4X99A

Immunoglobulin fc heterodimers variant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVCTLPPSRDELTENQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSWLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Crystal structures of immunoglobulin Fc heterodimers reveal the molecular basis for heterodimer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x99A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x99A01
5CBAB 3BPOC 3GHBH 4WW2B 3KXFB 5C07A 1S8DA 3MFFB 3UTSA 3L1OH 3RVXC 4OD3H 1AI1H 1BQHA 2WWKT 4Y1AE 1A47A 4YHKL 5A2FA 5KVEL 4OFKA 1RSFA 5TFSH 2HWZH 1X5ZA 2DMBA 2J8UA 1NUFA 1C12A 2PTTA 1YEIL 3O4LB 2DI9A 2AGJL 5GGTL 1MLBA 2MQ0A 3BPCB 4LVNB 3WXVH 5T1MB 2NW3A 1UG9A 1KC5H 1R5IB 4AEHL 1JZ7A 1I4FA 5ERWB 5EU6B 4QRRA 2VUYA 1MWAL 4XMKH 2ZNXA 4P2OD 5T33L 4N8VG 4LSQH 2O26U 2KZWA 4LPCA 2YD9A 3VFPA 2PTVA 2Z93B 4KDWA 3DUHA 3HI1A 3IKCB 3FB6A 3SCMB 4RGMC 1U3HB 2HKHH 4OLXH 1PZ5A 2NMSA 2FJHB 1M7IA 2NXZB 3A67L 4LLWB 3QG6B 4I4WB 2P5WB 4MHHI 4Y4HA 1JUFA 1Q9LA 3BQUC 1A6UL 3IDNA 3IAQA 3LRHA 2QSCH 3DYMA 5F7MC 4AEEA 1S5HB 1DZBA 3DVIA 4K07A 1HHGB 3G5XB 2MKLC 5C08D 4WY7H 1K6QH 3FO9B 1Z6JT 2GSGA 1HHJA 3LEYL 4LHQB 4MNHB 5D72L 3DUSA 1S7XB 4PB0L 4KH2A 4K94C 4R90H 2BFVH 5EPMB 5CSGA 3MMEB 4PRHD 5BJTA 3NIFF 5CIPH 3L3IB 4HMCA 2W9DH 2EDBA 2UV3A 5CS7A 5IT2H 3OKNA 3NZHH 4M5YL 4RX4A 4P5TA 2ZOLB 2ICES 3MYJB 3K8KA 5IEHA 5DDHB 4PJ7B 1EBAA 3DXAB 1J0JA 4FXGA 2Q20A 1UACL 3UP1A 3O8XD 1WBZA 1RZJC 3GMMA 5C09E 4O5LH 5FYLD 3KXFE 4GW4B 4F7EB 2BOCB 32C2B 2OR7A 5KS9A 3GI8H 2UYLA 4OAWA 4QWWC 1DDHB 4UV4H 1QLEH 5IFHH 4LCIH 5JPNB 4PLKD 3O45B 4HC1H 2VMFA 5HDQH 5JDSB 2Q86A 2XZAL 4R2GB 2APTA 4JO4H 3O4LE 3OHXB 1MRFL 1Q72H 3N1FC 3VI3F 4Z7VA 1CR9H 4ZFOL 4OM0H 4NQVA 2X4NB 3O3DA 2V17L 4CU8A 4TYUA 5EU6E 3OJ2C 4ZYKA 5TF1H 4F2MB 4QHMA 3ES6B 2VAAB 4EDWL 4YHMH 3KWWA 2RCSH 3P77B 1CLYL 2QHRL 5DD5L 1QEWA 1KJ3H 1PD6A 3HE6C 3ARVA 4MS8C 5E94A 1VEOA 4EQ3A 3LQAC 1J7VR 4TOYH 4LARH 3VXUD 5CSBA 3ZTNH 4XPHL 2YHGA 5B4MD 4FZ8L 1F3DJ 3O6FC 2APVA 5D7SH 1BQSA 3IDMB 4KK5C 4LPVA 5C6TL 2WZPD 