4X98B

Immunoglobulin fc heterodimer variant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
204
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPRVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLVSDGSFTLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of immunoglobulin Fc heterodimers reveal the molecular basis for heterodimer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 35
structure length 204
sequence length 207
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98B01
1XGUA 4PJHA 4UZGA 2Z8RA 2DIJA 5IVXB 1CLCA 2YPVL 3RKDC 5HJ3B 4WFED 3NGBB 3P9MA 1AY1L 8CGTA 4HIHA 2GAZA 1RJYA 4AEEA 1UENA 3U4EA 3G04A 5ISZB 5DJCB 1IM9B 1J12A 2DM2A 4JPIB 1E4XH 3BAEL 4U7KA 2G9HA 3S36L 2R2BB 4GXVL 1OM3H 3W0WE 4JR9L 2H9GB 3B9KC 2Q8BH 4D0DB 2BC4A 4H88H 5EU5A 1AKJB 3C9NA 2HLFC 3NFNB 4KMQA 3HPJA 2BDNL 4AIXA 3UTZB 4P49A 4JQXC 3ORJA 5LXGH 3ZTNH 4KVCL 5CZVL 3PWPA 4CNIA 1FZOB 1KXTB 1ORSB 1S9XB 2WIMA 3QO0B 4YGVB 3VMPA 3BT2L 4MD0A 2ADFH 4I9WD 1X5HA 3PQYA 1EO8L 1I8KA 1VERA 3GMQA 1TNMA 4QXTB 4MMZC 2IALB 4KJQC 3SKMA 1LE9A 3LQZA 3IDXL 2KBGA 1QSEB 1RHFA 2R15A 1N5AA 4PJDE 2P5ED 1HH6B 3VXQB 1MY5A 1FNGA 4YHYB 2R1WA 5EZOL 1RK0B 2VL5A 3EZJB 4X6DB 3D18A 4ZTPH 2Y6SC 1XIWD 1FH5H 4LAJH 3SGEH 1MCOH 5DZOA 3QYCA 5J57B 2P7TB 3SDAD 4FNLL 1S7VB 1TZIB 1OB1A 5I1KL 25C8H 4MA1B 5AUMB 1J0HA 1EDQA 4K9EL 5AG9A 4NZRH 4PJ8B 3B5TA 4PJGB 3ULUD 1CR9H 2LE9A 5F1IA 3U79A 4N0UB 3PIQA 5E9DE 3QNXB 5IF0A 4TUOA 1VGKB 3NBNA 3WSQL 3STBA 3N0PB 5IWLC 1ZANL 3U9PH 3D9AH 4NN7C 2AEQL 1C7TA 4A2LA 2FH8A 4MCZA 3LIZH 3QG7L 1WAAE 4HGWA 3HPJB 4Q9RL 5J11C 1AHWC 4X5WA 4FTVD 4HUXA 1SY6L 1NFDE 1IGFL 1I8MB 3ZSSA 4F37K 1ZVHA 4PJEB 5EULV 2CQVA 2WINA 2BHZA 3MRHB 4KRNA 3G08A 2UZIL 4OCWL 5L7XH 2FJGB 3GSUA 5ESQB 3TP4A 1UCTA 4YNYB 3I50H 2EIDA 4OZHF 1EZVX 1LNUB 2NXZB 3AXLB 4B41A 3AMLA 1BOYA 4ONOA 4LF3B 3KDMA 1KIRA 4G5ZL 2KQNA 1R5WA 4LSTL 3OKMB 2DQCH 4GLRI 3UTPD 3WL9B 1INQA 5D5ME 5DJ2A 4BQCA 1QPPA 2WV3A 2XRAH 3K8KA 4HPYL 3QWRA 3LQMA 1H8NA 2R2HB 3DGCR 4JR9H 1KCKA 5JLZB 2UUDH 1OWRM 1MFDH 4NKMB 3SJVA 3R0NA 2OJEB 4Z8FH 2YUWA 4X4ZA 3F5WB 4P4KB 3KR3L 3NIGF 5D9SB 5ALBL 3O2VL 2UZXB 3GSQA 4JJHA 4QGTA 3TA3C 3HE6D 3BT2H 2EC9T 1GC1H 4NWTH 4W4OA 4U1LB 4XNZB 1C16A 3MACL 3TCLB 2OMBA 1FGNL 4P4RA 2Z35A 1FNLA 1NDMA 4QOKA 1N6QL 4R7DA 5DJAA 1YEJL 4I3GA 4F7TB 4D94A 5CP3A 3QUKA 4Z7UB 3CVIH 4XTRD 2D4FA 4UIKH 5D96B 1KT2B 3C08L 1OTUD 4MMXC 1LILA 4P9HH 5IW3A 1MVUA 2MKWA 4A6YH 5F8QC 2UWEB 4QT5B 1LO0H 4MXVF 4G6JL 2YA1A 2ZZUT 1MJ7L 3ZKXC 1KG0A 1KCVL 3HS0A 1E28B 4HC1A 5DJ8A 3RVUD 5JHDE 1DLHB 1WV7T 2W60A 2JJTC 3KS0J 2RGSA 2DJ4A 2JJUA 3SKNB 2J2ZA 4GRWF 3AY4A 3F6LA 5DRWA 2IAND 3KXFE 1T7WA 5F7WC 5IQ9A 2CLRA 3Q1SL 4F7EB 1D5IH 5DQDL 1GPOH 1FO0H 5C0AB 1F11A 5TFSL 5TDPB 1IKNC 3MFGB 4U1SA 1F3JA 4JZJA 1NC4D 3STLA 4P5TA 4WEBH 4UTBH 4YDVB 4DVRH 2C4XA 4ZFOL 4GRWE 3QXVA 3A6CL 5DZLA 1NAMB 4HEPG 4NKDB 5B3JF 4GAYA 1XGRA 4MS8D 3UPAA 2BZDA 3O8XC 3MQIA 4P4RB 3MV9A 2W65A 2VZ3A 1TVHA 3PF2A 3KPRE 5J9PA 4JB9L 1YJDC 1MCBA 2HT3D 4BSWA 4PRHE 5DYOB 2R0WH 1WBZB 4U0QB 1RIVL 3T3MF 4L4TD 3AU1B 1DCLA 1BREA 4LPWA 1K4DA 5DT1H 2Y7QA 3MODL 3ZYJA 3MUY1 1T0MA 1A3RL 4WFHD 2PXYC 3DLQR 1IGFH 3QRGL 3PL6D 2Z31C 3JTSB 4M7ZC 4FQ1H 2CRZA 3IFNL 1EZVY 2HP4A 2NW3A 2VDPL 3DXAB 3OZ9H 4CMHC 4O2CB 4HWZB 3RY6C 5EO9B 2JIXD 1T1XB 5F9OL 4JN1H 1CG9B 5TQ0H 4Q9QH 3NCEB 1NFKA 3U4BL 4AZ8A 5JA9A 3B8SA 4NQDA 1U8QB 5I16B 2FGZA 5TF1L 4HMDA 3WD5H 3GK8H 2XTJC 1JF1A 4MNQA 1SJEB 3BISA 3NIFE 3GBNL 3FQXB 3VG9C 1FIGH 1J86A 1YDPB 1Q1JL 1MAMH 1I7RA 1T4KB 1T20B 1P4BH 4JZJB 2GCYB 2FH6A 4TOYH 3QI9C 5EBMB 3MNVA 1KACB 5MEND 2Q7NA 1QSZA 3PDDA 5F21B 1VB9A 1V3JA 3P4NA 1VGKA 2ED8A 4OB5L 1PQZB 5H94A 4Q0XH 2XA3A 3QCVH 3RIFK 2DBLL 4NO2A 5F7KC 1JNHA 1S9VA 4IOFC 1SBSH 3TGXA 2E27H 4P2QA 1KPVB 2I5YL 1FNFA 3MCKB 4Y5XA 4PJDF 1QTYT 1RZ7L 2O5XH 4UBDC 5CEYA 2HTKD 4N5ED 5HHNA 3E6FB 1JFQH 3EYFA 4ESKA 1OGAD 5FA3A 5T1MA 3I3EA 2O61A 2BP3A 2RB8A 1HHHA 3GM0A 4KWUA 3MPCA 2FJFB 4LAQL 3DXAA 1B2WL 2YEZB 5DHVB 1DVFA 1NKOA 1U3HC 2NXZC 3CH1A 1EK3A 4L8SA 5D6DC 4YHPA 2FYYB 3R4DA 4GT7A 1FVCA 1H3PH 4QRPE 4R3SA 5DJDB 3BIKB 4XNQA 4HJGA 1AKJD 1K8DB 2XQYG 5E2WH 3FT3A 3CUPB 1OP3K 2AJ3A 5I1JH 4O9HH 5I1EL 4OZIB 3L7FA 1U3HB 4JFDE 2BNQE 4KGJA 4KK5D 4PRBB 4Z7UE 1Q0YL 1SVZA 4TUJA 4LSQL 4PRPB 1PW3A 1A1MB 4PJAB 4NO0A 1DE4A 2R56H 1REIA 3LH2H 3S37X 3EFDH 4IRJB 4HK0B 4FG6C 3QI9D 3R0MA 1QFUH 3HI1A 3QPXL 4XVUD 5FM4A 1IAOB 5I1GL 1RVFL 3S4SG 4KY1H 4EI5C 3MLSL 3L9RB 3N85L 3WLBB 1HYSC 3DROA 3GJFK 1ONQA 4PD4J 2NTSP 5I15H 1DBMH 1Q72L 3LD8C 3PWVB 3B2VH 4ZD3L 5JQ6H 4NZUH 5F6IB 1EHLH 1U3HA 1CWVA 5KZCD 1JWSA 5CD5D 4UBDD 4NT6A 4MS8C 3WIIL 1CE1H 2WW8A 2D0FA 3GDBA 4P2OC 3O3UN 3GKZA 5I8KL 2ICES 1IKNA 1A6ZA 3QDGE 4ZQKB 4XBEL 2ATPB 4WI7A 4ODXA 4WUKL 1CK0H 4H8WH 1BJ8A 2UY6A 3ARDC 4KDTA 1O7SA 5EORH 2ZKHL 4Y5XC 1A6VL 4P9HC 3V4VH 4DFHA 4XWOD 2VN4A 3D25B 3VFSA 4I48A 1UWGL 4GFTB 1W0WB 2H26B 1U2CA 5I1DA 1LO5B 3UCRA 4K7FA 3DURA 3ARBC 3EO1A 3FT2A 3L3GA 1RFDH 4DFIA 2E7MA 3PWUA 2WWKO 5HYJD 3IJSA 4I3SH 1LO3L 4HKXB 5F3HA 1I7TA 4JAMA 2X1OA 2D7OA 3GB7A 1E4XL 3BAEH 3TNMB 3OKDA 2XPGB 3BJ91 