4X98B

Immunoglobulin fc heterodimer variant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
204
Chain Sequence
b'PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPRVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLVSDGSFTLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Crystal structures of immunoglobulin Fc heterodimers reveal the molecular basis for heterodimer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 204
sequence length 207
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x98B01
4IOFC 4L3AA 5A2LH 2JJUA 5TE6H 4HC1A 1H3PH 1FZJA 5I9QC 4EOWL 1Z9LA 3LS5L 5BXFB 2DJUA 3KJ6H 3T0EC 5EU5A 1E6OH 2B1HL 5ESQB 1KPVA 2R39A 5JW3L 5CILL 1KJMB 4CDGC 3EJZC 2JE8A 4LCCC 5KN5B 4BFBD 2LE9A 3KVQA 4FXKB 1IGMH 4HF5L 5T1MB 1CGSL 1UM6L 5FO7B 1NCDL 1PLGH 4D0BB 4H25A 5IBTH 1FIGL 3O2WH 3O41B 5F70A 2YUVA 4PGDA 3SY0B 5EORH 3ULSA 4NHUA 4JY4B 3VXOB 2X10A 2CDEB 3NACL 2DI9A 1IAIM 1MI5E 1YDPA 1HWGB 2YUZA 1FJ1B 1OB1B 5GGQL 4QYOA 5HJ3A 5IV2A 1CDYA 2VXQL 3DUSB 2YKLL 3FO9B 3QP3A 3MODH 2P24A 1FAIL 2ZCLL 2K7QA 4HLZH 3PJSB 1Q94B 2E6PA 1OT1A 4P4KD 5KSBE 2A74B 3FFCD 4X6FA 3CAFA 3QFDA 4UV4L 3WFHA 1FFNA 5DTFB 5KVFL 4JFQB 4K8RC 2EXWD 3N06B 1UJ3A 3GMLA 4G3YL 2R9HD 4OKVB 4RFEA 1Z6JT 3GI8L 4PRPE 5I1DB 2C26A 5FAAA 3QXUA 3JV0A 1ZVSB 3MRLB 3LKPB 4R96A 3RBSA 3L6FB 2HAZA 3TH4T 2O5ZH 4K3GA 3LKRA 1IAII 3GJEA 3IDJB 4M6OL 4P2QA 2GT9A 3T1FA 3BD5A 4ODUA 4M4RA 4JPVH 5IW6B 4JG1L 4GW4B 4X4XA 4FFVD 3U30C 1CDUA 2UV3A 4HT1L 2J8UA 3OXSB 4KJWC 1AD9B 1OGAB 2DLEA 4YHOH 2E6QA 4DN4H 2EH7H 1KN2H 2YMXL 3CLEL 4OJFH 1K5NA 4ODSH 1V3KA 2RQ8A 2DICA 3SQOL 4P5TD 1NGWB 4P2RA 4Y1AA 5IVOA 5E2VL 5J6HB 1A6UL 5C0IA 1R3LA 4OD3L 4QWWD 4OAWA 1RURH 4PD4K 3ALPA 3V6FA 2O5XL 4G9FD 1NFDF 4NQDB 5GRYA 1FYHB 2HKFH 4F7EA 3PWNA 5TDNB 2OXHA 5J11B 5FYJU 5E94A 4Z18A 2MFNA 2H32H 3DX7B 1CD1B 3QNZB 4G7YH 1WICA 1AE6H 1HXYB 1B0RB 1U91A 3EO9H 2VC2H 3RZWA 2IMMA 5DD3L 1JNNH 2HN7B 1RK0A 4OCSL 2Q86B 1FG9C 1WBZA 4XPTH 3ULVL 2I60L 1RUML 4R7DB 1CGUA 5D7IB 4UV7H 1CF8H 5DYOA 1YEIH 4PR5A 4M7KH 3P0YL 3PL6D 5DEFA 3WXVH 5DWUL 5JQ6L 3P4LA 3DV6B 4GSDH 3WLBA 2DLFL 4Z95H 4LL9A 3KYMA 4YBHA 4NT6A 1FP5A 1CN4A 2IQ9L 3VXUA 1G1YA 4XCEB 1KCRH 5F7UA 4E0RB 1TDQA 3U9UB 12E8H 5I1CH 3MRNB 5F3BA 4NJ9H 1S5IH 3A6CH 1PW3A 1T1WB 4I3RL 3BOVA 4PJ5E 3HRZB 4R9HA 2YPLD 3B9KC 4X5WA 2APVA 5FV2A 3SE3A 1I75A 4P46D 2MSPA 4P5TB 2OL3H 1NCTA 4Z7UE 5CGYD 5FM5M 4OGAC 2QHRH 3BGMA 2XWTA 3PHQA 2DBLL 2MPAL 4OLZH 2IBZY 3OAUH 3R1GH 5C0RH 1Q9OA 2X4RB 4L4TE 2FO4A 3W9DB 5M7QA 4BSVA 1RIVH 4BYHA 2OMNA 3AS2A 2COQA 1NAMB 1JK8A 2B8OT 3EDKA 2FX7L 1K8DA 5AEAA 3HCVA 2D0GA 3RWDB 4PP1D 4JO3H 4WI8A 4Y5VA 1C12B 3DUHA 3IU3A 5IB1B 1KULA 4LLYB 1HE7A 4NNYA 3DECA 1BQLL 5E9DE 4G8IB 3SDCB 1NBYA 4Z7NF 3CFBB 1NC4A 5IMOA 4HKBA 4NQSB 4XMKH 4MZ2A 3S37X 4XAKD 3MTRA 4Y4HD 3QRFM 4ETQB 3RVXC 4JFOB 1MLCA 4WGVB 4OZIE 1BFVH 5J1AB 4OFDA 3KDMB 4PRHE 4UILL 5DUML 5FUOL 1BBJB 1S9XB 4RMTA 1NAKL 5D7LA 4MQXD 3OGOE 5I71C 4XBPA 2BSED 3BH8A 1XGRB 4TPRL 5DD0L 4HUVB 1I1AD 4RFOL 3QDMB 4KC3B 2BDNH 2PXYD 1OPGL 1I7UB 3HZKA 4QRRA 4TUJA 2PYFB 4N0YH 5JPMB 4D3CH 4HJJH 3HAEB 1AHWB 1DEDA 2YSSA 4X7SL 5MERA 4JQVA 4LSUL 4QRTA 4LARH 4WNQB 3SO3B 3IDYC 3BKML 3O4OB 4POYA 5GJSL 1PYWB 1YNLL 3FQWA 1H0DA 5DQJB 3TZVD 1A6TB 3VCLB 1KIPB 2DKSA 1XGPB 4ZOBA 3FB8B 1GCFA 5HGAB 1AGDB 4JM2D 2OJEB 3MLWH 4MDJB 4O5LL 5C7XH 3VU2A 4FQJH 4AH2B 5KBNC 1U95B 4ZS6D 1OP3H 3HPJB 1JE6A 1DJSA 3LKNB 5EPMA 2I26N 1MCEA 3SPVA 3WJJC 4X80H 1ONQA 3DWTA 1NEZA 2VL4A 3GM8A 3VWKD 2ARJQ 5KSVA 2FECL 2GSGB 4ZUUA 4KDTC 3D0LA 1FHGA 2O61A 3NCBB 1Y6KR 3V7AG 4NZTH 5I8OL 2YPKA 5LJYH 3BP6B 1ETZA 4GBXC 5GGVL 5IB3A 3TVMC 4CADA 2HVKB 2WUCH 1KJVB 1JBJA 3HC3L 3ZT7A 1P7KA 3MJGX 4PJFF 1JVKA 2ADFL 1W2KT 3QUYA 5JXEC 3T1WA 5D1ZA 4GRMB 5ANME 1HDMA 1BM3H 3EYQC 2BNQB 4RGNC 1T2JA 4OLWH 1RV6X 4X4YA 2Y07L 5C0EA 4P5KA 3UROR 5C0GB 3QUKA 4XPAH 5HI3C 4Y7MA 1DL7H 4J3XA 3QEUB 4EBQH 3L5WA 5A2KH 5JR1L 4G9DB 1MFBL 3MRPB 4K7PH 2ITCA 4OZGA 3MV9D 2AQ2A 2WBWB 3JV4B 1KB5B 2VB5A 3BW9A 1J0KA 1FC2D 2ZOLA 4WUUD 4XCNB 5F9OL 2IF7A 3OL2A 1RULH 4A6YB 4LIQE 4OZ4A 1H3XA 3V52L 3HE7D 5FHBH 5KVGL 2IH1A 3TBTA 2IAMA 4MMXC 3A6BL 1BFTA 1JYWA 2J8OA 4GG6F 1D5XA 3KR3L 4A2MA 3CX5J 3OPZH 1JL8A 1XGTA 1E4XL 3HMWL 3KPQB 2YZ1A 3MLXH 3NFSL 1R3HB 2FJGB 1KXQE 2FJHA 1J5OL 3ZL4L 3DYOA 3N85H 1TJGL 1XCQA 3S34H 4XBEL 1G7HB 4PJ7A 3T0AA 1A6ZB 3WSQH 1YMMB 2IPUG 5F96L 2VZ3A 5JO5B 1D6VH 5A40E 1JTTA 1KEGH 5DD6B 4MNGA 2GAZB 4W4NA 3TN0A 2Z4QB 2FATH 1QTYT 1RVFH 4OCLC 2OK0H 4M1DH 2PO6B 2Z93B 1UWEH 3VFUA 1DDHB 1KJ3L 2IH3B 3L7EA 3IKCA 3RY6A 4JLRA 1N6QH 1B6DA 3BKJH 4D9LH 1T21A 2H26B 1J8HB 4HIXH 1FORL 5ALBH 1S7WA 5IGXH 4KV5E 3U9PL 3NIFE 2VLKA 4OD1H 4DTGH 2F53A 4TSBL 3REWA 5ADOL 3QI9A 3R0NA 1LE9A 1DQTA 5DMIL 1A22B 3HUJE 4PJXE 4LLDA 5CCKH 3QQ3B 1JPFB 5E70A 4WCYH 4RAVB 1LE5B 4LSDA 2VUOA 4PRIA 3KJ4B 5D93C 5IT2L 2PCPA 3FO0H 4GLRI 3I2CL 2HT2C 3BQUD 3L3KA 5FYKE 3D18B 3IDNA 3RGVD 4ACPA 5SWZE 1SM3L 3JVGA 1UZ8B 1N64H 25C8H 4LLWA 4YHKL 1MJJA 4OGYL 2VLJE 5IF0A 4MLIA 1JHTA 5I16A 5HDQH 3K74B 3BVNB 3VXTB 5BS0D 2NXZD 4JM4H 2AEQH 4L5FH 1AFVL 3ZDXE 1QLRB 5DHXB 