1J1OL 5E8DH 4X5WA 2AJUL 5TDPA 4P2OB 5IB5B 4HK3J 4PJHF 3HMWH 4Y89A 3QUMA 4FNLL 2SEBB 4QTIL 1UYWH 5AAMA 4L5FH 2AEIT 2EEAA 3NIDF 2LVEA 3AVEA 4JHBA 1ULVA 2RFXA 3FTGA 5T1LB 4F58H 3LMJL 4ZNEA 5BMFH 2GKIA 1MIEH 2OZ4A 3O3AA 1PW3A 4G7VH 5DRWA 1NBQA 4B7LA 1CK0H 1F97A 3F12A 1LWRA 5K9QG 3FN3A 3MRJB 1AKJA 4UIMA 3RZCC 1T1ZB 1P7QA 2N1KA 5DSCB 2IG2L 4LDLB 1OVZA 1NGWB 3T2PA 3ARPA 4TVPD 4PJ7E 5SWQA 2XZQH 3DXAE 5F6HI 5AZ2L 1MHEA 4HIEB 1F90H 2VDNL 1FSKC 1R24B 3P11H 1JWUB 2D0HA 1T7ZA 3JXAA 3QCTH 3L3HB 4RMWA 4GRLA 3GUTB 2CLRA 1A3LL 1CD1A 1VFBA 3IYLW 5CJ5A 1IAII 3PABA 1DE4A 4LCYA 4MJ6A 3H2WA 4XVUD 2FATL 3O9WA 5TQ2H 3ZKXC 1SEQH 8FABB 5DUBB 3H9SA 4NHCL 1HN1A 4FFVC 1RUQL 1SJHB 1J0ZA 4A2LA 5MEQB 1U8LA 1TZHB 3ZL4H 3O8XB 2VJXA 1QSEA 1HI6A 4PJIF 2ZSWA 4PBVC 1A7RL 4XP1L 2BY3A 2QKIB 3LPGA 2W0PA 4KK8D 4ZAKA 4Q0XH 1U95B 4M9PA 3V7AG 5ITFA 2NZ9C 5I8EB 4CGTA 3MJ8B 1J0YA 1UH3A 2YK1L 1L7TH 5J6GA 1K3ZA 5GISH 2IPUG 4L4VA 1CXIA 3T0ED 1YEKH 4CVXB 2VDML 5IQ7L 4OZHF 3SDXB 1IGIH 4WEUD 2IH1A 3P73B 1T03H 1X5JA 1I3GL 4AM0A 4OCWL 4HBCH 1D5BB 2I07A 3O6LL 5L8LB 4AIZB 1A1NA 3C2AH 3BH9B 5E4EB 4X9BA 4LEXH 3G5ZA 1WBXB 3HAEA 1A14H 3BGAA 3V7MA 3O6KL 1U8NB 1AE6L 3QUZA 2XZCH 1N5YH 1JGUL 2JKXA 5L7XL 1T83C 3VWJB 2J5LB 1KBGL 2MHAA 2OI9B 1A0QH 4MNQB 5JOEA 2A6DB 4XH2B 3B9VA 3CZFB 4BSVB 3EOTL 1Q9OB 3NAAL 3O11B 3WFDH 4KKCC 4W4NA 4OIIH 4LPWA 5GS1C 5GGTA 5IEKA 1MREH 4M3JA 2YWYA 4ZS7H 2NXYC 4HKBB 5I74B 3VGDA 4KTYA 4OTXL 1KJ2H 4YHLL 3TBWA 4X4ME 3RUGF 1MWAA 1YPZF 1W0WA 6FABH 1NAMH 1OAUL 2AEQH 2B5IC 1FVDB 3HUJA 4ERSH 5C08E 3HPJB 4L8SC 1II4E 2BCKB 3PWVB 2AK4A 5GZOC 3ESUF 4PRHE 1ZXQA 2HT4D 3QYCA 4QHNB 4OF5A 4OCMC 4P4KA 4OSUH 4R7NA 5LWYH 2CDEB 3BZDA 1ZANH 2WUBL 1KENL 5DYOA 5IF0B 2Z92B 3QEQA 3DO7B 4MYWB 1A4JB 5EUOB 3BP5B 3HKFA 1CU4L 4NWTL 5CEYA 5D1XA 3BUYA 4X6FB 2AI0H 5CWSB 5BW7A 3P4NA 5F7UA 3N50A 3QNXA 1MH5B 4WFFD 3OB0H 4JJ5B 4KU1A 4ZS6C 5BO1L 5FYLE 4LNRB 3HLAB 2VZ3A 3NFSL 2VAJA 3U9PH 5J6HB 4HUKB 4U1KA 2OQJA 1ORSA 1RIVL 4YX2H 3HC4L 2QADD 1VDGA 3UC0H 3ZKNC 25C8H 4YO0B 1BF8A 2CD0A 1FHGA 1F8TH 1T21A 1E4XI 