2HT4D 1LMKA 1JPTH 2YZ1A 3HC4H 3LS4L 4XBGB 4P2OA 5GZND 1P1ZA 1OAKL 1RULH 5JXAH 5L2KD 3MBED 3M07A 4OD1H 2BDNH 4M7LT 1CN4A 1OAUH 1PSKL 2YD5A 3EOTH 3G6JB 5F7DA 3U9UB 1JRHH 2GJ6E 3MLZL 1NC2A 3X11B 2VE6A 4GRLD 3WNMA 4L8DB 3QFDB 3L5WA 1NC4A 5CILL 3CLEH 3KYOA 4OFDA 3DJ9A 3TN0A 3GMPA 2CUIA 1XAUA 1HOCA 2PNDA 5A16A 4LKCA 4U1LA 3WFDL 1X6NA 1ZANH 4PGEB 4JKKA 3HNSH 3C6SB 2D7TH 4OIBA 3MV9D 5FXCH 2XKNB 4OI9A 2V2TB 1D6EB 1K2DB 4MX7B 3CFDB 1HIML 5D70L 3DVIA 1EV2E 1T7ZA 3O8XA 5FYKD 4JPKL 1ZKAA 32C2A 2AJUH 5EO1B 1KELH 3SDCA 3CVHA 5IHLB 1GAFL 1T66D 5IMOB 5I1CL 2FL5A 3LB6C 5LVEA 25C8L 3MJ7B 3PE9A 3RGVC 4Z5RB 5F3BA 5JQ6L 1HEZB 1F42A 4O5LH 1P4LB 2Z91B 4MB5A 3N50A 4FQ2L 1A47A 4N90E 4Y5YA 3KXFB 5H35A 2NXYB 1FL6A 5EC2A 4JVUA 5LGJB 4TSCH 4OIAA 4W4NA 1ZVSB 4HK3J 1YNTA 5HI5C 2QQKL 3DGGA 3A6BH 1R3HB 1E4WH 1ITBB 5I73C 2X1XR 3G6JE 4UILL 2DRUA 4KGLA 2QV2A 2IJ0C 5EFIB 4U1MA 4JLRB 2Q7YB 4LDEB 1CR9L 4RFEA 1FNSH 2DLGA 1T83C 4L3EA 4MNGE 4U1NB 2J12B 5FECB 1IC7H 4FP8H 1UVQB 4NQSB 2VR9A 4IRSA 3KPOA 3UC0H 4EQ2A 3L5HA 2R9HD 1G7MB 2L4OA 3MO1B 4MD4A 3MFFA 5IW6A 1BAFL 5DLMH 1Y6KR 2Q3AA 5KSBE 3WDIA 5EOCJ 1INEH 3ZKMD 5KSVB 1XCQB 1DQMH 4ZPVB 2P4AB 5EA0H 3VXTB 4U1GB 3MRNB 4AQOA 3IDGB 4GMSH 3FB6B 2AXGA 3S3PA 3RU8H 1IQWH 4HBQA 3VDCA 2CDEA 3AB0C 1MFAL 2CJUH 1IC1A 1JN6B 3EFFA 4R90L 3EJZC 1OQOA 3MNWA 2BJMH 2YXMA 4JFOB 5FDWB 3VD7A 2IH1A 4LP4A 1TCRA 3EIFA 5J1SC 4PJ5E 4DTGH 3JSSA 5C07B 2IALA 4ODHL 1RZIB 2FX8H 4KJPC 3QUMB 5TE6H 2AJZA 3ULVE 2B20A 1A3QA 4GSDL 3BQUB 1CXLA 2PYFB 2OTUB 3CVIL 3MJ9A 3VJ6B 5FKAA 4JFEE 3ARVA 1IQDA 4ONFH 1L4IA 4NN7B 2EEAA 2I07B 4QF1B 4WHDA 1ZTXH 1RUPL 2Y6SD 1PG7W 1T21B 3L6FB 4UDTB 4PJ7E 3UPCA 5HHOA 1NFDB 1FP5A 4RNRB 1IC5L 2CKBB 4M4PA 4NN6B 2EC9U 1DQTA 6CGTA 4GUPB 4K8RL 2V5TA 1NGZB 3NABH 2XY2A 4NO0D 1FE8H 2JIXA 3VWKB 3VXSA 4JM4L 1MHPL 5IV2A 1IEBB 1IGYB 4PTTA 1RU9L 3U0TA 5IIEB 2HFEA 5HGHA 3IFOB 1ZT7B 5IB3B 4X6BA 4XGZB 3QIUA 5T3XH 5DEFA 3OQ3B 5IWLA 2EYSA 2NY7L 3CFEB 1NANH 5CEZH 3KLHD 5FCUL 1I1YA 2IG2H 3GIVB 2VERN 1BQUA 2W1NA 3QNZA 3UAJC 2OI9B 5H2BA 1KB9K 3FONB 4NJ9H 1W0VB 1FNEB 5HPMB 4M62H 4NZTL 1IGIH 4JRXB 1WIUA 5HYQA 4RMUA 2X10A 5DRZA 3LQAL 4OD3L 1CL7H 4P46D 2A38A 5E94A 1JPSH 1WC7A 4PJCE 2VQ1B 3UJIH 4U1JB 4JREB 3EJYD 3MRDA 1UYWL 1IAKA 3NA9H 1KPRA 2GI7A 5GSVA 1XR9A 5BCAA 1B88A 4DUXA 2DJSA 4EIGB 2B2XH 2HKHH 4A2MA 5MI0C 5D6CB 1DP0A 4WTZA 4MXQD 3LPGA 1MLBA 3RVTC 4HT1L 4WIQA 2R0ZL 3BP6B 1F00I 2G2RA 5C0BE 4PRPD 3HLAB 2ARWA 4HMEA 3IDNB 1YN7A 3OKLA 5EPMB 4QRRE 5D7JD 1HINH 3FOLA 4PJ8D 4FFZH 3L3JA 3OXRB 3RGVD 5D7KD 2JK5B 3WKNA 4W6WB 5F88B 5TQ2H 3UO1H 4RGND 3LHPL 2E6QA 3VG9B 2GSIB 1NUNB 3HMXA 3BHBA 1TMCB 4QXWA 4B7LA 4MA3B 5JPMA 2P8MA 3KJ6H 3VXTA 4HBCH 1G7JA 2GK0B 4UV4L 1RIHH 3ESVF 2GTWB 1MFNA 3PWPB 3WUZA 1H9VA 5EDXA 5DD1H 1TFHA 5BOPA 4DGYL 3KGRA 5BZDA 3VI4E 1MAJA 3W5NA 2EDJA 3MZTA 4QRRD 2EDWA 4FFYL 4AENB 3L3KB 4AM0B 1FZKB 1JYVA 1D9KB 1CFVL 5JXEA 5IFHH 1QLEH 3P77B 5MEPB 2X6MA 3BYYA 4LEXH 4ZO9A 3K3QA 2V2WB 1QLRA 4MAYC 3S37L 1BGXH 1DQLH 1T0NA 4X4YB 4WI9A 3WS3B 3VFWB 3BPCB 3BP4B 5FYJH 5GZNC 4U1HA 1C5CL 4NHCH 3BGFB 4GBXC 2C3WA 1BIIB 2ZWLT 3N1MC 1HI6A 1S78C 1CT8B 1P4LA 3EO0A 3I02A 4M3KB 4XBGA 1EAPA 2HJKB 3MXWH 2Z8VC 4JM2C 4X7SL 5DHYA 4JKPH 3SEPA 5EN2A 4AEHH 4RQQA 2R9HC 1F4WH 4AL8H 3QZWA 3H9HB 2EYRA 5I17A 1FNGB 1CL7I 2FSEA 3D85A 3DYPA 3CVHH 2BOBB 1NUGA 4HS6B 2N4IA 4LARH 1LD9B 3EYUH 1Q0XL 2AEWA 5JHDB 3ZT5A 3BPOC 4X9IA 4XP4H 1N3NA 2ZKHH 4OZHA 5GGTL 3PJSA 4S11A 1TVBA 4NM8L 2BSTA 2UWEE 5F89A 5ADPL 5E08H 2DQFA 3R06A 5E6ZA 4C57C 4RDQF 1XCTB 3QG6A 4ORZC 3BKYL 1DUYA 2X4TB 2FO1A 1WIOA 3O4OC 4FZ8H 1CD1A 2C9AA 3WN5C 1M05A 3IFLH 1U6AL 2GTZB 3ARQA 4EUPB 3LMJH 2Z91A 4LCWB 1YEDA 3RTQC 4R6UA 3DVNB 5H37H 4XPTL 3UJJH 3VXSB 4XPBL 4JAMB 4LCYA 3GB7B 4K3JL 3OF6A 2NR6D 4V2CB 1EHNA 4E9LA 1JUFA 5E6YA 3ABZA 1EX0A 1FCCA 3E8UL 1T2XA 4N1HB 4PJ5B 1HZHH 1V5JA 3CSGA 4IMLB 4YDLB 1SYSB 3CLFL 4XCYB 5CINL 2PYED 3O6LL 3RWCB 1JVKA 2HH0L 5EBWB 5FUZH 3TJEH 3ES6A 2OTUA 3CX2A 4H0HB 5KS9F 5GS1A 4M02A 3MRMA 3L7FB 4MA1C 1QQDA 3L95B 5F1SA 4BSWB 3VE0A 3G5YA 1CGWA 4JFFA 4JRXA 1MCFA 2YRZA 3KAAA 5HDBE 2YA0A 1ZGLA 3QH3B 4H1LG 4WTZG 2MCPH 5SWZA 3T4YA 5CGYC 1NAMA 4OI8A 3S4SB 4LDOB 1HCFX 1PGRB 1VACA 1HSAB 4BZ1H 5D70H 3AROA 4P2RB 3PWLB 5IQ7L 1MFEH 4PJEE 5C3LD 4TULH 1MAKA 4ODUA 2LU7A 5I1AA 2UV3A 2YWYA 4FQJL 4OCRL 3PWVA 4WHYH 3QEQA 2ESVB 3D2UA 2BNQB 2F54B 4H1LB 4EI5B 3DNKA 4XCFL 1NANI 5C1MB 3FN3A 1KPUA 1J0JA 3O3BA 3H0TA 4KJYA 5BV7C 2FIKA 5DRXB 4IRSD 5D1QA 2A83B 3MRHA 2P8LA 5A3IC 2W0LA 1Z9SA 1C5CH 3BO8B 1OGTA 1A0QH 3U6RA 4GKSA 4LCIH 5GGUA 4KROC 4LLAA 3MBEC 3WFCL 3SPVB 2ZUWA 4UOJA 4NBXB 3EDJA 2EYTA 1GGYA 3DBXB 5C86A 1BD2B 3BDYL 4X7SH 5TH2A 4HSQA 1DEDA 1RPQA 3NZHL 1MH5B 3K2UL 4K71B 4OSUL 4P2OD 1QBML 3FQRB 1FLTX 5CZXD 3IJHA 3DETC 4GG8A 1TTFA 1UZ8B 3SJVB 3GO1H 3MROA 2GITA 2A6IB 5HVWA 5HGDA 3FO1A 3N1QC 2BVQB 2EEDA 3QUYA 1S5IL 2AGJH 3ZO0A 1EEYB 5HD8C 1UQSA 1TZIA 2D7TL 3O11B 4HHAB 5IMMA 2IBGA 4ZODA 1J7VR 1RHHA 3BZ4A 3IRPX 3WLWD 1ZMYA 5KSUB 2PW2A 2RAMA 4NQVB 4TRPH 3TCLA 3ILQD 3HZYA 1EUTA 4LMQE 4NC0B 4RGOL 5EO9A 1KCRL 5C0IB 3RUGA 2VL4A 1JGUH 