1FO0L 2Y6SD 3KPRB 3NZ8B 5DI8B 3EHBD 2L7UA 3C09B 5EU4B 4GAGL 2ZSWA 2EXYD 2F5AL 3KHOA 4P9MH 4WV1C 5FA3B 4TSCL 1UWGH 1C16A 1XIWD 5C0JA 1Q9WB 1G7IB 4JANB 5AWNH 1QBAA 2R1WA 3P4NB 5BZWA 1INEH 2PTTA 3PP3H 1MCJA 3CK0H 5HHPB 3MJ7B 4DFIA 1FZOB 4EQ3A 1WZKA 4FABL 5KS9E 1RJYB 5EIQA 1RIHL 3PABA 2V2TB 2DKMA 2R29H 1NCBH 4QTIH 4YNYB 2W9DL 5F6IB 4JFEB 4ONHB 3B3IB 3QXVA 4Q0XL 3ARDB 3OBAA 1NLDL 4RISH 5I1LA 3RX8A 4M5ZH 1DLFL 1VHPA 2KL6A 4GKZB 4GW1B 4L4VE 1U8JA 3BXNB 1UJTA 3SJVA 1DLHA 1KPRB 4IOFD 3WBDA 5BV7B 4HHAA 1OAZL 5CMAB 3H7BB 3O6KH 3SE8H 3RVVC 1ZSDA 5A1AA 1TMCB 3HZYB 4YHML 1PKQA 3TBSA 4MCYA 1UWXH 2KZWA 2QKIB 5KVMC 5D72H 1AKJA 2CIKA 4L8CB 1EO8L 1CXKA 3CH1A 2NLJB 1MHPL 3V0WL 5BS0B 5I0ZA 1B88A 4DN3L 5E99H 3B2VL 2MCPH 3D3VD 4GAJL 1VCAA 5EOTA 5F44A 3B6SA 4M9OA 1XEDA 5EOCL 1NGXB 5IFAH 2EO9A 5DUBB 4G80B 4MJID 2M2DA 3D39A 1NUNB 4KK9C 4ZXBC 5E00B 3O9WD 2FB4H 3OHXA 3HHRB 4EVNA 1JGLH 1T7ZA 1XR8B 4O9HH 4U7KA 4HUWB 1L0XA 1TNNA 3C5JB 2PYED 2UZIH 3EYFA 1NGPH 3B5TA 1Z9SA 1ADQL 1J1XH 3PDDA 1JI1A 4XP4H 4MXWL 1YJDC 4YX2L 3O8XC 4RMRA 1JV5A 1MNUL 3V8CA 3O4LD 3VRIA 2X70B 3ZKMC 4G43B 3GSXB 5C09E 4D0CB 3NAAH 3O2DH 2CDGB 1KJMA 1REIA 3EFDL 1G9ML 4CW1B 5FCSH 1S78C 2NY2B 5E8EA 5FUCE 2DQEL 1CE6B 4FXKA 5EZOL 5T1MA 4U7SA 5D2LB 5I9QB 3A6OA 4LRNL 4QXUL 4P9HL 3GM0A 1C5CL 3T0EB 2FJFB 4Z0BL 4FFZL 3SDAD 3QUZA 1KT2B 3I02B 3KPSB 1V7MH 3MRIA 3DURB 1V05A 2CDEA 2H1PH 3CXDL 4IS6B 5L6YL 4LCCB 3V5KA 3PDOB 5K93A 1W0VB 2UWEA 4D9RE 3OG6B 3IGAB 1NC2B 1I9RL 3OKOA 1LEGA 1V3JA 4E42B 4DUXA 4QO1A 3VXME 3L5HA 4HFWB 4RZCB 1QFWH 4NRYA 4PJBE 4PBWD 1KCSL 3UTZB 3DUUA 4JFQA 3ZT5A 4M62H 5J9PB 5LVEA 5ILTH 2YN5A 2V5YA 4ZNEA 3NN8B 4ZUTB 4U6VL 1X5GA 3IDIA 4FFWD 4OD2B 4RNRB 4XPFL 5IMKB 5EIIA 1J0ZA 1MRCH 3W0WD 4RA0C 1CFTA 4Z7VE 3MV8B 3BEVA 4OLVH 4MAYA 4BH8A 1MFNA 3S36X 2X42A 3MRFB 2W60A 1ZT1B 3SDYL 3CX5K 1JZ7A 3QZWB 5EO1A 5BO1L 4MX7B 2GSIA 4OCWH 1C5DA 5C6TH 1SYVB 3MLYL 2BNRD 4JKMA 4NUGH 5T5FL 3WUZA 1BOGB 2DM4A 1XT5A 4J6RH 4KQ3H 4LLUB 1EHXA 1OL0A 1HH6B 4JAMB 1B4JL 1D5ZB 3U30B 5JPNB 5TGBB 1NL0H 4B5EA 3NIGE 1FO0A 4X4MA 5F8RC 5DHVA 2E27L 1MWAL 2G60H 2WK2A 2VDOH 4Z8FL 5T33L 1LK2A 1RZJH 1QSZA 3FAWA 3QJFB 3ARGC 2AK1L 2NX5B 2BSRB 5TDNA 4FA8A 1B0WA 5HYJB 4PV9A 4EIGB 4GKSA 2BVEA 1GGYA 4P4KA 3SKOB 3QNZA 3FFCA 5E2TH 1HXYA 2OTUA 1PZUB 1FNHA 3INUH 4X6DF 2E7CA 2ATKB 4QRRE 3SOBH 1L0QA 2HN7A 1TZGL 4TOYL 1E4WH 2X4UB 1F4XH 4NQCE 1CBVH 3EDFA 1YEFH 4AG4L 5HYIA 2DWEB 3OR7B 4R97C 3IAGC 4KJQC 1RJLB 2XZAH 5IB5B 1HQRB 2ESVE 3DXAD 1A1MB 5MEQB 2PW1B 2O93L 5C07D 4PRNB 1J7VR 4N8CH 1A9EA 3NGBC 1UEYA 1W72B 4LHUD 3MA7A 1SY6H 4JFFD 1FH5L 1CDGA 1IQDB 3I50L 4XAWL 4P5TA 3WUWG 2X4TA 3TH3T 2C1PB 4NQXB 3L3GB 5C0FB 1TVHB 3D85B 2QQLH 3EOTH 5E7FA 5JHLL 2F8OA 4XCFL 2AXFB 4KK6C 3SHSA 5CHNA 4G9FA 5I2IA 2H3NA 4UZGA 3B9KB 4ZQKA 1FV1B 2D31B 4A2LA 4BELD 2YOCA 5EZIH 5F7KC 2X6MA 3QXAA 5DZNA 1NAMA 5DMGD 2B1HH 4OB5H 1MFDL 3UTSB 1FL5A 3LQMA 1CXHA 4YDVA 3IDUA 1FPTL 2E6JA 3SKJL 3TA3C 5K9KA 4WFGD 2A6JA 3REVB 2J8UF 3S36L 3PV7A 2VDLL 1ADQA 1WCQA 1ZLSL 3LOWA 4M61A 2NY1D 2ICEB 1QSEB 1FIGH 5J1TC 3JWDL 1JYNA 2W0LA 3TT1L 4GUPB 3DPBA 3MOAL 1U9KA 5HI4D 1UGNA 3FZUC 5GGQH 1P6AB 3ZMRA 2NNAA 3QDJB 3RVWC 1FAIH 2IFGA 3CNKA 4XVUC 1HCVA 4HX1A 3OKNB 1CXIA 1X5KA 5ALCL 2YPLA 3JV6A 4TNWF 5JPMA 4TUKL 4NSKA 3HAEA 1ED3A 4UDUA 4JFHE 5KVDH 4BKLB 4IHOA 2VIRB 1BFOA 1FLRH 3NIDF 1XR9A 1OAQL 5BQ7A 5I71B 5DS8A 1QOKA 3QCVH 4C56D 1Z5LA 1HI6B 3PGCB 4HDIA 5GSRB 3EFFB 3KGRA 3GBNL 5D7JD 1XGPA 4M6OH 2BY0A 3DO7A 4W6WB 4GMTL 3FB5A 3EYQD 4MDJA 5KG9A 1MLBB 4AH2A 1EVUA 4JG1H 1NKRA 1JWMB 3JV5A 4ZODA 5GS1A 3BP7B 3IDYB 5HHOD 3HPJA 3G5XB 5E5UB 2EZ0C 3QO0A 5H35A 4M93C 1RFDL 3BZFA 1EFXB 1CLZL 4QXTA 1HINL 1MHEB 1ODAA 4G5ZH 5JMRA 1IFHL 2EEAA 5EU6B 3SQOH 2JK5B 4PJAF 2B2XH 4JPIB 4BFEA 5LGKA 3H9YA 3CFJA 4NM4H 1BIIB 5I1JL 1SBSL 2IFFH 3I84A 1OF2A 3FQXB 5CEZD 1IARB 3AM8C 4HEPG 5D1XC 5E8NA 2R23B 4JDZB 2X40A 2UZXB 3BX7C 4YZFF 1OTSD 5JOFB 4HBCL 3Q1SL 3PE9A 3I3DA 3S35X 2R2BB 4JHBA 5I8KH 3S4SG 1S9WA 3L3JB 5DVLA 1JWUB 2HVKA 2NY0D 2ZUXA 4UINH 4P59L 4XNUL 5GHWL 4D8PB 1KJVA 1I1AA 3WNOA 3QNXB 3QA3B 1MWAA 4GRMA 4PJGB 4PRBB 4GBXB 1FQ9C 4K7PY 1K9TA 1OM3H 3TVMB 1H3WM 4H8WC 1YEKH 2BVUA 4L9DA 4PGBB 3DIFB 4WI6A 4FXGB 3TZVA 1CE1L 4MGXA 4ODHH 4OQTL 3QIUD 4K23L 4KJPD 4LGSB 4MA3B 1LEKB 4JM2A 1F4WH 4RQQB 3HMXL 4RGNB 4F2MB 4Q2ZB 2K3TA 4BZ2H 2HJLA 5HHOB 4HCRL 3MV7D 4LLQB 1F3DJ 1AO7D 4I3RH 1WVZA 5B39G 3HNTL 5JLZB 3MYZA 1NDGA 1KSRA 4I77H 1GGIH 2A6KB 1OD9A 3U4AA 3LB6D 3MLTB 1B4RA 3KPQA 3EYVB 1NGZB 1I8IB 3GMMB 4ZTPH 1Q9KB 2MPAH 4OTXL 2AJVH 4O2FB 1JZ8A 2ADIB 2XWJA 4C4KT 2V17L 2AV7B 1Q1JL 3VI4E 4YGVB 1YMMA 3C5ZC 5I18L 1OP5K 3O3EA 1WLHA 4YIQA 4EEEA 1HILB 3UPCA 2BOBB 1RZFL 2R15A 4IEFB 1T22B 2QLVB 1UADC 2Z4QA 2VZOA 1LWRA 2J8HA 3TT3L 1HZHL 3STLB 4FQCH 4XBGB 1DN0B 1IBGL 3PWVA 1S7VB 4FQLL 1NGQL 1D7FA 4RMSA 1VA9A 3QEQE 5CSZA 4LDEB 1IT9H 3K4AA 3VFGL 3C60D 4OT1H 2C3WA 3O0RL 3KHQA 1J8HA 1BQLH 3LS4H 5JOPE 1HKFA 3QFJD 4JFDB 4XH2A 3BRFA 3IJSB 5T5NG 5C92A 4O00A 4YDJB 3BPLC 2CSPA 1I7TB 3MRJA 4M03A 1CXEA 3MV9A 4WJ5B 1IEBA 5E4IA 3QHFL 4IMKC 3ZKND 4YJZL 5FYJE 1QLFB 4PRDB 