1MCOH 5IWLA 3O2DL 4NBYB 2AJ3B 2RHEA 4G9FA 1CI5A 4U1JA 4XRCB 3PWUA 4UUJA 3BEWA 4XAWL 4EI6A 3AS3A 3MACH 4Y4KD 5C1MB 3I85A 3GHEL 2BNUB 3MRLB 1A7PH 2YRPA 4Q9CA 1QPXA 5L0QB 2DWDA 1F4WH 3RL2A 5HHVL 3QIBB 3PL6A 5ISZB 5IB2B 2HN7A 4FQJL 4JFYA 4PR5B 2NY2C 1CTOA 3VXUE 2AV7A 1N5AA 1P9MA 1SYVB 2Z31D 4MQ7A 3SBWA 4ZFOA 1F6LL 3TPKA 1TPXB 1KF9B 3BWAB 1OARH 2VZVA 3QDGD 4M5ZL 2BHUA 3WNOA 1D3CA 3ULVD 4O02H 3PP4H 4NQDD 3DWTA 3MLWH 1JPSH 3WHXA 3R06B 2OR8A 2OR9L 1N8ZB 4W6YB 2A9NH 1F4XL 3QEHA 4X6CE 2CJUH 5GGUB 5ICXA 1MF2L 2CK0L 2P4AB 1CXKA 1INQB 3T0BA 3X17A 4GAYB 5I1JL 4WTXA 4JHZA 3EBAA 1QFWL 4CJ0A 3RKDD 2F8OA 3E6FB 1RZIA 2WLYA 5EUOE 4TVPE 4PRDB 3VA6A 3QUYD 3HC3L 3AY4C 2PO6C 1FGVL 3FO2A 3MBXH 3MNVA 1U3ZA 1P6AB 2HG5A 3NN8B 4F3FA 1Q1JL 1F58H 5CJXC 1ZGLB 4NN5C 3MJGX 2CLVA 5HHOA 4DN4H 2GTWA 2J4WH 2OXHA 3X3FL 4NJ9L 1UFUA 1IE5A 2N7BA 1F3JB 1KLUB 1X4YA 4QXTB 1YEHH 5F96H 1DBAL 5F89A 2P8LA 1WWBX 3QWOA 4XC3L 4F37K 3QULA 3O41B 4HK0A 3MBEA 3TVMD 4OCYL 5SV4A 4I8DA 1NPUA 1P7KB 2CKNA 3BGFC 3QDMA 3MRQA 1RK0B 5IQ9B 4FABL 3TV3L 3OF6A 4JJHA 5GQBA 3P9LA 1EJ6A 4LLQB 4I9WD 2GW5A 4WRLA 4BA8A 1WCBB 1HYSC 1F4YH 5JPMB 4QXGL 5ISZE 4RDQF 1EFQA 3QIWC 1UC6A 1YJDC 2LE9A 3LDBC 4HD9A 4Y5YA 2QADB 5F9AC 5EOCH 2XXCB 3BHBA 1JJUA 4OGXL 3PWLB 3FQRA 4PJDB 4LCWD 4JZOA 1YN7B 2YD8A 3T0EE 1RURL 4PREB 5KW9L 3V5HA 4RGNC 1ITCA 4MCYA 1PSKH 4DW2L 5K93A 2I26N 5F6HJ 3VFVA 2BP3A 4O2CA 4Y4KB 2VZTA 3FQNA 5CKAA 4DVRH 1WZ1H 5TE7L 4X98B 3QUKB 2XN9A 4OJFL 5E8PB 1YA5A 5E6ID 3HI5L 4F15C 2R2HB 5IMMB 4KHTH 2Q76A 2VZOA 2BC4B 4MDJB 5C0RH 4DKEL 3U46A 2DWEA 5DVOA 1T22A 3RWCB 1LO4L 1GOFA 1XGYH 1FN4A 1NBZA 5IVNA 3F6LA 2Z31B 3ZYOA 4RZCB 5DD3L 3REVB 4E42A 5C8JB 1GCFA 1C5BL 5TE4H 1ZA3A 5E8NB 3QDGB 1A9BA 5E1AA 3MRGA 1C5CL 1CFNA 4IRJA 4Y2OA 5SX5H 3QZWB 2VO5A 5EC2A 4XVJL 4MXWL 4NFDA 1T89A 4FS0A 3MV8A 5I1GH 3VCLB 2E9IA 1CVSC 2BSTB 4PS4H 4RWYH 5DHYA 3UTZB 1FPTL 1BVLA 3MNWA 5ID0B 2NY5L 3TIDB 5EOTA 2ATKB 3S34H 4DAGH 2HT2D 4ELMB 1X5IA 3LKSB 3MJ9H 1T7VA 4R3SB 4OFYD 4X7EC 4CVZA 2E7BA 5HVGB 5A40E 1DQQA 4G6AC 4KXZI 4LK4A 1K4CA 4NN7C 