4X93A

Crystal structure of lysosomal phospholipase a2 crystallized in the presence of methyl arachidonyl fluorophosphonate (tetragonal form)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
376
structure length
376
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Group XV phospholipase A2
total genus 128
structure length 376
sequence length 376
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x93A01
5AKJA 5K3FB 5DJ5A 1WB5A 4M0EA 1LNSA 4AZ3A 2IIVA 1UKAA 2OGZA 1PFQA 4EZIA 1CQZA 5HCUA 2PUHA 5EHNA 2BUAA 4AO8A 2JEYA 2HA4A 4E46A 1CUIA 2WILA 1UXOA 1CUFA 2OCGA 1BN7A 4IH9A 4KE9A 5LZ2A 4X91A 4FNGA 4KJXA 1RYYA 2XE4A 2GZRA 3WYNA 5FKJA 3K9BA 1XKLA 5EGNA 4PSDA 5CURA 2CEKA 5CH3A 1EI9A 2XUHA 3H2KA 5CT6A 4CCYA 1JJFA 3IBTA 4DNFA 3TJMA 1VXOA 3M81A 1ODSA 2VA9A 3BDVA 3EQ9A 4G9GA 4ZREA 4A23A 1VZ2A 1UK6A 3PFCA 4UHBA 3Q8WA 1IUPA 3GFFA 1GPLA 4QDUA 4E14A 4IHAA 4Q34A 1F0NA 1HKHA 1DQZA 1YA8A 3I1IA 4J0IA 5JAOA 4G1FA 4BB0A 4ZWNA 3MUOA 5ALYA 2XQKA 1LBTA 3B3QA 4N5IX 3LCRA 4W1SA 3WA7A 3KDAA 1BRTA 3RK4A 1XZGA 1QIHA 4UHCA 2PBLA 1E5TA 5JIBA 3G8YA 6YASA 3LIPA 3F67A 5AO9A 3WJ2A 3PF9A 5LZ7A 1ORVA 5D3ZA 2WHQA 5BWCA 5AK5A 1IZ7A 1UWCA 4INZA 5AICA 3VVMA 1EHYA 1ZIXA 2HIHA 3PUIA 4S0XA 3DOHA 4FOLA 1H2WA 1FJ2A 3EIOA 5CT5A 4X97A 1WB6A 3V1NA 1KU6A 1JU4A 4QA9A 5AM5A 1TCBA 3QH4A 4LXHA 1RP1A 5K5EA 2EDAA 5A7FA 5DYWA 3K2IA 1ZI8A 2C7BA 2QT9A 2XMGA 5AKEA 3I2FA 4IH1A 4Q1VA 2K2QB 4H18A 2NW6A 4CG3A 2X76A 5HF6A 4X93A 1K4YA 1H2XA 1EB9A 3JW8A 4ETWA 1RWQA 3DL7A 1W52X 4I19A 3G0GA 1Y37A 5KWIA 3KXPA 3E4DA 1W6RA 2WUEA 5A2GA 3QZUA 1F8UA 1XQWA 2HM7A 1C7IA 2QJWA 2HRQA 5ALKA 4DMHA 3BDIA 1DT3A 2DR0A 3A70A 1TCAA 1SCKA 3D3NA 4F0JA 4AB1A 2GBGA 4A5SA 4BE4A 2PVSA 4B85A 1LBSA 4NMWA 3WLAA 2PU7A 5CXXA 5ALDA 3I28A 3WK7A 2WG0A 2QKYA 3FNBA 2CKMA 1L7AA 1R9MA 2XI4A 1A8UA 3FVTA 2H7YA 2HADA 1QE3A 3WKEA 2B20A 2FX5A 1CUGA 1QIGA 2WTNA 5AH0A 4MJ3A 1VOTA 2XLBA 3PICA 1P0MA 5DTJA 1GQSA 2PKYX 3VXKA 1H23A 3IVMA 1UOPA 3DYVA 5I9IA 3UMJA 4BDSA 2PSDA 1ETHA 4FWBA 2QVBA 1XRPA 2PSHA 4W1RA 1XRMA 2D5LA 5J3JA 4NVRA 4CFSA 5AOAA 1EXWA 1NX9A 2XUJA 5FOQA 2AXEA 5C81A 2VAXA 3FBWA 3ESBA 3FLBA 4FLFA 1E8DA 1HPLA 5HFAA 5JZ9A 4PNZA 4H7EA 4MYDA 4XWGA 1ORWA 3QPAA 3WWOA 3N2ZB 4NZZA 2RONA 4UHEA 3QITA 2G5TA 2Y6UA 4KAFA 5BV7A 3E3AA 1MNQA 4P9NA 4KYVA 4C88A 4XX1A 2JBWA 3V9AA 4QDTA 1EX9A 2EDCA 2G63A 5JYCA 3WWEA 3LLCA 2C5FA 3HJUA 3ZLUA 3STTA 3AIMA 3KWFA 1CFJA 3DCNA 4AN0A 5DYTA 3TGLA 3HACA 3OOSA 5LKAA 1LPPA 3O95A 3GELA 4AMYA 4BTLA 1CUZA 1U2EA 2AJCA 4BP8A 4GW3A 3STXA 4O08A 1QFSA 2DSNA 3FYUA 5KREA 1TK3A 4LYDA 3KOOA 3WMRA 1MN6A 1BROA 2JGJA 3IUMA 3VKFA 3X3HA 1JI3A 1TCCA 1HDEA 3B5EA 2W6CX 4X71A 4IH4A 4RGYA 4C89A 4UBIA 2RHTA 1XZHA 1CEXA 5IVHA 4KAAA 4Y2RA 1CQWA 4DMKA 3G0IA 4C4ZA 2PSEA 4U2DA 2Y2UA 1H2ZA 1IUNA 4YPVA 3D5EA 1XRLA 1A88A 1AMNA 2BUBA 4RE5A 4H77A 2OG1A 3QM1A 4G8CA 4UFNA 3QMVA 1A8QA 3C8DA 4MXDA 5AK6A 2R8BA 5ALXA 1AGYA 2I3DA 5EFZA 3TRDA 3MUNA 2XQJA 1CUHA 4U2CA 1O6FA 4K6GA 4DYHA 1SCIA 4KACA 1R3DA 4PO3X 1MX1A 3TEJA 4ZGBA 3HI4A 3H1BA 2RI6A 2C4HA 4KRYA 1YA4A 5JAPA 2Z5GA 3VJLA 4X95A 3ICWA 4P93A 4Q05A 4GHWA 4Y2JA 1XZFA 4CCYB 2V97A 3LIIA 4X6UA 3HC7A 4BP9A 5A62A 2BJHA 1P0PA 3VJKA 2VSQA 3CXUA 5FXMA 2YASA 2ZYHA 2XMDA 1XZIA 2OCLA 1ZJ5A 3FYUC 4BVJA 1EINA 1XLUA 1PV1A 3ZLTA 1TRHA 2WLSA 2XUGA 5E4YA 5HK8A 3BWXA 2B61A 4L72A 4LHEA 2QXTA 3DOIA 1J2EA 2OLEA 2QUBA 3IUQA 4OYLA 1QJ4A 2ACEA 3GZJA 4B83A 5AI6A 5LIPA 3T52A 1CUXA 3C6XA 3H0CA 4WFKA 3JYHA 2GBFA 3HABA 4Q3KA 5HF8A 1IVYA 4ZV7A 1XROA 2FJPA 5I8PA 1H2YA 1H22A 3A2MA 3R0VA 2X8BA 4C87A 1CVLA 4MQLA 1CUJA 2XMCA 2BGRA 2XUDA 5ALNA 3WJ1A 4X00A 1YB7A 4B0PA 3KD2A 5IH7A 1AC5A 3OPMA 4EUSA 1R9NA 3MVEA 3W9UA 5AI8A 2WFZA 4MQMA 1CPYA 3AIOA 5AM4A 1QO7A 1JT2A 1VXRA 2GYWA 2HA6A 3WWPA 1UFOA 3FWHA 3H2JA 3KSRA 2VJDA 3SK0A 1CV2A 2VF2A 4QZVA 4EY4A 1K8QA 4DNOA 1MAHA 5KWJA 3CCCA 1ZI9A 4OU4A 4WDQA 3AJAA 2HA0A 2OCKA 5K3EA 4DTCA 2ACKA 1CLEA 4Y9SA 1XZBA 2C0PA 3WKDA 3U1TA 2OCIA 4DLNA 2AJ8A 4OB7A 1MT3A 1X2BA 3O9VA 3MGAA 4FFVA 4KR0A 1MNAA 5ALIA 2YYSA 5IVDA 4MEAA 5CMLA 5EHZA 2OGSA 3O9MA 4KAJA 2BGNA 2HU7A 3PDCA 5AM0A 5E4TA 5DNWA 3DNMA 2H9YA 2ZYRA 1U4NA 1QTRA 5ALMA 5C8VA 4L0CA 2XUFA 1CUWA 3WI7A 4J0KA 1ACLA 5IVKA 2WFLB 1THTA 1WOMA 2YH2A 5CT8A 3RKSA 2XQGA 3F8SA 5DLPA 1VA4A 5ALZA 2W22A 1GPKA 4PF1A 4IO0A 1CUCA 3V1KA 4BZZA 2X5XA 2ECFA 3L1HA 4CCWA 3ESAA 3G0DA 1N5MA 4WFJA 5H3HA 3G7NA 1SOMA 4G4GA 3H17A 4OPMA 1L7QA 4UHFA 3UUEA 1IZ8A 2WUFA 3F9CA 5ALSA 3C8HA 5FUMA 1MX9A 5ALHA 3KWJA 4DIUA 2HL6A 4J0HA 5FV4A 2IX9A 5A7GA 4B80A 1JMYA 4BZWA 4QDZA 7YASA 4B82A 5ALFA 5EHQA 1QLWA 4WY5A 1EK1A 2BUCA 5AKLA 3WK8A 2DHDA 2QTBA 4ZXFA 2BFNA 1USWA 3O4HA 1UT6A 1ZD3A 4OUKX 4BCCA 1W76A 2VAVA 3IUJA 3I6ZA 3F97A 1HLGA 5LYYA 2IITA 2GZSA 3DKRA 1K63A 5ALEA 3AILA 3DKKA 3VISA 1CUEA 2ZSIA 2D0DA 5AKZA 4FLEA 3VJMA 1DX4A 1WPRA 1DX6A 3M3DA 1KEZA 1R88A 4FFWA 2WFLA 1CUBA 2XMRA 3I2HA 1HL7A 1ZGBA 1DT5A 1K6EA 3FYTA 1MAAA 3D0KA 3A2LA 4UUQA 4L3WA 1GGVA 3M83A 4OB8A 3I1YA 1P0IA 5T4BA 1XQXA 3ICVA 4RE6A 2JIDA 1N1MA 3WL6A 4KE8A 3BIXA 3WKBA 2CMFA 4FNMA 3WK4A 5AHXA 2WG2A 2PU5A 3PI6A 5JADA 2BCEA 