAEA 2Y2VA 5JATA 3H2JA 3V1MA 2H7XA 3QM1A 5ESRA 4KAJA 1MX5A 3A70A 1SCKA 3Q0TA 5H3HA 4BZZA 1SCIA 2H9YA 1M33A 2WUEA 4Q3OA 2H7YA 3FSGA 1YR2A 4MEAA 1KEZA 2WIDA 2UZ0A 5K3EA 5AOCA 1CQWA 3FLEA 3F97A 1BEEA 3FOBA 1MAAA 1U2EA 2IIVA 3I6ZA 5IH7A 3KWJA 5HF9A 4ITVA 4FWBA 5HK9A 2XMZA 2PSHA 2PKYX 4WFKA 3R3UA 4BVJA 5EGNA 1DWOA 1C7JA 1RYYA 4BCDA 2VTVA 4GLBA 2EDAA 5DWDA 2DSNA 3FYUA 4BB0A 3DOHA 1NX9A 1NU8A 2ZVDA 5C7YA 4G4JA 1DT5A 3O4JA 2XQFA 3ESCA 1IMJA 1GT6A 1TCAA 3C6XA 2WJ4A 4HS9A 4KRXA 4M0MA 4LXHA 4BCBA 1GKKA 3HSSA 2WUDA 2FX5A 1WHSA 5AKIA 4FTWA 4B9EA 4K2AA 4Z49A 3WIBA 3W04A 2ROQA 4W1SA 4GDMA 4FFWA 2RAUA 1P0IA 3BJMA 1X2BA 3WWPA 3PICA 1ZIXA 2V98A 5JZBA 1AZWA 5FRDA 1HQDA 4AO7A 1XQVA 1E66A 2QOEA 2WFLB 2OCIA 4PSCA 2HRQA 4DNOA 1DX4A 1GQSA 1MU0A 4KEAA 2V97A 3HRHA 4BE9A 3DCNA 5JAHA 3G9TA 1A88A 2J3DA 2QRUA 4J03A 4AB1A 5ALNA 4CG2A 2GBIA 2XUIA 5AM2A 4QDZA 2XMQA 5LKRA 5EI5A 5CH8A 3EQ7A 1EX9A 1CFJA 4L9AA 2VAXA 4BRZA 4UBMA 4JEIA 4AZ3A 4C4YA 2DQZA 2LIPA 5DNWA 1YAJA 4Y7DA 5AI4A 3TJMA 1K5PA 4UBJA 2WSLA 4Q05A 5I9IA 4QLOA 4P9NA 2WG2A 5CT8A 3ZV7A 5ALZA 4UBOA 1YASA 4Y9SA 5HFNA 2VA9A 4OU5A 4HXGA 4EBBA 3PFBA 3WWCA 1CLEA 3G9UA 5AKKA 1E89A 4DYHA 3ZWQA 2C5GA 3G0CA 5HFAA 3LP5A 1JFRA 3MUOA 1AKNA 2I3ZA 3QYJA 4GBGA 4BC0A 4BTLA 3WK6A 4BRSA 2HA3A 4A16A 1TCCA 1SC9A 2XUPA 5ALWA 3CCCA 3BIXA 3H2KA 3U0VA 3FVTA 1KU0A 5AM5A 4N5HX 5KWIA 2VAVA 3STWA 2VT6A 3G02A 3ZI7A 3V9AA 4DM7A 1CUEA 1BS9A 4XX1A 4FLFA 3EIOA 5LKAA 4NVRA 3DYVA 4IQ4A 2PPLA 1UFOA 3F8SA 2WG0A 3GA7A 4U2FA 5BOVA 4DNQA 4P08A 3NUZA 1BCRA 3UMJA 5KBYA 2VJBA 4X6XA 3O4GA 5CRIA 3STTA 1PJAA 1VA4A 3WWDA 4Y2XA 3D59A 5DYTA 5AIAA 3QPCA 1JT2A 1N5RA 2WJ6A 3GUUA 3WQHA 2XMCA 5EIEA 3C8DA 3H17A 4DNPA 3AUKA 5HF8A 3FYUB 1FFEA 2X8BA 2JGKA 1JMYA 4X90A 3BF7A 4HRYA 1UK9A 5ALUA 1XZHA 3R3YA 2VEOA 5JD5A 3K9BA 4D9JA 5KREA 5JZSA 2IX9A 3EQ8A 4MYDA 4NZZA 4AXBA 4BYMA 3ESDA 1XRMA 5JALA 4OYYA 4EY4A 2AJCA 2BUAA 1HDEA 2ZYHA 4DTCA 5DYWA 2CJPA 5K3BA 3G7NA 2OGTA 1ACJA 4EHBA 1U8EA 4AN0A 1ACLA 5AKXA 4DSAA 4H7KA 4CG1A 3S8YA 3WYNA 4ETWA 3B12A 3ANSA 2AJBA 3DOIA 2OG1A 3HACA 1LGYA 2ZYSA 1CUHA 2RIPA 1IVYA 2QR5A 4U2GA 3JWEA 1XRNA 4WDRA 3K2IA 4DMFA 1ZJ4A 2I78A 3WA6A 4J7AA 1VXRA 3O9MA 1JI3A 3VVMA 1FFBA 1G42A 2FUKA 2XB6A 3F98A 1XFDA 1WCYA 3PFCA 3W06A 2H7CA 1QFSA 1VA5A 3M3DA 5ALXA 5AK4A 1Q0RA 3OURA 1IZ8A 2G5TA 3U1TA 1DQYA 2PBLA 1A8SA 2QTBA 4HXFB 4B85A 3D3NA 2JEYA 1RP1A 1JU4A 1I6WA 4FLMA 5ALYA 3T4UA 4H7HA 3WWOA 2DHDA 4FFVA 2CB9A 1E3QA 2FJ0A 4OUKX 1UK7A 5LZ5A 5LLSA 2WFMA 4H77A 3MVEA 5E4JA 4IH4A 4KRYA 4LKOA 4EY8A 1ZI9A 4HRXA 2P8SA 1HL7A 3HI4A 4X71A 4A23A 5K3FA 1CUYA 1EVEA 2B4KA 4PW0A 4UBNA 2PUHA 4LYDA 5LYYA 4M0EA 3WZLA 4RGYA 5ALTA 1WB5A 5AKHA 2PU7A 3BDIA 3DYIA 4UHBA 1QIFA 1T4MA 3L1IA 1LPBB 3GFFA 3IUQA 2XLBA 1TIBA 1ODSA 4OSEA 3DKKA 5CT5A 4BDSA 3O4IA 2WILA 5IVDA 1YSCA 1Y37A 4BP9A 2XMDA 4FNGA 5ALDA 3H2HA 5T4BA 4RPCA
chains in the Genus database with same CATH superfamily
1HURA 1E7MA 5FOQA 2MTBA 1A9OA 2QVYX 1CQZA 4TLMB 2HWXA 3TNFA 4IRMA 3OKAA 1G8JA 3KR2A 3PWZA 1P6UA 3OPYA 3G0BA 5AVOA 5JAIA 3WO0A 2B3TA 3LT4A 2OCKA 1N8KA 2VF5X 4AF8A 3QTBA 16PKA 4KR0A 1N1MA 2GCOB 1Q84A 4WKNA 2ODAA 4U3JB 3CH4B 1K8QA 3FFWA 1KZ1A 2I99A 4DLXA 1UINA 2F90A 1UZMA 3VI4B 4RGVA 3D7LA 3OMLA 4CKWB 1PT6A 3K6JA 1ZN2A 1EWQA 1IRIA 2A0KA 1H0KA 3D3KA 3L1KA 5COQA 1OB2A 1MAHA 1T2FA 3PNMA 1HXHA 2VF4X 2PBFA 3GDHA 3Q10A 4ATNA 2X4IA 4CJXA 4ZN6A 5E4TA 4X66B 1CQPA 3V34A 1SC6A 4I5GA 3IQZA 2BFMA 4RE6A 4HT3B 5IJXA 3G23A 4C6TA 1NVUQ 4REQA 3DZJA 3KFLA 4PAGA 3L8EA 3T1OA 3QEMA 2H06A 1BSVA 5KYWB 3QV2A 4LXYA 2YJ5A 4HYTA 2VBIA 3MJFA 3WL5A 3OQPA 4PIMA 2EZTA 4P7FA 4RZSA 4YJFB 1F0PA 1Q50A 1XCPA 4ISBA 2WJGA 4W5WA 3VAAA 3R6TA 1IJFA 2XCOA 4PO3X 3V4FA 4OD0A 2EEZA 4YJKA 5CFOA 3R9IA 1ZIYA 2RKOA 5JDIC 3BK1A 1HWYA 1NJ2A 1Y5LA 3NVMB 4INZA 1EZ1A 3AJ9A 2CVOA 4BEJA 3NT5A 4IEFB 1JR4A 5E3HA 4Q24A 3FSRA 3GGSA 3EJ6A 1H23A 2AG0A 1HEYA 1UMBB 1I0LA 3GWZA 3N8IA 2XOXA 1B1AA 3M2PA 1YHNA 5JJBA 1GQOA 2FQ1A 1R0KA 3QBJA 4JFRA 1KY4A 4N3CA 3HCFA 2JFHA 2WYWA 4WLFA 3LHFA 4BJHB 1LLDA 3EB9A 2ZYDA 3QE4A 3N53A 2MSCB 3R9KA 4M83A 