4CVXA 1FZKB 3SDXE 3G5YB 1H15B 1E28A 1KTKE 4JCLA 5IWLC 3HE7A 4J1UB 2CRMA 4CMHC 4X5LA 1IL1B 2FBOJ 4TPRH 5CSGA 2BRRL 3VXRB 3TWCH 2IANE 1D6EA 3VWJC 2Y06H 4K71C 4M1GL 5HBBA 4S0SD 5T1DL 4HH8A 3T2NH 5C0AB 2XRAH 1Q9LB 3Q0HA 3OZ9L 4CMMB 4YHZH 1UZ8A 1E6JH 3DETD 5FHAH 2C3VA 3G9AB 3TYGL 5E6ID 5A16B 1XMWA 1SVCP 1ZT7A 3HLAA 3KPTA 3IFLH 5DA4A 2VXSL 3BVNA 4FQPA 5D93B 4C54A 4K9EL 1ZE3C 2WM0A 1KPUB 1MREL 3O81A 3UJTL 2A1WL 3X14A 2LABA 3NZ8A 3KPRA 4X9IA 3ULUD 4O5LH 4MCZB 2W59A 4OZGF 4RGMC 4WWKC 1JNHA 3GIZL 2A9NH 1T20A 4C59B 4QHMB 1CL7L 2VE6A 4KI5F 3ULVF 4M02A 1V7NL 1G9NH 4AM0A 4YGAB 3X3FH 1K4CA 3GSRB 3ZKSD 1M4KA 4WI7A 2Y7QB 4Z7WB 4FTVE 5B38G 2HLAB 2VABA 2VISB 3WV0A 1MVUB 1URLA 1BQUA 3C6LD 1X7QB 1U8IB 3IAPA 5DJ6A 4WV1B 3MRQB 4HEME 5IKCA 3LZFL 3ES6A 3KXFD 4BK4A 1OD7A 1PEWA 4KRLB 4XHJC 1HQ4B 1ZHBA 4BA8A 2QSTA 4PJ7F 4GKZA 3GIVB 4PJEA 4G8EB 4GW1A 1RJZA 1I9EA 1HHKB 4D9QE 3H7LA 3ARUA 1KPRA 4P2YA 4ZNEE 1R24A 3VFPB 4M8QB 1P1ZA 2IPTH 5CMAA 1YYMH 1S9YA 3EOAA 4HIJA 3O8XD 5DRWB 3IVKA 3ZKMD 2QKIA 3LN5B 1V3MA 1HYSD 2J12B 1QD0A 3RGVA 3S5LB 1HSBB 2IG2H 4OI7A 1G7MA 1ORQB 2Z8RA 2RFXA 5BS0A 4ZUSB 4UTAH 2FZ3B 1EUTA 5D6CA 5DD5L 3GI9L 1DVFC 2P5EB 3GO1H 1INQA 1OGAE 1TQBC 2APXA 5EN2B 3PQYD 1NGXA 4LSPL 5F9OH 1S5HA 4JQIH 4ZOCA 3QHTC 1XIWA 5JIPA 5DJXA 3UTPE 1A7NL 3S37H 4LRIA 3ROLB 1MFCH 2P8MB 4KQ4H 3ETBF 3PHOA 4APQD 1TCRA 3FKUS 2AABL 5IJKC 2BSSB 1T1ZB 1MCNA 1NANH 4LSVL 4HUWA 5FDWA 3HMWH 4NQDE 3CFKB 3NFSH 4XMLL 2MHAA 2MKWA 1KCUL 4U1HA 1J5OH 3ZL4H 5INCB 2FEDD 4NN5C 1SEBB 1JJUA 4ZXBB 3UC0L 4R0LA 3IU4L 4OLUL 4JDTH 1J1OL 5F96H 5JIHA 2Y5TB 3D25B 3T4YA 1BZ7B 4HS8H 5TE4L 4I2XA 3CDFA 5D2LA 3TFKD 2DQTH 3MRBA 3G5VB 3ZTNH 1L9MA 3NCMA 3STZA 1MF2L 3O8XB 2EDYA 3RWIA 3BH9A 3MFFB 5D7IE 1JGVH 1SEQL 3IFPB 3I02A 1BGXH 3ARQA 4O51B 3V4VL 3WDIA 4J12A 3P30L 1FORH 4QXGL 4WY7L 3MA9L 3KLHD 3U9PH 3MGOB 1WBXB 3QO1B 4AQ1B 3ARYA 3OGCA 4JRXB 4ALAH 3RKDD 3D3VA 3UXFA 4U6XB 3GSWA 5A2JH 1ZGLB 2V2XB 4XGZA 4GOSA 1BWMA 4BH7B 1XZ0B 3HG1D 5DQ9B 5EC2A 1YNKH 1RSFA 4DKAA 4MJIA 1QEWB 3IT8D 3KPMA 3S4SA 3U2SA 1H3VA 2VR9A 5L2KD 3O9WA 4HG4J 2FX8L 3E2HC 4PG9B 2NTFB 3CVIH 1H3UA 3OAYK 5AZ2L 4YC2C 3MV8A 1EV2E 4MZ3A 1ZHKA 2PYEA 1UM4H 1SM3H 4WU5A 4POZD 5CWSB 3F7VA 3KPLB 1BQHG 5EBWB 5GGRB 3UAJD 4BJLA 1ZT1A 3BIKB 3O4LA 4GQ9L 4AEHL 3M8OL 4N0FB 3MUGB 1AFVH 3OKDA 2FR4A 1R5VA 1SYVA 2FGZA 3MXVL 2D3VA 4XPGL 4WFEE 4M43L 2DYPD 1ZEAL 4RA3A 4GAGH 5C0NC 1GZPB 2HG5B 2F19L 2F5AH 4NQVA 4CJ1A 4Y4KC 1WCBA 1JMXA 4YHIA 1N5AA 1DCLA 5J57B 1HH6A 4WHCA 2C1OB 2E7BA 3TBYB 5B39A 4ONOA 4XNYH 3TYFA 4FABH 3V4UL 2B4CL 1EHAA 5HSFA 1RIHH 2OTWB 4OCXL 3S7GA 1DEEB 2BSRA 1KUMA 4XVSL 5ABDE 1IKNC 3SKOA 1QVOB 2JB6B 4Q0XH 1NLDH 3MNZB 5JDSB 1GGCL 3QDME 5IJVB 4JDVA 1DLFH 4BZYA 1I85C 2XKNB 1ORSB 3KLSA 4M7ZC 5BMFL 2J3SA 4FHBD 1A2YA 5GGSY 2EE9A 3ARGB 1VSCA 4HIHA 2X4UA 5CAYB 2OMBA 4UDTB 3W0WA 3O6MH 2WUBL 2AK4D 2DDQL 3ARSA 4F9PC 3GNML 8CGTA 2QR0B 1ZA6B 3L3HA 1KN4L 1G6RH 3OR7A 4XP9L 1DQMH 2E9WA 4OM1L 1HQRA 2KZ1B 4U2ZA 1MHPH 2W65A 3V0WH 2GJJA 3K4ZA 4DN3H 3LPWA 1G7JA 3UZVB 4PY7A 3AAZB 2UWEF 2BNRA 4GAJH 1FNLA 5CKGA 1XAUA 5CEZL 5HYQA 1NBZB 1W72A 4GAYA 4UQ3A 5FK9A 1EMTL 4R97B 3WEXA 4BM7A 5HGHA 1FNEA 3CFIC 1P6FA 4JPWL 4N90E 5GJTL 2VDNL 2YPVL 1N8ZB 4NHCL 5E5MB 1GZQA 2QEJA 1G7QB 1A7PH 4ZO9A 3D85A 3DVNA 3IETA 4I18A 4XVUD 4XMPL 5ICXA 3NGBB 1I1FA 1HN1A 3KPPA 5FGSA 2CGRL 3OR6B 5HHNB 5INDA 2PF6A 4LCYB 4UU9A 4ZFOL 1FV1A 3FT3A 5JHDD 4KK5C 2YHGA 2L0DA 1RZ8A 4YX2H 3NFNB 3GSUB 1T04A 2ZKHL 4QGTA 2VLRB 1ZHLB 1M71B 3NTCH 2NY4C 3EFDH 3PIQB 1FL3A 4B0MM 5IEKA 3H3PH 5FM8A 4HUKB 1DSFL 2YEZA 2B0SL 3DX6B 5JUEL 2BNQE 4DVBB 4N8VG 1P7HL 1A4JB 1IAKB 2HT3C 4JN1H 4P9HH 1A7OH 2ICEA 3UYRH 1Q0XL 1C5CH 1U3HD 2GTZB 2IBZX 4Z0BH 3T08A 4OZFB 1M05B 3WCYA 5F97E 4XCCL 4AL8L 1GL4B 3CXDH 1B90A 3TA3B 4PJCA 4OUUA 2DQFA 4JZOB 4HWZB 1N26A 5B38A 3DXAA 1I9RH 3ZO0A 4Y5YA 1PAMA 5C07A 2CLVA 3GMRB 1LDPH 4GMSL 2AI0H 4JE4B 3BP5B 3UPRB 1FYTD 3RWHB 1AXSB 5IB2A 3D69B 2P5WB 3JSSA 1QA9B 5DMKA 1EGJL 3LRHA 4V2CB 4Y4FC 3KLDA 5F7FA 3D9AL 1TJHL 2X1QA 4XPFH 2V9RA 1LO2H 2VLMD 3GSVA 2SEBA 4M6NL 1F4YH 2HFGL 3UZQA 2ZUSA 5TFSH 2GITB 3T4AA 1HI6A 5GSRA 5I1IL 3RU8L 3EFFA 4Q9QH 3UX9B 5FYLD 4FNLH 1YMME 3U46A 3TC9A 4IIQA 2JB5L 1T7YA 5FOBA 4X8JA 1VERA 1BBDL 1WITA 3G04B 1MLBA 5GZOD 9CGTA 3EBAA 5BO1H 4FQXC 3SE4A 1JWMA 2XN9B 3GBLA 2ZUWA 5AYUL 3V6BR 4JRYD 4EUPB 4GRLC 1QSVA 2BHYA 1FFOA 2VR5A 1P5VA 2AXGB 4M1CC 4UNUA 1BPVA 1AQKL 1CU4L 1KENL 2D7NA 5DQDL 4GJTB 5EUOE 5KSUA 1J8HE 4JPIA 2IADB 2W07A 1TETH 1BIIA 2HRLA 3DVIA 2BJML 2WLZA 3K80A 1B2WH 3FQXA 4ORGA 3SN6N 3VFOA 1ZHNB 4M93B 3WFCL 1D9KC 4JR9L 5JOFA 5IBLD 1NGYA 1HOCB 1EUUA 1BWWA 2R2BA 2XQYG 5JZ7D 1JWUA 4JQXC 5F89A 4AIXA 4G7VH 3MREA 4OCMC 2FX9H 3D2UD 1HXMB 5DO2C 3VXSB 1A8JH 4NYLA 1TZGH 5D1XB 4TOYH 5SWQB 3ULUL 2ZUYA 5TPWL 3SBWA 4WHTA 2XWBB 4R8WH 5LGHL 1T4KB 5I1HL 3MRMA 3T04D 1MY7A 1KXVC 4HWBA 3ESUF 2F74B 5CLTA 3ILPB 1NFDB 4PGBA 3W5NA 4C56A 4X6EA 5DZOA 3DIFA 4N5EC 5IM7A 3T2OA 4UUJA 3TM6A 1MJUH 4HG4K 5D7JA 1JGUL 4XVJL 3QIBD 3U6RA 4RAHA 4U3CA 4WFHD 4MA3A 1LEKA 2D03L 2DQJL 4G6KL 3HNSH 4LIQH 3KPRE 4CN4A 2VOTA 4PB9L 1CQYA 