2B4KA 1QIFA 5AI5A 2O2IA 1DQYA 3HXKA 4GLBA 5EI5A 1E89A 2VT6A 4Y2PA 1Q0ZA 3S8YA 1OCEA 1QZ3A 2DQZA 1QTIA 4TGLA 1LGYA 2V98A 5CBKA 1MU0A 4E11A 2WUGA 4HXFB 3NOXA 3LP5A 4WY8A 5C7YA 4X6XA 4DNQA 2O7RA 2BKLA 4H7FA 4U2EA 2G5PA 1YASA 4PV7A 1LPAB 5ALLA 1ZD2P 2WFMA 1FFCA 2HA3A 2PSJA 3K6KA 1GKKA 1LPNA 4B84A 5I7UA 2QUAA 2RIPA 1WB4A 3C5WP 1TQHA 3ILSA 4N8EA 5AOBA 3DJYA 5C8XA 4JEIA 2B9VA 4MEBA 1UOOA 4K6HA 1DU4A 3Q0TA 3C6YA 1JFRA 3B12A 4G4IA 3QYJA 5FP0A 2OQIA 1G5FA 4HZGA 1XZAA 4FLMA 5FDFA 3C70A 1YS2X 5KBYA 5EHXA 4LXIA 4N8DA 4PQEA 2XUQA 4LKOA 4I4CA 2QXUA 3E1GA 1XKTA 5CTAA 4AO6A 4BCBA 2Y6VA 1EDEA 4W1QA 2CZQA 2XMZA 4AMZA 1MPXA 5AKIA 4H7IA 5ALQA 1DTEA 3H1AA 4ARAA 4UHDA 4IQ4A 4QDXA 3F98A 5AK4A 2XQFA 1S8OA 4FKBA 1TKRA 4XIIA 1YS1X 1EA5A 1MO2A 2I03A 3WK5A 5BWBA 5JANA 3WIOA 2OGTA 4H7JA 2Z8ZA 3H2GA 4X90A 4DGQA 1EB8A 2CJPA 3ANSA 5AM2A 3BXPA 4BRZA 3W2TA 1SFRA 1AUOA 2XQIA 2WM2A 4FHZA 4YK7A 4KRXA 1UZAA 3OURA 3LS2A 5T4EA 2R11A 2WQZA 4ITVA 4UBMA 3RLIA 3FLAA 4X85A 3PE6A 1JJBA 2DHEA 3CN9A 5JASA 1QFMA 4HAIA 4K5QA 5CT4A 3WL7A 3DD5A 4LXGA 4Y2SA 3WZLA 1XFDA 1E66A 1UK9A 4UBJA 3WKAA 4Y2UA 3D2CA 2J4CA 1TIBA 1DWPA 1QIEA 2FJ0A 1VA5A 3ZV7A 4GI1A 5HKBA 1AX9A 5HKAA 4HVTA 5DNVA 3C6BA 3VVLA 1XZJA 4N8SA 4F21A 2OAGA 1E8MA 2PX6A 1G42A 2ZSHA 3T4UA 1QIDA 3M82A 3DLTA 5T4FA 3WL5A 3V1MA 4Q82A 4AZ0A 3STVA 1F0PA 3GROA 4U2GA 3WWCA 5AKHA 4QLOA 3V48A 1MX5A 4PSUA 1ZI6A 2V96A 3QMWA 5AKKA 4E15A 2DHCA 3F96A 3EBLA 5JAHA 2JGIA 4A16A 4G4JA 5E2IA 3G0BA 1CR6A 3NUZA 1OXMA 5CW2A 1ODTC 1WHTA 5C8ZA 5D6OA 2WJ6A 2VJAA 4MYSA 3DEAA 5EIAA 1QGED 4UFPA 5K3CA 4Z49A 1VLQA 2EEPA 5ALWA 4H7DA 1I6WA 4X7BA 5AK3A 1ZOIA 1L7RA 1WHSA 5YASA 3WK6A 3R3ZA 2WIFA 2JGLA 5CH5A 4BRSA 3N0TA 3SWWA 3AZQA 1XZEA 2QZPA 2H7XA 3O0DA 4OSEA 2ZVDA 1T2NA 1CUDA 5AJHA 2XMBA 2AJDA 2JF0A 3ZPXA 3I2GA 4BE9A 4Q3OA 4N5HX 3WYDA 5ALUA 1IUOA 5LZ5A 3D2AA 1JMKC 1AZWA 5LZ9A 4C6HA 1W4LA 2XMQA 4UBKA 4KEAA 5IVIA 2XUIA 4HRXA 2PUJA 3H2HA 2C0QA 4EHBA 4B9AA 3FCYA 3FVRA 4DM7A 5LZ4A 4CI9A 1QIIA 4MWTA 1XLWA 4Y2QA 5DNUA 5T4HA 4UHHA 1YSCA 4C4XA 4TVKA 3NWOA 2QS9A 2YXPX 2HFKA 2PPLA 3OG9A 3PFBA 3VDXA 3IURA 3R41A 1YCDA 4G5XA 4G8BA 2HA2A 1J06A 5HQ3A 2Y1KA 2QJRA 3ESDA 2WJ4A 4J7AA 1QONA 3H04A 2H1IA 2ROQA 1X70A 4AO7A 2I78A 1XZDA 3R3VA 3H2IA 1CUVA 3WKCA 4WCVA 1LLFA 2ZYSA 3EQ8A 3NGMA 2J4FA 3RARA 2OAEA 4GDMA 1DINA 1KU0A 2GYVA 4FBLA 1F6WA 4QDOA 2ZYIA 3YASA 2QMQA 4L9AA 3WIBA 5FPPA 3HLKA 4BCDA 2RGUA 2JGEA 1R50A 3I2JA 2JGMA 2VATA 1C7JA 1T4MA 1ODCA 2HA5A 5HQ3B 2HDWA 4W63A 1M33A 4HXEB 1FFAA 1R1DA 4HS9A 5JD6A 2E3JA 1DWOA 4JYMA 2WIKA 5IKXA 1P0QA 2GBCA 5ALOA 4UBLA 4JH0A 1W75A 3WK9A 4B0OA 4P92A 4DSAA 1X2EA 4YASA 3I6YA 5HFNA 4XJVA 2J3QA 3H19A 1OILA 2QR5A 1Q0RA 3DQZA 4H7KA 1EDBA 4ZRDA 3FOBA 4AN1A 2WIGA 3BJRA 3O4IA 4GXNA 1PJAA 5ISMA 2OQVA 4MWSA 4QWWA 2CBGA 2WHPA 3FLEA 3QPCA 3R3WA 5A6VA 4G8DA 3ZLVA 4ZI5A 4U2FA 4PW0A 5AKGA 4JUIA 3DS8A 5AIBA 1LZLA 4QE3A 5CT9A 1QIJA 2WJ3A 2XUAA 1NU8A 4WJLA 4BDTA 5CXUA 1VE7A 2QRUA 3WA6A 2Z3WA 5JD4A 3FSGD 2XB6A 1XZMA 5JZBA 1SCQA 4AX4A 5D7BA 2VT7A 1AURA 3C6ZA 2WUDA 1FFDA 4GECA 1XZCA 1CRLA 2PM8A 2ZJ6A 5DYYA 4DMFA 4JNCA 1YB6A 1VE6A 4BC0A 2DFPA 1BE0A 3H18A 1EH5A 3O4GA 4BC1A 5AKXA 1ZD4A 2PSFA 1UKCA 5HF5A 2DQYA 5CH8A 4UBNA 4UBOA 4OD0A 5FLKA 1C4XA 4GEGA 1LZKA 1A7UA 1WM1A 4WFIA 5AM1A 4LYEA 1CUAA 4J0JA 1A8SA 2XDWA 5K3AA 4U2BA 1Q83A 3QVMA 5AP9A 3WWDA 2DCMA 2PL5A 3D7RA 2WU4A 4RPCA 5K3BA 3AZPA 1EK2A 2G4LA 3GUUA 3AUKA 3HRHA 4EB0A 2XT0A 3AINA 1WPXA 3GBSA 3ANTA 3QBJA 3IB3A 5D3KA 5ALPA 4QLAA 3BF8A 2HRRA 1XRRA 4K6KA 3PF8A 3C43A 4CG1A 1EDDA 3AFIA 2O7VA 3D2BA 4GWLA 4X3CA 4J0DA 3W05A 3V1LA 5K3DA 1B6GA 1UKBA 3G9UA 4G9EA 4Y2YA 5JAUA 3OTQA 3STYA 1WCYA 3JWEA 3L1JA 4J0GA 4P08A 2JGKA 3DDUA 3GA7A 4LIPD 4CG2A 1QOZA 4I3FA 3G9TA 2XUOA 2VJBA 3I6MA 4H0CA 3HSSA 3D59A 1GZ7A 1LPMA 1GQRA 2Z8XA 3IUNA 3IULA 1BCRA 3G9ZA 1E8NA 1BS9A 2HA7A 4J3JA 5AOCA 2RHWA 3ZI7A 1O6GA 4TPKA 4X92A 4BBZA 4WDRA 3CN7A 2JEZA 1ZJ4A 4XVCA 4KE6A 4B81A 2ORYA 2XMSA 3AZOA 2I3ZA 2ZJFA 3W06A 3OM8A 1HQDA 3HEAA 1TAHA 3C87A 4ROTA 1UK8A 1ACJA 1K5PA 4NS4A 5JZSA 4EA6A 5ALRA 2LIPA 1R4ZA 3FAKA 4W1PA 1XRNA 1NU6A 3W9BA 3RM3A 2JGFA 4UPDA 1BEEA 3CCBA 3DL4A 2HU5A 1AKNA 2HU8A 5ALJA 4J03A 4HRYA 4EBBA 4F5ZA 4CIAA 1YR2A 3E0XA 4DMCA 4M0FA 4OYYA 4B6GA 1GKLA 1UK7A 4BAZA 1HBJA 5A7HA 2QM0A 3A2NA 5AI4A 1Y7IA 2P8SA 5ESRA 1GXSA 1D07A 5LLSA 2WSLA 4C4YA 5SYMA 2QOEA 5F4ZA 2VQ6A 4Y7DA 2AJLI 3BIWA 1XQVA 1LPSA 2UZ0A 5AM3A 3R3XA 5HF9A 4OCZA 2Z3ZA 4QWMA 1LPOA 3PUHA 2WHPB 3P2MA 5BOVA 4DSZA 5K3FA 4FTWA 1FFEA 2WKWA 2Y2VA 1JKMA 1YAHA 3BL8A 2WHRA 3SX4A 3UUFA 5ALTA 4UFOA 3QPDA 3OC0A 2CUTA 2WIJA 3EF3A 4FMPA 2CB9A 1VZ3A 2BAGA 2FUKA 5AI0A 4C01A 5A71A 2Q0XA 2WTMA 4CIBA 2VEOA 1THGA 5FRDA 1N5RA 1VKHA 1EVEA 3DYIA 4FDMA 3HZOA 4YX9A 5SYNA 4B9EA 4X6YA 4BAGA 5JATA 1JU3A 2HHAA 2ZJ7A 4BYMA 3WL8A 1N8SA 1FSSA 1E3QA 1QO9A 3C45A 4QNNA 5JALA 2OXEA 2WG1A 1CUYA 3ZWQA 1GT6A 5EIEA 5LZ8A 1B41A 4B7ZA 3R3UA 2V9ZA 2XLCA 1Q84A 5HZGA 4OB6A 4BVLA 1AQLA 2HFJA 3STUA 4Y2TA 1U65A 4D9JA 1ZGCA 2C58A 1U8EA 3O4JA 3AIKA 4F60A 3QMMA 4PSCA 2AJBA 3IA2A 1EVQA 5EIHA 1Z68A 1JJIA 2XUKA 3ESCA 3SC2A 1ZICA 1VJ5A 