1NXVA 2CVPA 4LNUB 4UCXA 5FNVB 4IIVA 3N0RA 1IHUA 2ZE5A 3ABQB 3VC3A 3PHHA 1YA6A 4L5IA 2IYNA 4V0RA 1GPBA 1B2LA 1TQ4A 2OBMA 1RQXA 3P2EA 2NU8B 3UKOA 1ZH4A 2CJXA 2J07A 3DOFA 4JV5B 2VK1A 1MN6A 2XITA 3INYA 2Y0EA 5EVJA 4FFMA 2CDNA 1XZCA 4DRYA 1JJBA 2GHTA 4YJ2B 1O87A 1T3GA 2FZGA 2V7VA 1CUVA 2QT0A 2Y2UA 3MRVA 3KQPA 3RRXA 2X5OA 2P9EA 3H4MA 3Q7SA 3RKUA 1KEEB 4DVGA 1GG9A 2PA0A 2BGMA 3QUBA 3N2GA 2WM8A 5DTMA 1PR3A 3WAJA 5SY6A 4IWXA 4L0QA 1KYTA 1ZH2A 3KSDO 4CMHA 4CIBA 2XT9A 4R8RA 2NQTA 2H2HA 4PCVA 3IDOA 4IHAA 3TOVA 1CUWA 4W9NC 2HW8A 4LDNA 4Q1AA 1EFAA 3RUIA 1V8PA 1OBCA 1SVOA 2D1FA 2IHVA 2IBMA 2P2CA 2QUKA 1PFWA 3CPJB 4JP8A 5FHRA 4E1AA 3T5AA 4ASUA 4NZ9A 1L7MA 1JYSA 3E9ZA 2D5LA 3A25A 4MIEA 4UCWA 5HG0A 2DLDA 4RHXA 4CUZA 4NZNA 4JR2A 1XZNA 2P0AA 3CPHA 4RCVA 3N8DA 5MGBA 4JUFA 2L2QA 4OFBA 2RHWA 2NUTB 1OHHD 1XXHB 2IP4A 4G0QA 1U81A 2ZIZA 3A9WA 5CXQA 3LHKA 3VVLA 4R2XA 1CYDA 1LJLA 1W4LA 2AE1A 3J7TA 1JHVA 1ESNA 3CG4A 1X1EA 4I4IA 3DOJA 1F1JA 1WCXA 4TV9F 5SZJA 3P32A 1W581 3OM1A 5JZVA 3KJNA 3P9RA 4FUQA 4MKFA 4QOSA 1DS6A 2QKYA 2IZOA 3QMWA 4HBGA 1RVV1 4QLAA 2Z83A 4JI4B 4DMMA 4X62B 1FX1A 3IEXA 3PV0A 2HO4A 1LUAA 1O1YA 1D2GA 1BVYF 4IWYA 1JN0A 3EARA 3QVGB 3ZGLA 3KZ1E 5GIPE 4IZHA 1XK7A 1WCV1 4ID9A 5LUBA 1QP0A 3RFVA 3OA2A 4O08A 4LOKA 1JEAA 4JYMA 4NS1A 4Q6WA 3SJAA 2FDCA 2UZIR 4EAQA 2QVCA 3EEIA 3JWPA 3VH4A 1QGED 5SZIA 1N2EA 2C5BA 4DJJA 4EJSA 3VFDA 1C7EA 3IEIA 5CJJA 4DZTA 3B5EA 2BUBA 2GD2A 2FQYA 3OM0A 5IF9A 3K6SA 2WJVA 2JB9A 3R09A 3KIPA 4B33A 1R0ZA 2WT8A 5L4NA 2CE2X 3GJRA 2W8ZA 4B17A 3EDYA 1YZUA 2QS9A 5ER6A 3W0LB 2VF2A 4E1VA 1KGSA 1KO8A 2C4HA 2D2VA 1QV9A 1T3TA 5EFZA 4F72A 5JO9A 1HYHA 4TS9A 4E03A 4ID3A 2NUAB 3HL0A 4L8GA 5F4BA 1FJGB 4DCCA 2RCNA 5CPFA 3HWWA 3LO8A 3R7WB 3IMEA 1ISPA 5DH9A 4LGYA 2SKDA 3VC2A 2IIPA 1GCOA 2GKOA 4HL6A 4RWEA 5H83A 1VDZA 3DMNA 3O4FA 3UMGA 1LD3A 4BNLA 2H2AA 2EEPA 2TRSB 3GUCA 4RZIA 4TWBA 3R7BA 4AMZA 4EKGA 3KQHA 1IUOA 2WG1A 4OIMA 4UHDA 4OFZA 4R7ZA 5A5VA 2W6CX 1ODJA 2BDEA 1EK2A 1MD9A 4OYHA 5KTRA 2HA4A 1RM4A 2XVZA 3N39C 2CXXA 3NPMA 4J0JA 2ZGVA 4EUEA 4GOOD 3KVNA 3N2ZB 4JU9A 4DLNA 5D3MB 1ZM9A 1NVTA 3BIOA 3SQXA 2WU8A 3A04A 2ZS8A 4NTZA 4UREA 5F52A 3WSVA 4G84A 4XVCA 4DG8A 3UPDA 1SUCA 2I8CA 3ZI0A 4G4SO 5LCXA 1QIMA 2H0AA 3BZWA 4ARUA 1N36B 1ZGGA 1HE3A 4CLXA 1QORA 4L5YA 2JZOA 3LLCA 1YAHA 2GZRA 3HZHA 3CLSC 821PA 4X8MA 1C9JA 2O5RA 1SB9A 5A4KA 1JQDA 4Q4AB 2GMWA 3MTAA 2BGGA 1B15A 4WQMA 5B1SA 1E1YA 4QNMA 3VJKA 4C4SA 1YF3A 2CMKA 3FJYA 4RM3A 4ZI5A 4HDOB 1SC1A 1H2AS 3JVVA 2OXFA 2HA7A 1HQYE 1SQFA 3G7SA 5B37A 3CRVA 2OM2A 1T2DA 1WUYA 3TIFA 2PT6A 1W36C 1H4SA 1Z35A 3C1OA 5DBIA 4UTVA 1T4DA 3QMVA 4NOJA 3ZCPA 1JFTA 3NIFB 3K0KA 1UC5B 1V9SA 2Z9CA 3N8HA 4M1KA 5BNTA 5CLFA 2QAGB 3EXEB 5I7UA 2BGNA 4BJ1A 4ZHSA 4KCGA 3UA4A 1X7DA 1E2MA 1RHJA 3I3OA 4UTNA 1E0JA 1U0JA 3W6ZA 2HLPA 3GN2A 5KWJA 5L3VA 1JYFA 2F3UA 4ZDWA 3SAJA 4F2PA 3HO8A 4Z7JA 5U9CA 2BYTA 5KNDA 2VOEA 4Q48A 4BBPA 4WZBA 2UDPA 4EMTA 1EB8A 4I55B 5HK8A 2WNIA 3CZMA 4OQYA 1NVKA 2CK3D 2OCBA 4NSNA 5HKAA 3B1YA 5KWEA 4DLVA 4MI9A 3R5FA 2ZRGA 1QO7A 2W6ZA 4ZEVA 1LBHA 5ILGA 1QX3A 2OCGA 3I0MA 4EEKA 1CQJA 3ADBA 1CWUA 4BNWA 1REQB 4KMRA 4BYGA 5ADHA 3VV3A 2VDQB 4GHWA 3DFMA 4HDQB 3SJCA 4C7VA 3TUZC 1TW3A 3RAEC 2Q27A 3DHVA 5D86A 1C1XA 4R2HA 2FKAA 5C1DA 1CYEA 5LLTA 2GSDA 5CTJA 2HF8A 1NURA 1OVGA 1QK4A 3N9IA 1FMFA 3EVTA 1WHTB 5FJIA 5D00A 3G85A 2VQSA 1V96A 3LBNA 4J0DA 1EQ2A 3AP3A 3GNLA 3GZ4A 1BMTA 1JSXA 1Z16A 3CSSA 4RE5A 3LMKA 1M5RA 1F7UA 1E4OA 2QXUA 3M89A 1D1TA 1ESMA 1VE3A 4DMUB 1V39A 4EH1A 1I7PA 1OGYA 2KBFA 3FCXA 3SICE 3KQMA 2XVMA 3ZWWA 3X2SA 1R2QA 3C4VA 3VU1A 2B35A 2B2NA 4ZJUA 2H1VA 3I1IA 1U0SY 4BL5A 1PUJA 1JHQA 3N0XA 3IOYA 3ID6C 4XIFA 1PLJA 4PG5A 3AV0B 3BA6A 2ES4A 5HW0A 4PPNA 5JAPA 1KORA 3JQFC 1NATA 1K08A 5IAJA 1KBZA 1SGWA 1Z6ZA 4WE3A 5HOEA 3KXPA 3R3VA 1AHIA 1FYVA 2HBQA 2JGMA 2PM8A 2JHFA 2WYUA 3GP5A 2GM5A 4LRSB 1O6BA 4RD0A 2ISCA 2F3SA 3KG2A 3RVDA 2ZROA 4YPOA 2XMSA 1L4KA 1W5TA 1B8NA 4JOBA 4P34A 3T7JA 3U4MA 4Q1FA 4F1KA 4RTMA 4FC6A 1YRAA 2FOXA 3OQJA 4HNAA 4TMFA 4L8FA 3PQ2A 4GDFA 4EAAA 1PF7E 1POWA 4XVRA 1EFRA 