5IF0B 1NKRA 3QJFB 4X9BA 3PV6A 5FYLH 3TJHD 5KSVA 5LQBL 5I75C 4K7PL 3QXAB 4AMKH 1N5YH 4RCAA 3QWRD 1R5VB 4UDUB 5CLTA 1CFSA 1U95B 1HHKB 1GGTA 1IMHC 3OR7B 3VFPB 4UINL 1MWAL 4KJQD 5DS8A 1P9MC 1PG7L 3RWJB 4V2BA 4L4JA 1MNUL 2XY1A 2IMMA 4QTIH 2E3VA 3VRJA 1I7UB 4O4YH 4OD2B 1NH6A 2A6KA 1TQBC 5IKCA 5D7IE 5DD5H 5C0DA 5FFLA 5M7QA 4D9RD 4M7ZB 2NY4C 1AD9B 1DQML 2GIYA 1U92A 5DJ0B 1DBKL 4Y5YC 4M9PA 2AEPH 3N1GC 5T3ZD 2ZUQC 2EDDA 1A7OH 4IRJD 2H9GA 2F58H 3AC0A 1W72L 1P4IL 1FCGA 4I77H 4CDGC 2FSEB 4BH7A 4EVNB 3OAUL 3AS2A 1MJUL 1TJGL 5IGXL 1QSFD 1AD0B 1WZKA 4ZNEA 1F90L 1WT5A 4MNQB 5TDPA 4HGKC 4ZSOA 2NY4B 4GAGH 3FMGH 3FQWB 1XIWA 5GS0C 1PKOA 3C2AL 3SDYH 1X7QB 1D3CA 3O6ML 1E27B 4Z77B 2NCMA 3E2HB 2PYEE 4XPHL 4M4RA 5D2LA 4KFZC 4OIIL 2VABA 2DL9A 1CE6A 5F88A 3ECBB 4GMTH 4XWGH 4OZGA 4NM4H 1R0AH 2VO5A 2BMKA 2NXYC 2XI9A 5KVDL 3RTQD 5JW3L 3GBLA 2DQGH 1ZT7A 1QNZL 2XKNA 4FOMA 3IAGC 2BY2A 5CJ8A 4EKXA 1BZ9B 4HGMA 1S9KC 5B39B 3QNYA 4Y89A 1S7XB 4P2CG 5A43C 5I1AB 2HJLA 2XT1B 4G9DB 2AXFA 1OP5H 1ZLWK 3BRDA 1A4JB 3MRPA 3KPLB 4Q6YA 2EH7L 4Y4KC 2ZCHL 3JTSA 3GO1L 3U30B 4AENA 5D7JA 3DURB 2OYPA 4L29A 1P4BL 3UJTH 3LQZB 3AB0B 1KBGL 1ETZA 4F3FA 3EDKA 2AJVL 3MBXH 4MDIA 1CF8L 3BKCL 4PJAE 3RDTD 3BXNA 1U42A 2IPTL 4F8QA 4OF5A 3ARXA 3NZHH 5AYUH 3RZWA 2IG2L 1ED3A 5LAXB 1J1PL 1WCBB 1A22B 3CXHK 3TIDA 3ZZ1A 1T2JA 1QSVA 1IT9H 1QR1A 4NJAL 1NL0H 1H3VA 2HVJA 2Y23A 4MJIA 2R4RH 5E2TL 2DB8A 3Q6FA 5K93A 2I60L 4ZAKB 2APVA 4XCCH 1JK8B 3ALWA 5BS0B 4URTB 4P3CH 1DQDH 4DGIH 1U3YA 5FV2A 4HWBA 5ITBH 5HGAB 1A7PL 2CIIA 4PJ9B 2VZVA 2A73B 4ONGL 4RGMB 3BH8A 3QHZH 5ENWB 4OT1H 1L7IL 2AK4D 3L3OB 1NGPL 3MV9B 1I3RA 5D71H 1ADQA 5HHME 4HUVB 4XTRC 1SY6H 5KVFH 1JNLH 3BQUC 1Y0LB 2K1MA 4G9FA 1FFNA 4Z0XA 3ZKNC 1KIUA 3RI5F 4PB0L 1N4XH 3O6FB 3MRPB 1E6OH 1BECA 1UA6L 1I7ZA 1UB5A 4LSRH 1ZHKB 2C1PA 1KEML 1IEBA 2VR4A 1K5NA 1OSPH 1T5XA 3TYFB 5IFHL 4HZLA 2HN7A 3IU3A 1CK0L 4H8WL 1U8PB 1J1XH 1S7TB 2D2OA 3QA3B 2JKXA 1CCZA 4OIIH 2BXYA 4LDLB 3D85D 4IS6B 5EU3A 4L4VD 4EN3C 1IQDB 5IB2B 5C0GB 1XH3B 4HAFA 1T0PB 2H2PC 5EOTA 1DBML 4ZD3H 1FV1B 1ZT4A 3D18B 4QWWD 4OF8A 1MHCB 4KHXL 5EU4B 4EJ1C 2XN9E 3O45A 2O5ZH 2FGWL 3VXUA 3C5ZA 1ZE3C 5DHXB 7FABL 4KKLC 2VLKD 4TQEL 1C1EL 2XICA 1BQSA 5E9DB 1BVKB 4RGNE 3RUGE 4S1QL 1D5IL 1FZJA 4MJIE 4MJ5B 1MI5E 1JYWA 3CX5J 4MX7A 1JHTB 4MAYB 4J3XA 1I1AC 4OGYL 4EDWL 3RGVA 4ZUVB 4ZOBA 4QTHB 3INUL 4XRCA 2M8XA 5EOQL 1B0RA 1HCVA 1DLFH 5C0BD 5CJOL 1D5BB 5ANMB 3L5IA 4LVEA 1HXYB 2BSED 5GHWH 3KPRD 3VH8A 2OP4L 1NQBA 2NMSA 4XPFH 1CLZL 3S7GA 5IW6B 3PIQB 1U58B 5MERA 4BFIA 4P2RD 2I9TB 2QEJA 4J4PC 2YWZA 1YNKL 1CQYA 1TQBB 5GS2D 1T7YA 3RPKA 1J0YA 5C07D 4FMKA 1JF1B 4MCYA 1RK1B 3QEHA 2WUCH 2A74B 3ZSTA 1MJ8L 2ESVD 2P8MB 3I9GL 5DYOA 4E41A 4GBXD 1A6UL 2IQ9L 1MCEA 1W8OA 3LN4B 5C0GA 4NN5B 1I8LA 2QSVA 4PREB 1KELL 2F53A 1Q0XH 3D3VA 3BGMA 3G08B 3HMWL 4L8CB 1BHGA 1MFCL 1XGPA 1JNLL 4YFLI 1DBJL 1NBYA 3SDXB 1MLCB 3VFRB 1KJ2L 1YC7A 3MLTA 4WUUB 3RWIB 3PQYB 5EZJA 5AZEL 1CICC 5T5FL 3MRBA 4J3UA 1NBVL 3GBNH 3WIHL 3F7YB 5B3NA 2ARJQ 1UM4L 3D2UD 3ULUC 2W0FB 5C0CA 1S9YA 3KNBB 3X12A 3UTZA 4DEPB 4K2UH 5SWZE 1RUKL 1S7RA 2J5LC 2HFGH 1Z6JT 3W2DL 2CXKA 3CFCL 4G8GA 1KJVA 4YHIA 4WW1B 4ZFFB 5D93B 5IVXE 4UV7H 4YDKL 1Q8MA 2VC2L 4MQXC 5I76B 3CK0H 1UXWB 2R23A 3P4MA 4XZUA 5FGRA 2N56A 1U3JA 1AJ7L 2EDLA 5C08E 1UACH 4NQCB 4JB9H 1VFAA 4Y4HC 4Q6IB 2J6EA 5IFAH 1MELA 4RMTA 4XHJD 1HNGA 3VDBA 3QSKB 4CBPA 3WXWH 3MRQA 5ERWA 3QFJE 3CCHA 3U0PB 4EXPX 2HMID 1KLUB 2JJVA 4IS6A 5EU3B 5IESH 2XWBB 2ZPKH 3AGVA 1MFAH 2CJUL 1I9RL 3SKOA 1AO7B 5TE7L 4JZOA 1WEJL 1B2WH 2EECA 3MV8A 4QRSA 3C60A 2GJJA 1FAKT 1F2QA 1QBLH 3VE0B 4J23A 4IRSC 3PDGA 3JWOL 1YJDH 1TZHB 3ZDXE 2DI8A 2GEEA 1B0GB 2XZAL 1DUZA 1HDMA 2DMCA 1CFQA 1Y6NR 3OF6D 1KN2H 1RZGB 3DETD 2EC8A 4FTVE 2B1HH 4HUVA 3DECA 4LPTA 1ZA6A 4Y2OA 1LP9F 1P7QD 3VXMA 3HI5L 5SWSE 3RVXD 1BJ1J 1GRWA 3RJQB 1QO3B 1MVUB 1QEWA 3P30H 1N8ZB 2BOCB 1L0YA 3UZEA 5L0QB 5CJXC 3TO4A 4P48A 4XT1C 1KTKE 2A9ML 3FAWA 4XZUB 3RIAK 3PWUB 5JR1H 3I84A 5KW9L 5MENA 4OZGE 1DBAH 4TN9A 4N0UE 2NZ9C 5F9JA 2P49B 3LCYA 3GUTB 4PJGE 2O5XL 4JFPA 3DVFA 3H3BC 4DZBA 4X9FA 2R39A 1X5IA 2ILLA 3J7HA 3MV11 3QPQC 4R4ND 3OAZK 5FUCC 3GSXB 5KS9E 1FLRL 4PJXB 4KV5F 5ETUB 2ADJA 4WY7L 2NTFA 3D5OF 4EN3D 1BP3B 3ARZA 2Z92B 3CC5A 4AYFA 2WINB 2NLJB 5FYKE 4EDXA 1CXFA 1G7LA 1SJHB 2DD8L 1MFCH 3FQUB 4NFCA 3LZFL 3X13B 4PJHF 3CPLB 4U1IB 3AREA 3QZWG 1B90A 1XGPB 1FO0A 5FAAA 4MLSA 4LCCB 1TTGA 2GUOA 4YBHA 2DL2A 3MRLB 1VFOA 2YMXL 5I16A 5JDJA 1Q9KA 2XYCA 3BQUA 4KAQH 1UM4H 3ZE1F 1JGLH 5EU6A 3FMGL 2X05A 3I6LD 2DQHH 3VFGL 5TJWK 3ZKND 5F9AC 4LLDA 4PTUB 4XI5C 1AXIB 3WE6A 1ORQB 4QRUA 3DRTB 2JTDA 3DPBA 2XZCH 1NMBL 1NDGA 2CDGB 1A3LL 1J10A 3FO9B 1F45A 5IM7A 5GRVL 5EO0B 4X6CB 4ZFOB 2R1XB 4JO3L 1I7UA 1Z9OA 2DWEA 1C08A 1LEGA 2LAAA 4Y2DA 5C08A 5CIPB 3WKML 5D2NE 1CXHA 3CNKA 1F97A 3WSQH 4LU5L 1HQRA 4LGPB 4LHQB 3QDHA 5B38B 2BFVL 3QO1B 4P5MA 4YHPB 4LBEA 2OR9L 1YDPA 3BGMB 4L8CA 4FNLH 4PRAB 4M6OL 3GMQB 3EHBD 4HUXB 4WFFD 4DQOH 4F8TA 5BRZB 5EOCL 5EORL 2DMBA 2OK0H 4OM0L 1NUFA 2XWTA 1EJOL 2VDQH 3HI5H 2DYPB 4U1KA 4Y5VB 3HHRB 3HZYB 4KZDH 5FB8B 4P0DA 5F1NB 