1G66A 4M0MA 4ZV9A 5JD5A 3G0CA 4AQDA 5ALGA 5AI9A 1LPBB 3IIIA 2O2GA 4KE7A 4BATA 3FSGA 1MTZA 3EQ7A 4Y2VA 1IMJA 5DWDA 4HTAA 3W04A 4Q3LA 1ZIYA 5HK9A 3L1IA 4EY8A 4H35A 2H7CA 1CUUA 2ES4A 5AIAA 1UOQA 2J3DA 4OU5A 2VTVA 1QIKA 3BE8A 3S2ZA 3D4LA 5DTIA 1YAJA 1SC9A 1W1IA 2WU3A 3STWA 1G4HA 2ONCA 4FBMA 3R40A 1J1IA 4DNPA 4Y2XA 1MJ5A 5LKRA 4QEKA 1Y7HA 4W9RA 1DWQA 3WQHA 5JARA 2OPHA 4J0CA 5FPQA 4EY6A 3C5VA 4BTVA 3G9XA 4K2AA 2WIDA 1J07A 3I2IA 4V2IA 1BN6A 1BU8A 3WZMA 1BEZA 3HYSA 1FFBA 4H7HA 4BAUA 2O2HA 1ISPA 1ZD5A 3FYUB 1XQYA 4JYPA 4BVKA 5AKYA 1BCSA 4GBGA 1XZKA 4AXBA 3ED1A 1QIMA 1CUSA 3U0VA 3BJMA 4EY5A 3BF7A 5LP1A 3A6ZA 1GPNA 3G02A 5CRIA 1XLVA 4X94A 2GBIA 1XZLA 5ALVA 2VJCA 4RNCA 3IDAA 2C5GA 2XUPA 4HXGA 3FCXA 2RAUA 3I2KA 2GYUA 3R3YA 4ARBA 1XRQA 1CIJA 4EY7A 5E4JA
chains in the Genus database with same CATH superfamily
1VIMA 3GJ5A 2QGFA 3MUEA 3K9LA 5K3FB 4HVCA 4IYRA 3HYRA 5HRUA 4ZVVA 4GC9A 3NIBA 5DJ5A 1CG6A 2A9JA 1H94A 3D81A 3NYWA 3PC3A 1IJFA 4M0EA 1F9EA 1A71A 1VC2A 1GTZA 2Z8YA 3CLSC 1Y6RA 2IIVA 3FKJA 4HAWA 1UKAA 5IYZB 5IP5A 1CZUA 4C6TA 1GZDA 1JXAA 2HK6A 3MF4A 3U61B 1WXWA 5CDGA 3K4QA 4OMDA 3LY5A 4KL8S 2A33A 1CUIA 2PTHA 5DHUA 2WILA 4A91A 2ODBA 3R7LA 1BXRA 2FR8C 1H1LB 4J49A 1N8NA 1R8SA 3FPAA 1CEYA 1Z18A 1Z5WA 2HOQA 1V1MB 3H1PA 5JJ5A 3BB4A 3BMNA 5LZ2A 4HO1X 4AMZA 1SD2A 4QECA 4QD3A 5H7XA 2X5JO 4OI4A 1EBBA 1XCBA 4FFBA 1NF2A 1RI5A 3IQZA 2HRBA 2ZTMA 4J1TA 4MO2A 3LT0A 3SDBA 2OBFA 3IEPA 2KI5A 2R97A 2P6UA 4IZHA 1ANKA 2FRDA 4XD7D 2XE4A 1VPWA 1USUA 4TLAA 1UXJA 1QG6A 5DOVA 1VDZA 4IWNA 3PUKA 5BW8A 5KWEA 2YRWA 1SC1A 3MLEA 4NCXA 2NV6A 2Y9PB 1F1BA 1CDDA 1JRLA 1ZDMA 2D0PB 4OOFA 2BM0A 4K9RA 4PSDA 2JBHA 3F7NA 3FZNA 5K2MA 2YXNA 4L76A 1E3WB 2IHVA 1CQIB 1G3QA 4OI1A 4CV0A 3HADA 5KYVA 4E13A 4ENQA 1PDWA 5E1DA 4ZRNA 5B30A 3LECA 1OYOA 2ECOA 1TX4B 1OWLA 5I7AA 5B5SA 3HKDA 2IS1A 2XNKA 3ME5A 2EHDA 4G1UC 4CCYA 4IG4A 1JJFA 3ZU4A 1ZW6A 2OXCA 3PKJA 3VOBA 1Z8FA 5KYKA 1ODSA 2YUTA 3BDVA 4GO1A 4PZPA 2HF2A 1Y48E 4I6JA 2PGDA 4BV2A 1UBRS 1R74A 2YW9A 1JIQA 3K0AB 3AI7A 3AF2A 4FJ2A 4REMA 5ICCA 4HH3C 2AVDA 2PNJA 4BGVA 4N82A 3PFCA 4ZO9A 3WIDA 2IPXA 1WUYA 1I4TD 4BNKA 3VPXA 2AEFA 1FFHA 1IHDA 3EH2A 4WAUA 5MN5A 1VTKA 4DJ5X 1G6Q1 2EKDA 3VFDA 2OOSA 3KELA 1GA1A 3A1VA 5DNDA 5GV8A 2BI7A 3PHIA 4E14A 3FPFA 4RKQA 4DQUA 1RFGE 1V6SA 3LVFO 3F5DA 1PK7A 1ZOLA 3V4VB 4ZOCA 1HG1A 2FMFA 4ZZ2A 1HKHA 3E6AA 3OM1A 4KPEC 4Y0NA 4G1FA 4MRMA 4I46A 5CB8A 1G3MA 1IQRA 2GAOA 2YS6A 3E81A 3JZDA 5ALYA 2XQKA 4I9UA 2BGKA 3KSZO 2VTEA 3PCRB 4MUAA 5LIRA 3LCRA 4CE6A 2DTXA 1XZGA 2GCNA 1A7JA 1RKXA 4ENSA 4AQ7A 3WNCA 1A2KC 3NHMA 3E2MA 1E5TA 2F3RA 2QU7A 5DEIA 3H9GA 4S2EA 5JIBA 4I4NA 3VKVA 2YQ4A 1I33A 5C9ZA 1I7SB 2NO5A 2QZJA 5FJJA 4JR0A 2RGDA 1N9GB 3F67A 1YBMA 4KI7A 5DULA 3SSAA 3WJ2A 3PF9A 1EWVA 2ESRA 3LWBA 3CJRA 1ORVA 3L01A 3P9PA 2PD3A 5HUQA 2OG2A 4PSKA 4NAHA 1K2VN 2NTYC 3ABOB 2MYUA 3ISJA 3OQIB 2VNSA 3IKVA 1VMIA 4IV8A 5DN9A 3KOWA 1D6SA 2YDYA 2ZKIA 3HO1A 1KKUA 1IZ7A 1UWCA 4JDPA 1PG0A 1S3GA 1GZ4A 2JCGA 4HQ6A 2G76A 3AG5A 4JUAA 5KS2A 4JI5B 3W5IA 2JAQA 2P5YA 3RR2A 5CDFE 3T7KA 4BEWA 3Q2KA 1G98A 1TM5E 2JD0A 4A8JC 5LMZA 1FJ2A 3EIOA 3KL4A 3ZDFA 1N5OX 3KYCA 4X97A 2ZB8A 1OGIA 2P3LA 4HDNB 4Q7QA 4RVUA 2AW3A 1WDKA 2W93A 3CVXA 3MYRA 1SUEA 2R751 2PXCA 3KALA 3W8RA 2YYYA 2RGCA 1SAYA 2PIAA 1PJZA 2DPLA 1C8BA 1T5DX 4P3PA 5IG2A 3BUSA 1E0AA 1J8DA 5DM2A 5IDXA 1RP1A 5K5EA 4YP5A 1B3BA 3TXXA 3MEQA 4G24A 1G6OA 4YPFA 1KK1A 2CCKA 4R2JA 2QT9A 2CYCA 3OU7A 2DQ4A 2OCXA 4BQNA 2H2IA 2QRGA 4MWBA 2GK6A 1LLCA 3I2FA 3QXHA 1O4VA 3G8BA 4CNBA 3KSDO 3WSVA 3BMXA 4CQLA 2OZLA 3ICCA 4Y6SA 2PZFA 3TLYA 3DLIA 2EWVA 4UNQA 2Q99A 2VHZA 3DPIA 1C8LA 5LOVB 4CKBB 2NUAB 2NW6A 1MT0A 3IDOA 5T6MA 3R6LA 4R5MA 3TPFA 4AMGA 2P0EA 2DFDA 2QAIA 5HF6A 1UBOS 3OUUA 4FFOA 4JCCA 1K4YA 1UMKA 3SXUB 4HDMB 3UAGA 4DYDA 2DWCA 5JYBA 3JW8A 5JS2A 4OLBA 5COBA 2CDCA 1PZNA 4AW9A 4CFYA 2EKQA 3CLKA 4PYOA 5TQVA 3U3OA 4QEZA 3OCUA 1E5LA 1RABA 1JHVA 2ZBUA 1WKCA 1F2TA 2DERA 1N2XA 3D8BA 2JH3A 3DTVB 5KYWB 5KWIA 3PHJA 4TQGA 1S8FA 5DHSA 2AHOA 1DC7A 1HDYA 1X8XA 4UHJA 4EVSA 3SX0A 2QE6A 4I5GA 2VPYA 1RHRA 2DE0X 5IK2D 2WUEA 5FX2A 2O0LA 3LVRE 4F45A 1TLLA 5LN1A 1G21A 4NRDA 2PR2A 3GDWA 2CLOB 2HRQA 3KPUA 3SLKA 5AW9A 1KJNA 4L5JA 4YWHA 2ZE5A 2PKCA 1YZNA 1DT3A 2ARKA 1ILWA 1FLAA 3KZNA 2Q1UA 3EDCA 3GFQA 2IZZA 1UXHA 3PKIA 1SCKA 2H85A 3SGLA 2W70A 3O1LA 5HTOA 2ATXA 1DEXA 4CLXA 5A4JA 2LE0A 1NXTA 1Y9DA 2H2GA 1RIIA 2PGIA 4GMHA 4TM8A 2QG6A 1N6KA 4RD4A 4TXMA 1IE3A 4NU5A 4CT0A 2PVSA 1IJKA 3ENZA 1US8B 2VUSA 3IP3A 4KUGA 4Z9XA 5LP6B 4FYMA 4NMWA 5TMDA 4QUDA 5ALDA 1L5WA 2J46A 5FPTA 3HVIA 4QXQA 4DXHA 1NYRA 3I28A 5D51S 3WK7A 4BN4A 4IVNA 5CB0A 3RS2A 1EJ0A 3ZI4A 3SS8A 2Z09A 2Y0EA 3GUVA 4JJ8A 3B53X 2IYWA 5KEIA 3HM2A 5FBLB 3RH0A 4W5QA 5BN5A 5A05A 3L79A 2CWWA 2JLRA 2W2QA 1LI5A 2X3UA 1HT2E 5L3SA 1A8UA 2CN1A 2FR8A 1H1LA 3KUUA 1QO0A 1CR0A 1DKMA 1BMFD 1BYIA 2GH1A 1FRVA 2QMUA 2MSDB 1JJAA 4KSBA 3R7DA 3MT7A 4C05A 2W4MA 1HXHA 1KY3A 2B4TO 3AHHA 4QYIB 1QE3A 4CHTA 2CYBA 4DJEC 4MV0A 2B20A 2VRCD 1Z4OA 2JLAA 5IBPA 3LC0A 4MJ3A 1KAEA 2C2XA 2BLNA 3H87A 5J4YA 3G5MA 4J7XA 1WEKA 1YS7A 