1D5MA 5B4MC 4ZPVB 2XICA 2XKSA 4HUNB 4KKAD 1CGVA 1OP5H 2DWDB 5FO8A 5HHOA 4MHHG 5BJTB 3I6LE 3RIAF 1I8KB 4LPWA 1DE4A 3BD4A 4I48B 2YK1L 3QR2A 5D1QD 1FH5H 2EH8L 2EDOA 2F58L 3MRDB 1Y6MR 4L8BA 3VGFA 1RAMA 1XH3B 3MFGB 3OKLA 1UACL 1JN6A 4KVNL 5JHLH 1HNFA 1Q9KA 4WGWB 4JFEE 5IIEB 3GZKA 3RPIB 4KZEH 1I9IL 3C6SB 1UJ3C 2KQNA 4CNIA 1U58A 4NQTA 1JPTL 3ZHKA 2I07B 2BOBA 3DSFL 4G6AD 2X1PA 2OLDA 1T22A 5DLML 3WKMH 1BQHA 2CDFA 3FN9A 2R56L 1MFDH 3L1OH 1HWHB 5TE7H 1BJ1J 1ZA3B 4PPTA 1Q0YL 1DN0A 1S7VA 3SKJH 4OCYL 5K33A 5HHVL 3MLUL 4ZFOA 3MLVL 3C5ZB 3S36H 4NDMB 3V4PL 2VDLH 3IS1X 1SJHA 2CMRH 1T66C 4RIRA 2R4RL 1MCWM 3I6KB 3NFPA 3RTQD 1FAKT 5DGRA 3CPLB 3TT1H 4LPVA 1TVBB 4LU5H 5LGJB 2XZQL 1G0YR 2C4FT 3MOAH 3VG0H 2CIIA 3W2DL 1BF8A 1J86A 1HHIB 4PLJC 1IAIH 1SJEB 1A14L 4K94L 3QWRD 2APWA 3KNBA 2YD3A 2CUIA 1KCLA 3H9HB 1QLFA 1NMAH 2GIYA 5IHLB 3G5YA 1KGCD 4LDLB 5HI5C 3MV7A 5K9OB 1KIQB 5LWYH 1AO7A 4NO5A 3WL9B 1IL1A 4N8PA 5J6GB 1JYVA 5C2BL 5LXGL 3BPLB 2CPCA 1UYWL 5KAQG 7FABH 2J88H 4TUKH 3G08A 2QSCH 4X7CC 5F7DB 1FFPB 3G6JA 4P48A 1AR2A 1YPZA 5C0AA 4KHXL 4EN3C 3MOBL 4NZRH 1LO4L 4X7FC 1T6VN 2F5BL 5DVMA 1RI8A 3VFSB 4AJ0A 4CMHB 1RUQH 2NW3B 1VADA 3CSYB 4F9LA 1EGJA 3VWJB 4K71B 4EXPX 4Z7QE 1YQVL 4WFFE 1KJ2B 2VDPL 4GMTH 4MCZA 2XA8H 2VDQL 4PLKD 4JM2F 4JZNB 3WE6A 2UY6A 4DKDC 4AT6B 5D2LE 2X1XR 1ITCA 2A6DB 3B83A 3BKCL 2KPNA 1WBYB 4QHMA 4XC1L 5DHYB 5DJ2A 5B8CC 4L1DA 3T0EE 5IB4B 5JORB 4NWTL 3CUPB 2C4FU 3KPSE 4KHTH 3C60A 1HKLL 4WHYG 1IFHH 2Y7QA 1MVUA 3QFJA 4JO1L 3FN0L 4NRZB 4PS4H 4RGMB 4WWKB 5ICYA 2WW8A 5KW9L 5GRUH 1U2HA 1KEMH 3EOYG 5I1JH 4JG0H 4LK4A 3VFVA 2XTJC 1SBSH 1X4XA 1UH3A 4YE4L 2FSEB 1HQ4A 5ERWA 3SE3C 1DBAL 4ODTL 4QHUB 4NC1C 5K9JL 1F6FB 4O58L 4RX4D 3OJDA 3P40A 1T1YB 3Q1SH 1QKZL 3FT4B 3QNYB 4G8EA 1WZ1H 4YHPB 3SDDC 2CKBL 5GHWH 2NY5C 1NCCL 2P46B 1XCTB 4TVSa 4QF1B 1QRKA 1JPGB 4MNQB 4QCIB 4Z78A 4XZUA 3MV8E 1BF2A 3FB7A 6FABL 1WFOA 2JIXB 1FBIL 3LD8C 1NUFA 1R3KA 4RWHA 4X99B 5E6IA 5CIPH 5T3ZE 4N8VA 3VD4A 3VW3L 1KLUA 1U92B 4ZFFA 1ORQA 2BOCA 4ZUSA 5MEPA 3PWPD 4IRSD 2FZ3A 4Y5VC 4PYHA 4OQTH 4K23H 2W0FB 3X12B 3I6GB 2P5EA 3NZHL 4XXDB 2G5BB 2BFVH 5ESAA 3P4MB 4PTUA 5HHMD 3GJFA 3HMXH 1XF4A 3MRKB 4PJFB 4NGHL 4G8FB 4ZUVA 2E9JA 4PJDA 1ZANH 3F5WB 4HCRH 5IHUH 3ARED 2P8MA 5I15H 1OLZA 3QXDA 3KYNB 4J3WA 4LQ1A 3RGHA 4NQED 1DVFB 1DQQB 4GH7B 5DF0A 1M7IB 1TQBB 4JREC 3C6LA 4R26H 1QR1B 4ZUWB 5KJRL 4ZFZB 2NX5E 2WINB 5HYJE 3KXFA 4DOHB 1JPST 3BO8B 3P4OB 1J18A 1A6AB 3UEZA 3U4BH 3ME0A 3BSZL 5EUKA 1UH2A 1IGJB 2ID5A 2OBGA 3L7FB 2GJ6D 2WLYA 3K8KA 1JMZA 1M6OA 2Q6WA 1CFQB 1FRGH 1X5JA 2FWOB 4F7PB 1K4DB 4JQVC 5C08B 1PQZA 5IHZA 4GG6B 2BVQA 2DQUL 5JMOC 3O8XA 3T0WA 4LPYA 3IXTA 1IBGH 4FQLH 4PP2A 4U1SB 4YXHL 4NN5B 3RVTC 3IFPA 1FVDB 1UENA 2ZSVB 2VDMH 4CVWA 1MCWW 3KYOB 4YXKH 3HC4H 1IC4L 3DI3B 5B22A 2VLLA 4TNVK 1WWAX 1T1XA 4OFKA 3TESA 5D7KD 3O3AB 3RAJH 5AUMA 1JF1B 3P9LB 5HHMB 2ICCA 2V2XA 3FQRA 3U1SH 4QGYA 3PQYA 4IRJD 2GY7B 4BH7A 1UZ6F 1JRHI 1FGNH 2OYPA 1UFUA 2EDWA 3M1BB 4FG6C 3WIIH 1DQDL 2ZJSH 4V1DB 4PJEF 2QSVA 2BRRH 2QADD 2VN7A 4H88H 4N1EA 3HTLX 1KG0B 5EFIA 4APQA 3NOIA 3ARZA 4BFIB 2VN4A 4PG9A 1KTRL 4ZAKD 4EKXA 4EQ2A 2JKXA 2LU4A 5KVEL 5DEGB 3UTQA 5T1LD 3ARVA 1FNSL 1CWVA 5EBGA 5DRZA 3S35H 3I9GL 4JKPL 5FCUL 5EBWA 4WI4A 2H6PA 2VXSH 1GAFL 3MCKA 3QUYC 3TIDB 1NCNA 5D1ZC 4M4PA 3QCTH 2R0KL 3E2HB 4N0FA 2FHBA 1FG2A 1WGOA 1MREH 4LSRL 3UTSE 2H41A 4YC2B 2CO6B 3QUMB 3LIZH 3HR5A 1HEZB 4AMKH 4HLZG 4LKXA 3GIZH 1S7SB 4HKXB 3RNKA 3V6ZA 2LFGA 3MQIA 1QSEE 4MJ5B 1OY3B 1ZGLM 5EU3A 1KLGB 3U7AA 3ZTJH 3C08L 5K9QI 4I4WB 3IF1A 4KI5C 3ULVC 4GG8B 3QPXL 2EDTA 1MHHB 5EC1A 3BGAA 4U1KB 3QDJE 1QFUL 3BZ4A 5E7BA 4Y4KB 3LZFH 2IAMC 5HD8C 3L5IA 3RNQA 3QUXD 3RWEB 4LP5A 4S1DD 2E7MA 1BD2B 3SKUD 3HG1A 5JW4N 5FYLL 1TZHB 4LCWB 4XXCA 4JFZL 1D5BB 2PN5A 3BPCB 4R2GD 5L2KA 3KWWA 4H5SB 3HNVL 2XG5A 4NPYB 3C8KA 1T2QL 1LQSR 2YC1B 2HLFC 3RIAK 4RMWA 5D2LF 3RY4A 3A67L 1MIEL 5BRZD 2YD6A 5J89A 1QFOA 2X05A 3TCLB 1DUZA 2DD8L 3CMGA 5C9JB 5SWSD 3TN0C 5TE6L 3S9DB 1H3PL 1M7DB 35C8H 4M7ZB 3KJ6L 3WS3B 3TJHD 1MFEH 5DUPH 5DFVC 1E6OL 3BMVA 5HYSG 5DD5H 3GI9H 3H9SE 2DYPA 1BJ8A 4MA8L 1EK3A 2EYTB 4PV8B 1IEHA 1N5YH 2CD0A 1NBZA 2ZCKL 1IGML 3RX5A 3HZMB 3DGGB 3HB3C 1N8ZA 3KPNA 5EU6E 1PLGL 1MQKL 1MCBA 4XNMB 5IBTL 3O2WL 1EO5A 4FP8H 5EORL 1H8NA 2AABH 3IXAA 3RP1A 3QI9C 3W11C 3H6JA 4U6HB 3QIWC 2EC9T 3BE1H 3QDGD 1J9CT 3OR6A 4QNPE 4LCYA 3SQBA 4MB5A 4K3EH 1MCCA 5C71A 4LEOB 2APFA 1FSKC 3P77A 4U1NA 1GHFL 3TLRA 2EDHA 3MBXH 3IU4H 2VLRA 1J1OH 4RBPK 3SGEI 3IJHB 2I27N 2ZOKB 3JVGC 1SMAA 5CJOL 2DQDH 3R8QA 1RZIB 4MA7H 4PJGE 5TE4H 4JZJC 4FQIH 4CU6A 1A4JA 3DVFA 2AK4A 1QFPA 1QRNE 2A0LD 3UCRA 4GLRH 4OZFA 4RAUB 1T89C 3K1DA 1LO3H 2ICWA 2NY4B 1JF6A 3VFMB 4WO4D 2OSLA 1TFHA 2L7JA 2IALB 4QXGH 3KG5A 4JPVL 4RGNE 1BFSA 1U2CA 3T2QA 4I0CC 4I3SH 3JXAA 1EBPA 4QRPD 3OG4B 3UTTB 1U8MA 4K7FA 1UM5L 2Z35A 3DHMA 4FZ8L 5BZDB 1PY4A 4YHOL 4DK3A 2DL9A 2P5WA 2DQHL 5CBEA 1KTDA 4ISVB 4OJFL 3IFNL 4P23D 2EC9U 4ODSL 2NZ9C 4M7JL 2ZUQC 5M95B 1P7QB 5EH1A 3OKEB 3ZE2E 1QSFD 3T0DA 3NA9L 2FX8H 1OWWA 1S9VB 3T3ME 5FKAB 5AZ2H 4MWFB 4W6YB 2GITA 1WIPA 3KLAB 1RURL 1GGBL 4NIKB 