1NLBH 5E1HB 5IB1B 4HJJH 3VD4A 3C5SB 3JBG7 2V17H 5E1AB 3CZJA 3QIWD 3IXTA 3MFFB 1JTTA 3DUSB 4N0UA 4UOW1 3ZE0F 1BQLH 5B38A 4KUCD 1YYMH 3VFMA 1NFIB 4KK6C 1KCSL 2ZSVA 3VMNA 4F9PA 4YQXL 3AFLA 5FHAH 2VLJB 4XNMA 1DQJA 2NY1D 4TPRH 3SGDI 4E41E 2SEBA 3B9KA 1XGTB 3QEQE 1P7KB 2ADGA 5TFSH 2H8PB 1UKSA 5HYJA 3B8YA 4WFGD 3BD5A 4X6FB 4Y4FB 4J3OC 2ORBL 4Y0GA 4HUMB 4HIEA 4OUOA 4HWEL 4Z7OF 4NKDA 1J87A 1RUQH 3KPQA 4KTEH 4KK5C 1YN6A 1A6ZB 4Y1AE 3K74B 1RURL 3CXHJ 3F7RA 4EIZC 3RTQA 2G9HB 2ZUQB 4OKVB 3QIBD 3D39E 1AXTL 1MF2L 1MRDH 4RISH 3MREB 1RJLB 3VH8B 5FYLE 3V7MA 1UZ6E 2BNQD 3UTSD 3HE7B 1QLFA 1VFBA 3BZDA 2YA2A 3ARSA 4R7NB 4DN4H 1UXSA 4JZOB 3T4AA 1J5OH 4XNUH 1H0DA 1FNEA 5BQ7B 5HPMA 5GRWA 2EEBA 4KKBC 3T1FB 2RCSH 5C9JA 4HKZA 4CAGA 2A1WH 1MI5A 4HD9A 2NYYC 4YHZH 3QHZL 5ICXB 4RZCB 1EBPA 5DJ8B 1WZ1L 4O2FA 3MXWL 4J8RB 5SWQA 5TQ0L 3HE7A 2YPLB 2BXZA 3T0EE 1JPGB 3G6AA 2V7HB 5INCB 1BZ7B 3LY6A 3IJSB 5GGSA 3JWDH 3L1OL 4V1DE 4L29B 1FBIH 4H20H 2K3TA 3PQYD 1I1AA 5D8JH 5DWUH 3WJLA 4D0BB 2GW5A 4B7IA 1MQKL 3WN5A 4H0IA 4ZUTA 2PCPB 3BXNB 2WMPA 5C0CE 3VD9A 5E5RB 4GW5A 4OLWL 4KKNA 2X4RB 4DKEH 1UWXH 4GH7B 1DFBL 1NJ9A 4I0PC 4DUWA 1ZSDA 4OKVA 4JANA 2D7PA 4QGYA 5JHLL 3O4LE 5DD3L 5I18L 4QRTA 3W5MA 3PXJA 3S9DB 1AXSA 1G6RA 3H9SE 4LFHD 4OZFH 4WW2C 2YN3A 3FQTA 3TIEA 3D3VE 5J3HC 2ARJA 1I3GL 5FCSH 2MCPL 4IOFD 2FB4H 4NT6B 2BVOA 5JIPA 4OJFH 3G5XA 1A21A 3IDUA 4ZUTB 1JI2A 4ZTPL 1UGNA 4Y5VA 3P4OB 3O4OB 4FG6D 4WHTB 5FO7B 1R24A 4QHNA 3AXLA 4I4WA 2BRRH 5L2KB 5IBLC 2P8PA 1BQHA 2DI7A 4D8PA 4P2YA 3ZE2E 4DAGL 3H9SD 1RUQL 3H9YA 4MGXA 4QXGL 3ZLQC 4K94H 2Y07L 4FABH 4PREA 5DT1L 3U0WH 1AO7D 4MD0B 1QRNA 4TVPH 3UXFA 4JDZA 2Q7YA 1CFNA 3D9AL 4F58L 4PS4L 2Z8SA 1CT8A 3C5ZD 4M6AA 1PVHA 4K3DL 1NGWB 4Q2ZB 4M7JL 1KTLA 1ZHBB 5GJTH 2YPVH 4RA3A 3PWJB 1F6FB 1D5ZB 2IBZY 3GSOA 1CDYA 4LMQI 1R5VA 5D1XA 3MV8E 2HKFL 4XPAH 1N59A 5I17B 4G8FA 4P59H 1K4DB 1S7SA 2OSLB 3MRGB 5E8DH 4NQDB 4KJWD 4PJFE 3ZE1E 4BK5A 1VGEH 1ZT4B 1E4XI 1EGJA 3IDGA 3GGWB 4JO1H 3T3ME 5HHOD 2ZSWA 4B50A 4ZO8A 1CICD 2ATKB 4YDIL 2OX5A 1Z9MA 4M1DH 5F1IB 2X09A 4DW2H 3WNLA 1TIUA 1F6AA 1NBVH 2Y25A 5IBTL 4B0MM 3H7BB 2Q8BL 2DI9A 4LQ1A 3WHE0 4WHCA 4HH8A 5I19L 5IVZA 2HFGL 5CZVH 3ZTNL 2E7BA 1PQZA 5H94B 4AEIL 3CDYA 5DUMH 3VFVA 5HDQL 4Y4KA 2I26N 4U2YA 3SY0A 4QLRA 4UV7L 4YK4C 2VLJA 4YDKH 4G8GE 4NCDA 4YHLH 3ZKMC 1VEPA 4ZNEE 2FECI 5T5FH 2LTQC 5KSAC 1IM3B 3SE4A 2YRPA 2NW2A 3S35H 4G9FE 1U36A 5E00A 5JOPE 1T22B 4NOBA 2MPAH 1WCQA 5DJZB 3V6FB 3Q6GH 4NO2B 3U7YH 5J12C 4GRMA 5D7LB 1AC6A 4HIJB 4EOWL 4CN6A 1OCWL 1DSFL 5C7XL 5MEPA 5CMAB 4OZFG 1U8QA 2ZJSH 5C0AA 3IETA 2VDRH 3SE8L 1GC1C 1OARH 5CGMA 5HGBB 5L7XL 3MLSH 3N85H 4WI2A 4WTXA 1M71A 5TDOA 2IGFH 1DBBH 2X4UA 2OR8A 5EG6C 4ONHA 4M61A 1BJMA 4G5ZH 1IRAY 3CZFB 4K94L 4YHOH 4YC2B 2BSRB 4D9QE 2GHWB 5DURB 4JDTH 3KPSD 1RIHL 5EU6D 4MDIB 1A6WL 1K5NB 4PGCA 3SCMA 1UM6H 3EOBA 3CD4A 5F7HA 4DVBB 4YAQA 3I6GA 4IMLA 2WLZA 2F5BL 3PP3H 4PJ7A 5KSAB 4LHJB 4N8VA 1LP9A 1R3JB 2H26A 5IVXF 5BO1L 4HG4J 1KGCE 2AXFB 2EH8H 4FS0A 4NNPL 3T4AB 4TVPL 1QQDB 5FGBC 1MLBB 2APBA 4YZFF 4K23L 4Z18A 3QUZA 5GPRA 1JP5A 2VR5A 4Y19B 1NGXA 4MDJA 1GYAA 4O2EB 4FFWD 1FGVL 1I9IL 4QY8B 5E9DD 3QULB 2ATPA 3QUZC 3HNTH 2MWCA 5DMKA 4NO5A 1JYXA 4WU5A 3I75A 3FRUA 1WSST 1DL7L 4LPVA 4DKFL 4N8CL 4LIQH 1ZGLB 1F13A 4K07A 3O41A 4I48B 4U6YA 5BW7A 5J13C 1OLZA 2ZUUA 4L9LB 3GKWH 4Y8DC 5DVMA 3ROLA 3O0RL 4PRIA 4AEHL 3CMGA 2Q76A 3HUJB 4LSUH 1CD9B 1TITA 3FZUD 4RAVA 3MJGX 4IRJA 4BZ2H 5EZIH 1DLHA 2BVTA 3PGDB 3BW9A 2DQHL 1OAKH 1RULL 4LSVL 1BBDL 1NLDL 3LOWA 4XMPH 4ACPA 1S3KH 5ILTH 5D71L 3VXNA 4CVXA 2VDNL 5DK0A 1KEGL 3IT8D 5TDNA 1UXSB 1MVFA 2ICCA 2R1YA 4ELMA 5I8OH 1A4KA 1S7UA 3HC0B 1Z5LB 3MX0A 3L95A 4KZEH 4X6DF 4R2GB 4PBXA 1QYGH 3CLEL 3OKKB 4HIIA 4D0CA 1SJXA 4BSVB 2VRAA 1YPZF 2FEEI 2LFGA 3S34L 1QRND 1MY7A 1KV3A 2K9UA 2YKLH 3H3PH 3WUWA 2OJZL 2NY0D 4FQHA 4GKZB 2E27L 3OSKA 4OF7A 1QSEA 1U8JA 1PX3A 3ARWA 3C5SA 2F8VA 2Y36H 5ITBL 1IGCL 3QCUH 5DC0A 1INQB 5DJ2B 1QKZH 4HKJB 1PFCA 1H15B 3BEVA 4WCYH 2QHRL 1M7XA 1UJ3A 1G9MC 5FUOH 2UVFA 4YDJA 3SDDA 4OZFA 1HNFA 3MLWL 4JN1L 3NCYS 5HD8D 2E8YA 2IQAB 3OWEA 3TBYA 4X8JA 2F5BH 3RVXC 1RUMH 3QCTL 2F8XC 4ZYKA 4LVOB 3R1GL 1OY3B 5JPNA 4PR5A 3BP7B 3JUYA 5FV1L 5E6ID 5BXFB 2C3VB 3DX8B 3KPSE 2ZG1A 3VWJD 3O2WL 3ARGA 1C5DB 4D9QD 4M5ZL 1CTNA 1AKJA 3C9NB 5CAYB 32C2B 3ALXA 4EXKA 5FDYA 3REWA 5EU7C 2GSIA 5D1XB 1A3RH 1HH9B 5CEYB 3BFOA 1IAIH 2X9WA 2DQDH 3O2DH 3K2MC 2PETA 4NWUH 5GIRA 3UZQA 3DRTA 1MCQA 4X8JB 1U8OB 1WVZA 1I3VA 3TNNA 1U91B 2J5LB 2Z8WC 4JRXD 5C0DB 1B6DA 4KH2A 2HN7B 4LHUD 4AMKL 1BBJB 3FZUC 4K23H 4WI3A 2O5ZL 2VH5L 4NZUL 1I1RA 4UNTA 5D2LE 1ZA3B 2XIDA 5I71B 2R1WB 1SM3H 1FZKA 3EYQC 1CDCA 3PP4H 4K3EL 2FX9L 2JELH 5JOPD 1NAKL 4XNXL 5EZLB 4RFNB 4G8IB 4UDUA 3EO1B 3F58L 1N2RA 3FT2B 3T65B 3L1OH 1UM5L 3M45A 1J8HB 4O4YL 3V5KB 2DQUH 4ELKA 1S8DA 1YYLL 1BOGB 1R3IH 2FEDD 3HRZB 3IGAB 2FO4B 1LO4L 3B9KD 5IFJA 4OLWH 1JGUL 2ITDB 3VGHA 3ZDYF 1MHEA 5D2NA 4JY5H 3U2SA 3LKPB 1S7QB 4Z7WE 2I5YH 3RGVB 1X6LA 2QQLH 3RZCA 2NZIA 1UB6A 2WP3O 4JFHD 3ARFC 3FFCB 2AGJL 5CZXC 3MV7E 2PF6A 4WGVB 1I3RB 5DUPL 4AJ0A 4HWUA 4KMTH 1R6VA 