4JL8A 1Y9EA 4I9NA 4K9SA 1WDMA 1L4LA 3HYLA 3OTOB 2PKYX 2G80A 3ID6C 3DW1X 4D0LB 2AWNA 3IVMA 4U9UA 2Q9AA 2H2WA 1O95A 2XTNA 4TTQA 1ZLYA 2SECE 2O8NA 3OIFA 3IV6A 1NVWQ 4P4LA 4XX0A 3UO8B 2C3YA 1UQUA 1VG8A 2GCEA 3MFYA 4O5AA 2JGRA 3L0ZA 2H1OA 3NH6A 2AOTB 2FWMX 2HBQA 1JLLB 1FBTA 2ETVA 3PVSA 3AFGA 4UZFA 1TEZA 4U3JB 2IYTA 1Z0AA 5MDHA 2Q3BA 3VNBA 2ANCA 2XGMA 4IFIA 3J81k 1B6TA 4F72A 3H5VA 5K0FA 2A78A 3VR6D 1PR5A 4IHJA 1PL7A 1OWNA 5F7ZA 2GXQA 3HU1A 5J3JA 3B1WA 5J47A 4CFSA 4CQMA 2ZRQA 5FNVF 2J45A 5EJFA 4AJKA 1G5TA 3ZXYA 3ZE6A 2UYCA 1NX9A 3UJPA 1OGYA 4XQ9A 2AQHA 1JKXA 1U9YA 1NSFA 1XNJA 2P68A 2XCUA 3DDOA 2BMAA 2TS1A 3FLBA 5LUBA 3IP5A 1QVRA 2WABA 2D4HA 2XODA 3DC2A 1Q1NA 4BVEA 4NAVA 3SZRA 1YDHA 3LPAA 3UH0A 2W6NA 1A97A 3MIZA 3U56A 3WMFA 3I62A 4TT3A 4JJ4A 4OHWA 4UHEA 5IEBA 2G5TA 2G71A 2QN3A 1R9GA 2RHRA 2YMMA 3B8HA 4TMXA 5E4FA 1CHNA 1YRLA 3FSRA 1TTPB 4QJ4A 3OZ7A 3DAOA 1J0EA 3TSAA 1QAOA 5EE9A 4NZ9A 5KVCA 4XASA 3Q8KA 3KR9A 6NULA 4Z5XA 4DWWA 1A0OA 1PNOA 2Z5FA 1DG3A 1UC4B 2E4ZA 3I9V6 3JRWA 5GZ6A 3S1AB 2IV3A 1X15A 3HZZA 1NVVR 3GHHA 3M1LA 3SIRA 3V9AA 5JMOA 2PFSA 1EX9A 2Q0QA 2VNIA 1ZK0A 3E48A 3L0YA 4X65B 3S40A 5JYCA 3I0MA 1KZGB 5K6TA 2GDZA 1VBKA 2DH6A 1E9SA 3RVSA 2BCGY 2VZEA 2G40A 3Q0EA 2C5FA 3DBOB 1JEQB 5HEKA 4KNYA 2VHCA 2YWHA 3OX1A 2IBMA 1KOJA 121PA 2WKPA 4X8OA 1LRLA 5H3CA 1CFJA 1YO6A 2ZT6A 5C5IA 2ENWA 1MIOB 4RV4A 3EQZA 4FUTA 3TGLA 3DV0B 1L5RA 3PEEA 3W78A 1G291 1JFFB 3MJDA 3TTSA 1J2UA 1Z4PX 4UE2A 2VCYA 4DTIA 1IN1A 1LPPA 2EQAA 4YIHA 4KC0A 2PUWA 4XVRA 3O95A 4CKCB 4GG1A 4AMYA 1CUZA 1TM4E 2P35A 1U2EA 4QARA 1EG7A 3H7AA 2ZRLA 4II2A 2C20A 4G1CA 5FEMA 1M8FA 4HDNA 3B1KA 4L0DA 2CE2X 1Z16A 4LBVA 3U9SA 4CLEA 2WIAA 1ZLXA 3STXA 4O08A 1ZOOA 2C42A 1QFSA 3DHEA 1KAMA 4GC5A 4BQSA 4EW2A 2YFKA 2QD4A 3KSMA 2WU8A 3H4IA 3UJCA 3UMSA 1AN9A 3DVLA 3V97A 1UDRA 4GKVA 2QT1A 1G6KA 2R8OA 4EARA 3LPLA 4LYDA 2IPLA 2JAHA 2F3QA 5KCMA 1EP9A 2I91A 2SHKA 2R2GA 2XW6A 2COKA 1USGA 1TD1A 1JI3A 1F8YA 1TCCA 4IICA 3SVLA 3CE6A 5KNDH 1CB7A 3UTCA 3IXMA 4YP6A 1HSZA 5LLTA 5IJAA 5K2OA 2DWQA 4C3UA 2BKVA 3NVDA 5C18A 2VHVA 4B73A 4L4SA 4PNEA 3C3DA 2ZR0A 2RHTA 2OORA 3HDVA 4MOWA 3BEOA 4DR6B 3A1EA 4CCSA 2Q0SA 2HSWA 2BGIA 3HMKA 4KAAA 5CUQA 5IVHA 1P5FA 1XPUA 1PU2A 5CDYA 5TLSA 4GH5A 1IZ9A 2HBZA 4M9QA 2Q7OE 1PGPA 4B3XA 1PQPA 4C4ZA 2OD7A 4CZ2A 5JRZA 4UM8B 2YZNA 2QSZA 4LXYA 4PS1A 4EPWA 3H0KA 3BDAA 4G63A 4C0KA 3HVJA 4IYJA 1IUNA 2VDPB 1GR1A 2GXUA 1WG8A 5A2QA 1BH2A 2BJWA 3HB1A 4EQ6B 1HNNA 4D3DA 4MB0A 1N5JA 4J4HA 1OD6A 2NUTA 4FC6A 3QVKA 4BQQA 1PZHA 1WUHS 4QASA 2EG9A 5EG5A 5KWVA 4LFCB 3L49A 3QM1A 4UFNA 3EVDA 1L6RA 4JD5A 3B89A 3AMVA 4G0XA 1A8QA 2VLBA 3C8DA 4MXDA 1IG0A 4HEA1 2ZIWB 5HWSA 1Z2OX 1Z8DA 3L0CA 4UE3S 4I9FA 3EJWA 2I3DA 4LI3X 2X3YA 3F78A 4CNQA 2ZJ8A 3OFVA 4PLVA 3SC6A 4RA6A 3Q3VA 3WADA 1FVOA 4BUCA 3QVTA 4PCAA 3RIXA 2Q1TA 1V9CA 4C4AA 2DR3A 1RRKA 2VKQA 4FNOA 1Q77A 4RGVA 4CMCA 3KK0A 2GCIA 5ERYA 2P9HA 1O6FA 4X60A 2J09A 2XSZA 3GPBA 3NU1A 5LNK1 3M6XA 2HX1A 1R3DA 2HLNA 4LXTA 4MYSA 1J2RA 3E9MA 5ER6A 2P9QA 1MX1A 1ES9A 2EGGA 4LSWA 2M6LA 5LP6A 3WL3A 1H2FA 1KJ9A 2YY6A 3O8BA 2W8BB 1N9ZA 3A3YA 3NP9A 3VV3A 3WWZA 3RO7A 3VR1A 4DABA 1UMDB 4AL4A 5TJHA 4PXAA 1YHZA 3MLAA 2OMKA 3B48A 3D3WA 4BFXA 1GDHA 2G07A 2PCJA 3T12A 1P60A 1GG9A 3DLAA 1JYFA 3HQ4O 4C3ZA 2Z5GA 1OUMA 1Q50A 4PO9A 2H00A 5FFMA 1EFAA 4O25A 1YH3A 4P93A 5JWRA 2C03A 3AG6A 3LY8A 3R74A 3T3IA 2O59A 3ES9A 2Q1YA 3HN7A 1XZFA 4GHWA 1Z0KA 3PUYA 4U9HS 4HGPA 2MYNA 4L50A 4LC0A 4Y1RA 3RRYA 3LBFA 5K8CA 4B3SB 1MF7A 3HU2A 3OZIA 3MA0A 3VSCA 5CFNA 4G65A 3HC7A 3LTEA 4NCBA 1ODKA 3KQPA 3BMOB 3GLGA 1K7SN 1R0RE 3R6DA 4QOFA 1G8MA 5DWVA 3VJKA 2NP6A 3FW1A 3OE7D 4U6NA 4ZOLF 1Z29A 2BFFB 3QKWA 221PA 3CXUA 2C1EA 1XDGA 2ENUA 2RI1A 2ZI9A 5KQMA 4DW8A 4HUJA 2ZYHA 1FC0A 1UCFA 3F6YA 4NENA 1QYDA 1K0FA 3TYXA 1MKYA 4J1QA 1PR6A 4EDFA 4MMXB 3EDYA 6GPBA 2OCLA 4MYTA 5F2NA 1Z6XA 3WLFA 4GPEA 4BVJA 2XYHA 4O5OA 2GVNA 4GI5A 5BMVF 1XLUA 4V38A 4YCAA 2GOYA 1O96A 5BR4A 3ZLTA 2GK7A 1WXDA 5E4YA 5J9FA 2OVFA 2ZI5A 3K09A 1XTTA 2DWPA 5HK8A 1TZ2A 2FWIA 1A4UA 1OREA 1TLFA 4LHEA 2BTQB 4OIFA 3L5KA 4A7PA 3Q6NA 1WU7A 3WP1B 4NH0A 3SJ7A 1Q3TA 2LBPA 3V8PA 1USKA 3ZD9A 1QE0A 2OHVA 2XZPA 2ZT8A 2ZB2A 1ZUHA 3AVQA 3N87A 3WDMA 3HR7A 3KHUA 5LXTB 4MQEB 1O03A 4ONEA 4OYLA 4AZSA 2CEAA 2ACEA 2Z2YA 1IN7A 3GZJA 4KH0A 3B60A 1QHGA 4KV7A 3ETGA 2I2CA 2O52A 2E6UX 4BWVA 4MHTA 2B9EA 5AI6A 3Q1LA 2WWHA 2UUCB 3VU9A 1NNEA 1FLDA 5FLEX 4UCFA 5ICGA 2OZKA 4BO0A 1XVIA 1U28A 3GJRA 1CUXA 5REQA 3P2JA 5T57A 1FS5A 2FP3A 3C6XA 3H0CA 3WV5A 4S05A 1E1NA 4WFKA 3JYHA 1XZ8A 3OJXA 4FSDA 1C9EA 3OIGA 3EPKA 3HABA 1Q14A 4AWBA 2QLJA 1Y1KE 2Y1WA 2C98A 1IVYA 4R9VA 1P5ZB 4TQ9A 5DE3A 5TARA 4J6EA 1T2EA 3UGQA 4C4TA 1T5BA 1MP0A 4A82A 5KTPA 1IY9A 2XWSA 4YONB 2EKLA 3KR0A 1D2EA 1PFGA 3CONA 3EYAA 3L8ZA 3PNBA 4HFMA 1CVLA 4X84A 4MQLA 2PAAA 5FI0B 2XMCA 5KU1A 2X0NA 2XUDA 5DM70 4QQNA 5ALNA 1UODA 4MV9A 1ICIA 3PHLA 3K8ZA 3SZLA 3QOXA 4H1TA 3H4MA 4B2PA 5JZMA 1N2HA 4J75A 2ZZNA 3NVKI 2EGHA 3O6VA 1R9NA 4LUCA 1G3UA 2PZGA 2FFHA 3M0EA 4E4TA 3PNSA 3SDSA 2YIMA 2ZE7A 3PPYA 4PNPA 3W6ZA 5IJ9A 4M53A 3FOCA 1QUEA 1YJCA 1N2JA 