5BVPH 1S7QB 2XT1B 5JHDA 2X9WA 2NY6C 1AP2A 3CCHB 2HKFL 3LQZA 1A9BB 3DMMD 2HMIC 2EKJA 4Y4FB 4PGEA 3G04A 1T7WA 4LCUB 1JPSL 4HZAA 1AE6L 1CVRA 3FJTA 4XPGH 3FL7A 4YWGH 3EO9L 1N4XH 2VC2L 4M43H 3IDMA 1JNNL 4N5ED 5T5NF 1UB6B 2F19H 3HI1A 2V2WB 1U3HA 5CZXD 3AU1B 4UV7L 3RHWK 4JFDE 2IADA 4FQXB 1YEIL 4M7KL 2VZTA 2R2HB 4J7RA 1UXWB 4YDLC 4GSDL 1NUDA 4GRLB 2DBJA 1WFUA 3WFEH 1A1OA 1KCRL 2UUDK 3CVHL 4JKWA 3VMNA 3VRLF 3FAXA 5I6XC 12E8L 1S7RB 4XVSH 1EAPB 2CRIA 4NJ9L 1FYTA 3A6CL 3GSNH 3S8WA 5F1IB 3K2UH 2EDLA 5CBAA 4BUGA 1GGCH 3VXRE 4L3CA 5I1KH 1VACA 5L2JA 4YQXH 3AM8A 1OT2A 3VI3F 3LRGA 5SWQA 2OL3L 3WHXA 4K8RL 1D9KB 1T5XB 5HDBF 4JFXB 2XWBA 5C0AE 3T77A 3F65A 3OKMB 2OZ4H 2DDQH 3FFDA 3MBEC 1CXFA 3JTTB 4OLZL 4DGVH 2A6IA 3OAUL 2UVFA 1OHQA 3R1GL 3WLWD 4WU7A 2MNUA 4WHDA 1FZJB 3I3EA 5GIRA 1RIVL 4PJCF 5EU5B 3BIBX 4X6DB 3BWAB 4JRYA 3QUZC 2R0LH 4LAQH 1KPVB 1OGTA 2N7AA 2R4SH 5B3JF 5SX4H 1I8KA 2VKXA 2YD4A 3PGDA 3O6FD 4Z7WE 3MRDA 3RWJA 5HPOA 4H25B 1QNZH 3WYRA 1CICD 3ULSB 1BX2B 4XMKL 1A7RH 1JUFB 4NHUB 4JN2A 4XMPH 1WAAA 3GMQB 1QBML 1YDPB 2ADJA 4WW1A 1BFVL 3PXHA 4QYOB 5IV2B 2PTUA 2X4NA 4KXZI 3VH8G 2P24B 1XGQA 1KCVH 5H2BB 4MAYC 1ZA3A 2BDNL 4CU7A 5EWIH 2CLRA 4HPYL 4KU1A 3WFHB 2GUOA 1FFNB 4N0YL 4HJJL 2DLIA 2B0SH 3ISWA 4NDMA 4Y5XA 1UJ3B 3RWCA 3GMLB 2MMXA 4RFEB 3MGTA 5I8CA 2C9AA 1CR9H 4G6FD 1N3NA 4X7DC 4UT7H 4E41B 5LGJA 4AL8H 2V9TA 4R96B 3GRWH 2BVPA 3QIBA 1X4YA 5ISZD 3LKRB 3GJEB 2VSCA 4K3JL 1HHIA 2P5EE 2HT4D 1SJEA 3L3OB 4P2QB 2GT9B 3T1FB 4ODUB 2F8VA 1JZ2A 3MLWL 1KF9B 5C7XL 4FQJL 4QNPF 2DB8A 2P8PA 2VWEC 5K9OA 1KIQA 2J8UB 1N0XL 1WK0A 1PG7W 4XWOD 1I3UA 2DIAA 5D1QA 2E3VA 5EA0L 4LBEA 1K5NB 4MDIB 4TUOB 3V2AR 2YWZA 4CDHA 1FFPA 3WFDL 1OAXH 4P4KC 1TJHH 3NPZB 4P2RB 2CUHA 5E8OA 5T3XE 4Y1AB 4KRPD 5C0IB 4KGJA 1R3LB 2V5RA 4LVHC 2NW3A 4OAWB 4IDJH 4JB9L 2EDRA 2X1OA 4NZTL 3RU8H 2EXWC 2R9HC 4F7EB 1QHPA 4HGMA 4I9WD 5A2IH 3CSBA 1WSST 5E94B 1HHJB 4EN3B 4KFZC 15C8H 2BVTA 1XGYH 5AYUH 5DHYA 1WBYA 3CJJA 5IK3A 5KSAD 2EDKA 5HYSA 4TVPE 4JHAH 5IB4A 2ZG3A 1RK0B 1BM3L 1VFBA 2G9HA 1FVCA 4GXUN 4OLWL 1CU4H 1WBZB 4FFVC 1P2CA 5I8EA 7CGTA 2H32A 4NRXB 3RTQA 5DYOB 5J3HD 4PR5B 4XPAL 5DEFB 3ZSSA 4EBQL 5FA4A 5B8CB 5TF0A 1K2DA 2BJMH 1JYXA 4S1QL 3WLBB 4JRXE 3KYMB 5BVJA 3EYOA 4NT6B 4WVRA 3QWRA 2VZSA 3WFCH 3VXUB 4HAGA 1T1YA 1T0NB 2OTPA 5IR1B 4M6ML 3FT4A 2X4SA 3QNYA 4NOFA 4QWWC 1RULL 4AIZA 3WMSA 1R0AH 1XCTA 1DTUA 4UQ2A 2XTJB 4QF1A 3MRCA 1JPGA 1PEZA 4MNQA 4PJAB 4X5WB 2B20A 3ULUH 4HIIB 2H2PD 5JA8B 1YC8A 3VGDA 3BGMB 3BKYH 5CEXA 2XWTB 3SDDB 4X9HA 1U92A 3PHQB 3N85L 4AK1A 1GVIA 5F93C 4L3ED 3S34L 1UCTA 3TBVA 2DQGH 3WSQL 1JGUH 1Q9OB 3IAQA 3K2MC 4KKBD 5IOPB 4UTBH 3N1QC 1IKFL 2OL3A 1D6VL 4MJ6B 2FO4B 2ZP0T 4G6KH 1A7BA 1CGTA 4J4PD 4UAOC 1KEGL 4BSVB 1I1RA 2A73A 2ED9A 5ELIA 3LD8B 4HJGB 2IBGA 1JK8B 4Q9RH 3PL6C 2GCYA 1KFAH 2FATL 1RVFL 4ETYA 1K8DB 2OK0L 3F5WA 3HCVB 5CJXC 3N9GL 4U3HA 1G9MC 3SEPA 1UWEL 3ILQD 3L3DA 1PX3A 4Y5VB 2BMKA 2VRAA 2OP4H 1OSPH 1DVFA 2EH8H 3BKJL 3IU3B 3LAFA 4D9LL 4P9HC 2W9EH 4HIXL 4YBLC 5ALBL 3WD5L 1OWRM 5H37H 1NBYB 3LDBC 1ZS8A 5IMOB 1UACH 4HKBB 3G6JF 1YPZF 3DV4A 2CK2A 4DTGL 2DTMH 3P4OA 4WTZG 1MLCB 4P46C 2GK0A 1C5BH 4RX4A 2FDBP 4WTXA 5CGYC 1CFQA 5D7LB 1JPTH 3ZKXC 3DSFH 4JREB 4WCYL 1U8HB 5DLMH 4XBPB 1EZVX 5IMLA 1WZMA 1IM9D 4KJYA 5GGTH 2FCBA 3ARRA 3JWOH 1Q0YH 3HZKB 4TUJB 3FO0L 1UB5A 2E7LA 5IVZA 4FQQA 2ZSVA 3V4PH 3EYUH 3KYOA 2YSSB 5F6HJ 1N64L 25C8L 5MERB 4QRTB 4KKLD 5C0CD 5GS1C 2G5RA 4PP1C 4L3EB 2GTWA 2R1XA 3PWPA 3FQWB 1H0DB 4IRSA 4R4ND 5HDQL 3AS1A 3LY6A 2AEQL 3W5MA 3O3AA 1A3LH 3P9LA 2EEBA 2NY3D 4H0HB 2Q3AA 4MD4A 4PTTA 4JY6A 4XX1E 4P9ML 1C08A 1UWGL 3BIAX 1CDBA 2OJZL 4Y4HC 5GRVL 4CRPA 5AWNL 2ADGA 5C2BH 5LXGH 5DJAA 1INEL 1UYWH 4PJ9D 1YECH 1S7TA 4NQEA 4IRZH 5EPMB 3CK0L 3U7WL 3S3SA 3SPVB 3U0WL 1MHCA 3BESR 5DEGA 4MQXC 1ONQB 4KUZH 2JELH 3MCLH 5JDJA 1NEZB 2CXKA 5KSVB 5EBLA 2F5BH 4ZUUB 2HTLC 1I1AC 3D0LB 2R29L 1NCBL 1JZ3A 4B7LA 2PXYC 1BJ1H 5FDYA 3TIDA 2Z8SA 2YPKB 3QG6A 4LASL 1AY1H 2GJ6A 2OR7A 4NKIH 4RISL 1ETZB 2VLRE 4M5ZL 2B7DT 4PJHA 1MELA 2VDPH 4XPBL 1DFBH 5IB3B 4CADB 5EBMB 4Y16D 2VDQH 4X5XB 4TTDD 4OCNC 4X9FA 4NNXA 3ULUF 1M1SA 4HKXA 1GIGL 5C0BD 2P45B 2FEEI 4J3OC 4XC1H 1RZGA 1P7KB 3TZVC 2DM2A 4N0UA 3SE8L 3QUYB 2FLRT 2APTA 5CZKA 1F2QA 5D1ZB 2JJWA 4MJ5A 3U36A 3ALXA 5DK2B 4NWTH 2UYLA 4JM2C 1HDMB 1KLGA 4PJDF 1CDJA 5DDHA 1HKLH 3MCG1 2F54D 4X4YB 2CLZB 3DNKA 3HI5H 3HN3A 5C0EB 4F7CA 3U48A 4P5KB 3V0VA 5I19H 3QXTA 4ZS6C 5KW9H 5L7XH 2J6EH 4WIQA 3L5WB 3ZLQC 2MCPL 4OZGB 4N5UA 1PZ5A 1YUHA 2GJZB 3BW9B 3CFDB 4IRJA 3VWKC 1F3RB 1BD2A 3OXRA 4G8GD 3GB7A 2P5WE 1MRFH 1TZHA 1EVTC 4HQQH 2CKBH 3VH8A 4OZ4B 1TTUA 2IH1B 5KZCB 5HVWA 3TBTB 2IAMB 4GRWF 4ZAKA 4FS0A 2GK2A 2FB4L 1CT8B 5MEND 5T1LA 5KANI 1HSAA 4O9HL 1A7QL 1D5XB 4XB7A 5IVXB 1U93A 1I85A 1XGTB 5C9JA 4P2OD 1NGPL 5CJ8A 3BDYL 1BAFH 1J1XL 1QLEH 4XP4L 4KKCD 2IEPA 4PJ7B 4XHQA 3DYPA 1N0LA 2YS4A 4U1IA 2XN9E 2YD7A 2DMBA 3NAAL 4F9PA 3O2DL 2CRYA 2EYTA 4PV8A 1KYOJ 1XF2B 4AIOA 2E8ZA 1X5AA 4KGLA 3TN0B 3HZMA 4RBPH 4KZDH 2HTKD 2GEEA 2Z92A 4YDKH 3VFTB 4H1LH 1RZKH 3QHZH 3L7EB 4HV8A 3IKCB 4EI5D 4JLRB 3SE9H 4OFPA 1QP1A 