1HE1C 1E18A 5ALEA 1EDEA 2IRWA 1P8AA 4F21A 1AMUA 1BXGB 3OLVA 4NYIQ 4U5XA 2W9XA 3AKEA 1NBOA 1LI4A 3Q5GA 1ZLYA 1EXWA 5ADVA 1FNBA 1XN1A 4OHXA 3FNQA 3U4IA 2ALJA 2BE9A 2CEKA 4QDTA 4K6KA 2JFZA 2FZ4A 1KOFA 4LJ9A 3ZWYA 3W6UA 1QQ7A 2B8JA 4DCUA 1A8IA 2V5UA 2XT0A 3K31A 3LC7O 4OHWA 1FMTA 5ERYA 4DCOA 4DLAA 5JO0A 5LOVB 1V45E 1JT9A 1J5PA 1Y9EA 3NHSA 4CF3A 5AW7A 3JAKA 4G65A 4EY6A 3OAAA 1FW6A 2R8PA 2WIBA 1KK1A 3E7PA 5HX7A 3MT8A 4BE7B 2II6A 4E2FA 5DHUA 1QVAA 1Q1QA 3D7RA 1XTUA 2JI9A 5CT9A 5DIZA 2QI9F 2O3TA 4LXUA 4X00A 2E4AA 3DDUA 3K9NA 3I4FA 4X6LA 3RK1A 2AW3A 1YR7A 3GLUA 4QUIA 4A0FA 4E11A 3G5LA 2EFDB 1BN6A 5FQOA 2C58A 2X8WA 1DU4A 1KP2A 2B5VA 3PHJA 4CF5A 2Q3EA 4CMIB 4CR8A 1SXQA 3AVTA 2G0AA 4JB2A 3ER8A 4D4MA 3P0EA 4OQPA 1Z68A 4B4VA 1I94B 3IX7A 3N6RA 1I5EA 4IJMA 3DAFA 4KPGA 4LC0A 1GZSA 1Y4AE 3FNFA 2Y99A 4DIFA 2ZBUA 1Q6YA 2QVXX 1DJOA 1H9BA 3P9XA 3SJZA 4RTPA 2FG6C 5E8RA 1XDZA 2XDQA 1Q92A 2F1HA 3OC6A 4UOEA 4KUEA 1C30B 1CVIA 5LZ7A 5TT1A 5CAEA 4NZMA 4UOZA 1TK3A 1VRWA 3M83A 3QTLA 2BGUA 5CNJA 1QJ4A 3R77A 4PLGA 3VJLA 1ES9A 2XKBA 3GH3A 1OILA 3W5DA 1C3LA 1SUFA 1EINA 1GUBA 3E1KA 5CA1F 1N32B 2QX9A 3L0IB 3LX6A 5IKMA 1GG8A 3G7UA 3EVCA 3F9RA 3R75A 1WKBA 3TL3A 3OWXA 2AFIA 4EJFA 3BSSA 1UZLA 5IVIA 2Z8XA 3OZWA 3NDIA 3QU9A 1X7YB 2C4MA 3BWYA 4LZZA 4ZV4A 3UT6A 1XSEA 3N8GA 4HN2A 3V8PA 1LQUA 2O3JA 1TVKB 2EX1A 2IPAB 4H0NA 1O94D 4L4RA 4EY7A 1JDNA 4NENA 5HGJA 1MLDA 4CL8A 4DWJA 3UCEA 4E4RA 4L5AA 1E5DA 3TOSA 4ZI3A 2XI4A 5ITWA 1TADA 4IPTA 4G9BA 2AL7A 4CU5A 1MIOA 4B6GA 3M4YA 2VNKA 2A5YB 4A6PA 2PX2A 3L7CA 4Y6GB 5I45A 2O59A 1N2SA 4GEGA 3BE4A 1GLVA 3C87A 1M6YA 2FVXA 4RD2A 1M8PA 1DP4A 2XE7A 1P9RA 4RYDA 5BRJA 1T35A 2AKAB 3OCYA 1B43A 2R0QC 1XJWA 2O2HA 3EXIB 4QG7A 2HM7A 1GPMA 2Q3HA 4Z9FA 3SYNA 2ZT8A 5L7TA 2OPHA 5LXTB 2HRDA 4CIYA 4LF9B 2XXAA 4RNDB 4RMNA 5BSRA 3SC2A 2O48X 3BWEA 2QSYA 5FI1B 3LIPA 4WPGA 1E1LA 4UHJA 3RH0A 2RHCA 3K9CA 3UQYS 1I2AA 1IN8A 2WSMA 1VPWA 3WS7A 1ZWLA 5CA1A 5BN4B 2HADA 3PPVA 2QRLA 1A2KC 2RHGB 2VTEA 1A5TA 4DCPA 1QV6A 1KNXA 1F5SA 1ZCFA 2J9GA 3IDFA 3KOXA 1QYWA 1UJ6A 2H31A 3AT1A 3LCUA 2P9GA 4INAA 4K40A 5HXAA 3HR7A 3DDWA 2PX6A 3T9AA 3TVTA 2NP7A 1E77A 3RVRA 3COSA 2FFQA 1X1SA 2HXYA 3WISA 1J9EA 4AC9A 2VZLA 5I7WA 1L4BA 2J5KA 4N41A 2PKRA 4QOFA 3Q7RA 4UE2A 1XLTA 3OEYA 4FKBA 3IHLA 4H1UA 2CGEA 2BM1A 2HK8A 2PZEA 1K0FA 1QH1A 3QVOA 5FTNA 1NC1A 3ZWDA 2CV0A 2MYTA 3LT0A 2MCFA 5K0ZA 2TMKA 3PNBA 2A0YA 1NNEA 3PGA1 4YQFA 4HDAA 3JVIA 4ZOCA 1XGKA 5KQRA 1K4KA 4JSYA 4GPBA 4CMEC 3TRFA 5LQAA 2JANA 4LWZA 1UOQA 3DBLA 4OXQA 1DCMA 5ARDA 4WBNB 1CLUA 1ECPA 1MX1A 2E87A 3ESAA 1ECBA 3QU5A 1RZUA 1B6SA 1KFBB 2JGLA 2VHZA 3C6QA 4FCVA 2JL1A 3RVJA 1G3IA 1L7NA 4O29A 5JASA 2Z2YA 1ZMOA 4XCXA 5ALFA 3EXAA 5FA5A 3CLUD 4KN8A 3RTEA 5BV7A 1IZ7A 1E6UA 3K6KA 1RI3A 4GUAA 2BRUA 3LHSA 1QGUA 1SCNE 3VTFA 4DHEA 5C7LO 1VLZA 1UXIA 4EUFA 1HI9A 1F06A 3PUZA 1X0XA 4TL9A 1V26A 3NYWA 2DFPA 3N6XA 3OIDA 5IKOA 3ZIAA 5T3YA 2VZ8A 4RM2A 5D01A 3VKUA 3GLFA 3TINA 1EUYA 3TRDA 1HTBA 4NBLA 3T4EA 2G07A 5KOJB 2E6UX 5E7IA 2K2WA 1E79A 1RS0A 2B25A 4Q1BA 3QSYA 3BG5A 3THOA 3SQWA 3PF8A 5JZOA 3PYMA 1GCIA 3EMVA 4GGOA 4MUFA 3VU3A 4YQZA 3ZS9A 5AVSA 3GPDG 4I50B 4FHGA 2GYUA 4XYLA 4QEDA 5LYJF 2JCYA 4WZAB 4Y3UA 4XUEA 2QTFA 2VHJA 5I9TA 3S99A 2WTUA 2PMBA 2DKOA 1KP3A 3TQOA 4DOMA 1Z0IA 4MQUA 1K0UA 3I4LA 4XWAA 4OOFA 4Z0HO 2BEUB 1YHZA 5EEHA 5JXIA 1RCUA 1C9MA 1T29A 1CX9B 1FYFA 1GYPA 1T25A 3LH5A 1OIXA 1HE5A 3K2EA 5AVKA 1RD4A 2ON6A 5T4FA 4BLWA 4DDWA 3ZVMA 4FR2A 4ZVSA 5TGZA 4BUJA 4B3XA 4TUYB 2CZCA 3IQHX 1E1CB 3LYUA 2PMCA 4KP7A 4RPIA 5TGTA 3IHTA 3UQZA 3ZC3A 1J97A 4OGKA 3SLGA 1ZAYA 4J2OA 3N2EA 3DW1X 3WXMA 5DM60 3DEAA 2PSFA 1NNUA 3OPMA 1QE5A 3RC1A 3AHEA 1JUDA 1UKEA 1GSIA 3T8YA 3U3DA 4EHDA 1TTTA 3AVVA 2G40A 4JBXA 4CEHB 3OO0A 4H3VA 5DK4A 1W29A 2QLBA 2UYQA 3UK2A 4A6EA 1SURA 3KEMA 1AK9A 3TJRA 2QN7A 3ND7A 3MT7A 3NYRA 1N2IA 4HCJA 5L7WA 1X1TA 2OAQ1 3U81A 4DIDA 2Z5FA 2COEA 2OD9A 1XCJA 1ZXLA 1AGYA 3PF9A 4HGRA 3BQ9A 4YI5A 4FCCA 5CT4A 3SY8A 3TCXB 4RTSA 5BQPA 4KTVE 5DJ5A 4OJQA 3DTNA 5LYJA 3W5AA 3VDQA 5FUMA 2OWEA 4Q4DA 1E99A 1YBHA 2GEFA 2XUHA 