4CXMA 2VYNA 3VAYA 4YCMA 4HWRA 1WZEA 1GEGA 4X8HA 1A4RA 2DFNA 1LRKA 3WWPA 1RXWA 1PYGA 4WI1A 4JLPA 2Y1OA 3FWHA 3IQEA 3H2JA 1J8MF 4YLGA 2MT9A 5T6BA 3A37A 2PH3A 2TMKA 5A5EA 1GPH1 3SS7X 3SK0A 2WOOA 4GEKA 2R60A 4R8SA 4WLOA 3VKHA 4N5MA 1S4QA 3UFXB 5BSWA 4WHMA 5LL6P 1TJPB 3W5DA 2WB2A 2EJUA 3HWRA 4QZVA 2IHYA 1U04A 4EY4A 3TW6A 3A7DA 5JNWA 2VAMA 2BSAA 2PY6A 1K8QA 3RBVA 5KWJA 5TY0A 3RI3A 1CVIA 1OASA 3T7JA 2J4DA 4JWTA 4PQYA 5I9NA 2HO4A 4FOOA 4ME6A 2FEPA 1F8GA 4L07A 4OU4A 5J1SB 5CPBA 4JODA 3IODA 4GAEA 3JD1A 2ZJZA 3UG6A 5FO0A 3BJIC 3GFBA 2LDXA 4D41A 4RANA 2IU6A 3U7HB 1AOXA 5B4VA 2QLTA 2GEUA 3NEJA 1L7VC 3KL2A 3AESB 3AR6A 1U98A 2JLCA 4V0RA 1JT9A 3ZDXB 3KDPA 1JR3E 3HN2A 4PZDA 1NURA 5AW7A 5L3VA 1YGYA 3NDIA 2C0PA 1UP6A 2UVQA 1WNFA 2VH5R 2YZ2A 2Z5LA 2GUGA 3PRHA 4YJ3A 2DBZA 4J1SA 1A9XB 1Z13A 4R9RA 1G55A 1H0KA 2OCYC 3PXCX 5GTDA 1WVGA 2PQ6A 3NHKA 1YOVB 1GV0A 1X7HA 3VHXB 4DV6B 4AZVA 1F20A 3M5CA 4MAFA 1QYWA 4D45A 1TMOA 2GN4A 4M89A 4GBJA 3MGAA 4G0QA 1YGPA 3ROEA 1JQBA 3JSAA 3OFJA 3UOGA 3VPSA 3K3PA 3N8IA 2HNAA 4MEAA 3C3AA 1ISHA 4NTZA 4QGHA 2D54A 4MVXA 3TMKA 3SF8B 3Q12A 1MO6A 1ULUA 1YOBA 2WLTA 4NESA 1M34B 5C4GB 1M2VA 2C1ZA 4WNAA 1D03A 1IM5A 1LI4A 1NYLA 3AR3A 3MTAA 4KAJA 1HQCA 1MOSA 1JG3A 3GEHA 2QI9F 4OMUA 3RAEC 4CQNA 3PDCA 1VL6A 3OPYA 3IXLA 4UDYX 5BSHA 3WYBA 5C37A 4L0QA 4TROA 5DNWA 1Y1PA 4WKCA 1SKYE 1XDWA 3RU9A 4YR9A 1YDFA 3WAJA 4CMBA 2EW1A 4QJIA 2FV8A 2BFEB 4ND1A 3FBTA 3KDSE 4JB0A 2I7VA 2LCFA 3GRFA 3HFGA 3AEUA 4NI5A 3GVPA 3DVQX 2RCNA 1ACLA 1O5OA 3KE9A 4OREX 4WFQA 1AQNA 1A8IA 3GLFB 1MRZA 5DW3A 5IVKA 2WFLB 3ZJ4A 5ARDA 2E4WA 1SUDA 2M1ZA 2H63A 4CV2A 3DE5X 3FH0A 2FHPA 2ORWA 1WSDA 1ZVVA 2OXFA 1UOEA 3N74A 3QYAA 4HDKB 1MHPA 5CVUA 4CF7A 3WGYA 1ZXLA 3WNQA 3M6UA 3L6CA 4BNUA 4EIWA 4GPIB 1SXHA 2P3SA 3F8SA 5DISB 5DLPA 2PRJA 3AV0B 1NW7A 1PUJA 4XGQA 2W22A 5F2OA 1QMGA 4E6EA 4BVAA 4DV4B 1YJ5A 3U40A 5C4MA 1K7CA 2X5XA 4O4JB 3PQ2A 5KTOA 2EJWA 3L1HA 1GUZA 3AP3A 1IAVA 2W90A 2LV8A 1WSWA 3V1YA 3REOA 2ZQ5A 4OMFG 2A88A 3V2UA 4C08A 4X3OA 1HNXB 3G7NA 1SOMA 4G5RA 4G4GA 5EINA 5IRCD 1XD8A 4D4LA 1CB0A 4WLUA 2WWYA 3U7QA 2FSUA 2WJGA 1Y4ZA 3MSCA 1E69A 4G5YA 1L7QA 3EW7A 3GCZA 4DDMA 1XTVA 4M1YA 3AVWA 5JCPA 1CDEA 1E5QA 3LP8A 3DBVO 3BWEA 3COVA 1OTYA 3EH1A 2WUFA 1OX5A 4EA8A 4RPGA 2QUZA 4N49A 4W5WA 5L3RA 4QVIA 4MV7A 5EFOA 1R0WA 2C3PA 3M33A 3VYSB 1T0BA 3CMMA 2XNHA 3LLSA 1H5UA 1P4SA 1JR3A 1Z07A 2M6RA 5LQSA 5SY9A 3ZHZA 5IT9A 3BE6A 1L8QA 3F4LA 1HYEA 1UMBB 2GVZC 2HL6A 2QSYA 4JROA 4M6WA 4WBXC 4WGFA 5LCXA 2PMEA 5K09A 3Q7TA 3EZLA 5FV4A 1VE1A 2GJ4A 4HN4B 5A7GA 2FN3A 4EJ0A 5I9SA 1N0HA 1XZQA 5DBFA 3UMGA 4YUWA 3RS5A 1XMQB 4R8LA 1DQRA 3GIWA 1DAMA 3E5HA 2PZJA 4D5EA 4E88A 3GZNB 1VI5A 3NV7A 1JSCA 3ERCA 2BUCA 1WZ2A 4IDQA 2ZWVA 5F1OA 2QN9A 1NVBA 1D2CA 2W6JD 4KSCA 2EFDB 3N9IA 1RHMA 3PHBE 1Q57A 2BFNA 3MT9A 4YTEA 1THZA 3F8WA 3K0FA 5HP4A 1C30A 4EA9A 4C78A 1FU4A 1NXWA 1ZNXA 3AJEA 4YMWA 5LQRA 1DLIA 2QN7A 2HHLA 4N3AA 5GWXA 3OE5A 1DO2A 4RTRA 1D6JA 4BCCA 4PO1A 3IPYA 3T7SA 2EL9A 4BMZA 2V8OA 5AW0A 1ZY2A 2F7SA 4LMRA 1X7DA 1OIXA 2GZDA 4HFNA 4EB6A 1AKMA 2QG9A 1W94A 3F97A 1VL1A 1M1NA 2MR6A 1ZMOA 3P0EA 1G8GA 4E09A 3IVCA 4P53A 2F1HA 3GGGA 3O75A 3WLTA 4CEHA 3O4RA 4YGYA 3LSYA 1ZAYA 1K63A 1YIDA 2X14A 5LP6C 3UXYA 3W5AA 3O2QB 2X5NA 4PPFA 1UQRA 4WA8A 4OQPA 5C1IA 2PCLA 1WW3A 5IAEA 1KVSA 1Y7PA 7MDHA 2ZK7A 1L5HA 1IQPA 2QN8A 2C5LA 5T41A 1MFZA 5LMNB 5JVDB 5AKZA 5KZMB 1TB4A 1UFKA 3PUXA 1DX6A 3M3DA 4ZJYA 4JJFA 1KEZA 2EX1A 2PT6A 3UAYA 3UZUA 1CTQA 3P96A 1V1MA 4JL6A 3VZQA 2GD0A 1W4ZA 2X9GA 1M2OB 3BRSA 5KWSA 4GP7A 3GEEA 3OQNA 3WGMA 4H6PA 4QTZA 1KQFA 2JB9A 2DPGA 3EIXA 3IAS6 4RSMA 1CY1A 1K6EA 1KFEB 3NRCA 3P9SA 2IXEA 4I1SA 4IM7A 3CLTC 4B6SA 3CIFA 1AHNA 2IXFA 2AR0A 2CZCA 3D0KA 4P1ZA 4QODA 4UUQA 1R0SA 3DWFA 4UUOA 3FOAA 5E3IA 1W4CA 3KXDA 1ZZGA 4MRVA 1JDVA 2R8RA 1AQ6A 1C7QA 1XZPA 3TL6A 1JQJC 5JDIC 3AVTA 5L45A 4YCDA 4B4KA 3KT6A 4EEZA 2GCPA 1S01A 4XLTA 1GPWB 3LRXA 1PR4A 2K7ZA 3IC5A 4I36A 4MUMA 2O1EA 3ICVA 1J39A 5AVTA 4RE6A 4ZVLA 1X7WB 1X7XB 4Z1MA 1BRMA 2ODNA 1ZZEA 1ZKMA 2GZ2A 4CUKA 2D3TA 2VWGA 3K9GA 2R6FA 2ZU6A 3CF4G 4POAA 4UTXA 1C1YA 3AONB 1JG2A 4FNMA 3LFTA 1ECLA 3AVVA 2VBFA 1SCNE 2G17A 1H6BA 2BCEA 4ZKEA 1CRZA 1U6JA 2O6HA 4FE3A 3C1TA 3RSZA 5AI5A 3JQFC 1RQ7A 2O2IA 4WY2A 2JGNA 4ITUA 3HXKA 4GLBA 3STVA 4JITA 5EI5A 5B55A 3LWNA 1GAQA 5TIIA 4D97A 5IT5A 2VT6A 2A9QA 5E7IA 2ZRMA 3J7AC 1DZ3A 3X1MA 4UVEA 1Q0ZA 2BC9A 3S8YA 3UMBA 3ZX5A 2BMVA 4IUYA 3T3GA 4DC1A 2PWBA 2ZJYA 3ZY6A 1QTIA 3L0PA 4TGLA 4EY5A 3AT1A 4NFSA 4PG6A 3OWHA 4DMGA 2V7QA 3IT0A 1AGPA 5DTQA 1ADCA 1PDOA 1XD9A 1MU0A 1QANA 4AJ4A 5LBUA 1WWKA 4HXFB 4MVCA 4V39A 3RVLA 5GJBA 5GJVC 1E2KA 4KPGA 2E4UA 3LP5A 3V7YA 2Y68A 1QH9A 4DHEA 1XU7A 2X8WA 2CVQA 5C7YA 4X6XA 3VSAA 3I1FA 4L4XA 1W5TA 5CCBA 4KG7A 1C1XB 5K4AA 4ILKA 2O7RA 3GRPA 3LYUA 4UHKA 2BKLA 3I73A 4GZ3A 1JUDA 4H7FA 4U2EA 4M60A 1YASA 3OFKA 3KLMX 4ZO4A 1BVHA 1EESA 2C3UA 3DXXA 3C85A 1ZD2P 1LF5A 1QYIA 4MQ5A 3ZWVA 1PSWA 4W99A 1WBBA 1R6TA 2EYQA 2BEKA 4O4LA 2MIIA 4UXJA 2I8AA 1KDRA 4PONA 1MQSA 3K6KA 3ZWYA 2Z2JA 5I7UA 1V11A 5IJXA 1LA2A 3HKEA 1WB4A 1X38A 3C5WP 4ZVRA 