3C2SA 3WJJA 5GRJH 1NUDA 2BY3A 5SWQB 1JWMB 4LCWD 2X5PA 4QTIL 2Z9TA 5CJQL 3VD5A 2VDMH 2PUQT 3MV8B 3HCVB 12E8H 4PP1C 3KYKL 1OAYH 3CSYA 4JN2B 1OAQH 4QHKI 1EUUA 3TN0D 1N5YL 1MCCA 3NPZB 2NW3B 4QRRB 2YPKB 3RAJL 3L3GB 1KC5L 4PY8I 2IADA 4QNPE 4H25A 5JDSB 4FFWC 3HUJE 1U8LB 4JG0L 3DIFA 4YE4L 4KKCC 4XCNB 4YXLH 3CU1A 4LSDA 2BCKA 1F4YH 4P3WA 4N9GA 3V8OA 4CL7A 1ZXQA 4OZHE 3VXMB 5DVNA 3RNQB 3KYNA 5HI4D 3O8XD 3PHQA 5JTWA 5MP6H 3O3DA 5HTSA 4HS3A 1A7BA 5E2JA 1FVEB 1F02I 4TSBL 2ZOKA 5ADOH 4EZMA 4YHKL 3AAZB 3TBSB 3HNVH 1V3LA 1FFPB 4G7VL 5JW3H 2Q86A 4L8BB 4APQB 2VDKL 5D7LD 4PJBB 4PRDA 1TZHA 4ELMF 4LCYB 2ID5A 3GMMA 3STZA 5ESAB 3AS1A 1NCTA 4UT7H 1WC7B 3KHOA 4UB0H 4M5YL 4Y4KD 5IW1A 5E2UH 3CUPA 4Q7DA 2FD6H 4JG1H 5BS0E 3MJ8A 1OPGH 2WQ8A 3ULVH 4XCYA 3WLBA 1T66C 5DD0H 4APQC 3DX6A 4M61B 4OJFL 3G9VA 4Y16A 5FYKU 1R3KA 1T1YA 5KVDH 5IEHA 3DYMA 1CGTA 2NR6C 4D9LL 3VXME 3SGKC 4PJDA 3LRSA 4OZ4A 1NGPH 4C83A 3SDCC 2DQFB 5B8CA 4WEBL 1HHIA 2G5BB 1BD2D 3VGBA 5C0CD 4U1KB 3SE9L 5K59F 4O02H 4X4ME 4P23D 2P5EA 3G5VA 1T2QH 1KFAH 3P9LB 3V8CA 3P73A 5C0JB 3PQYE 4IEFB 4U6HB 1IC7L 3PWJA 1R3JA 1NGYA 4CJ1A 3BKYH 2R4RL 5E2TH 4BQ9A 4F58H 4GXUM 2VXUH 5J7CC 3ZKXB 1OQXA 5ALCL 4OV6F 1J9CT 3MOBH 2CK0H 2CO6B 1LQSR 4U3XA 1OCWH 2WUBL 2R1XA 1VPOL 4ZO7A 3GSQB 4JPKH 4JQIL 1IGTB 2WBJB 4Y4FD 2YMXH 5D96C 5FYKH 4YUEH 4HLZG 3H9ZA 3SGDH 4KI5D 5C0FB 3OR6B 2XG4A 2ZSVB 3CXDH 3HKFA 1OW0C 1I9JH 3K46A 4DZ8A 2CSPA 4MD4B 4WGWB 5CBEB 1HQRB 3BD4A 3V6ZB 2FZ3B 1NGQL 5FK9B 4XAKE 1N0XL 3QIBB 3W11D 3OGCA 4PG9A 3LSOA 4ERSL 5LGHL 4L3EB 1P7KA 4JZNB 4XHQA 4P57A 1I8IB 3MJ7A 5TE6L 1J8HE 3V0WL 3IXAA 3TBWA 2COQA 4HWZA 1T7XA 4ETYA 2NNAB 3IDJA 4LLYA 3FCTB 4Y2DC 3FOLB 4HUNB 1JPFB 1RJZA 4WDIA 2EIZA 3IXTB 4U6XA 3MRDB 4YR6A 4MB4A 4R96A 3ZYOA 4ISVA 1I75A 5DFVC 1QSFB 2VISA 4RA0C 5ETUA 3LRGA 1KPUB 2H32B 1KB5L 5LWYL 5HVFB 2D9QB 3NABL 3S8WA 4MHHG 3B9AA 3MUGB 4PJFB 4XCNA 1IAIM 4ZSOB 1HILB 1N0LA 3QUXB 4RWYH 5D7JC 3WFBL 2F53E 4X0KA 3QDAA 1QRNB 3LEYH 3SHSA 2QTEA 3MGAA 3TVMC 4HKXA 1UFUA 3DV4A 1GJIA 3TEUA 1CLYL 1QBAA 3KJ4C 4HXBL 4LEOA 3BKMH 1A0QL 3I6KB 4OFVA 5BJTA 3TF7C 1GVIA 4HJJL 5DR5L 3OPZL 3BKJL 2YRLA 3BUYB 4GAJH 5I0ZA 3PABB 4ORGB 4J4PD 1VDGA 3GSVA 3NTCH 5K33A 3ES6B 5C70A 4PG9B 1D9KC 5DFVD 2HTLD 4A6YA 1UQSB 5C71A 4AIZB 2QL1A 2ZG3A 4KJWC 3WNNA 1CDIA 4NDMB 5T3ZE 3B3IB 3KPMA 3QEUB 2V5YA 1QSED 2VNCA 2EDNA 4UAOC 2LU4A 1CDGA 1RZKC 3QQ3B 5DRZB 3RPIA 4GMSL 2B4CH 2HAZA 3HPLA 1RURH 1BFVL 2KL6A 4YDLC 3IS1X 5C92A 4PJBE 3ZL4H 1H5BB 3AS0A 4PJ5A 1OOAA 1ND0B 3EYVA 3H9SB 3MRIB 2R8SH 4WU5B 1C7SA 2EXWD 5DVLA 4EBQL 3GSRB 5CFHA 1QVOA 3WDHA 4G6AD 1B0GA 4M6ML 5E99L 1H0DB 5E8EA 4LKXB 1ZEAL 4QHNB 1P53A 3V6OC 5DRNB 5HGAA 1MHCA 1A5FL 3MRJA 4FXKA 3ULVF 3CFJA 2ICEB 1NCWL 2AK4B 1CBVL 5C07A 1NMCB 3NPSC 1MCSA 2HG5B 1NFIA 4OF6A 1OD9A 4UNUA 4WO4B 5IROC 4PJ7B 4PJHE 4OKDA 1T6WA 4L4TA 5KVGH 1Q94A 4WRLA 1EO8H 4WWKC 4PJHB 1EH9A 1M71B 1CDHA 3TO4B 3GMLA 1WCBA 5KAQF 3IS0X 5AEAA 1YEHH 3HB3C 2V6HA 3H3PL 3WIHH 4LLWB 4OLUH 3QHTC 1AIFB 3VFTA 4IJ3C 1WZLA 4QHUB 4KROB 4DCQB 3I3BA 3QUMA 3F5WA 4JRYD 5IMKA 3QCUL 2OXGA 3QDJA 4D3CH 1BFOA 1BEYL 2B1AL 1EEZB 2H6PA 2P5WE 5ITFB 3RTQB 3D85B 5CEZL 2R69L 1E6JL 4Y5XB 5CLWA 1G6VK 3K2UH 4Q74A 3P9WB 4LLQA 3M17B 4ZUSB 4BK4A 3CIQA 5JUEL 1UZ6F 4NZTH 4G9DA 5JW5A 3FB5A 1AGFA 5ALBH 1U41A 1PLGL 4JY6A 2OI9C 3W82A 4HF5L 2J8UB 4FTVB 3DHJA 1G1YA 5F1KC 1ZLVK 2X4NB 3GNMH 3R1GH 2VLKB 4RGMC 2FJGA 1T03L 1EEZA 2H6PB 1KN2L 2FYYA 5ITFA 1MHHB 5IJVB 3D48R 3F58H 2AKRB 4R26H 1DE4B 1U92B 3BVNB 3NOIA 4N1CA 5J6GB 2HYMA 4GKNB 2BRRL 3WL9A 3HG1E 1HSBB 3CX5K 1PYWA 4G8EA 4MA7L 1C5DA 4LCWA 2W0FA 1M4KA 3FT4B 4JZNA 3KYOB 3MUJA 3RUGF 5IGXH 5C8JB 1S8DB 3S35X 4MSWA 1KCUH 3MUHL 4FQXB 4OZIF 4LBEB 3MCLL 1IT9L 3W0WA 1JL8A 3LEXB 3OL2A 1K6QL 3QG7H 4AIZA 4ODWA 4PS4H 3DXAD 3OJ2C 1MHEB 2FX7H 4HIEB 3RWHB 2DLFL 3GMOA 4YBQC 1L0QA 2DLIA 1ZEAH 2AV7A 5I66B 1JE6A 3P40A 5EU6B 3RWEA 2BK8A 3ARFA 1NCCL 5ELIA 2D31B 3ILPA 1N64H 2A9NH 5T3ZL 1BZ9A 3RWFA 3O9WB 4PFEA 5FK9A 2FATH 5T1KB 2VAAA 3X11A 4C4KO 1QA9A 2JCCB 2QSCL 8FABB 4P2QE 3GSNH 6FABL 5GS0D 3ISWA 4JCMA 4U1HB 5D72L 5DJYB 2H1PH 1T1WA 3G9AB 1LE9B 4XMKH 5SWZD 2V2XA 4YX2H 3P4OA 4WHTA 2YD7A 3O6KL 3SDDC 3QIWC 3P0VL 3PGFH 3GMNB 5IHZA 5D7IF 4JKLA 1FFQA 1KJMB 2X4QB 5KSAA 2P42B 4QOKD 2BC4B 3Q3GA 2J88H 5E8NA 5I1HH 3SQOL 3SGEI 1CGVA 3BO8A 4XVJH 4F2MB 3IJHB 3RY6A 3QWQB 4G6JH 1TNNA 2BNUB 4PLJC 1BX2B 3MRKB 4NQDE 4Y19A 4FQLH 4R0LA 3GFUA 1ES0B 1AHWB 3CDGB 1BD2A 3HZKA 4U6YB 5CP7A 1PLGH 3QP3A 3NIGE 2ESVE 1Z9LA 2HTLC 1QP1A 4LLWA 4JO4L 4LLUA 3TZVA 3C08H 3ZHLA 1M7IA 2WBJD 5JPNB 4ZFOA 5EIVA 2MHAA 4RAHA 4YIQB 1HIMH 4UAOB 4JM2D 4AK1A 2BFVH 4P2RE 5HHXH 1E6JH 4RIRA 3IVKB 5IBLD 4KI1A 1FZMB 4R7DB 5C0BB 5IVNA 1MJ7H 3MLXH 3EOAB 4ZDHB 2YPLA 5DUML 4R0LB 1D5MB 5LG1A 1WFTA 3QR2A 4TVPD 1Z5LA 4RSVA 2F15A 2X42A 3QDJE 4G7VH 4XCCL 5ECJE 5JIIA 1UB5B 2ITCB 3KLSA 4NBZB 3B3IA 3KPMB 3UPRB 1AC0A 4FN0A 3BUTA 4K8RH 5M95B 4KVNH 3AAZA 3RNKA 5CD5C 1MRDL 3QI9B 1MI5D 3WUWB 1TTUA 3AREB 4X98B 4JPWL 3VH8G 1J1OL 1HYRC 2XN9B 2Y9RT 1E4JA 4MAUH 4DEPC 4MWFA 3TIDB 3R06B 5DMJB 3VI3F 1UWEH 4JHWH 3KG5A 3HFML 5ENWA 1XF4B 