1H22A 2IUSA 1ZGAA 4PRKA 2RGAA 1VL2A 4Q7EA 1YS2X 4N1AA 4YMIA 1W47A 1VHWA 1SBIA 1QGDA 2HRBA 4PG7A 1AKVA 5IFLA 5BRAA 1ISGA 2FYTA 4OQQA 1U65A 3AWIA 1MJHA 3OKFA 4BVAA 1Z33A 2D8AA 3Q12A 3B6MA 1OCEA 1THTA 1XRSB 2GS9A 3QOWA 2G9QA 5DM0A 3TBKA 5BWLA 1MHTA 1M6HA 3RNLA 2ZSHA 5A7HA 2DY1A 1L1QA 1XELA 1NJ8A 2EARA 3DZBA 4QTXA 1R1DA 2CV1A 3LK7A 3BRWA 3RM3A 5IWCA 2AC7A 4AZ0B 2JJ2A 1WOYA 1FUUA 3JARB 3ODPA 4DQ0A 1OH5A 3TI9A 1Q1AA 1XAIA 3DTVA 2B8EA 2BKXA 4PVCA 4ILEA 4AL4A 4L0MA 5ALMA 4BP3A 3CX3A 4O2BB 1O6FA 4MIOA 4KBFA 5FO1A 4B84A 3M49A 1CIJA 1MMFB 1TVEA 1YQGA 3H5RA 3PNYA 2CVHA 4TWZA 4ZZIA 2Y1DA 1EUDA 3CNEA 3NONA 2NT4A 3NXSA 2L42A 4M9SA 1SOAA 4RUKA 4V0KA 5KX5F 3D54D 4QBGB 1LRJA 1Y3AA 2E4VA 4BMSA 4Y2PA 3H4TA 1N2JA 2JW5A 4RFVA 3TIXB 4I9UA 1VDMA 5A02A 4QTTB 2WQ7A 4N6GA 1YQWA 4YAGA 1CUXA 3W2TA 2XQKA 3G49A 3KVVA 3NHLA 1SXGA 5CLHA 4G4IA 4TLLB 1XQ6A 2XCIA 4WERA 5THXA 1VKZA 3TCKA 1RHMA 2VJAA 4OO3A 4HB3A 2I7TA 4EFNA 3OJFA 3M1AA 5JYBA 4BLQA 1A7AA 2VCEA 2WJYA 4LV5B 4R01A 3DD1A 1ZMRA 4AYXA 4LV8B 1G4HA 1N0VC 3D9QX 3BIWA 3ZH9B 1MC5A 3NHMA 1FMJA 3ZCQA 1NU6A 2WTMA 4S05A 2V4ZA 3MJDA 5HNKA 3K9GA 1LXCA 3CTPA 2FR0A 1L3IA 3CX6A 4K9PA 1Q7TA 3M6MD 2RHDA 3N59A 4QYIA 3SVTA 4TTJA 1V6SA 1TQHA 2NU7A 1AXRA 2HD4A 3F7NA 3R0JA 4DUGD 3DR3A 2O3RA 3LUPA 4NV1A 4B3TB 1C3OB 3A11A 4MS1A 3V7FA 1F2TB 1U5BA 3OEWA 2B94A 3QX3A 1J4AA 3I72A 2PH5A 3OJEA 4H7DA 5KTYA 3GG9A 4CNBA 4MJ3A 5J43A 4J2HA 1VKJA 4Q3KA 1S3SA 3MS7A 1B26A 5KSWB 5KX5A 1SFRA 1T5HX 1IXZA 1NUSA 2X2EA 4MW0A 1QDEA 1P7CA 2R68A 3DEYX 3KKZA 4DEXA 4Z86A 1GAQA 1DTSA 3KWFA 1R4NA 3H6KA 4M1QA 4J16A 4HQFA 2CSUA 4ZARA 5HOQA 3WGOA 5IJ9B 1S8OA 3NALA 1RM3A 1P2FA 5IPFA 2OAGA 1KHHA 1QE0A 3IHWA 4M4SA 3CRMA 4WECA 1NMZA 4A1FA 1WF6A 1GNVA 4HD8A 1OGJA 4U6SA 3CSDA 2GD6A 4DQKA 3DDHA 3F5FA 4OK5A 1N2XA 1L1FA 1SOWA 1OXMA 4G0NA 4GPZA 1A98A 4CGZA 2EJVA 5AQEA 4JLOA 3ZNNA 1JR3E 4ZOAA 3PDJA 2FSUA 2AN3A 4P92A 1JZTA 5TMDA 1ZA2A 3CNLA 1DE0A 2ENUA 1STOA 2NV0A 4FYYA 3TRKA 3VNSA 5E3JA 4HX5A 3RO7A 4HMQA 1NTRA 3BTVA 1Q0TA 1U2ZA 1C8VB 1X1BA 1NULA 3CUVA 2HWUA 4LZNA 4PHGA 2AUTA 3IILA 3DO5A 3H8SA 2PGLA 2PO5A 3K0AB 4CUJA 4LX8A 3RUFA 4EFLA 5J47A 2MYNA 3N75A 1DT3A 2YYAA 1E2PA 1HDZA 3WQBA 1R10A 2AYYA 1MVNA 2AD5A 2Q2QA 3WWEA 2B7CA 1FEZA 4DR3B 4KODA 2VDUE 1M34A 4KI0A 3HJNA 3QHPA 3R41A 2REXB 1N2CB 4E7OA 3H04A 1GPNA 4DIOA 1E6EA 1X7WB 2P90A 1D2HA 3CKKA 3JW8A 5DNCA 4FC7A 2GTPA 4GE0A 4MUMA 1WOMA 3KWLA 3FY4A 1D3AA 2OGWA 3H7IA 4W5NA 1Z4LA 4GYKA 1FQWA 1XNJA 1JR3D 1J0CA 1L7XA 1WQ4A 3ANTA 2EKQA 3OLCX 4KWHA 4X1YA 3RWOA 3WL3A 4HRAA 2KM1A 1TJYA 4C6HA 3DMTC 4QOIA 1T13A 2ORIA 2M9MA 1N3LA 4OPMA 2C98A 4NBUA 2Y6VA 2KW5A 3KU1A 1I13A 1RI1A 3B2QA 2OR3A 3NH9A 1WG8A 4L4SA 4Y6OA 3MMPA 4QSHA 3JALB 2ZJ1A 3LPMA 3OOHA 2VJPA 4DS3A 3KZMA 1N5LA 4FZJA 4L4ZA 2XD9A 4ODIA 1DRUA 2DECA 3MWJA 3RHTA 1HDGO 4I36A 3IKMB 4AWXA 4B7ZA 2PX4A 4LGCA 1Z63A 1IEQA 5KIAA 4KB5A 1QPGA 1V35A 1XXHE 3WNBA 5K01A 5DLQC 1IQRA 1X7GA 2FU5C 4XD2A 1RACA 3KJEA 5TSDA 2R9VA 5ALGA 3VDXA 4CQMA 1B0UA 2W8BA 3EFOA 5ECWA 1FDWA 3TDNA 3OT4A 4MQLA 5IF3A 4TLDA 1FVXA 4KLAA 5F1PA 2GEVA 4M8KA 3P71T 1K5GA 1MEOA 3EBOA 3P0HA 2NTNA 2PFSA 4MGKR 2QLTA 4MYRA 3C14C 5AKZA 4AFNA 3HPQA 5HIKA 1W76A 2H4FA 1JEYA 3E23A 4AS3A 4ZCMA 2FEAA 4YRAA 3BEOA 4I2VA 1G8GA 3LUAA 1DAHA 3ZHVA 2AR9A 5CVUA 3Q0IA 2F2TA 1DFHA 3GVPA 3S27A 1PK7A 3QF4A 5L8VA 5C2JB 4F97A 2HT1A 2Z2IA 5DEOA 2CD9A 4KE8A 4GIBA 4B31A 3QXCA 3O83A 4EB0A 1PWXA 1GHTA 1VL1A 2L19A 4PLZA 4ZXFA 2GZAA 4GI5A 4F2WA 5KJCA 3RHSA 2PUGA 3JQRA 3CB4A 4L75A 3F0TA 4GLLA 1NSYA 2OORC 3KHSA 1V1MA 3E2IA 3PB3A 5FWAA 2QG6A 4M6WB 1EFTA 2I66A 4IV5A 3BD8A 1QO0A 1ZDMA 5ECGC 1DKMA 1THZA 1VPTA 1KDTA 2B7LA 2W2QA 2WV7A 4FZ3A 2NUPB 4G89A 4JQOA 2VJMA 5DBFA 4ZEOA 5KYYA 4BXOB 1AC5A 2QX6A 2R751 2CBXA 4CFSA 3ELBA 2CKDA 3PC3A 4RS3A 2GXAA 5JWRA 3G0IA 1U9IC 2LNDA 3M5PA 1FU4A 4E5PA 5F1OA 2WTEA 4G25A 2CNLA 4Q47A 4GM0A 3D1LA 4EI2A 4ZGBA 3Q15C 2WIGA 4LBVA 4LXQA 1XDSA 4E31A 2QT9A 4PO8A 3ECSA 2W71A 3DULA 2KI5A 2C9YA 4ZAWA 3QW2A 2QRVA 4QDUA 3TTTA 3OTGA 2IU0A 2FCAA 1H6CA 2NZJA 5K8JB 1ZEJA 2P4QA 2I03A 2FW0A 3T1VA 3ORFA 