1K98A 3U31A 4B6QA 4K88A 3HN6A 5THKA 1P9LA 1RRMA 4YALA 5AOBA 3UHOA 3V4PB 4OI2A 1OF1A 3E23A 4NNPA 1TYEB 1T8PA 2IOFK 2R1ZA 2EWWA 4KMMA 1MBZA 4HX9A 3THSA 2G67A 5CDSA 2AT1A 1KMMA 1PR1A 4JEMA 3W9YA 1VCHA 1IUKA 3C7CB 2I6GA 4JQYA 3GMSA 1QE5A 5A4DA 4XRGA 1WJGA 1KQGA 3ZJ5A 3TG2A 4MGIR 3R76A 1JFRA 2ZWOA 1PR2A 3B12A 4IXTA 4X1IA 3CHYA 3QYJA 2KE5A 1XTJA 4NARA 3AR5A 3C3CA 4R98A 2OQIA 3NBAA 1ZUD1 2FLVA 4O4JA 4TXHA 1G5FA 1QLJA 1AKWA 3KM0A 2CHVA 2FH5B 1GPUA 4KB5A 2JJ2D 3WRXA 3DB1A 1YS2X 1R2QA 4IV5A 3RAFC 2CCGA 1KXZA 5KBYA 2HB6A 1JHXA 4URFA 3O03A 4LCBA 1VPLA 2C2YA 1E3MA 2ZSKA 4MDHA 5BVGA 5CB4F 4CKEA 2G1UA 3CQ9A 4BP3A 4CR8A 2IL1A 3E1GA 4Z2AA 4CKBA 4JASB 4M36A 2RD2A 2D0IA 3KPWA 5CM2Z 1G5HA 2IYUA 1NQTA 1QPGA 4D3SA 4BCBA 4ZDIA 1QORA 3ACCA 4HDMA 2P1ZA 1XGKA 4RIHA 4W1QA 4J3NA 4EYGA 1VYVA 3H65A 3H6HA 4ERXA 4DR4B 1J8QA 4UMFA 4JU9A 1VHJA 1UFQA 5ALQA 4I5EA 1ZQ1A 3UT0A 3WRWA 3T5CA 4EFNA 1NVVQ 1IAQA 3L0OA 4QUAA 5I48A 2AX4A 2QD1A 4B2IA 4YPOA 5FBQB 5IAGA 3PYMA 2VYCA 5B1HA 1S8NA 4XFDA 3EZ9A 5ECYA 1ZWLA 1E2LA 1M34E 4E5YA 1CC1S 2WNHA 1P4GA 1SWVA 2EFEB 3GJ0A 1QVZA 3IJRA 3CEAA 5IABA 3ABSB 1S8OA 4GLJA 4P2GA 1YZ3A 4FKBA 4XIIA 4XSGA 4B6PA 4PPGA 5HDQA 3UW3A 2BEWA 4WK4B 2ZUUA 4BU1A 4BFYA 3WIOA 3FDZB 3P4YA 5DGHA 3S70A 4C0LA 3J81A 1JFSA 2I33A 3GLFE 5HM8A 3LPCA 2YCLA 2IY7A 5IAOA 3M7IA 1XNRB 1K66A 1EB8A 1GQQA 4H4DA 2Y1XA 5AM2A 1S1MA 1Z88A 4BJHB 3U4CA 1MDBA 2K6GA 4M0KA 1T29A 3F5MA 1AUOA 3OSZA 2YWJA 1V39A 1J42A 2XQIA 2X6RA 1ZFNA 4YK7A 2CB0A 3WLMA 3K0EA 3OURA 1HYGA 2O0KA 2HD4A 1G21E 4ZOLA 2RBKA 3RD5A 5T4EA 3S5JA 1RYEA 3NWEA 2ZJOA 2YVLA 4LDJA 1EVLA 2JLVA 3GI1A 3CB2A 3F3YA 2B8TA 2F55A 4FKMA 4QUJA 1YBHA 5ABPA 3D3EA 2E87A 2OLJA 2DQKA 3SLGA 2AN9A 4ID9A 3PE6A 1JSZA 1JJBA 3C74A 1WSAA 2EZ9A 3JQQA 5JASA 1TJ4A 4WLNA 4EO7A 2B2CA 4JP5A 5BMVA 3HCCA 4PFJA 3CC8A 4LYHA 2XZOA 5GZ1A 2FQQA 2R4TA 3DD5A 4DHWA 3WZLA 1KMNA 4EB3A 2WT9A 1KOLA 1XFDA 1E66A 1XXLA 4NG5A 3BGSA 5G02A 4ND5A 2N75A 3TRKA 3WKAA 3P9XA 2NOAA 4L2IB 3BJZA 1D4OA 3NTVA 2RHLA 5HKLA 3D31A 4Y2UA 4ZTBA 2WYIA 4NBTA 3Q7PA 4R2XA 1TK2A 1TIBA 3CEJA 4HQLA 5EZYB 3VSDA 3JWIA 1BHO1 2X2EA 5CA0A 2PPVA 1FNBA 2X3FA 3NATA 2P77A 4YP7A 4GI1A 5CVTA 4LN1A 3RIMA 1TAQA 1XPJA 4I5DA 5HKAA 4O4HF 2GWHA 3PLNA 4KFRA 4NE7A 2EU8A 3ROZA 2RGEA 4Y6GB 2CE7A 2XV1A 2AOTA 1FTNA 4F21A 2JHCA 3KCQA 4POOA 4W5OA 3N0VA 2C99A 3RGGA 5JR3A 4B48A 5CBPB 4RTKA 4FFPA 1NULA 4F96A 2AUNA 3E84A 4XQCA 1BKDR 1DJOA 3D4IA 3NBMA 2Q2OA 1QWSA 4YRTA 5T4FA 1GNVA 1RAHA 3V1MA 2BE9A 3Q7EA 4AZ0A 2WSYB 1OXVA 2GARA 3THXA 1FRNA 1X9IA 1T15A 1SU7A 3D6MA 4D6XA 1WHSB 1ZM7A 3T7IA 3GHYA 1IQUA 1MX5A 2QB5A 1A69A 1PGNA 1T34A 2BMFA 2NO7A 4C03A 3VBEA 1XYVA 1QDLB 4IX9A 4DZRA 2HMAA 4C7BA 4EG7A 5LMUB 4M4SA 1ZI6A 3W4JA 3LUPA 2VJMB 3TDMA 3QGMA 4MP3A 2VPQA 2D06A 2DHCA 3G1TA 2FW0A 4HLNA 5EIBC 5BWLA 5HM6A 4Q48A 3NJ4A 3ZDRA 3KFVA 5C7LO 1AIPA 2R48A 1BHJA 5JAHA 1AB6A 2V54A 3PXEA 2R6R1 1HSOA 3TPZA 2Q6KA 3HV2A 3VR4D 2ZCJA 3S8EA 1E1CA 4LK2A 3C48A 2XYQA 2BI8A 4JJGA 2PL1A 2CYAA 1P72A 2JFBA 3G0BA 4KFUA 2JD1A 4GR5A 2YXDA 5ADWA 4KBGA 2BD0A 4QSHA 4YAWA 1L7MA 5KNBH 2BP7A 4LZLA 5DX0A 3SQLA 1M0TA 4W7HA 5D7NA 4YRAA 2VJAA 4KQCA 2W0MA 5ILOA 4IIHA 4JVNA 3SC3A 2A8YA 1KDPA 1PVDA 4EUSA 4ZHSA 1NOKA 1TCUA 2HPHA 1ZJ6A 4IVRA 1UBKS 2V5UA 2WAXA 4HSGA 4D5GA 2AFHA 5ALWA 1JJVA 4OXKA 4X62B 1YQGA 3UICA 4NJEA 3O3CA 4DLXA 4DXDA 1IZZA 4EMBA 1XTRA 1KZ1A 4ZT3A 4ZJUA 4MV3A 3WK6A 4FBGA 1A72A 3R3ZA 3AF1A 4OGFA 2NPFA 2WP8J 4OL0A 1JDNA 1YRWA 2DTDA 2HPZA 2JIZD 5CH5A 4ZT2A 4X64B 4BRSA 1SWWA 1PWHA 1ENYA 3L7MA 4FMBB 4JSTA 4V0KA 5E6RB 4YUVA 3SQXA 3N0TA 2XHEA 3SQOA 2IYQA 1Q1QA 4W5NA 3O82A 1NNI1 2V0NA 3DF7A 3V8BA 4MPJA 4N0EA 3TOSA 1XZEA 2X5OA 3LY7A 2P8JA 4XUGB 2H7XA 3V4OA 1RRGA 2WNSA 3IALA 4OSEA 1JW9B 5C7OO 1Q6YA 2ZVDA 3R09A 1ZD9A 4OHMA 1KAHA 2XH8A 1NL3A 4D8XA 4AVYA 4B3MB 3H97A 3UJ8A 3FPBA 3UB4A 3O4FA 2QL9A 4FXPA 2JF0A 3S1LA 1ISRA 1A98A 2B25A 3OTWA 1W5BA 2I99A 2ZSFA 3AFHA 3C1AA 2YINC 4FVTA 4YS6A 4DJAA 5NLLA 4TV9B 2WV9A 1Z63A 1R6BX 1C8VB 4ND8B 5GIPE 1Y8ZA 3A36A 3QWAA 4Q37A 4Q9LA 1IUOA 5ALUA 1TAGA 5LZ5A 4YDQA 3RFUA 1FU7A 3U3ZA 1TLTA 1ZSYA 2JKYA 5BQXA 4PG7A 1VPVA 3K2EA 4HLDA 4PHGA 4C6HA 3PLRA 4I14A 3EF0A 1FK8A 1AHIA 3MRVA 5JU6A 2PH7A 1KP9A 2AOWA 3UCXA 4B74A 1KO8A 1OZHA 1YZHA 4NFYA 3T95A 1XQ1A 2V0GA 4ML3A 1MV5A 2C0QA 5BUQA 2QX9A 3MJ4A 5D3MB 1QXSA 2R4QA 3T5AA 2I1LA 4NV3A 2JLWA 4BB9A 2JIRA 2J48A 3PZBA 5JT1A 1Z56C 4QRIA 4EQ6A 4EW6A 3CINA 4ZZIA 4P0PB 1KMCA 2VVTA 3JQDA 5JO9A 4NBNA 3F8TA 4D0SA 3PQ5A 4MWTA 3BSSA 4Y2QA 5DNUA 4ZV4A 3QKRB 3RQSA 1OZFA 5BR8B 1HOTA 3IDQA 5K8IA 1E9EA 4R1PA 4U7FA 3SR4A 4DJFC 4ZJPA 4JHLA 5IM4F 2DECA 3NASA 5J1TB 1PG5A 3DA8A 4Q01A 2CUNA 4YO8A 2CCJA 3A4NA 4KQKA 4AUNA 1CNFA 4HX2A 4P3NA 2JI7A 3QVOA 2Z4RA 2O3TA 5EKDA 3NWOA 2GD2A 1RAGA 2NXWA 3C6KA 3JALA 4LSMA 3T3EA 4D57A 1Z5GA 3IS3A 2GXAA 1ZA2A 3CVOA 4FXOA 3PFBA 3CT6A 3IL2A 3VDXA 3F74A 1D4FA 2GCGA 2IUFA 2P9FA 3E3OA 4N5NA 4WWHA 2PD6A 3ZCVA 2WPDD 4BIMA 1YCDA 2QQ5A 2YWGA 3IEXA 2I3BA 2OENG 3PA6A 4Q3DA 2VP3A 1Q44A 3BE5A 2Q5IA 2C5EA 2GDJA 2AG0A 1NNLA 3B6EA 3GD7A 3IQDB 1OW3B 4IEFB 1UJNA 3KVVA 4CMEA 4XYGA 1QZZA 3II6X 