3FB6A 1G0DA 2ZJSL 4U2ZA 1D5MA 4JCLA 3ARDD 3OGOE 4YPGB 2YBRA 4PJBF 3ILQC 2BSSB 5KJRH 2CKBL 4R4BA 4Y4HB 2ADIB 4TNVF 1P84K 3I6KA 5IEHB 2B5IB 2QSCH 2EDXA 3VWKC 4XCFH 4F80A 5MENB 3GK8L 2ZCKH 3KPOB 1T2QL 1OSZB 4UMGA 1L0XA 3L5XH 1U0QA 4X7DC 2MFNA 4D2NA 3QDJD 1RJCA 4FFVD 3UTTA 3PDOB 2G75B 1MUJB 2EKSB 3DMMB 4JFDB 4K8RC 3C8KA 4PGBA 1CD0A 4ZPVA 4K9EC 2R0KH 4EDWH 1B3JA 3VDAA 1S7SB 4CADA 4AH2A 1X5LA 5DTFB 4XVUC 1CGSL 1U8KB 3QHFL 1DBKH 5B21A 2QADB 1ZHLA 4MXQC 1QFUL 5AD0A 5T33L 1X4YA 3TWCH 2RR3A 2IPKB 3UTQA 2AV1A 1KTDA 3SBWC 4JFYB 2DDQH 4PV9A 3RIAF 1D6VH 1C16B 3RVVC 5JHLH 1K9TA 1T04B 1XZ0B 2X89D 1F58H 2WSKA 1QRKA 4OGYH 1BBJA 1WWAX 4HUUA 4N0YH 2GK2A 3MBEB 4AT6B 5D7SH 3E6HB 2UZYB 1HHKA 4N8VB 4YO0A 2E5EA 2XWBA 2CGRL 5I1HL 5L0QC 3V6ZA 4JFOA 2YOCA 3FQXA 2VITB 4QF1A 3WHE1 5T3XD 3VFWA 4OAWB 5D1XC 4QXTA 4ODVH 4YZFE 1FFRA 3WXVL 2ZSWB 3MLPA 1RU9H 2CO7B 3KDMB 3FKUS 2P44B 1AHWA 3HZKB 4NRYA 1MQ8A 1XEDA 1HH6A 1EJ6A 3GSNB 1DANU 2OSLA 1FSKC 1QKZL 2IAMB 4HV8A 4HC1H 3KWWB 1F8TL 1NGYB 5E7FA 1N6QH 1SMAA 1UB6B 4S1RH 4LSVH 2Y7QB 1N7ML 4Q9BA 4JFED 5DTFA 3E0GA 3HMWH 3V4UL 2IPUG 2X7LB 1RMFH 4YXKL 1ZLSH 1FSKB 4YGVA 5EU4A 4HLZH 3BKCH 4KROD 2E9IA 2EYTB 5F7FA 2F74A 3I50L 1I1AD 1EMTH 5F9JB 3DXAE 3GUTA 3B2UC 5CSZB 3H42H 2MQ3A 4KVNL 2FLRT 2I27N 4RRPA 1DDHA 1OAUL 1PSKH 1SEQL 3B6SA 3HAEA 4LCUA 5BV7H 4F15C 1IAKB 2ZUVA 5EZLA 1FDLH 5IHUH 3BH9A 2MCG1 1A7QL 1SMOA 3B2UD 2F53B 2Z31B 4ZUUA 2DWDB 2GK0A 3KHQA 4P3CL 4X6DE 1CGYA 3KJ6L 5HYQB 1UG9A 4FQCH 3EJZD 1JGVH 1V05A 2PTUA 5EO0A 2V5SA 4NQVA 1RY7B 3IJYB 1JWUB 2BNRE 1MIML 3OR7A 4LVNC 5TE7H 3CVHB 5EBLB 3MGTB 2DLHA 1FORH 4LNRA 3H7BA 2Q8AH 3TM6A 1XR9B 2X1PA 1QFWI 4UIMA 1S7QA 2WWMD 1FL6B 4Q2ZA 3QT2A 1B4JL 3PHQB 2E9BA 4CVUA 2FL5B 1TVHB 3BN9C 2B1HL 1YQ2A 4H5SB 1CFTA 5HY9B 1LEIB 4LGRB 5DD6B 2W07A 1FFPA 2FDBP 3T2PA 2R4SL 1U8KA 1A2YA 3BPOB 3QRGH 1A5FH 1VHPA 3C6LB 2W0KA 4PBWD 2VYRE 3EUUA 4NKIL 3LV3A 1KJ3H 3SBWA 5D4QA 3IFOA 2I9LB 1M7IB 3L3OA 5CHNB 1F58L 3DIFB 1LK2A 3SKOB 3CGTA 2CMRH 1FZMA 5C0BA 2RQ8A 3O6LH 4OQTH 3LRHA 4NUGH 4WW1A 2AJYL 4M93C 2LU3A 2DIBA 1QR1B 4S1QH 3IDYB 3CMOL 4LL9A 5CCKH 5ID0B 1NMAH 3KPRA 4K7FB 4PRPA 4JHAH 5JW4M 3MV9E 1H5BC 1TVDA 5EBLA 3G6JF 3CSYB 4JN2A 4HQQH 2YK1H 2XZQL 1W0YT 4DCQA 5IV2B 3L3HA 3ARGD 3A6CH 1LEKA 2Y06H 3OKDB 5GRUL 3SGJC 3FB8B 4B53A 1IC4L 3V0VA 2HWZH 5CEZE 1ETZB 4F3FB 1UA6H 5BO1H 3D0LB 4HUWA 1OWWA 2J1KA 2MOVA 1RAMA 1NL0L 3BW9B 1KLUA 4OLVH 4PPTA 3Q5YA 4KKCD 1E4KA 1ADQL 2HA1A 3DRQA 2EYRB 2NY5H 2J8UF 4K94C 5FKAB 3S5LB 5J0BA 2DQIH 1T89A 3G6AB 4XP4L 4LLUB 3TZVB 4OLXL 3G5ZB 4I2XB 3JV6A 3I2CH 4WO4C 2VDRL 4ZOAA 4NSKA 5JHDA 1CD8A 4Q97A 2NY7H 2NX5B 4O2FB 4JVWA 5MI0B 2OZ4L 3WFCH 5DJXB 2CXGA 4CGTA 1KTRL 5HHVH 4NZDA 1WZMA 4Z0BH 5BV7L 3QXAA 2YD2A 3S97C 1T7VA 4X6BB 4L5FL 3IAQA 3MV7A 3T2NH 1V7MH 2J8OA 3TBWB 3DUHA 4E41B 1VFAB 1AP2B 1MHPH 2D3VA 2HFFA 4DN4L 4OZIA 3OZ9L 3RWJA 4HJ0D 1INEL 2GUOB 5E2VH 3S96B 3IDMB 2X4PB 5F9OH 4IJ3B 4O58H 5ICXA 4JM2A 5EC1A 3LEXA 1KENH 4PJ7F 1P84J 3QDGD 4I0PB 1FVCB 4KK8D 2Q6WB 2R4SH 3VXOB 3EFDL 1MPAL 3BDXA 5IQ7H 4WUUE 5IR1A 2IAMA 3FQRA 2DBLH 2X4QA 4KDTC 1MREH 4NQCE 1QG3A 2CRMA 1YA5A 2H32H 2GSGA 4ZMAT 3O3AB 4KHXH 5J3HD 4UNVA 4G7YH 4JO2L 1EXUA 1N26A 4X6DA 2I24N 4MXWL 2NPLX 5L6YH 5IM7B 5IB2A 5EOCH 4WV1B 2HJFA 2J4WH 3KPTA 3EGSA 4BZ2L 4FQHB 1VKXB 3PGFL 2VWEC 4ONFL 1K2DA 5E8PA 2CR6A 5D7IB 3HZMA 3W9EB 4QHMB 1A6PA 2N7BA 3GBMH 3RIFF 1YMMB 4G6FD 4XCEB 1MH5A 1H15A 5A3ID 3DMMD 4JFDD 2DN7A 3ZYZA 5EOTB 4ODUB 3C8HA 1LDPH 2E7LC 3VXNB 4ODHH 4W68A 1T5WA 4MQ7A 5T3XE 5FM5M 3QIBC 4L3EE 4NDMA 5HJ3A 5E5UB 1H3UA 4OBRA 4EVNA 5I1EH 4L8DA 1F2XK 4Z7WF 2C4FU 5DA0B 5F9WC 5EPMA 2UYLA 4H88L 2B0SL 2A83A 1K4CA 1G7PB 3TT1H 3O2WH 5BZDB 1O7VA 1A6TA 3SCMB 4S1DD 2FBJL 5DJCA 1I1CA 2FB4L 4RRPG 4IDLA 5F9DC 1Z3GL 3GSXA 4CUCA 2VQUA 4KZEL 2XXCB 4PJXA 3BUYA 3LEVH 3OAYH 2N1KA 4RAUA 1BZQK 1OW0A 3WIHA 2QKIB 4N0CC 5E2WL 4LQFH 3HI6L 1JZ8A 4D0DA 3DV6B 2APTA 4NCC2 4RIRB 3PWPD 1QFWL 3GSRA 1G9NL 4OCNC 4X6EB 3OV6A 5BMFL 5MEOB 1RZGA 3RBGA 1UH4A 4Y7MA 4DAGH 5DMKB 1S5IH 1Q0YH 2BHUA 1AR1D 2VLLB 3KS0H 3LB6D 4PTUA 3TO4D 1YEKH 1A8JH 1JGDA 1GHFH 1VENA 2JB6A 1L9NA 3HLAA 4KI5F 3FOMB 4PJXE 4ZUWB 4G80B 5SX5K 4WCYL 3I3DA 3KPSB 3ESUF 1FLRH 1FBIL 2OCFD 3RFZC 1G9NC 2PW2B 4MAUL 3QRFM 4D0BA 5ESAA 5KTEH 4M62L 4PB9L 1VCAA 3GM8A 4IHOB 2DLTA 4O58L 4KKAC 2IADB 3DSFH 3WNKA 1J0ZA 3RZCD 5FYJL 1AGDB 3C09C 4KPHL 3HMXL 2BVYA 1IM3A 3NFPA 3S88L 4JDVA 4YK4B 5BQ7A 4CVWA 2QHLA 3SDDD 2KQMA 2Q76B 4Z7VA 1HQ4B 3KYNB 5CEXA 4ELMB 4ZUWA 3MR9A 1YEGH 3NIDE 4PGEA 5IJKA 3DO7B 5IK3A 4E42B 1LNUA 4Y16C 1LD9A 5DWUL 4M48L 4I0KA 2OXHA 3TCXA 3V4VL 2H2PD 4ZAKA 3HR5B 4HS8L 3KYMB 2F58L 4HK0A 1MFDL 2CGRH 2HT4C 3T8XA 5CJQH 3DVGA 1URLA 1X5GA 4XMLL 4ZS6C 4KDVA 5JW4N 1HILA 2AXJA 3O3BB 3ZMRA 4DGVL 2HJLB 2AJXL 3PL6C 1GGBH 4NKQB 4OM1H 5IEKB 3EYOB 3VGEA 5J1AB 2VXTL 5FA3B 2ED7A 3MR9B 3AREC 3RI5K 3VGAC 4NQCA 2FIRT 2BNUA 2B8OT 3MOAH 3JV5A 4XB7A 3K4AA 1XGQA 3IU4L 3CSBA 3J8F7 3L7EB 4WUUA 3PGCB 3RWIA 2W38A 4UU9B 4Z7QE 4XNZC 3OJDB 5FGSA 1EFXA 1F8TH 1ZOXA 3U2SB 1XT5A 2HLAA 3I6GB 5JXAL 1BGXL 4X7TB 3C09B 3FB8A 2XA8L 2FBJH 1X3DA 4JLRA 