1TT5A 1WLYA 1DIRA 1JECA 3KT3A 3STYA 3AUFA 1ISMA 1GG5A 2V4MA 1ZUHA 4IUBS 2LP4Y 3BF8A 2CB0A 3FPBA 3OTWA 5AKJA 4ZQIA 5K0FA 4MS3B 1RXIA 4B3RB 2DWPA 3HQ4O 1NYTA 4NDAA 2R00C 1NNSA 3ZLBA 4A27A 1WUJS 3K5IA 5GZ6A 5EZ5A 5CDGA 3E3NA 1GTSA 3HBMA 2GJ8A 2DPHA 3X1ZA 1XIVA 2BC9A 4Q93A 4X6YA 2GLTA 1OF1A 3BRCA 3M6XA 4U9HS 1S3IA 4MKXA 5ICMA 1GNQA 4ND8B 3QUTA 13PKA 1O89A 1A9TA 4BVKA 4RDIA 2VNJA 1UCFA 4RW0A 4P4TA 3O95A 1SZCA 2IHBA 4OMUA 4D0GA 3HTXA 4BKOA 3WMGA 4YK7A 3CR8A 2VATA 3AUXA 1YB6A 3PXUA 1BDBA 2R84A 1L5HA 4AP6A 4D3FA 2PIAA 1Q6ZA 3AIKA 3UG7A 3T52A 2IS6A 3M5WA 5FADA 3GYBA 1P2VA 3A1CA 1G63A 4LG1A 4PLHA 3WZMA 3A6ZA 2B6HA 4P7JA 1O96A 5FJJA 3QELB 2PUCA 1RWMA 3L0OA 4OXYA 1RBMA 3ECCA 4MROA 1RZRA 1XI2A 3NBFA 2A6PA 1I24A 1U80A 2NTYC 1NBWB 1E8MA 3OZCA 4GH5A 2Y1CA 6ABPA 1X0VA 3ESBA 4YC7A 1SVIA 3V80A 4B80A 4EB3A 3DUFB 4NMLA 1SR8A 3WLOA 4N0QA 1SVUA 1XMPA 1GUZA 4FMPA 5TQ2A 1G8FA 4H0CA 2HSZA 2F8TA 1C3XA 2A59A 3HPRA 3EPJA 4JC4A 4Q01A 2JLWA 1U4OA 2FW8A 2BH9A 4TKVB 4WFQA 3RLIA 3JYQA 1E9BA 2BEJA 5HJ5A 5AJUA 3F67A 3RS9A 4D26A 2IVFA 1K6XA 2WBLC 2JH3A 3A1NA 3WLSA 3NV9A 3ZZNA 4AT1A 2XQIA 1R9GA 2HT6A 2L18A 3H18A 4YH1A 1J9ZA 1TJ4A 4Y18A 1X9GA 3HYRA 3CXRA 3I76A 2NT3A 1LW6E 5BQ5A 4DR2B 2CZQA 4P0PB 1D4OA 2VRBA 3I37X 2QD4A 1YA8A 5JAOA 5JAMA 2VT7A 4PICA 5G1NA 3UUFA 5HDBB 4KGVA 5IAKA 2RGNA 5EESA 4A8HA 4C2BA 1W5FA 5TE9A 5LMUB 4MRSA 3Q9NA 1UOOA 1M2HA 4DR1B 3FWHA 2OZPA 1ZD3A 2OZVA 1PQYA 3TAHA 5LQRA 3HLYA 4EMUA 1QMPA 5FQNA 1QR6A 2GEUA 5ARBA 1Z4KA 2QAJA 3C6MA 2XWSA 5AOVA 2VVTA 3GLHB 2WMDA 3IURA 4NDZA 3EYAA 1COZA 2VUHB 2YXPX 2RHTA 4YMLA 4LE1A 4CEJA 4XX0B 4TV8F 4KAXA 4KXWA 3NHYA 3QP9A 2NYUA 3C8UA 5ALQA 2FSVC 2PXXA 4TYWA 3CWZA 3FWNA 3S6JA 2BM0A 3KETA 3DBHB 3USCS 4TS4A 4BFCA 4CLEA 1Z4PX 1JDSA 1Y6FA 3HXPA 3CCBA 3WGTA 1H2FA 3TPFA 1QE3A 5KVSA 4OYLA 3PTZA 2VXOA 3KKEA 3IFSA 1HBJA 1A2QA 1QYCA 4LBWA 4EJ0A 1Y82A 2VWPA 2W37A 2X3FA 4BMVA 5I51A 4CXMA 1OA1A 1JDPA 4H7FA 3ZWKA 5K3DA 4FT4A 4V24A 2UXDB 1Y8QA 5ABPA 4C04A 2DG2A 3EQ9A 5IAAA 3EF1A 3EGIA 1S8FA 1P7VA 1PWZA 4OK3A 1QU2A 1A7KA 3WBBA 4AG6A 3OQIB 1ZMXA 2FV8A 1I1NA 1Z38A 3C3XA 3AOEC 3CN7A 4KACA 2Q3BA 2VUSA 3PGLA 1J0DA 4JJ7A 1LBEA 4JODA 2VFAA 4ARZA 2NADA 4YT8A 3SEQA 4E1BA 2VH5R 3BORA 4F1JA 3AU9A 1XZAA 1CKEA 1P91A 1Z8FA 5E0KB 4A0RA 5CDUA 3SZLA 1Y8CA 1HDIA 1XPJA 1MAWA 2EFHB 1HGXA 2DH5A 2IIBA 4KFTA 1E1NA 2JF0A 2EP5A 1YOBA 1VHDA 4II2A 2O1SA 4LVNA 4NCBA 4TV8A 1JDBB 1YJBA 1VPVA 3ASYA 3DB1A 2ZUUA 3EIEA 3EWAA 1OTYA 4KR9A 3MWFA 3OOJA 1LBSA 5K20A 3DM5A 1GQQA 2C9ZA 4RAQA 5JSKA 3ZZUA 2IL1A 4G0OA 4LSZA 4XVQA 2WPDD 2JAHA 5C0OE 4CFYA 4C4OA 3WV4A 3A6GA 1YD7A 3AETA 3EDCA 4R16A 2K4MA 4F93B 3N2NA 1B73A 1FU7A 3JASB 3U39A 4AQYB 2X6QA 1EJ0A 3B1KA 3UUWA 4QECA 3QI7A 2XZPA 4LZLA 2P2NA 4G1CA 1WP4A 4MDHA 5JNRA 2BI7A 2GO1A 4BFLA 3RSSA 3AHCA 2ZIUB 5M34A 2GBFA 3VPFA 1NONA 3TRJA 5FPQA 3FZNA 3L1VA 4EG5A 4RV4A 4F38A 2O54A 2IF2A 3AM5A 3NHRA 2HPVA 4ESEA 3NHJA 3GJ0A 3BERA 5EY5B 2B1IA 4R1SA 3C7KA 4B3HA 5A05A 2W2LD 2C94A 1YGPA 1G2PA 4XD7D 3F47A 1PEKE 2ZB7A 4GLFA 2OFOA 2Z9DA 4HC4A 3AY7A 4UHCA 4B81A 4JHXA 4DXDA 2GPBA 3HKCA 4BQPA 3ZYCA 2ACEA 2I7DA 2KYRA 4B83A 1RT9A 2GZ1A 4X41A 2YHAA 3D6AA 4CCYB 1LX7A 4BN4A 1FP2A 2F48A 3F6RA 3FI9A 4J9UE 2PD4A 5DXAA 3HXQA 2Q3MA 2P2ZA 1UBNA 2Y67A 3HE3A 1U7PA 2DCMA 1AA6A 1AKYA 3OETA 5I9MA 1XBTA 3BL8A 3F90A 3KYCB 4MA5A 1MJNA 3HA5A 4LISA 1T1IA 1IY8A 1OC4A 2JFQA 3KX2A 4G85A 1U8AA 3M2TA 1OHHA 4CMAA 4ZCIA 3ZK8A 3U7HB 4HEHA 4F9EA 1F1BA 5CG1A 1W44A 4C3UA 2G9ZA 2PNFA 3QQPA 4ER3A 1G38A 2DR0A 5NULA 3ZDBA 3KV1A 2P8JA 2ORYA 2V45A 1VI2A 2HH9A 2YWGA 3K1YA 4ESOA 2BGWA 2LCQA 2NO9A 2P2DA 1G6OA 4ZMRA 1V3VA 2W00A 5DRYA 2MSLA 1N7HA 3QXSA 4NFYA 4P98A 1TQ6A 3HHPA 1K97A 3KB8A 3WJ2A 3OM8A 3S1AB 1M2OA 2HAEA 2P9TA 3FOEC 4AG5A 3PDWA 4R1UA 1BVUA 1D0VA 4ZYUA 2WWGA 1LPPA 1PUIA 4XM2A 2WPNA 5C5CA 3RTCA 1V4BA 5I9NA 1EB9A 1IBKB 3DKRA 5B3JC 4JXZA 1MABB 3P9NA 2VQEB 3KTOA 2XHZA 2ZWOA 1MGPA 4QU8A 1KQFA 5G2OA 1A1SA 3HUEA 3N2YA 2UVPB 4J3FA 2ZSJA 3IQGX 2APJA 1QFZA 5A62A 4I9NA 2C2XA 3CB2A 5LL6P 2ZCVA 4XRRA 5DWQA 3HLKA 3VUFA 3T4XA 3PUIA 2R5FA 2YMLA 