1N2RA 1OARH 2H1PL 4KK8D 1T21B 1A6PA 4XWGH 5JTWA 3HE7C 3JWDC 1S7WB 1WFNA 2RB8A 3VJ6A 2DMCA 4GXVH 2VLKB 1TCMA 4ZYKA 5GS3A 4DGIH 2F53B 4EDWL 5DJ0A 5DC4B 3BSZH 4JJ5A 3AXLA 4HGWA 5EB9A 3QI9B 4ELMB 3CFCH 4YHNA 1LE9B 3QIWB 4QOKD 4LLDB 3VXSE 5CGMA 1BZ9A 5E8DL 4DCQA 4M62L 5ILTL 5DURD 4PRIB 3ARBD 1KNOB 1FSKB 4X6CA 1MRCL 2PCPB 5MENB 1NFDE 1BMGA 4NZDA 5BRZA 1KB5H 4OLVL 3L3KB 5LBSH 3IDNB 4N1HB 1IC4H 4LLWB 5A2FA 5LQBL 4M9PA 4A6YH 1UVQA 5L8LB 5IF0B 4JZJB 5I16B 1JHTB 3EO1A 1Z9OA 5J06A 5I17B 4L4JA 4NJAL 3GKWH 4OCWL 1KOAA 3RL1B 3OV6A 2KBGA 3C5SB 3HFMH 1VPOL 5BZDA 1LD9A 4HUXA 4F8QA 5T3XL 2ZSWB 1KELH 2VDRL 4J6RL 4KQ3L 4P3CH 1C16B 3OKEA 5L88L 1SYSA 2AGJL 2R1WB 5BZWB 2AS5M 1C7TA 2PTTB 5SX5K 1OVZA 2DS4A 4OF0A 1GXEA 1NL0L 4NP4H 3KLAA 5GRZA 1FNSH 2G60L 1H5BA 2VDOL 2VR4A 3PABB 1MFAH 3D0VA 1RZJL 1XF3B 2ZUQB 1G0XA 1NCWH 4HSQA 1VDGA 4Y19D 2UUDH 3BQUC 5I1LB 3INUL 3RGVC 1PBYA 5KTEH 3X3GH 1U8JB 3AB0C 3SJVB 1DLHB 2NY6B 8FABA 3CFEA 1INDH 2WQRA 2NXZC 3N1PC 4HHAB 2V2WA 1F4XL 1MPAH 1R3JA 1ZSDB 1YEFL 2Y6SC 3TBSB 3EHBC 1MCOL 5E8PA 3CXHJ 4GRLA 4KRMB 4WO4A 2EXYC 3QPXH 2CIKB 3VDBA 4J3SA 3ZDZF 5J8OA 2IGFH 1I9JL 1XIWC 5HGDA 5CUSH 5KAQF 4OI8A 1QFUH 4LRIC 3HS0A 2WIMA 4M00A 5DJDA 1WC7B 1PG7X 1OAUL 2ZG2A 3HC0A 1EAPA 5IEHA 4O4YH 5CFHA 1MI5D 4N8CL 4YDLB 3QSKB 4OIAA 4WTZA 5EOTB 3D1MC 2X89D 3B6SB 1EFQA 1K6QH 4P23A 5FYLH 1SY6L 4LPTA 5CEYA 4Z7NE 4YUEL 1QSFA 1F11A 3WDHA 3D39B 1T0MB 3V6OA 2QQLL 5I6XB 5F21B 1DBKH 4R0LC 2D2OA 4UT9L 3A67H 2P44B 3L3IA 4EVNB 5ID1A 4PLOB 1I1CA 3EOBA 2DD8H 3FONA 3GFUA 3EYFB 4OLEA 4Y0GA 5EZIL 1FGVL 3DMMA 1A4KA 4PRPD 4MB4A 4PGCA 2EECA 2XPGB 1JV5B 3VDCA 3VRIB 1YQ2A 1WEJL 4MJ2A 4X6DA 2J7LA 3BWAA 3M17A 4FQ2H 4OB5L 2AJUH 2JF1A 2V7HA 3MBEB 4MA8H 1SBBA 5E8EB 4BQ8A 2ZCKH 5A3ID 5GS0D 5D5MF 4AQOA 1MQKH 5AAMA 1NFKA 2W91A 3QUZB 1BX2A 5F1NA 5IMMA 1JUFA 3O2DA 3MRIB 1R3IH 3GMQA 4OQ1A 2RGSA 3V5KB 1XGUA 3D5OF 2UWEB 2IQAA 1QG3A 3O9WC 3OKOB 1LEGB 4NO2B 5BV7H 1IGCH 1EPFA 2APBA 3F12A 1E4KA 1GHFH 4XCYA 5H2BA 3C9NB 4NRYB 5AG9A 4MNQE 2J4WH 3IS0X 3DUUB 1I3RA 1R5IA 3HE6D 2DQIH 5CJOH 3IFOB 4LHJB 1ND0A 5KVDL 3IDIB 2CH8A 1YEDB 5EIIB 4LKCA 1FLRL 1K8IA 1CFTB 3QCVL 4E41A 5DA0B 5CJ5A 3BEVB 3GDBA 4MAYB 4BH8B 2Z91A 5K59F 1G7PA 3F6IA 1FNGB 4HKJA 3ARFD 1CTNA 3L3OA 2W60B 1KTLA 3N1FC 5EO1B 4PJFE 3SDAC 4N0CD 2GSIB 4K9EC 1C5DB 1OAYL 1UM5H 4FZ8H 2DL2A 2WBKA 2DQHH 3IFNH 2WWMD 4MDIA 4TUOA 4G5ZL 4M7JH 4OSUL 2XZCH 1KYOK 2B2XL 3NA9H 4PJ5D 1CICA 4NM4L 1Y18B 2E9BA 2IFFL 4DOHE 1FO0B 1GGBH 2XZZA 5DHVB 2I24N 3P11H 4MB3A 5ADPH 3MGAA 1LK2B 5EDXA 4FFWC 3B9DA 3GGWA 4PV9B 3CH8A 5EOQH 5I8KL 3N50A 4GKSB 1HHJA 4EN3A 4P4KB 5C08E 1JPSH 4UINL 2X44D 3VA2C 3FFCB 1A1NA 2VAAA 4U1JA 2OTUB 1QFWM 3Q6GH 4GG6E 4LVHB 4L4TD 2C3HA 3O2VL 3PV6A 4IOIA 2F9BT 5EZLA 1EXUA 5LCVL 1QHOA 3RDTC 1OM3L 2EDJA 1JP5A 4NRXA 1YEKL 1JI2A 3ZKQD 2ITDA 3MJ9H 5B8CA 5ISZA 4ODHL 2XNAA 2WV3A 5E9DD 3U82B 1F4WL 5IQ9A 2YRPA 3CVHH 1WAAF 1PVHA 2ZNWA 3GMOA 1T0NA 1DUYB 5IR1A 3BYTA 4KY1L 4PFEA 3FQNA 4BZ2L 5J4MA 2VO5A 1PD6A 2RJMA 3OJVC 3OSKA 4I18C 4PGZA 4V1DE 2VITB 4PRHD 1A9EB 5GGSA 4OCRH 5GGUA 3ZYIA 3MA7B 2EE3A 4PJAA 1IC7L 4KMQA 3H2WA 4I77L 3RY5A 1GGIL 5T3ZH 3U0TA 4K8RH 2X4TB 4HIIA 5FEBA 3Q5YA 3RBGA 2C5DC 1P53A 1JFQH 4GO6B 4JHZA 3SDDA 4ZTPL 1QQDA 5CP3H 4NNPL 2AJVL 5CHNB 4G9FB 5I2IB 2H3NB 1IGTA 2XQYK 5IOPA 1SY6A 4ZQKB 3T3PF 4WUKL 4Z9KB 4MJ6A 2IPKB 2DM7A 4K2UH 2AKRA 4PREA 2D7MA 3QXAB 4HJGA 5FO9A 1WT5A 2ZCHL 1FNFA 5TDOA 1FL5B 4YDVB 4FQCL 5KSAA 2IC2A 5DJ8B 3VD3A 2D7PA 3CDGB 5K9KB 1E27B 2A6JB 3VD5A 4GW5A 1IT9L 3QH3A 3OAZK 4MQ7B 4OT1L 4PRAA 2AJYL 2LTQC 4M61B 1BZQK 3BHBA 2P4AB 4UAOB 4Y5YC 3LS4L 3S97C 2XACC 3UBXB 4M7LT 4HW6A 3PL6B 4LVOC 1KLFA 2ZZUT 1CDIA 2XI9A 2DIBA 1QBMH 2R69L 3BI9X 5E9DB 3TJEL 5H94A 2NNAB 4QXWA 1BD2E 1W8OA 3CXHK 4RWYH 4LCWE 3TV3H 5FB8A 4YBLB 1U8HA 1U36A 5IP4A 3LDBB 1II4E 1IAOB 4HX1B 5FFLA 2HTLD 2P42B 2YPLB 3TWCL 3MJ8A 3JV6B 4HPYH 1X6LA 1U3JA 1P69B 2Y06L 2IJ0C 4P46B 4NSKB 4IIQC 1BEYH 3FO2A 3T2NL 1ED3B 4UDUB 5D2NA 1JZ4A 5DMGC 2XRAL 4IHOB 4YHZL 1BFOB 3ZKXB 3SE4C 1E6JL 5FHAL 1XR9B 5BQ7B 3PDGA 5DS8B 1LK3H 3IFLL 3QPQD 4L3EA 1Z5LB 4HDIB 3P2TA 4X6BA 4YXLL 5J56B 2EC8A 5LAXA 2X9YA 2YN3A 3FRUA 3I3BA 4TSAH 4K3JH 3P73A 4J4PA 1ES0B 2HJFA 3DO7B 2NY1C 3FB5B 2OM5A 5KG9B 1I7RA 1WIUA 3RJDA 2JCCA 3BFOA 2A9NL 5MP6H 5GS1B 5HI4C 1G9NL 1N0XH 3Q2CA 1VEOA 1NEUA 3QO0B 4YFEA 5DRXB 5H35B 3PNWA 5L9DH 3BZFB 3X3FL 5EA0H 4QXTB 3AFLA 3F6LA 2AEPH 3BPOC 3VFRA 3WFDH 3S6CA 1U8PB 2NXYD 3CFJB 4XP6H 3W9EA 5EO9A 1VFUA 2VMFA 3VMOA 4Y4HB 1OF2B 1RMFH 4JB9H 2JJVA 4F37K 2B4CC 4LPUA 3G5ZB 5E8NB 1S7UA 4ZO8A 3LKOA 2HH0H 5I30L 3SBWC 3NCYS 3U4EA 2B1AH 1S9WB 5EBMA 4X5XA 3T0XA 5ACLA 2P8LA 4ZO7A 3BJLA 1I1AB 1IM9A 3MLRH 3MRHA 5DFTA 2PXYB 2YA0A 2IPTL 3JUZA 1YYML 5D7JC 1OSZA 1MWAB 4LGRB 4P4RA 4QRSB 5DK2A 4Z5RB 1GPOH 4RMVA 4Z77A 1CQKA 2CLZA 2PR4L 3RWFA 1TENA 4HWEL 3SCMD 5C0CA 2IG2L 2C7UA 1U41A 4O02H 4UTAL 3F62A 4ZPTA 3TZVB 4S1QH 3WN5B 3UTTE 3GO1L 1MEXH 4JM2B 1ZLUK 2GJZA 3CFDA 4M6MH 5HY9A 5I1EH 4JQIL 2HJLB 1AIFB 5TDPB 2VDKH 3S37L 1MFCL 1T7XA 3DX8A 4KQ4L 4PJ9A 5HGBB 1OTSC 1NDGB 1CT8A 1EA9C 3MYJA 3QWQB 3B9AA 4R7NB 