5K0SA 2C7GA 3IAM1 5FIUA 4EGFA 4ISCA 4K8OA 4WESB 1FZTA 5B12A 1UMDA 2WF5A 2F1OA 3LQQA 3FUCA 4GVXA 4INPA 1JLRA 3MXOA 1SG6A 2OK7A 2BZGA 2B8JA 3MJSA 4MI6A 4DM3A 3DFUA 3AY3A 2ZTHA 2WJ4A 1Y5MA 5BQFA 1KPHA 1QONA 1CZNA 4RAQA 4EF4A 1TVKB 1MJGM 2VHXA 2B6NA 2G9NA 5DO9A 5ADVA 5EYPA 3K05A 2FUEA 2YQZA 1L3CA 1XEAA 4LF5B 5GJCA 1EFPA 1XZDA 2O8DA 1L7BA 4FFDA 1IPEA 1L8XA 3OE7A 3DGEC 2ZYSA 1RLOA 1W1UA 1XTKA 3H8WA 1U5BB 3UJDA 3NGMA 4I7EA 1ESCA 2OB1A 1BQEA 4CLHA 5KTKA 1OXUA 1KU0A 1RXIA 1TUBB 4LOKA 5G0VA 2V4UA 4F8JA 2FMTA 3KTFA 3ZBTA 4OJKA 5JNUA 3I42A 3ZKAA 5A3VA 4C7MA 1ISJA 1LV8A 4FYJA 4NENB 5TXGA 1YVPA 5F4BA 1C0EA 3A4LA 5FPKA 2C04A 2NSHA 4MS4A 3FB4A 3KD3A 5FPPA 1N9KA 3TCXB 3TZCA 1EX1A 3B9PA 3ZWXA 5CLFA 2ZE6A 3KP1A 2YBEA 5FL7D 1R50A 1VM6A 2VC2B 1T36B 4CPDA 3G2LA 5I4BA 3BFXA 5BW4A 3F6RA 3F9IA 3OJWA 1NBME 1F5NA 3R5HA 4HCJA 4NQZA 5B2ZA 4XIFA 3FVVA 1GPMA 1AZLA 4JYCA 5HKOA 4RAOA 1M33A 2PUEA 3IO5A 1FFAA 1OV6A 5CBPA 3FZGA 4E5VA 3VNVA 1DBQA 1R1DA 2OYSA 2LR0A 2WEKA 3SY8A 2IS2A 1PL6A 4YJGA 4UAUA 5ED4A 1IHOA 1OYVA 1SB8A 2GRJA 4LHXA 5A1TA 1DWOA 4JYMA 2EF0A 4GFDA 2OUKA 1SOAA 1P0QA 1YTLA 2VHJA 4QUHA 2I5PO 4L73A 2NO6A 1RW4A 1M1YE 2GM5A 4II7A 1ZK4A 4OQDA 3TIGA 4JLBA 2JZCA 2FNAA 3VU9B 4NPHA 2QD3A 2Q50A 3QV2A 5HFNA 1H42A 1O6ZA 2GN8A 1E98A 1U0EA 1M0SA 4FDUA 2QA5A 4LYAA 1RLUA 2VNHA 1TGYA 1M3SA 4U6SA 3HVHA 3FOBA 4RK4A 1U81A 1DEHA 4BO3A 4AN1A 1EQ2A 6REQB 1T0JB 4ABYA 1S4MA 2R7MA 1T9CA 4EKNB 3BB3A 3OZFA 2P27A 2I6QA 2V45A 3KEQA 1C50A 3QIVA 4GMKA 4GXNA 5BQ5A 1Z5ZA 3TW8A 3IR6A 2DB3A 4ETIA 4BMSA 1W0CA 4QBKA 3E3NA 1P7ZA 4MWSA 4QWWA 3VHRA 2FA9A 1NAHA 2CK3D 3E9ZA 5TPZD 1CXZA 1U94A 4D6YA 1GDDA 3QPCA 4GMGA 2OCPA 4PVDA 1JR4A 2J9YB 2QP3A 4BE9A 2QRHA 1ZN2A 3MT0A 4KP7A 2CC2A 1Z0FA 4FINA 1BE6A 4XOIA 4E4RA 3N70A 3DS8A 3JQ8A 4NJEB 1LZLA 1WP4A 3GAFA 4WNIA 3FGPA 1Z73A 4M9ZA 5F73A 4HV4A 3B9RA 1QFJA 3CX6A 3O2NA 2GF9A 1I9CA 3CW9A 5CT9A 1EX6A 2XUAA 3ENQA 3UY4A 1KZHA 4Q4JB 2Y9MB 1CNMA 2RC5A 1EUQA 3MS7A 2I4RA 2AMFA 3HFJA 3TSYA 3RC8A 1ZHHA 2ZDQA 2DTEA 1RDFA 2PXAA 3TS1A 1FW8A 3BCSA 3P8ZA 4GP9A 1J9GA 1FMLA 1OKKA 3KJGA 3WA6A 3RW9A 4BZPA 4RF3A 4DDUA 1J0XO 2Z3WA 3ZS8A 3WXBA 2XB6A 3RJTA 3KQKA 5JZBA 1T4CA 2JH9A 3ITNA 1OLOA 3ZHXA 2AXNA 3E9NA 2DU8A 2J0QA 4PZUA 1CJUC 2FZGA 3ENNA 2UUOA 3HK2A 4LZAA 1P7CA 1HT1E 2RKOA 3UWDA 1A2QA 3UJAA 2WAYA 3EXHC 4DXAA 1AURA 2YIJA 3CF6R 3MW8A 2WUDA 3AVYA 3PC7A 2AWOA 3LPDA 1ID8A 1JV2B 3SIWA 1I10A 4KLAA 1XZCA 1GXSB 2C96A 3SR0A 3EPRA 1A7AA 4Q02A 4RVCA 4DMFA 4JNCA 2EJCA 2ZRAA 2IYRA 3O90A 3R0IA 3QVLA 1VE6A 4ITRC 1DEAA 1WY7A 4IQGA 3ZW8A 4EKEA 2JLXA 3RKRA 2DFPA 4B3BA 4YJDA 3N7TA 1FRQA 1F9AA 1T6XA 1PF7E 3H18A 4E1AA 1MQAA 1JFVA 1SULA 2DJIA 3V8QA 3EZ6A 4JKYA 5I5EA 2CNKA 3V6MA 4PC7A 3WLOA 4A73A 2PSFA 2H4XA 1UKCA 3PPWA 1OJLA 3JWHA 4FOPA 5DF1A 4AI6A 1OWPA 1UDBA 1B3RA 1XTUA 3C2QA 3M70A 3IHKA 1DFIA 4JLUA 2FU5C 3VH3A 3LA6A 4F6LA 1ZPDA 3DEFA 3DWEX 3TSCA 4OD0A 2Y93A 4WBSA 1XWWA 2GF0A 5KUTA 1SXGA 3T3PB 5FWDA 5EP3A 2JHAA 4FGUA 1P4RA 4KOAA 2F3PA 3JR7A 4X8LA 5EIBD 4KR2A 2VF5X 1Z0JA 4KQWA 3MTIA 4OL9A 4QGGA 4WFIA 4U00A 4J90A 4QOIA 3BRQA 3QKRA 3L4BC 1NMSA 4YUZA 1GITA 1U02A 2QYHA 3N28A 3Q5DA 4FT2A 4J0JA 3VHQA 1TAUA 4G25A 1X3LA 1QRAA 1GL6A 1Z06A 5KPDA 4I08A 2GNPA 3QVMA 4G0NA 4U39A 1U0GA 1SVMA 4OK6A 5AP9A 2ZS7A 2QMYA 2C4WA 2DT8A 3D7KA 4GLLA 1G8PA 3I5MA 5HPYB 5I7WA 5GADl 5D1NA 2PL5A 5J2UB 4PY2A 1BC5A 3IPLA 2Q3JA 3DB2A 1P80A 4JSRA 1IY2A 2PVCA 3QU2A 1RHQA 3FR8A 2KLBA 4H16A 4INAA 5F3RA 5K3BA 5IWAB 1EK2A 4XPIA 1QF6A 3DEJA 3GLFA 2PMKA 1EFDN 1ZWKA 4M7PA 3AHCA 3QTTA 3KKKA 1RZUA 4MVJF 4UNRA 4LRTB 5JPIA 4REQB 3Q5EA 3QEMA 2ZTSA 2BIFA 3OOJA 5C1OA 2YS7A 1ILEA 2GEDA 3RC7A 3K4PA 2XBUA 3T1HB 3T3MB 4RMGA 1XWIA 3ZZUA 4HB3A 1EIWA 1CIPA 2XF8A 2X2OA 2AYXA 2FPGA 3IMGA 4DMLA 1CBUA 2IXBA 4CDRA 2NQ8A 3PGJA 3ANTA 4LW8A 4WZAB 5FPSA 3G7SA 1YRHA 1PT9A 4E2XA 1IB6A 4IY1A 1TVKA 3ZCUA 3EEYA 1YVEI 5D3QA 4RULA 3IB3A 3KPVA 1VI2A 4MHOA 5EE1A 5EYPB 2XB9A 4GL4A 4QLAA 2B1IA 4P4SA 2QRMA 1EFPB 3JYNA 3N2YA 3RVKA 2WF6A 3GEDA 3PXUA 1J7JA 5LNK6 1HURA 3BCHA 4B4OA 1ZM4A 5IF3A 3ROTA 3EZGA 1E0SA 5KNDA 2BH2A 4R0MA 2MMCA 5IAJA 3U0BA 4E5MA 4GLOA 1BFUA 4BJ3A 2PKRA 4RTLA 2CHFA 1KKLA 1Z2AA 1A04A 4AS1A 1RWWA 4GWLA 3TL2A 2IH5A 1NBMD 5E8RA 4A3SA 4CU2A 1EGVB 3ETEA 2GPWA 5THXA 3AHGA 4G9EA 6CHYA 2QPTA 2AK2A 2VIIA 2WD7A 3G1WA 5CLHA 1ML4A 5LD2B 1D2HA 1K8RA 4H31A 3B9BA 4DBZA 3IELA 1K89A 4LVCA 4P08A 4Q47A 5BNIA 3KJIA 3V42A 3V4FA 1L5FA 1GAEO 3CZRA 3T5TA 4OOEA 3ONEA 2IEGA 4G67A 4MCJA 4OXYA 4DRXA 4NQRA 2JGKA 3R8FA 4HR7A 3RVBA 1CIVA 4C6SA 3QE2A 2X4LA 3FE2A 2BHSA 3GA7A 3HCWA 3LY9A 5T7BA 5JJKA 4H9GA 3ZJTA 2HQ1A 4HKTA 2OPBA 3HSSA 2EFJA 1C30B 2F9FA 5DLQC 1RS0A 3MCUA 4JR2A 2G83A 4J0FA 1LPMA 5IU6A 2EBFX 1ZH6A 2XITA 4TMZA 1U2RA 3IDSA 4HWGA 3SSOA 3GT7A 1J0BA 1NA5A 1NW5A 4Q9JA 1B23P 3ZU2A 3EGXB 3RVMA 4Q21A 4BHTA 2HA7A 1SUIA 4M9SA 1T5LA 3RK1A 5AJZA 2P90A 1YRBA 2LNDA 1XXHA 2B78A 1O6GA 3ESRA 4ZCQA 5EIWA 2Q8PA 4V1CI 3VR5H 1IY0A 5F12A 1CW2B 4ZIRA 3RRFA 4NPAA 2Y1GA 1QC5A 3LUGA 3RWBA 1V5GA 3TVTA 3OCYA 1GEEA 5C4IA 1VB5A 1LC0A 5JCXA 3OLWA 1V7PC 4DIFA 3HUUA 1RP7A 1JWBB 4B81A 5ITZA 