2ZETA 2D62A 5A3SA 1NKSA 1HLGA 1Z4JA 4TYYA 3ORYA 1BAPA 1JE0A 2JVJA 3G2QA 3UFBA 4AY3A 5JECA 5EHQA 4HRVA 1XAHA 1EHCA 1AX9A 1YL5A 1YB5A 4BZPA 4G5FA 1EA5A 2NWQA 3RUAA 3FH0A 3SFTA 1VG0B 3WLKX 2E49A 2IYEA 4BMYA 2DTEA 4O3FA 1I14A 4PR0A 1U0HC 1AH2A 1BE0A 1EGHA 2IW3A 2ZYUX 3LCVB 1WIWA 2X7JA 5AI5A 5KOHB 3H5AA 1WXWA 3GNSA 3ZE6A 1DEXA 3E4CA 3ZGVA 5KTMA 2QP3A 1ZM7A 2PEYA 3NC0C 2AXEA 1H2WA 1Y33E 2IDJA 1X1AA 1Y3CE 3V00A 2F55A 1XU9A 4BNFA 5HCUA 1OV6A 4GZMA 4OJYA 3HU2A 5GGYA 3PNOA 3VX4A 4UPDA 3H5LA 4Y6PA 2DKFA 2Q6LA 3T4PA 3U49A 3H3JA 5DN6D 1UT6A 5HZHA 4H7PA 1EUCB 4PZUA 5HILA 4I5FA 2JS7A 4YASA 3K8QA 1CIVA 2G1JA 1PL8A 4ZI7B 3L9XA 1JFFB 1C2TA 1KYVA 2IYFA 1ZUNB 3GXOA 2ZRMA 3FTPA 5A5GA 5TV2A 1UWCA 5JANA 4HWSA 2B21A 1C41A 1PNRA 4MJLA 1YE3A 2BFFA 3H5OA 3V3TA 4BJ3A 3CKMA 4MKIA 4UBKA 2ZE7A 1UDAA 2BFNA 3H87A 3GZNA 4LN1A 5KAMA 3TZBA 3UHAA 1UJ5A 4EG1A 1MOZA 2ARKA 3GEEA 3H9QA 1TZ2A 2H48A 3ENKA 2E9SA 2JLBA 1SVLA 3OFKA 3AB3A 4Q3CA 4ZJYA 1DBSA 1ONBA 2O5VA 1RADA 3I53A 1VPDA 5K0EA 1ESDA 3CIOA 1L7RA 3GRCA 1JDTA 2X1LA 1T9GR 3K0CA 5L3QB 4TYMA 4M36A 4MS4A 2G7MC 3L7IA 1B3BA 1Q7CA 3AF6A 5E6UB 2V54A 2H1CA 2XUDA 1XLUA 3AG6A 4NR0A 1U2RA 2FSGA 1OLUA 1PFUA 2B8NA 1NNI1 1I2ZA 3KSRA 1I1QB 2O2ZA 2P3QA 3PHCA 2PLFA 2ONCA 1E3WA 2A0FA 1GPDG 3P52A 4KE6A 1J56A 4RPLA 4BPRA 2PGOA 4B4KA 4BFYA 3I9LA 3OP1A 3UJBA 3CKLA 3NTOA 3ZCUA 2VDLB 4QFBA 7AT1A 1T4CA 4LZAA 3PGKA 4N0PA 1Q20A 2DFLA 3DQPA 5C81A 2XNKA 3OFSA 1K6MA 2P41A 2XBUA 4K6HA 4G5QA 2DYKA 3D8UA 1J2JA 4QICA 4WKGA 1FS6A 2CK3A 2O7RA 2JGDA 4KIUA 5KVVA 4C0WA 3JVDA 4PU0A 4LJKA 3WLPA 4EY5A 1SWVA 4HB0A 3FB4A 1O9GA 1APBA 2AZXA 2WY2D 3KBOA 3FDXA 4QKQA 1BKSB 3F4KA 1RLIA 1Z5GA 1H3NA 3E6AA 5DT9A 2YIMA 2RGUA 4HTFA 5EGSA 3EODA 4TKZA 5GM1A 3V46A 4NBVA 3ZLVA 1QCZA 4BUCA 5BNZA 5IEJA 4YO7A 4YJDA 3WRVA 2OZLB 4RYLA 2WJIA 3CLVA 4S0XA 1X9IA 2FW7A 1C0EA 3IJRA 6LDHA 1NG1A 3D0QA 3Q9SA 3U4DA 1L7QA 1I3NA 4HHEA 1P44A 4IXMA 3BQNB 4RPJA 1T8YA 3G0OA 3IUPA 3KYDB 4HWKA 1U7DA 2QL7A 3PD7A 4QOEA 5HQ3B 4B7CA 3T9BA 4EFKA 1H6BA 1X86B 4NYJR 3PA8A 5D87A 2HQOA 4B34A 2EHJA 4EFDA 1L5RA 2GPNA 2NIPA 5D5PA 1YOVB 2ECFA 4KN6A 2OBNA 2OCXA 2MT9A 1L5NA 4NNJA 1ST3A 3ICCA 3QXJA 2R1UA 3RYIA 2JAXA 3AEKA 5J63A 4DJDC 1KYYA 4E5DA 3I1JA 3VR6D 1E2LA 4ZA2A 5F76A 1PQUA 2QRQA 1O6GA 2XB9A 4QBIA 1M75A 5CHYA 5CYOA 5T8KC 4OAPA 4FDUA 2HCRA 5F7JA 2DBYA 3ICVA 1NLMA 2GXQA 1L7EA 3EWSA 4DHWA 3RAJA 1A97A 4JJFA 3NFRA 1AKUA 5AW3A 1MX9A 1JILA 1D0IA 2DVMA 3Q40A 2HHAA 5C8VA 4BU0A 4D8WA 5DO9A 1PW7A 3TQRA 2LDXA 4P84A 5DNYB 2KMLA 4UHHA 4X84A 2A1UB 3TSYA 3JQ8A 5BV0A 5CG2A 3TYXA 1TYDE 1KDZA 5YASA 4AECA 5KS2A 2JLXA 3KQWA 1N9GB 1E2KA 2HCTA 2NUBA 1PZEA 4XR9A 1J1ZA 5L45A 2PUJA 4L72A 4WKCA 1LPSA 2H1WA 5K9ZA 1QYIA 3DXFA 3HXLA 1LNZA 2NM0A 5EQTA 1KJIA 5FXMA 3D6HA 4F3CA 5LA6B 2YHBA 1FVFA 1EI9A 1YO6A 3AJAA 3LU1A 1XTKA 1FU8A 4NIMA 4OHBA 3RFUA 4KQ9A 3GFBA 3ZV5A 4C0KA 5ARCA 5JRZA 2P91A 1AV7A 1WZIA 1GYRA 1YHYA 2QRNA 4HDNB 3X43A 2WDZA 3C3PA 4N0MA 5AVZA 3QX7A 2D1QA 4MKZA 4LKRA 5AVXA 3ROTA 1FFSA 4K0KB 3KOUA 3ZUGA 3ISTA 1JKJA 2NAFA 1ZGZA 3OWHA 4AJNA 2JIZD 1EVJA 2ORWA 1MAUA 3CZ9A 1R50A 3MN1A 2I1WA 3VV2A 2P9QA 1AQNA 5CR9A 3GHYA 4AQDA 4ND2A 4JX8A 5CB8A 5JTUA 2D3TA 2X0IA 4TMYA 3SF8B 5B7QA 5AW4A 3TLEA 4PCAA 3DONA 5EXDA 3ZWCA 2QTWB 3QFFA 5A4IS 1HNWB 3MLAA 2R1VA 3FWZA 1L5GB 1FFWA 2FK7A 4F56A 2BLNA 3TPZA 2C5AA 2QENA 4PF1A 3F3SA 3VOBA 3GRVA 4DIEA 2NO0A 3MCAA 1KZ4A 3VSEA 2IDKA 3LT1A 3R5XA 2BEVB 4EYSA 1R0BA 3Q6NA 1MFZA 3C8ZA 1KETA 4EL5A 1QDLB 1VJ5A 3VGJA 4A4DA 1C7FA 4Q3NA 5INTA 2O52A 4WBSA 2VBGA 3D3EA 2CXUA 2GK6A 1WUHS 3R2JA 1W0JD 2YJ3A 5EYPA 3RASA 3SZ3A 3M1YA 2DOKA 2ZEJA 4X7BA 1P5HA 3WYDA 4EL0A 3ETNA 2WU4A 1L6RA 3AUUA 2V55B 3S81A 1CQXA 1CHDA 2PA3A 2MINA 4YCMA 3BGIA 3RIYA 2EX4A 4Y67A 2FQXA 4YLGA 1VB5A 1JEJA 1WB4A 4ENVA 1A1VA 1KI1A 5F7ZA 5F21A 2G1PA 4MPJA 1YCGA 3IPLA 2EF0A 1PDOA 2PWYA 1P62B 5J2TB 2UUBB 5FUXA 2C7VA 4CHTA 2ZAIA 4P80A 5IT5A 3V1MA 3HEMA 1XWWA 2G9NA 3CZAA 3RUCA 2XSZD 5ERXA 2QTVA 4KAJA 4WA8A 5H80A 5C5IA 4JJ8A 1IE3A 3A70A 3BFPA 4LMPA 3RODA 2VKTA 4C05A 1SCIA 4IIJB 3WGJA 2H9YA 5ES3A 1QB7A 2AFRA 