2DJSA 4W4OA 2W0PA 2NY0C 3VWKB 5IVXA 5GXBB 5EO0A 3PWJA 4GT7A 4LVNC 3QCUH 2HJKB 2XWJB 3QEGL 4UIMA 5FYKD 5F72S 4JDTL 4HFUH 5SWZD 3O3EB 2AQ3A 1IKFH 4YIQB 1PX4A 4PBVC 1XF2A 5JNYB 2VLJD 4KTEH 4HS8L 2HFTA 1F5WA 2BC4A 4X7TB 5C0BA 1Z0MA 2DQTL 2OCFD 4DFHA 2YBRA 4ZS7L 3ZTNL 4I0PD 3VFTA 1EEUA 3N9GH 1I8LA 3LKQA 3QIUC 4KJPC 3PWVB 1MCSA 3BGFC 1JGVL 5CSZB 1BGXL 2F54A 3AY4A 1UKSA 1Y0LA 5FM4A 4YFDB 1CK0H 3WD5H 1AGFA 4XH2B 4BQCA 4MQSB 1CLOH 4HMDA 4ALAL 3MRJB 3MV9B 1LEIA 2KUTA 4I8DA 1IEBB 3LB6C 1BVLA 4ELMA 4WTWA 4G8GA 4YBQD 4DW2H 4WUUB 3QIWA 3LH2H 1RY7B 4CVXB 4P5MA 1YNKL 1E28B 3HE7B 5MI0C 1RUPH 3TIEA 5CD5D 4PJHF 5EZJB 1I8MA 3UJJH 4JFPA 2MWCA 4F9LC 2EDBA 5CLWA 2FHFA 1KNOA 1D6EB 3CVIL 4HJ0D 5MENA 4X0KA 4L4VD 1SHMA 5E2JA 4CKVX 3BISA 2AV1B 2PNDA 1CFSB 4P2OA 2EE6A 1UM4L 3TO4D 1N6VA 4CL7A 5GS0L 2C3VB 1AXIB 4HIEA 1H3GA 1ZT7B 3GHBH 3HLAB 1IGFH 4JZJA 3F58H 2FIKA 5I17A 1R6VA 4X6DE 1X5HA 4AEIH 3C60C 5ENWA 3RL1A 5E1AA 4NO3A 2QQKL 3C5SA 1CFVH 3X14B 4WDIB 1T89A 1IEAA 4Z0XA 3HPLB 3NCJL 1JNHB 3TNMA 5BOPA 1T20B 3UBXG 2R8SL 2OJZH 2VE6B 3PUCA 4EI5A 4JFYA 4AM0B 3ZKNC 1JHKH 3B4NA 3SKNB 1K4CB 3U7WH 1U8NA 4P49A 3ARXA 3U0WH 2HWZL 1DR9A 4XNYL 2A9MH 2VABB 3D48R 5JQHC 2QBWA 2V6HA 3WUWB 5DJ6B 1XF3A 1X5FA 5IKCB 3ES6B 1ZHBB 1T3FA 1NMCC 4LASH 4XPHL 4QOKA 4XVTL 4M48L 1NSNH 3RUGA 3S3JA 4PJEB 4PJIA 4XPBH 4F15C 3DETC 1RJZB 2DM3A 5E6IC 3GK8L 5C8JA 1UH4A 2FL5B 1R24B 1GIGH 1P1ZB 3ARBA 5C09D 3T0VA 1S9YB 2PKDA 3EOAB 4HIJB 3O6ML 3AROA 1QBLH 3ULUC 3IVKB 3BQUB 4E41E 4U7MA 3CC5A 1G6RL 3RGVB 2K9UA 1NBQA 3BP4B 1IZKA 5E1HB 2V5SA 4NCC2 1K85A 1DQML 3AB0B 3T65A 2DI8A 3RFZC 4P2QE 3MUY1 1G7MB 1F6AA 5HHQA 2RFXB 2NXZB 1WC7A 4HKZB 4PJ8D 5D6CB 1B6UA 3S96A 3CLFL 2J8UE 4KUCD 1INQB 1AR1D 3FHQA 3BAEH 4ZNCD 1Z9MA 5F9AC 2NQCA 3C6LC 4D9RD 1Z3GH 1TZIA 1S5HB 4W6XB 5CIPB 5DGQA 4J3TA 4S1RH 1UA6L 4P2CG 3FO1A 1XIWB 3SGDI 5DJXB 3VXMD 5HPMB 1A7PL 1T0MA 3ZE1E 1A21A 4P2RE 3PHOB 4ZO6A 4Y1AE 4PUBH 1TCRB 4NKMA 1MJ7H 3CU7A 4U0QB 2Y1VA 3FRPG 4F57L 1A7QH 3K3QA 4X6CF 3PWUA 5TQ0L 4DAGL 5FDWB 2YUXA 4TN9A 1DBBH 3BDYH 4ZD3H 3OX8A 4TULH 2MHAB 4MA1C 4U1HB 4U6YB 2Y23A 2XPGA 4Y19A 4OF8A 4YHYC 3VFNA 1HYSC 4R0LB 3V0AC 3NTCL 4N0RA 3Q3GA 3MBEA 2RBLA 3T4YB 4YEFA 3KAAA 3H3PL 3AGVA 3NIDE 4I2XB 3SKMA 3MRBB 4NBZB 3STZB 5JW4R 4JN1L 1ZWIA 3RWIB 1A7OL 4O2CB 3BH9B 3UYRL 1DQJA 4EDXA 1LMKA 3BZEA 3BEWA 1J87A 4ZFGL 2FECI 4M5YH 3VXUE 1TJIH 2AJZA 3GUTA 4WWID 2Y9RT 4APQC 1A6VL 1NC4D 2JJTA 2EIZA 4NO2A 1AI1H 3OGCB 5E95B 2N56A 1LDPL 4EDWH 1EIBA 3D3VB 3P9MA 3GSWB 2AI0L 4K94C 1DZBA 4XGZB 2X89A 3BMWA 3C9NA 4KROD 2XTJE 4PJAE 5EC2B 4L8SA 1JRHH 5E8DH 3IFOA 4NC1E 4MJIB 5KSBA 3KPMB 5KOMC 3S4SB 2FEDC 3U2SB 1LNUA 3O9WB 4DKFH 4LEXH 1LO2L 1YEDA 1F4YL 1TITA 1JHLH 3LN4A 4BQ9A 4QRRD 5TFSL 3RZCD 4YZFE 3WIFA 2YR3A 1AQDA 4XC3H 3FB6B 1ZHKB 2O5YH 4Q9QL 2PYEB 1FNGA 3LEVH 4U1GC 3TFKC 4FNLL 4NQCD 4WU5B 4PRPA 3F7VB 5LQBH 4U6TA 4ZOEA 3O4LB 4UT6L 3MOQA 4NJAH 1CS6A 3H9ZA 2X4OA 2JJSA 3OKDB 3RDTD 4F3FA 2FR4B 1R5VB 1KBGH 5DD1H 1WTLA 5B21A 3WIHH 1VPOH 1T0PB 2BY2A 3KLHC 3OKKA 2ESVD 5T3XH 5GS2D 2VDRH 4LLMA 4NQVB 5IQ7H 4NWUL 3FMGL 1WCBB 3RKDC 4YHIB 1N5AB 5L88H 2AGJH 3SDAB 4L29B 3LSOA 3QQ9C 1TETL 1UG9A 1Y18A 5B39B 4MVBD 1B2WL 4XXCC 3TYFB 5I76A 2WBJD 1VEMA 1E4XI 3MXWH 4JEGB 5F7YC 4MD0A 1H9VA 2ARJA 5D7LE 1YJDH 4GFTB 4TVPH 3ABZA 4G7VL 4E9LA 32C2A 2FX9L 2QHLA 1YMHA 3BDXA 4JDVB 4POZC 2QJDA 3PG2A 3HE6A 1I4FA 2H2SD 5CKAA 3UAJC 1G7LA 1V3LA 1A2YB 4KPHL 3C87A 4HIHB 4R8WL 3E8UH 3W0WB 4C57C 5D7SH 3JTSA 3GSOA 3O45B 1QUNA 1XF5B 1MCOH 3L3HB 1MJUL 1U3YA 2CJUH 3ARFA 4JGUA 4KRNA 4GAFB 3TO2A 1BVZA 4ONFL 3B43A 1I9JH 5E24E 2DKUA 2ORBH 3HNSL 4LIQL 4DUWA 3T8XA 4QT5A 2W65B 1DUYA 1AGEA 4PY8I 1OAUH 1AGCA 3RDTB 1G7JB 4PY7B 1S7XB 2Q76B 5DC0A 2BNRB 1F3JA 1AJ7L 4DZ8B 2VITA 4UIKL 5HYQB 1G6RA 4GAYB 4UQ3B 5FK9B 3WEXB 2OR9H 2GKIA 5HGHB 2BVOA 1FNEB 4U3XA 3QYCA 3ECBA 1F90L 5ACZA 4YUEH 5TQ2H 3WDJA 3MNVB 4LSSH 1GZQB 4HLJA 4PJ5A 3Q48A 3DVNB 1UXSA 5LG1A 2DLHA 2I9LB 3IETB 4UOW0 3OAZH 4I18B 4UT9H 3N0PB 5ICXB 2FGWL 1PJ9A 1I1FB 3KPPB 4JFHD 4Z7UA 2BNUA 2X7LA 3TNNA 4L9LA 5INDB 4UU9B 1CIUA 4KZEL 3FT3B 2HVJA 1FGVH 2IPKA 5AZEL 1RZ8B 4NBXB 4U31A 1FZMA 1T04B 3WKML 1WEJH 1AD0A 2FLBT 3L1OL 2EDNA 1YY8A 5TE7L 4L4TA 4PG2C 5DJ8A 3SGEH 3CDGA 1FL3B 1OTUD 5IEKB 1E27A 4NOBA 3ROOA 5FECB 2YEZB 3RA7H 4KVCH 4MQ7A 4OZHF 2CMRL 2HFFA 2IBBA 4QRUA 4YK4C 3QG7H 2M1KA 3UBXA 4RGOH 4KAQL 3CZFA 3PL6A 5EIVA 1U0QA 4LU5L 1ACYH 3ZE1F 5HDLA 3VG0L 5CJXA 5M94B 1UKQA 1J0JA 4PJCB 4OUUB 2D9CA 2DQFB 5E9DA 4OZGE 1IAIL 5B38B 1I1YA 3IDGA 3DXAB 4KI5E 3ULVE 4ZG1A 1NMAL 2LTQB 4Z6AT 4Y5YB 1KCKA 5C07B 3RVUD 1GJIA 2CLVB 5DJYA 4OZIA 1CFBA 5LWYL 1BLNA 1IAOA 4PRHA 1BP3B 5JW4M 3X13A 1P4BH 4LVOB 3EO0A 4LHUB 5IB2B 5FYKL 1C7SA 4LSTL 3GHEH 4JFFB 3ZDYF 5DMKB 7FABL 5F1SA 2J88L 4P46A 1P4IL 2QSCL 1OCWH 5IVXE 4NZRL 3MMEB 3GSVB 3BWUC 2SEBB 4LF3A 4PIRF 3K7UA 1RUQL 3T4AB 3LV3B 2PW2B 4PJ7E 4MD5A 3U46B 2ZG1A 2WWKO 2DQCL 4X9BA 4IIQB 1ES0A 5FOBB 4X8JB 1U3HC 5MHSE 2XA8L 3HRPA 1G1CA 3QQNA 4MNGE 1OAYH 2Z31D 2XOTA 1FFOB 1CGXA 3VXPA 5DRXA 4Y8DC 4KHTL 4D94A 2NY1B 4OSUH 5KSUB 1PG7H 1U8PA 4X4ZA 4ODXB 4PS4L 3BN9D 5GRUL 