4QYOB 4XXCC 2F54D 4KMLB 4LCWE 2HMIC 2H41A 2IBBA 5I66A 1MCPH 4JFFD 4ZXBC 3U0WL 5C6TH 1MOEA 5F97E 4XP6L 4RX4D 4HS6A 5EBWA 1DN0A 4FQPA 3MV7D 4F33A 4ZYKB 3NH7H 4RNRA 5GISL 2P24A 2F5AL 1YY9D 4XXCA 4NRXA 3KPQB 1QA9B 2JCCA 1AFVH 4JVPA 3BWAA 4LRIA 5GIRB 3BE1L 3FFCE 4X5XA 4N0YL 2EIEA 4K3DH 1I85C 2FD6L 3JVGA 4JG1L 2HVKA 2QR0A 2YUVA 3T77A 4F9LA 5GGTA 4Z76B 1FO0L 4YQXH 3ILPB 3BMVA 1CZ8L 5IB5A 4FXLA 5EUOE 3WDJA 1T1XA 2AERT 2PO6D 5F71A 4X99A 2GSGB 5DMGD 4TNWK 4POZC 3NFNA 2WIIB 1U8OA 4KTDH 4PRAA 4ZUVA 5CBEA 2E6PA 4U33A 1G9ML 1J88A 4EI6A 5JORB 1FORL 1ZHLB 3SQBA 4PB0H 3WS3A 4WV1A 1SYVB 4HS3B 3IDNA 4PP2B 1I8KB 3SGKA 2EO1A 2VZ1A 3U36A 1XGQB 3QXTA 5FO9A 2O5YL 3DX9A 2HRPH 3TYFA 4EUPH 3NCCB 4ONGH 4QRPA 1CU4H 3IXAB 1OSPL 1T04A 4XXDA 4C56B 3C5JB 3VWJB 5BXFA 1LEGB 2CIKA 1T1ZB 3ARBB 4HIJA 3LKNA 4XCEA 4DN3H 1A7QH 5C3TA 3RBSA 5HI3C 1FNAA 4PJ5D 2VLJE 2ICWJ 4AEIH 4EI5D 3HE6C 1PY9A 5D2LF 3V5KA 4R2GC 5FO8B 5I9QB 4OBSA 2G5RA 2NY2C 4RMSA 4E0RA 4ZPTB 3D69B 3MA7A 1T0MB 4AH2B 5ABDE 4WWKA 3WHXB 1DN0B 1DEEB 1OT1A 4YDJB 5FYLL 2YHGA 3LN4A 2F8OA 1XF2A 4OM1L 3BDBA 5CEXB 5LBSL 4F37F 2NY2B 3HG1D 1BFSA 1NAML 5DGQA 4G6AC 1WUNT 4EOWH 3OTTA 2HH0H 1L6XA 4L1HA 3V6OA 5DFWH 4YHYC 4LLQB 1Q1JH 1MI5B 1D5ZA 3GSOB 5DHVH 1PKQB 1G6RB 3QI9A 3RX7A 3TJHC 5JOFA 2VXUL 3E6HA 4MNQD 1IBGL 5L88H 4D0CB 1ROWA 4MVBC 4LRNL 4R2GD 3O81A 2BCKB 3PV7A 1JBJA 3UBXA 4K7PY 5CSBA 4HDIA 3BZFB 1F5WA 4U31A 5K9OA 1I7TB 1X5YA 1AXTH 1MF2H 4RISL 4X98A 4R97B 1NBZA 3WMSA 4LPXA 3DX7A 3RA7H 3NCYP 1DANT 2P5WD 4IHOA 1IFHL 1ZGLP 1QRNE 4FFZL 1I9IH 3BEWB 3V0VB 5ISZE 1JNNH 3OAZH 2LV4A 5J06A 4ERSH 4PGCB 5ALCH 4UT9H 2YBRB 2C7UA 5L2JB 1A1NA 1ZWIA 3ZDYE 1FZOA 1S9XA 4RFOL 1ONQB 2MQCA 4ZDHA 2YD1A 1B9ZA 1GH7A 3NZ8B 4HBCL 1NMAL 5JPMB 2VDOL 2VZSA 3BX7C 5IESL 4GUPA 5BS0A 1AE6L 4IRZH 4L8BA 1WEJH 2MJWA 1G9MH 4J3SA 3DX7B 5C9JB 4LOUC 4YFEA 3LS5H 2FLBT 2J8HA 3RNKB 4R4FL 4JPIA 4DVBA 2CMRL 4PGZA 4C58B 1DVFD 1FL5A 1ZSDB 4LF3A 1WBZA 4U0RC 4J8RA 4PLOB 4JE4B 4DKDC 5MEQB 4NJ9L 4LIQL 5ESVA 2YD8A 5TDNB 4L9DA 5D8JL 4JDVB 3TIEB 2AAVA 4QHLA 1CTOA 4P9HL 2VXSL 4YEEA 4UDTA 1MSPA 4NZRL 3W0WD 5JLZA 4J3WA 3HUJF 1LO5A 5GGVL 4HXBH 1DFBH 1A1MA 3QUYD 4TTDD 1G7LB 1A4JA 1L6ZA 1KCLA 2BY0A 4APQD 3MLRH 1AJ7H 3V4PH 1KCVH 1MREL 4ODTH 4YXHL 5DA4A 3MREA 3KPNA 1S7XA 3RRQA 1RD6A 5I6XB 4OCMC 4FXGA 4F7EA 5IQ9B 3T0EA 1J8KA 3WXWL 3BD3A 2HFTA 4WFEE 1IL1A 4NHUB 1GZQB 3RDTC 4JFEB 4GRWH 5LQBH 4G3YL 5FGBA 4MSWB 4YHMH 1E27A 4L3AA 3MLWH 2WLYA 3HNSL 4LLMA 1CBVH 5HYIA 2F19H 3L3IB 1EVTC 3DSNA 1U8NB 5EBGA 5C0CB 3M8OH 5GSRA 1BVZA 2DQCL 1MPAH 3N06B 5SX4H 3PHOA 4F57H 5F93C 3RWHA 2EDQA 4KHTL 1G7IB 1GOFA 4L5FH 2R2EB 5FA4A 3QIUD 5JQHC 4OZIE 2Q6WA 3KPPB 3FFCD 1YEHL 5FM8A 1ODAA 4V1DB 1H8OA 2YUZA 2Z92A 4MQ7B 3D39A 2F53D 4HULB 1EBAA 3O2VH 5K59E 3VFNA 2ATKA 1E4KC 1AI1H 1KUMA 3SY0B 3P30L 5DS8B 4NP4L 1H3GA 3DX9B 2VOTA 3WV0A 2PXYD 1F90H 3BVNA 1IVLA 3TPKA 2VTFA 2Y1VA 3K4DA 3T1WA 1EO5A 3V7AG 5JR1L 1VKXA 1YEJH 4ODWB 3BP5B 1JRHL 1R3LB 1RFDL 3MLZH 1FZJB 1WT5C 3LKRB 2VXQL 5F8RC 3NFSH 1CVRA 3V5HA 4GG8B 4I4WB 4MNGB 1YEIH 5EUKA 4G8GD 5B3JE 2JELL 4NCC1 4IM8A 1KEMH 4F15B 2BVOB 1X9QA 1QNZH 1RJYB 2X7LA 4HHAA 1HOCB 5I19H 2DQUL 1EGJL 3BP7A 4NIKB 4M7JH 3INUH 3F12A 4ZAKD 1P7HL 3ULUF 2OK0L 1U93B 1YECL 5IBUG 3RY4A 3SDXE 1NCAH 2V2TA 2A77L 3PP3K 5DMIH 1A14H 3FN9A 3PP4L 3WFEH 4HH9A 1FL3B 4LPUA 5FF6A 3GSVB 5F1NA 4PY8J 1S7RB 2FWOA 4L4VB 3AMKA 3GMNA 5IHZB 3P77A 4ODTL 4UT7L 4FQJH 5EWIL 4L9LA 2LQRA 5CHNA 3EJJX 1OGAE 1FV1A 4LSPH 4CVXB 3ZKSD 3EYUL 1I4FB 4XRCB 3QNZB 1O0VA 3MV7B 1FQ9C 3CZFA 3LSOB 5E7BA 1NC4B 2FEDC 1WFOA 5C0EA 4P2RA 1YMHB 3DV4B 3QDME 3IFPB 1A3LH 5JW4Q 1OARL 5C0FA 4K3JH 1XF3B 1R24B 4LVHB 5ISZA 2MTPA 2QSQA 4TSAH 3THMH 3MMEA 4NJAH 3FTGB 1DR9A 4MAYD 3MYJA 2ESVA 3D2UB 4M7LH 3D25A 3FB7B 1BD2E 3ARFB 5LKNA 5F9WB 1MCWW 1MEXL 2WM0A 3BGAA 2Z4QA 4OB5H 5FM5O 1GHFL 3VRLE 2VUYA 1KCUL 3D1MC 3IKCB 5J89A 5I30H 3NFPB 4YHIB 4Z7WA 1KULA 3PWPE 3WJJC 3TA3D 2GITB 1BZ7A 1OGAB 3OHXB 4K7PX 1NEUA 3MLVL 3T04D 1LEKB 1DSFH 3RZCC 1ZTXL 4X4MA 1QFPA 1ZLUK 4NO3B 2JIXB 3VWKA 2P46B 1WTLA 5D2NC 2CIIB 4PJ9A 4LPCA 5FCUH 3HZMB 1E6OL 3CK0L 1EEQA 3QQ9D 1PG7X 1VA9A 3FFDB 5DQJB 3VW3H 1KNOB 4H25B 1MAML 3FO1B 3Q0HA 4U0RB 3T8XB 3Q48A 3D3VB 1I9JL 3U0PA 2OJZH 5CWSB 4DTGL 3RWFB 2R0LH 9CGTA 3SDAA 2CKNA 4L3ED 3MODH 5HGBA 3MXVL 4JO4H 4C55A 4JRWA 3U1SH 1V8HA 3CAFA 2XWJA 1XGTA 2L0DA 3NCMA 4YPGA 4NO3A 3B9DA 43CAB 3RGHA 1D5XB 3VXUD 1QBBA 1JHLL 5CKAA 4Z7UF 1G0YR 1RUPH 2HLFD 5HYSB 1VFMA 3M17A 4ZUSA 5I2IB 3MOQA 2AI0L 2OP4H 5BW7C 2A77H 5DMIL 5JZ7D 1P4IH 3WYRA 1QLRB 4GOSA 2WIIA 1MRFL 2WP3T 3T0ED 4MLIA 1SEBA 2AXGB 1P69B 4R7NA 4G8EB 3K4ZA 5J11B 5GJSL 1CU4L 3P0VH 3ZDZE 4LLMB 2YPLE 4JHAL 3C2AH 3GSWA 3SDYL 5HYSG 2JB6B 1JZ2A 3VFRA 1HI6B 4JRYB 4BKLB 2AKRA 2P1YA 2XA8H 1NFDF 5BJTB 1NEZA 4WUUD 4JFHE 2P5WB 1VACB 2PO6C 2EDTA 1HHJA 5DF0A 4GMTL 1BVKA 3ZHDA 1G7HB 2C26A 4R8WH 2AABH 4EUPG 2LABA 1IGJA 2AK1L 3MA9L 1YMMD 4G6FB 5DD1L 5CSGA 2M26A 3NH7L 3THML 4BA8A 4HUUB 4HIXH 1OF2B 5EWIH 3R8QA 3GJEA 1H3TA 1YEDB 5D5MB 2B39A 2IPKA 4QO1A 5IMLB 4NKMA 2R23B 5DC9B 4JKMA 3LH2L 3H3KA 3IDIA 3OX8A 4OUUB 2EO9A 