2C3PA 4GYJA 1M33A 3ESRA 3Q2OA 4C7MA 4RFSB 4IGFA 4US1R 4XEHA 2HMAA 1Z15A 4M0CA 2YV3A 2B4AA 3DMDA 5HE8A 5HZMA 4MEAA 1KI6B 3KAJA 1BX3A 1O94A 1FSZA 1BQEA 2UZ1A 3HBNA 4CM8A 1KEZA 4YO8A 3ASVA 3I92A 3LUHA 5CX4A 3TX2A 1NXWA 1KP9A 3CURA 5AOCA 2HHCA 3Q2IA 4JVNA 5T7BA 1BEEA 5JBQA 3FOBA 1MAAA 1KEWA 1RE0A 1U2EA 3GI1A 3COPA 3DYBA 3RI3A 4EJSC 4FYMA 4HFMA 4KN5A 1OI2A 1KKUA 1QKKA 2EZUA 4M0PA 4QYXA 2RBEA 3A7EA 3D7KA 2J3EA 3GC6A 1VMKA 4GLJA 4MVJP 1QP8A 4OA5A 5CIYA 4WLVA 3RRMA 4G86A 2CFIA 2ZPAA 3A31A 1PR2A 4CLDA 4FWBA 1F48A 1I80A 3DAHA 1NRXA 4HAZA 5EJAA 5L7YA 4CIVA 1N2CE 1FSFA 1SC3A 1SG0A 2O23A 1II8A 2GJ4A 2Z43A 1DWOA 1GGNA 1HG1A 4CL3A 3U3RA 4G5HA 4L6CA 1OW3B 3SQLA 1LK5A 1Z2CA 3UT5A 5HS4A 2FEMA 3QXGA 4GLBA 4RJ2A 5KJFA 2DFTA 3ZGZA 5GJBA 1KMMA 1E3LA 4YLEA 5DCYA 3TD9A 1WQ3A 3ZU2A 4F6CA 1IN1A 2B1QA 1YZTA 1NU8A 5FPHA 2NVBA 3CO5A 1F4LA 3MAJA 4LJAA 4QUBA 5EKSA 2DEUA 4MDEA 3FUUA 4G4JA 5H59A 5CW1A 5C7YA 4R41A 4I5DA 4Y1GA 4TMVA 1J99A 3PVCA 1TCAA 3BM5A 3VDRA 3EYWA 5E9JA 1WDMA 3GGGA 1YI8A 4MVJE 1M8KA 3DDCA 5BVHB 4ND4A 4M0MA 2GN1A 3HJTA 4MQ5A 1NIJA 4BCBA 1GKKA 2QK4A 5IANA 2IA5A 3JWHA 3HSSA 5FFNA 3HVRA 3MJTA 1S9DA 2FX5A 5AKIA 4FTWA 1G5TA 2QRPA 3H9BA 3VAZA 3ZY5A 3RFTA 4BNTA 1O5TA 2PH1A 2QYTA 2WD7B 2ZE8A 3FUCA 3N2KB 1OLXB 4ZVUA 5AHRA 1CJKC 5GM2A 4HR7A 5F7XA 1ZIOA 3DLHA 4YUZA 4GEKA 1Y7PA 4XSGA 1QHIA 4GQBA 5ITZB 1DIHA 1NJ6A 3ZOZA 1A5SB 1PI3A 3BXFA 3B7GA 5DLEA 2ZYWX 1CY0A 2OILA 2A3RA 2ROQA 1M1YB 1RXCA 3A1SA 4B2IA 1M67A 4GDMA 1GY8A 4RORA 1BW9A 4QYSA 5EIXA 4XM0A 2HHJA 2RAUA 4U7GA 4LBYA 3RTAA 4AKTA 3COWA 4CMGA 1G2OA 2VIIA 1QHGA 4RLHA 2M6LA 1JQ5A 1M74A 4PFKA 1EX7A 1OZGA 1P6XA 5FRDA 4DCSA 3P96A 1UBMS 3QFRA 3N86A 4F6RB 1FYEA 1LBQA 3O3CA 4MR9B 3U7GA 4GI3A 3U37A 2EOAA 4NFLA 4XTRA 1IM8A 2YXLA 4KL8S 1FQKA 4K9OA 3ZNQA 3ROXA 2HJGA 2OWDA 1G5QA 2A3NA 2I9PA 4HJXA 2W2MA 3NB0A 2HRQA 2IEIA 4G36A 1PBNA 1LB1B 4TSKA 1H5UA 1GQSA 1L4GA 3WLJA 4DNOA 4ERNA 3SE0A 2PQ0A 4IS3A 4KEAA 3W4JA 4K9MA 3KL4A 4TVSA 3KVOA 1WCIB 1RQRA 3MINA 3RJTA 4ZQCB 3U3XA 1C4WA 1K8YB 3H0EA 1KS9A 2XYQA 3V6LA 4AY4A 5JAHA 5I5EA 2QN3A 4LJ6A 2HIGA 2GPWA 1YBAA 2J3DA 5B30A 1M2KA 4MRNA 1YXMA 3ON5A 5K8CA 3S2YA 4RSHA 2IS2A 1NPTO 2RARA 3O47A 1G3UA 4HQOA 1GGKA 2LDBA 4S1VA 3W8EA 4AB1A 4AROA 2EL9A 2I65A 4JLKA 4C3OB 3HCOA 4V1CA 2H8GA 5EXEA 4B71A 4LV6A 4G37A 5C4IA 1HFEL 3EQ7A 5ESXA 1CB0A 4HMOA 2XWJI 3ACCA 3KJGA 4L9AA 4MQFA 4RL4A 1RYHA 1KVUA 4JD5A 3NXKA 3H8WA 4OKIA 3ZE7A 1WULS 3SNKA 4RTRA 2IYVA 4JYZA 1UIRA 1HH4A 4MLDA 2Q7OE 3ZX4A 4A10A 4DRZA 4PGHA 3PC8C 4D3ZA 1SQGA 1PK9A 3ZX5A 2LIPA 2RBKA 1JIJA 2G06A 2GZ3A 2QE6A 3CF4A 3EASA 3G2KA 4G81A 4JYBA 5GINE 4C7JA 1DTWB 5B36A 3LTNC 1UFQA 3ICOA 3GIDA 4NMHA 2ZSBA 3LOQA 3RBXA 3SM9A 4CIWA 4F4CA 3MQ2A 4HAUA 1E3MA 5AI4A 3TMYA 1LQTA 4TSFD 4UVHA 4Q05A 3W5CA 5KAPA 4J1QA 4ZYYA 3ZD7A 2WTAA 1XVVA 2QROA 2IDZA 1HYEA 5I9IA 4MH0R 3PP8A 3RT1A 4FYPA 2WG2A 4P9NA 1UBEA 5H3LA 2LCFA 3LX4A 5IC5A 4DSNA 3PLAE 5AVYA 1R4MB 1IDOA 2AF3C 3E9NA 6AT1A 1VB3A 4KXNA 4YWHA 3UEOA 1I0ZA 2ATXA 2H2IA 2J9YB 1T8SA 3HZZA 3KSAC 4PC2A 5CBPA 1QF9A 2BFAA 1KH1A 4LMBA 1Q1GA 3G5TA 3MUEA 4URZR 2ZTHA 1HYGA 3WSTA 1XCGB 4HXGA 1B8VA 3WB9A 3PFBA 1HV8A 1AF4A 4Z54A 1T0HB 3E82A 3ROPA 4ZU3A 4PXSA 4C1NA 3FWPA 2JEOA 4PBSA 5IJZA 4ARIA 2OGUA 1XOIA 3BILA 4YRTA 2G5GX 3KK0A 2IXEA 4J4BA 5DGDA 3ETCA 5CA0B 1XFAA 2AQ8A 1W2HA 5GPBA 1KJQA 4KQEA 1NR1A 4E13A 2C5GA 4E5SA 2OZEA 1B23P 3QX9A 4I1YA 1NBHA 4M53A 1B7GO 1W2WB 1W46A 3AG5A 3IOEA 4QIHA 4JI7B 1NIPA 1T6XA 5CCXA 3B7PA 3PFFA 4IJ6A 1J2UA 1JIQA 4QT0A 1AKNA 3M6AA 1DBRA 4M9ZA 5TF0A 4ESVA 3UHOA 1QVVA 3G2MA 4BTLA 2MSDB 1H4VB 2B4YA 4RZ2A 3TR0A 4M1SA 3AC0A 4MWEA 4FOSA 3TNLA 2VAPA 2OB2A 3LKZA 4KV7A 4DQXA 4NATA 3QEBZ 2QM8A 3IAEA 5E9WA 5KHLB 1ZHOA 1T43A 1ILEA 2JIRA 4JBYA 4YN3A 3H2KA 1LRKA 3LHIA 5JPIA 3H5NA 3BN3A 3H8VA 2C0CA 5EZQA 5BW6B 3KJIA 4E4TA 2VT2A 2OYRA 1GCUA 2HMWA 2J31A 2VAVA 2X14A 3GLHE 2PJZA 2KS6A 1JRLA 3JY6A 3DBOB 1A9RA 3THSA 4BKRA 4R1PA 5K8VA 4FFBA 1JGTA 2VP2A 3DKIA 4RTQA 3MBOA 6ADHA 3L0DA 1Z7BA 5KTTA 4DM7A 1UPBA 1QHHB 1SD5A 1GUAA 2QJFA 4DUGA 2E21A 4W5HA 4RY9A 1P2SA 2DULA 