4QLRA 1KEML 3FCTA 3MLZH 4JG0L 4Y4HA 3J7HA 2VLKE 3VFWA 4RDQG 1OTTD 1W0YT 2R0WH 1F8TL 4ORGB 3VXQA 2F53E 4FFYL 3G5ZA 3VFOB 3FRPA 3JWNC 1NGYB 3BPOB 4JVUA 1EH9A 1OW0A 1WZ1L 1S8DA 4HXBL 3UBXI 2A77H 1ZLWK 5F89B 2Q87A 3IJYA 2J1KA 3MREB 2UVEA 2PXYA 1MCIA 4PRIE 3O2VH 4QRSA 1RUAH 4NYLB 2DRUA 4Z5RA 4F80A 3U0PA 4Y2DD 5LCVH 2CRZA 1ZMYA 1RIUH 4JCMA 5GZOC 4WHTB 2NY7L 3MRMB 4NKDA 5ANMA 4C56B 4X6EB 3DHJA 2R1YA 3QEQD 4DVRL 5IM7B 4UUJB 5DFWH 1OLLA 3VGEA 4OV5B 5D7JB 3U6RB 3WN5A 5MEOA 1AKJD 2D4FA 4UBDD 4Z76A 2BFVL 1JGDA 5JOPD 3MLSL 1D5MB 2YWYA 3O3UN 4KY1H 1MH5B 4N68A 5FO8B 5D70H 1AIFA 2NR6C 1ZANL 5TDPA 1HK6A 5IHUL 2LVEA 1O7VA 5I15L 5HGBA 5FYJD 1NMBH 1DE4B 1ZT4A 1AC6A 5IBLC 1IC7H 1IRAY 4LLVA 4N9GA 5JXAH 4R7NA 5JZ7C 3KYKH 3VWKA 2DJ4A 3FQTA 4L8BB 5I75C 1K3IA 4R26L 3OKLB 2IAND 1JN6B 1MY5A 4EUPH 2HJKA 2VL5A 3ZTJG 1A47A 1U8OA 1FDLH 4NNPH 4Z7OF 3U4BL 2KQMA 3MRRA 1B0GB 2DIJA 4LLAA 4WUKH 4Y5XC 2DLGA 4CNIB 4KXZH 1FRGL 1U58B 1AGBA 3DGCR 2AXHA 2NY0B 5AD0B 5JNYA 1J1PH 4BSWA 2H8PA 3F7YB 4ODWA 3SJVE 1BQHB 2CDFB 2ZCHH 3NPSC 4H20H 1MCKA 4X7TA 2YXMA 3QIBC 4HXAH 4ODBD 1KB9K 3LKSA 2JCCF 1MCQA 4HD9A 1WQVT 2D7TL 1PKQE 4ZFOB 3JUYA 2VDML 3OJMB 4YXKL 3EZ8A 1N6UA 2AJYH 3SCMA 4KKAC 3HC4L 3WFZA 1SJHB 3DBXB 4HH9A 1M7XA 4RIRB 3NFPB 4QHNA 4R3SA 3OF6D 3QRGH 4F33B 1D3CA 1EEZA 3QIUB 2CIIB 3FTGA 4FTVD 5D1QC 5D71H 3RAJL 3BGFB 2R69H 3TJEH 5E2WH 3U1SL 3KNBB 4WUUA 3KS0J 1FGNL 3P0GB 3DX9A 3WIIL 3HR6A 1MAML 3MV7B 2ZJSL 5EZJA 1AO7B 4LQFH 4NO5B 5FGBA 5F9JA 1CIDA 3D39E 4H88L 1LILA 3HUJA 3O6LL 3LEYL 4PJXA 4U0RC 3B9EA 3G08B 4D9QD 5AYQA 4G6AC 1UWXK 3G6JB 1YPZB 2AV1A 3S35L 1CFSA 1EERB 1IAMA 2FBJH 5MI0B 4H8WH 1VADB 2HRPL 1CD0A 4LNRA 3QCTL 4YXLH 5GZND 5D6DA 5SWZA 1NCAL 1WWBX 1CTOA 4U1LB 3L5JA 3FQUA 4WDIA 3LIZL 2VLJA 3OTTA 1NDMA 2Q7YA 3RTQC 4AMKL 3HPLA 4LMQI 3WE6B 4HUUA 5DJ2B 4I0PA 2QQNH 4AENA 3ZYJA 4NC2B 1OGAD 4MYWB 3SKNA 1HHHA 3WJLC 3C60B 3ET9F 1ULVA 4JO2H 4YHLH 4OF5A 5HXMA 3QFJB 3UTPD 3OWEA 3WUWA 5ICYB 2UWEE 4OGXH 2H9GA 3VFVB 5IVXF 1YEEH 1MCHA 4FTVB 1NKOA 3R06B 4LHUG 5ERWB 5JOEA 5KS9A 1Q72L 3UP1A 4MQTB 5I66A 4NQDD 3V7AE 5I30H 3OJDB 5FGCB 4MXVF 1NFIA 3X11A 2FL5A 1GYAA 5FUZL 3ALWA 1QFHA 2RCSH 3SGKA 4L4VA 4Z78B 1NMCB 1WF5A 4XZUB 3BQUA 3N1MC 4ORZC 3FB7B 3KYAA 3TO4A 4PLKC 3BP4A 2PR4H 4F15B 1R3KB 4HWEH 5E6IB 4N8VB 35C8L 4HPOH 4G6ML 1KLUB 4ZFFB 2BOCB 4YDIH 1LHZA 2J2ZA 2Y25A 3CU1A 5MEPB 4HKZA 1MFEL 3MV11 5E08H 5DSCA 5DUPL 2E8YA 5DJZA 4J8RB 4LDOB 5ESAB 4PTUB 4AYFA 3GJFB 1N5YL 1KIUA 1XF4B 2EYRB 4NFCA 4WEBH 3TCXA 5F7MC 4ZUVB 5CIPA 5CD3A 4ELMF 2DTSA 4FQ1L 5DC9B 3EZJB 4X98A 4PJDB 5HPMA 4DGYH 3DRTA 4FP8L 3QXDB 4OQTA 2NPLX 2EIDA 1EZVY 2VWEE 1FVEB 4XTRD 1YEJL 4X4ME 1KJ2H 3BE1L 3HMXA 1OAKH 3ARTA 3C6LB 5FOJA 3HKFA 1MJ8L 4HCRA 3KXFB 4K3EL 4K07A 4U6YA 3E6HB 1ITBB 2YD5A 1L6ZA 3QEGH 1IILE 5EUKB 3FFCE 2E7LC 3MBXL 3MR9A 1CLCA 2Q3ZA 1M6OB 2Q6WB 4GRWB 1PQZB 2DQDL 4MA7L 1MCDA 5IHZB 1U3ZA 4MS8D 4FQIL 5C09A 4IRSC 4ZS7H 2BVQB 4MA1B 3WS6A 1JNJA 4O2CA 4WFED 3IXTB 4PP2B 4U33A 1LGVA 4YHYB 4GXUM 4NM8H 4TNWK 1LO3L 5ETUB 1J0YA 1T5WA 3F7RA 2VLLB 3AREC 2C3GA 5ECJE 3SDCD 3QULA 4OM0H 1T1XB 3GMNB 3NA4A 4PJ8A 4I3SL 2BK8A 2BRQA 5AUMB 3EYSH 3FQRB 3QQ9D 3PQYB 1HCFX 3MX0A 4GKNA 5CJQH 2XFXA 3VXMA 3RUGF 4PJIF 4APQB 3LRSB 5EFIB 3QDMD 4PJBA 1KIRA 3C8DA 2Y36H 5AG8A 2AJSH 3HI6H 1GGTA 3UTQB 1FN4A 4BFGA 3LCYA 3Q6FB 3FB6A 5DRZB 4G9FE 5BVPL 1SMOA 4MAUL 5GS0H 2H6PB 3U7YH 4Z7VA 4RMUA 3MCKB 1YN6A 5DRNA 1L7IH 5JW5A 1FG2B 4NZUH 1F4HA 4AZ8A 4YWGL 2QQKH 1N4XL 3HR5B 4U1GB 3NCJH 4LKXB 4R4BB 3RNKB 3NCYP 1QR4A 2R8SH 3V6ZB 2XXMB 3QAZC 3H0TB 3SDAA 4L29A 5EU3B 4IRJC 3IF1B 2HWZH 4N90D 3WKNA 2YZ8A 5DVOA 5GSVA 4PBXA 3WFEL 2BXZA 5EC1B 43C9A 3CX2A 1YEGH 2QADC 4M7LH 3BZ4B 2F15A 2IWGA 3UYOD 4ZAKC 2K1MA 4ZSOB 3RNQB 4XPHH 3GSNL 3K2UL 3DTXA 4YR6B 4XVTH 4M48H 2YPLE 3HG1B 5I1KL 1MCLA 4YQXL 3GK8H 4YLQT 2X4QA 5L2KB 3KWWB 4LNVA 3K0WA 4AEEA 2R0ZH 4XNQA 3C8KB 3UZEA 3OB8A 2FHCA 3MUHL 1IZJA 5F7EH 3RZCA 2OZ4L 4ODVL 1R5WA 3O45A 2ZNXA 1XF5A 3RIFF 4DGVL 2BNQD 2I25N 1YN7B 1DUZB 4NQCA 3TBWA 2CKBB 2OXGA 3MACH 5D96C 3RDTA 1S7XA 3QB7C 3DVGA 2Q76A 2R0LL 4LAQL 5GGRY 2R4SL 4DQOL 3CLFH 2DYPB 4DZ8A 4K3DH 2ESVA 3CZJA 1UA6H 2Q8BH 3GKZA 3MUJA 3MNVA 3KPNB 4ZTOL 1I7ZA 4M3JA 1NJ9A 3QUXC 4EIZC 3M45A 1QNZL 5KSBF 4NQUA 2I9LA 3IXAB 4S1DC 4XAKE 1A7RL 2V7NA 2MCG1 2WBJA 1UQSA 4F57H 5I1AA 3QUMH 4JHWH 2NTSP 2EYSA 5TQ0H 4R2GC 4DAGH 4QY8A 1JF5A 4O2EA 2BSTA 4OLXH 2OI9C 2VAJA 1KCVL 4H1LB 3P77B 1PKOA 4U1NB 4RRPG 1TIUA 4KI1A 1J05A 5C3TA 5F3HA 1YMMD 1NBVL 5EWIL 3PGFH 2VXUH 3AVEA 4ELKA 3DI2B 1RUKL 5FECA 1IM3A 3TJHC 1CL7I 1QO3A 2AK4B 2PO6D 4NN7C 4UNTA 1CR9L 4UMGA 3O3BA 4UT7L 5C0DA 4P99A 1YNTA 3GRWL 5FYJL 1WWWX 2ICWB 1VEPA 4CJ0A 1U8LA 2OSLB 4KTDH 4ZFGH 1J8HD 3GBMH 1L0YA 4Y89A 5LKNA 1U42A 1A6VH 3WO3B 2I9TA 4M6AA 4YK4B 1U8MB 4K7FB 2Z35B 1EJOL 3DYMA 4LHUA 3E3QE 1U6AH 3ZE0E 4Q6YA 2W9LA 2VZUA 2G2RA 3L95A 5D5MB 4JFFA 1H5BC 1KTDB 1RHFA 4C83A 5CBEB 3L5XH 1OAXL 1T7VA 3B2UD 3MMEA 4PY8J 4LMQE 3O3DB 1FFRA 4IDJL 5JW4Q 3MO1A 1G0DA 1A0QL 3LV3A 3FOLA 2PW2A 3B9VA 5JHDB 1AP2B 4WEUD 5H37G 3LQZB 2LAGB 5ID0B 2ZPKL 2YRZA 4PGEB 1LO5A 1RQ5A 2A0LC