4KK9C 3QA3A 4BQ6A 4E5XA 2VMFA 5TPWL 4O51B 4AT6A 5I1KH 2OZ4H 5E4EC 2X70A 4NNYA 2J6EL 2X4RA 4POZD 4C56A 3M1BA 2ZUXA 1T1ZA 1P5UA 4N8VG 2A74A 4WI8A 1CS6A 3BPLC 4GQ9L 4OQTA 3CDFA 1HKFA 1MWAH 3VFPA 2G60H 3N1PC 4I8DA 3VXRD 3U9UA 1S9WB 3NCFB 1HINL 2BVUA 2R8SL 2V7HA 3BZEA 2L7JA 5B39G 1WFNA 4W6YB 3CC5B 2ADIA 5CEZD 4JRYE 1RIUH 35C8H 5EC2B 3UTPE 3GSNA 4FXKB 1EFQA 3Q1SH 4KXZI 1FG2B 4N68A 3U4AA 4YFLF 5JW5B 2AV7B 2HJKA 4BM7A 3OGCB 5DR5H 3MRGA 3FRUB 1IBGH 1EIBA 4HCRL 5BRZE 3UTSA 2HVJB 2VDLL 1FYTD 2DD8H 3MGOA 2P8LB 2ZCLH 1C12B 5F7LB 4JQXA 4RWYL 3MACH 5F44A 1KPVA 2W9EH 2YSSA 3WIIH 4P5TD 5F96H 4F33B 4PJIE 5C8JA 3O45B 3PHOB 4Z5RA 2PCPA 5AWNH 4Z7VB 3X14A 3ZYIA 4LEXL 1I7ZB 1F4YL 3FTGA 1KTDB 3P3YA 4PLJD 3U7WH 3EDDA 3HG1A 1WQVT 1UCBH 4LVHC 3MBXL 3EOTL 3RY5A 3ULUE 1HK6A 5TGBA 1TZGH 3ARYA 5FGCB 3REVB 3MROB 2ED9A 4ZOEA 4I1NB 2XFXA 2R69H 4X6EA 4DK3A 1T0NB 5MEOA 1XGYL 4BFBD 1TQCB 5JOEA 2V9TA 3BN9D 4Y88A 2DJUA 2NY6B 4KQ4L 2GFBA 2APFA 2NZ9D 5GJSH 2YUXA 3FOMA 4I3SL 5C09A 4XP1L 5D1ZA 1KBGH 1F4HA 5GRJL 5CINH 2WWMC 3ARTA 2XN9A 3LDBC 3HAEB 3C6LA 4QWWC 5GS1C 3TBSA 4X4XB 4O00A 2P5WA 1NCWH 1YUHA 3MRCB 4YJZL 4R8WL 3D0LA 4HUWB 4NKOB 1UM6L 5E70A 3FO2A 4HX1B 4DVRL 1KXQE 3HPLB 4R97C 3EO9H 3EHBC 1JMZA 1EJOH 2VDQL 5MEQA 2VWEE 1ZT1A 4Q9QL 1SVCP 4JFZL 4UI2A 1LDPL 5GGVH 5GS1B 1JZ4A 4DGIL 1GPOL 1GGIL 2EH8L 3W81A 1TJIH 5ID0A 1A6AA 1YQVH 4UIMB 3LKSB 1JZ7A 3ARED 4LARL 2NNAA 3IDJB 1HHGA 4LLYB 3QIWB 4UQ3B 5HYSA 5I2IA 5E4IA 5CIPA 4Y4FA 2Z35B 4U6VH 4MHHI 2ZUYA 2ICEA 2AJZB 3S36H 5DJ6B 3BQUD 4PRIE 2NY3B 4X80L 5E03A 1N4XL 3FT3B 2IC2A 1AO7A 4EUPA 4HK3N 1HKLH 5T1KD 5JUEH 4M6NL 1J05A 3GJFA 3EOAA 1NCBL 1HWGB 3TNNB 1OT2A 3RAJH 1A2YB 5CJ5A 4YIQA 2GYSA 4DK6A 5IHUL 4NO0B 3MGTA 1JZ6A 1WLHA 5J1TC 3ULVL 4OCXL 1FAIH 3OKYA 1FE8L 3U0TB 1JGVL 3SE8H 4XH2A 4PJFA 1Q9KB 3GRWA 1A9BB 2VN7A 4G3YH 5BZWA 1MCKA 4UT6L 4GXUN 4PLKC 1WK0A 4TSBH 5L9DH 2QBWA 4XAKD 2EYSB 3TZVC 1LP9B 1KEGH 1QHPA 1CXKA 4JHZA 5FO8A 5E00B 3QFJD 3HMXH 4Q0XL 5I1IL 1UKQA 4IMKA 4KI5E 4A6YB 4XPFL 1FJ1A 2Z93A 1S7VA 4Z77A 1UVQA 4OLEA 2CIKB 1X5KA 3NN8B 3B9EA 2KZWA 3X12B 1UACL 4X6CA 4PV8B 5C0RH 1KIQB 4LSSH 4QHMA 4GAFB 4HH9B 4NN6C 1YMMA 1JFQL 4QTHA 1JYNA 3LHPH 1NSNH 1M6OB 4PJCF 4NO5B 1U8JB 5HXMA 2DQIL 4L1DA 3MUZ1 4G9FD 4ETQB 1IC5H 3JWDL 1WWCA 4F7MA 1GOGA 4R4BB 4Y4HA 1DL7H 3O9WA 1AQKH 4KKBD 3EDFA 5HVHB 1ZLUH 3E1F1 5HPOA 3TVMD 1JN6A 3S96A 4UUJB 4CJ0A 1DTUA 4YUEL 1IKFH 1BQLL 5D1QD 4Q9RH 4PRNA 3JV6B 4TSAL 5IG7A 2DTML 1Q72H 4GJTB 4O02L 3O0RH 2VKXA 2Y06L 3LN9A 4QRPB 3MRLA 2DYPA 4QKXB 4S2SB 3OJVC 1MCDA 3K8LA 1OLLA 1YEIL 1MJUH 4UINH 1RK1A 1SJVA 2EXYC 4R96B 4KUCF 3GJFH 1YPZE 4XVTH 5K9QG 1CFQB 5I30L 3KWWA 4S10A 1GL4B 4XBEH 1LE5A 4LSPL 3FRPG 4LSQH 2ORBH 3F65A 3FHAA 1EGJH 5IBUB 5L2KA 3HAEH 3RKDD 3P73B 2R56L 1GIGH 1ULVA 3EO9L 3S36X 2W92A 3GHEH 3O3EB 1ZHKA 2C1PB 1A1NB 1ZWIB 3UBXG 5EFIA 4L8SC 1HHIB 4PGDB 4I77L 1RVFH 4RWHA 2APWA 2UZIH 4OCWH 1Q9OB 4P46B 5EZJB 5GGUB 5GGSY 4JM2F 3QXWA 1G7HA 3FHQA 4OLVL 2W60B 5I74C 5E24E 4Z7OE 1BQHB 1YEEH 2XQYK 3SO5A 4C54A 1D9KD 3L5JA 2R2EA 4KI5C 1GCFA 3LEYL 3W2DH 3JV4A 3U83A 5CBAB 1MFBH 3MJ8B 5T1DH 3VU2A 1FGNH 1MNUH 1OAXH 4RGOH 4PUBL 3UYRL 1EXUB 4LIQE 5IOPA 4ZFZB 5E56A 1KT2A 1KB5A 3FONA 1G7PA 4J12A 1BQHG 2QADD 3P9MB 5A40E 1EEYA 3ZTJH 4K9EH 3U46B 4NC2B 4P5KB 4NOFA 3OKEB 3PWLA 2NW2B 2XTJB 2PKDA 3QHFH 1ZHBA 1F3DH 5D1ZD 5DO2D 2OL3L 1KJMA 5ADPH 5E08L 1U8PA 3JZ7A 3OXSA 1J1PH 4FHBD 1V7NL 4M3JA 3WCYA 4RGNB 3RUGB 1Q9WA 2F54A 1A4KB 1S7UB 5DRNA 1KN4L 3ZT7A 1D5BA 3WFDH 3CFKA 4JKPL 4NQDD 3SDCD 2I60H 1CXIA 4JHWL 1T80A 5L88L 5EU5B 5SX5H 4WHYG 4MQSB 1Y18B 4P5KA 4MVBD 2DKMA 1IL1B 3O4LD 1TCMA 2H45A 1FVEA 4PLKD 4X6FA 5GGSB 1ZLVH 3KYKH 1LO2H 1Q9OA 1L7IH 5C09B 1BM3L 3CFJB 3HCVA 1IEAB 3ULUL 3ARBA 4S1SH 3FB7A 5K9KB 4X6CF 3WXVH 1IAMA 2YZ8A 4NSKB 5LBSH 4BQ8A 2Z31A 3RX5A 4XAWL 3OAYK 1YUHB 2HT2D 3MRCA 5FKPA 3D69A 1QHOA 1FYTB 1WBXB 4V1DD 1TETL 4F2MA 1CD1B 3EYVB 3H9SA 4P2QD 5HDOA 5HHMD 4RMVA 1M7DB 5F6HJ 2C3XA 4BFGA 5KOVC 5DLML 1A7NH 4OT1L 3QH3A 1CF8H 1LEIA 1X7QA 3DVNA 5IFJB 1GC1L 2J6EH 1Z3GH 2X2YA 3KPSA 4ODSL 1FC2D 1A7RH 1WGOA 3NACH 2HKFH 3EW3B 3QPQD 4PIRF 4KRPC 4NQXB 4XPGL 1CFVH 3MA9H 1B0WA 4KRLB 5AAWA 2XFXB 4XP5H 5JOFB 1KJVB 2FJHB 2BJML 3MCLH 1G0XA 3DUSA 5ACZB 3S37H 4MZ2A 3VI3E 3LPWA 2W9DH 2NY6D 4MCZB 2DICA 4CRPA 1C1EH 4N0CD 3VRJB 2UWEF 5GGTH 2QADC 1N3NB 2DLEA 5KVEL 2VDOH 2AABL 3TWCL 4M1CD 3NAAL 1BIIA 1E4WL 1NCCH 1T83A 4ODBD 2VDPH 2DDQL 3LKRA 3QUML 5HDBF 4ZQKA 1R5IB 2FATL 1N2RB 4FZ8L 3EGSB 4P4KC 1BFOB 4POYA 5ERWB 2GKIA 1YEEL 2PW1A 5CUSL 5F7EH 4MD5B 3KPPA 1U8MB 1IARB 1KTLB 2XQBL 3MRIA 4JANB 5DEFB 4WFGE 3RVVD 2X41A 4I0CC 3OKMA 5I6XC 4QEGA 5BZWB 3WS6A 5KSAD 1RUAH 4H5SA 4BJLA 3P0YH 4PUBH 4JGJA 4N5UA 3GI9L 2R1YB 4E41D 4ELME 3UJJL 4GRLC 2FO4A 5EUOB 4PRID 3PNWA 3A6BL 1F4XL 4M6OH 1DEEA 2CRYA 4TTDC 4DWHA 4HPOL 3VXSD 1MCLA 4DUVA 1Y6MR 4Y19D 3VFOA 5LXGL 4QNPF 1KC5H 1K8IA 5EC1B 3CDCA 3FCTA 5H8DA 3P9LA 3C6SA 4FP8L 4XNYL 1EMTL 5C6TL 3UYOD 5F7UA 2YS4A 3PDOA 4NRYB 5F6HI 1OF2A 1IGIL 2FCBA 3ROOB 1CG9A 5KS9A 1KN4H 4BELD 3VXPA 1EPFA 1RZ7H 4W6XB 4ZUUB 2X4OB 5FYJE 1VFUA 1HYSD 2FZ3A