4GVLA 2Q1WA 4FP9A 2PPLA 2H4JA 2NN3C 1G8HA 2WSBA 2X2OA 2BKUA 1NDUA 4L76A 2IP2A 4PX3A 5JUWA 1RI5A 3IXLA 2C7OA 3NHKA 1Y1TA 2UXBB 1SZPA 3K3PA 2F1OA 4HX2A 3EUAA 2PZFA 2WG0A 3OLYA 4JI5B 3IJPA 2R6FA 2OHVA 1YB4A 2VP3A 4JEMA 1FP1D 2Q50A 2WT4A 3P9IA 4HZUB 2VR1A 1WSDA 1G1AA 4QBKA 1E5XA 2PTGA 3EHDA 3PQDA 5TVKA 1UPUA 2P3SA 1J7KA 3DOCA 1NRJB 4GM4A 2EF1A 2ORED 1NQXA 3IKVA 3OEHD 4YMVA 5FPTA 1G6Q1 2ZS9A 3E9CA 4ONEA 3PNLA 2EKBA 4MW1A 2FPKA 2QI9C 3O4GA 2GCOA 2JCXA 3AYXB 4U3JA 4XGRA 3M7IA 2H1OA 3ET5A 3K0FB 5I5GA 4CTJA 1RW4A 3GLSA 3STTA 1PJAA 2PZMA 1YZLA 2HEGA 5EWJB 4YRBA 3LXRA 3TOCA 4FWTA 3UUGA 5FNVF 5AQ1A 4CKWA 3KQLA 3IT1A 1OU0A 1RRVA 1RWKA 1VHQA 1Y7TA 2YJ6A 3DHNA 5FULA 3VGPA 1MC4A 2ZZKA 4CM1A 5DYTA 1IOLA 2V6FA 5CK5A 5KYGA 3CNHA 4D44A 1ZW1A 1UF9A 3MNFA 1P1KA 4C0XA 1YDGA 4FMDB 3HCCA 3QOXA 1BX1A 2ATVA 3WQHA 4AX8A 1X15A 3SVZA 5KYWA 3RVKA 3BKWA 2R48A 4ZQEA 3IVRA 4B7AA 3V4LA 4YJ2F 5HF8A 5BXQC 4YJFA 5DTEA 3FYUB 3M6VA 3RSZA 4V3CA 1GM5A 2EU8A 2YWDA 1FFEA 1GAXA 2VTDA 1A9YA 1I4WA 2JGKA 2Y1WA 4XGNA 3D6VA 3WRXA 5GJCA 1PN3A 1U1EA 3O21A 5FLXA 3NASA 1GZ5A 4JJIA 4RTOA 3R9XB 3P9QA 1UK9A 4WLEA 1XZHA 2Z2KA 3HDYA 4G63A 5DN9A 3ZG6A 1VHJA 3K9BA 4DRXB 1UMBA 1JR3A 1YR3A 2HLHA 3LQFA 4IMPA 4N4AA 4NQZA 4PGAA 5F23A 4DV4B 5KREA 2GAOA 1C14A 4KPEC 5KQPA 2Z8YA 3O31A 5F35A 1WHSB 3NHUA 3UAYA 5ADUS 3OQHA 4TWIA 4AXBA 3TM4A 3ESDA 3R5KA 5FL7D 2PO7A 3NIBA 4LNUA 4NP6A 4YA6A 3V2IA 5FNVA 3NJ8A 2O2EA 4DAEA 1IIRA 1W1WA 1P7YA 4Y0NA 1U1CA 2XVAA 4FNOA 4RJLA 3ZD9A 4BNYA 4C06A 5AD1A 2HMSA 1HDEA 5J2UB 4A2PA 4AK9A 3RJMA 1E9FA 1CP3A 1CULC 1A8PA 2MMGA 4XGIA 1T9CA 4RV5A 2ZI3A 2NU8A 3SYTA 3UG6A 1P39A 2Q5HA 3B1ZA 3DF9A 2FCRA 4BNVA 1L8AA 5DYWA 4RIFA 5TNXA 4WLNA 2Y93A 3GL9A 2O0JA 1A9XB 1OOEA 1ZM4A 2RI0A 3G7NA 5IYZB 3ZHUA 1JLSA 1Y6QA 4Q3EA 3QE9Y 2JHAA 3L0ZA 4KOEC 1YNSA 1NSTA 4YJ2A 4YT4A 4R5MA 1U8EA 4IJWA 2NNWB 1F2VA 2HQSA 1P17A 1JIKA 3CZQA 3KNZA 1WQ1R 2F00A 4H7KA 4NFHA 4O6VA 4Q4CA 1Q0HA 2F62A 1Q3HA 2ZRLA 4IMIB 4QRHA 5FTJA 4PPGA 4BS9A 1KEEA 2AKYA 4ETWA 1R7RA 1EX1A 3DFZA 3R23A 3LYHA 3UENA 2YRXA 3B12A 3AQ4A 1EXNA 1RWNA 2GVZC 3WQSB 3T15A 2E0IA 2BP7B 2NZUG 2RE8A 2OG1A 2SBTA 2P77A 3NAQA 3TRIA 4EPTA 3PEVA 3S7TA 3A6EA 1JKFA 3DMGA 4U00A 1SKYE 1BMDA 2A1TS 2UKDA 2VOJA 2RIPA 1IVYA 2NAPA 4EM6A 5JFGA 3JWEA 2QTCA 2GEBA 4XB6B 5GONB 2HCFA 3K2IA 3ZXYA 1Z12A 4DMFA 2Q21A 3B5JA 5DU2A 2HJSA 1AK2A 4I99A 3O8OB 1P0CA 1JDJA 1TJPB 4DLTA 1HYQA 2I78A 2R85A 2D5BA 3NPAA 4HY3A 4RD3A 4L07A 2BGKA 3N0WA 5H8WA 2NQ8A 4J7AA 3LPCA 4MYCA 4WA7A 2PZBA 2Z8YM 3JQ9A 2NUTA 1XXHA 3BXZA 4A92A 1CCWA 3NQ41 1WXIA 3IYLW 3LPDA 1GPAA 2OB1A 3L04A 1ISIA 3L46A 2Y9PB 3LFHA 1D7OA 3BMCB 2ESRA 4G67A 1U2GC 3OPXA 4JC5A 3WFJA 4MVYA 1RRGA 3DPIA 1L4EA 1GCGA 3F98A 7MDHA 5KSYA 2BSXA 3AHDA 2J59A 2X86A 1XP8A 1H1LB 3V4SA 5FEMA 3FCAA 2C3YA 3PFCA 1BFUA 4KW7A 3N87A 3W06A 2Z5LA 4HB4A 2FTKE 2GDJA 2EWMA 2H85A 3JR3A 4M8SA 2I91A 1QFSA 2FUEA 4HVCA 1GRNA 1PYGA 4EMBA 4RXUA 4TTPA 3QVGA 3TXXA 3U1TA 2Q0QA 1RE1A 4ZCRA 2IZZA 2ZU0C 5FHQA 4LCJA 3VOSA 4QVIA 2RHMA 3IQWA 3IE0A 4A03A 4UATA 3V97A 1JXAA 7ABPA 5F78A 2PZAA 5BQFA 3PUVA 3O75A 2MU1A 1UAAA 1M6VB 1IY0A 1E63A 1SUAA 2V7XA 2XV1A 2YR0A 3AHFA 3KSMA 3O7WA 4RESA 1UKYA 4BFTA 2NZ8A 2XEXA 8ATCA 3A1UA 1SCUB 2D06A 1QCYA 2QJOA 3MJ4A 4G97A 5B58C 3D3NA 1RWWA 4TXJA 2JEYA 4LDPA 2VP5A 3AL0C 1XZPA 4KHPB 4YGXB 1QHFA 4WSOA 1U7XA 3T4UA 2RGXA 4H7HA 4DWOA 3T3OA 2MHCA 2JFFA 2VCYA 1FRFS 2NO7A 3EQ2A 2NUAA 1OI7A 3EVFA 3FPCA 3JYOA 3M8KA 1XDBA 3PT9A 4JP1A 1ZCZA 3INNA 2VL7A 4NJOA 3R7WA 4B45A 4E21A 2H0RA 1I3OA 5JCJD 2PKEA 3A3YA 2PUDA 3A37A 2PWAA 1VJ0A 2A84A 3U4AA 2P9HA 3AJDA 2CT8A 1BTOA 2H59A 2P7HA 5LLSA 4K87A 4CM5A 2XY4A 1E9RA 3SPXA 1DUSA 4TX1A 1V2HE 1E0KA 2IUUA 4IH4A 2Q9UA 4PPYA 4QOHA 4BMXA 3D6UA 2Y8EA 3HBJA 4EHJA 3TAXA 3KJFA 4D43A 2P8SA 2P9ZA 1D9XA 3FYSA 3LQQA 4PC3A 1TM5E 2HIMA 5DEIA 3RSCA 1E3TA 1CUYA 5D3MA 1J5XA 1EVEA 4C4TA 1EAYA 1TX4B 5JFOA 3PC6A 3G8CA 3NDRA 3N3BC 1N7JA 4DUZB 2QE7D 4I55F 1ZQ9A 2VXBA 3EGXB 4QFCA 5C1OA 4LS3A 2I33A 3A2KA 1N34B 4TWJA 3E53A 3JQ6A 2H5JA 4JQZA 1DARA 3FIJA 2ODBA 3LF1A 1ISFA 1CTQA 1QPBA 3OP4A