1E0JA 1YB5A 2VDUE 4QUEA 2XKBA 3NS7A 1N2BA 2ZJFA 3COYA 4TWAA 1ONSA 4BGIA 1GQYA 5B3LA 4MUXA 3OM8A 1PT8A 3VNAA 1HQDA 2CV0A 1M2EA 1ACJA 4R1LA 1P7WA 1VSUA 1O5TA 3NGXA 4WIAA 2Z8YM 3F6BX 2NP7A 1U0NA 2IYNA 1QK4A 1A4XA 4M7WA 1Z6QA 1VL2A 1N0IA 3HCOA 4JBWA 4ZHQA 2W6IA 1JAIA 2ORIA 3WFIA 3N05A 1ABFA 2JJ2A 1DKNA 5BSMA 3V1UA 5IDQA 1QHIA 4KDEA 5DLDA 2WI8A 1X80A 3P9NA 4W1PA 3V2HA 1PJSA 5JC1A 1KQ3A 2A1IA 3EQ2A 4UPDA 4V02A 1XAGA 1BEEA 2J0VA 2Y1FA 1EJ6A 2NIPA 1REQA 4LX8A 1GD1O 2NTNA 1TJ5A 1Z6GA 1C1HA 3DL4A 3I32A 2HMWA 1LDEA 1SXJA 3KEGA 1IFXA 4LAFA 4MGZR 4AJJA 5BURA 1CX9B 2PUTA 4R7GA 3EUWA 4GZ5A 5F52A 3PQ4A 4A8PA 4MR7B 4F5ZA 4DVGA 1CRPA 2ZPAA 4CIVA 4PN7A 4CM6A 5DV9A 1JG4A 1GFSA 4FILA 4LE1A 1UK7A 1D0SA 3BMCB 1Z5PA 3HP7A 3MWLA 3N2KA 4P3OA 2HMUA 1E20A 3KVYA 3CZ5A 3A2NA 3MBIA 3IEIA 2BFDB 3ELDA 1SK9A 1Y7IA 1JDSA 2J3IA 2P8SA 4Z7OB 1HFJA 3EDMA 1ZM9A 3MERA 1GXSA 4HNUA 2PJRA 4DQ0A 1HT0A 2RAFA 3MGBA 1PFWA 1QH8B 3K6RA 1WXHA 3AI2A 4TYNA 2BFOA 4TUYB 2GLXA 1N2ZA 3ZNOA 2G4VA 4GOND 5EHGA 4NCAA 2VQ6A 3SSNA 1XTZA 4Y7DA 1ZXXA 2YRFA 4XGKA 1UIRA 2R8PA 1B1AA 3LBIA 1KIFA 4ES6A 2CSXA 2O8EB 5BSRA 2VK4A 1YL5A 2CVOA 4M1ZA 3FZYA 2NMVA 4NZMA 3D6VA 4GUAA 4M1SA 4BX8A 1E60A 1K5DA 1V1RB 3I72A 2OE2A 1U28C 1EFTA 1WUJS 2W0SA 3PYXA 1KEVA 4QIHA 4QWMA 3K1JA 4QXAA 1LPOA 2A6PA 2WHPB 5DHFA 2WDZA 4YXWD 1HYBA 4DSZA 1FYEA 1X1QA 1KJ8A 3TLAA 1ADGA 2GERA 4JBHA 5K3FA 1XA4A 3BULA 2PRZA 3CR7A 4QOGA 3AXSA 3EF1A 3BGOS 2FF5A 1ZK3A 3PIRA 4NMXB 5IPFA 3BILA 3PXXA 3CZ4A 1E7WA 3LG2A 3W4IA 1YZLA 3FCUB 4G5SA 2R47A 4JBNA 5JJIA 3ESYA 3UUFA 5K99A 1DHTA 2XE8A 1F51E 2CLDX 3IOMA 1U1EA 4LVOA 3RUAA 3EZNA 4UFOA 3QPDA 3IQFA 3MQFA 2WIJA 5HJ5A 1BD4A 5EZ5A 1MHTA 3VDNB 3UNXA 1RXUA 2CB9A 1SQ6A 3F6CA 1VZ3A 4X24A 2P1DA 2W6ZA 3W4KA 1Y6FA 3GPDG 4AECA 2IFTA 8OHMA 4WK6A 4WN3A 1QCYA 2H1VA 1MW9X 4JP1A 4FFBB 1OFTA 1THGA 4DG5A 1N5RA 1CR2A 1QM5A 4FDMA 3JQ9C 1U4SA 2QVLA 4REQA 3PTAA 1AZSC 3P5SA 1ODIA 2XAUA 3OLQA 1JU3A 5FNVB 2FN9A 1N33B 1IBLB 2XY4A 4GPTA 1SKYB 1R37A 4PFSA 4QT4A 3AI1A 3U81A 4MARA 1R6DA 4MP6A 4FJ0A 1KYQA 1GNSA 4BNNA 3WXMA 1FQWA 1S2GA 1V3TA 2FPGB 3C3YA 3QWHA 4QRHA 1N8SA 2C4UA 1WQ1R 1D1QA 2G0TA 1RZVA 3PRJA 4PC3A 4XUEA 5FOSA 4PGAA 4RJIA 2QD2A 5HZHA 2DM6A 2UYQA 1C8KA 2A7XA 3C4VA 4DMUB 3MWKA 4LYGA 1BGXT 1CZKA 4U8GA 4AK9A 3A3OA 5JALA 1VBNA 2FFQA 4X54A 5FHQA 3ZZMA 1M9NA 3R23A 1V8ZA 4HB2A 3HBJA 3TR5A 3BXOA 4F2HA 2XADA 1PV4A 3HCFA 3T7EA 5E9QA 1KBOA 1XAIA 3QELA 3D4NA 4UEOA 4F8EA 2OORC 5H3LA 4BMDA 3R3UA 2V9ZA 3LPMA 3NHLA 5CFMA 3UWSA 3H4VA 3O8LA 5ETJA 1WPQA 3UJHA 1PJQA 4BVLA 3EC7A 4P3KA 1AKRA 3STUA 4JOSA 5FTNA 4Y2TA 5IKEA 3KWMA 5EJ6A 2FDXA 5JQWA 5MF6A 3N5CA 3RRNA 3U44A 2NADA 4GMXA 4WOJA 1JA1A 3AIKA 5UKDA 3RYHB 3MTQA 1W73A 2CV2A 3QMMA 1L1RA 3C6QA 2CFOA 4PSCA 2J3LA 4Y6LA 3MGCA 5CVCA 4ZC8A 1SUSA 5JH7F 3R9XA 1S2LA 2A4MA 2ETXA 4OXQA 1UAGA 3ESCA 2ZIVB 4UUPA 4BQIA 3ZWAA 3SC2A 3QU4A 3JAWB 5CAEB 3VR4A 4L08A 2QUIA 4M0MA 1SBNE 4KOEC 1I24A 1L4UA 2HGZA 3IVRA 5KVQA 2QJTA 1NI3A 3JAKA 3H4TA 4BX2A 4PGMA 3RBZA 3CLUD 1JYSA 4IFTA 4DA7A 1E9VA 1V16B 1NRJB 3TQCA 3PQ3A 3UJNA 4RSGA 2O2GA 2G09A 1M1YA 3FSGA 4DS3A 1MTZA 3TUZC 2FEXA 5A9TA 3NG1A 3W7VA 4J9VA 3OHSX 4Z1OA 1EFHA 1AKEA 3HLYA 4JX8A 3GOQA 4HTAA 3W04A 3QWIA 4ZPJA 4M83A 4B6OA 3B13B 3TLXA 2OM6A 1QR6A 2ZB7A 4Q7JB 3C39A 3I5XA 3CVVA 3K0CC 3TQFA 4XUDA 3JQ7A 4BNHA 1L4MA 2XXAA 3HDJA 4KKVA 3CBGA 3L1IA 4QQRA 4PN3A 1Y8RB 3CUYA 4U0KA 2BFBB 3OCWA 4H35A 3I4FA 4XARA 3WY9A 1UL1X 3H5TA 5LUAA 3EGWA 1HE5A 1P2SA 1ZK1A 4HADA 1Y8QA 3FTFA 5AIAA 4QOHA 1HLDA 4CL2A 4L8GA 4CVNA 4FE7A 3MRTA 1C41A 2ZUBA 4MROA 2HJVA 1MABA 1KHHA 3ZWNA 3EC2A 2ZIAA 3AW8A 1Q16A 4JGBA 4LSGA 4RBNA 1KI6B 4KWHA 1SC4A 3BBPA 1O7JA 4LK3A 5CVVA 1UT8A 3KBBA 6LDHA 4JELA 2QZ4A 2XWJI 2YWDA 5KJ6A 2BFCA 2ZG6A 4YJ2F 1MTOA 1QGZA 3L06A 1KDOA 3ZGZA 3RANA 2ONCA 2XYGA 5AVXA 3WDSA 2AIRA 2O3QA 2P9ZA 5KO2A 4RMJA 3TKYA 3IP9A 4Y2XA 5EJ5A 3LZDA 2ZBGA 4P5PA 5LKRA 1V3QE 4EG6A 3HY6A 1P6QA 2VXYA 3L7CA 4JUCA 3BTSA 5EE0A 3EVNA 3NDRA 4JVOA 1NKTA 4OQXA 2HT1A 1C4OA 2WVJA 3FZQA 1NW9B 5EPUA 5FPQA 2Q9BA 2ZI6A 1OY1A 1ECJA 1AS2A 4BFTA 3OOYA 1QCDA 2JK0A 4BTVA 1GTL1 5I4CA 3FTPA 4DQDA 3F71A 1VJ0A 2XVAA 1ELOA 3IBFA 3CEHA 5LP6F 1J07A 3I2IA 4V2IA 3IBGA 4BNDB 3LL4A 4QDKA 3TMYA 5IEJA 1KNQA 3I4CA 4ETNA 1U6IA 4I55F 1W87A 3HYSA 4NBUA 5IBCA 4AAYA 1MENA 4LFBB 2YJ4A 3PLAE 5KNBD 4ND2A 1EXVA 3D4BA 1DCMA 3TX2A 5TVKA 3Q6IA 1KS9A 1KA9H 3KR1A 4CI0B 1R66A 2A1UB 4JV5B 1CE8A 1PTKA 2OHHA 3D64A 2FFAA 2P78A 3PX3A 1DUVG 3GJSA 5ILGA 3DCIA 3FYUB 1ZCJA 4WKOA 4JYPA 1JXQA 5JQGF 3HBMA 5AKYA 5DHAA 4V3BA 1G21B 4KITB 4PHHA 5DIFA 1DAOA 3HSYA 3X2FA 1NYQA 1R10A 5TPWB 3KEMA 3U0VA 4RTSA 4R41A 1E2GA 4HDOB 2EFCB 2FOXA 1T1JA 1KFBB 2A35A 3K1YA 1DC6A 3OZVA 5T8KA 4B7AA 1OV4A 3A6ZA 3D1JA 1R4NA 3LYLA 2J9ZB 3M5DA 1VE5A 4AJNA 3AHEA 2V9PA 1E2NA 1P8AA 3G02A 5FR2A 3BWCA 4LC9A 3WB0A 2CDAA 1CJCA 1XLVA 2IKSA 4KQMA 3DNFA 1Y8CA 2CDNA 4X94A 2H1WA 1N4AA 3Q41A 4TMYA 3DZBA 4MI1A 1QFZA 1XZLA 4B8ZA 4JLNA 1BNCA 4CEJA 3ZY5A 3CZMA 4IILA 2BP7B 4A0QA 2P9CA 1U8YA 1RRCA 2EZ8A 1F1JA 2F64A 3EVFA 2GYUA 2ZZMA 2VR1A 3R3YA 3ZWKA 3LX6A 1WUKS 3GXOA 3V5NA 4TOIA 4EY7A