4UQ2A 3NA4A 5DRXA 4JKMA 4BH8B 4NO0B 5DJ8B 4WFFE 5HDBE 1FFPA 3HB3C 3RWEB 4PGBB 3BSZH 4F7MB 3KJ6H 4MJ5B 4G42B 4YC2C 1UWXH 2J88L 4MQSB 4H5SB 4WWKC 3OGCA 1IBGL 2GFBB 3CH1B 5E0QA 1UCBH 5T3XH 1KG0A 4PUBH 5B3NA 4PJDE 3OKKA 3IU4L 1LNUB 1M4KA 4X7SL 1RJZB 4JKPL 5D1ZC 3B5TA 4G8EA 4JFFA 2DQCH 3WN5A 3HG1B 2GIYA 3HZYA 1K4DB 2X4RB 3PJSB 4GQPH 4K7PH 5FHAL 5GS0H 5ABDE 3U9UB 4WUUA 1BFSA 2CMRH 1ZT7B 2ITCB 2EE3A 5E1HB 1G9NH 4GG6A 4QRPD 3QXDA 4Z7WE 3L7FA 3NACH 3SGKC 4Y5XB 1JPGB 4TTGA 1G6RH 4FHBD 5DUPH 1NFIA 4JG1H 3GHBL 4YBQC 5H94A 5A2JH 5FO8A 1ZA6A 1BZ7B 5FGCE 4K94H 5DFVC 1AXSA 4XBPA 2VLMD 1T5WB 3L1OL 4D0BA 1MUJB 4OD3L 4WJ5B 5FGSA 1NGZA 3O2DA 2OJZH 4IRSA 4M00A 2HWZL 5TFSL 3IJHB 1SQ2N 4WHTA 1AP2B 3QDGE 4I0PA 4Z8FH 3SQOL 3FFCA 3WXVL 3S37X 3ULVE 1KC5L 1UJ3C 1ZGLP 2JE8A 1U58A 4DZBA 1FE8H 4NQDE 1FZJB 2MQCA 4XMKL 2X9WA 3ROOB 1YEDA 4LSQL 4YAQA 3WJLC 3WIIH 4LVOC 1CLCA 4C54A 4HUVB 3UPAA 4ELME 4MSWA 1ORQB 2HKHL 3BJ91 5D2NA 4DOHB 4OLXL 1IEBB 4ZOAA 3RWHA 1U3JA 4PJ8B 3B3IA 4CN6A 3SDAD 5EO1A 3OG6B 1UWEH 4GBXA 4TTDC 5DGRA 4OLEA 5GS2H 1IVLA 5MI0B 5DA0B 2QSCL 4PGZA 1S7VB 4Y8DC 5DJ0B 1NGYA 4OZGB 4WY7L 5D6DA 3C6LC 1K6QL 5GSRA 1RFDH 2VDKH 5IHZA 3X13A 4R0LC 3JTTB 1HQ4B 4R90L 2BFVL 2WBWB 1JNHB 3LQAH 1KSRA 5C71A 4WEBH 4DFHA 2W9DL 1MCPH 1U92A 4XNQA 5IT2L 3WIHH 3NZHL 3NBNA 2F74B 1IC4H 4XCEB 4G8FA 1IC1A 2FO1A 2R1XA 3KYMB 3Q48A 4Q6IC 4RAUB 3D25A 5CFHA 4I9WE 3S5LB 3U82B 4Y2DC 1GRWA 2YR3A 4O5LL 1CYGA 1D5MB 2FYYA 2W0FB 4X4ZA 2HMIC 3U4EB 3S9DB 3TT3L 3DURA 3GI8L 4UV4L 3D3VB 1QLEL 1A9EA 5IFHL 4LCIL 1A1MB 4LCWE 5EC1B 5D7IB 4HC1L 5HDQL 3WO3B 4Z7UB 3MUZ1 3GMQB 3UZVB 4OFVA 4X80H 1Q72L 4ZUWB 5FKAA 5CGYC 1R5VB 5FDYA 2HVKA 4OM0L 1CGXA 5M7QA 3D39D 1JPFA 5HYJA 1DTUA 4CVUA 2YD2A 4MA7H 1ZEAH 2DM4A 5DEFA 5TGBB 4ONHB 4BFGA 3KPLB 4QCIB 5DO2C 5BRZD 5TF1L 1VGKB 1OGTA 4YHML 1OGAA 5ADOH 2QR0B 5IROA 3TO4D 3LD8B 2IMNA 1F42A 3EFFB 2EH8H 1KJ3L 1F11B 4N8CH 4DZ8A 2H9GB 4ELKA 5E5MB 4DOHE 4TOYL 4LARL 1DN0A 1CZ8H 2MPAH 4JKWA 3ZTNL 5FECA 4NNPH 1EK3A 2GJZB 3D85B 3CJJA 5ESQB 5D7SL 5LKNA 2BK8A 1VPOH 5E8DL 1FZKA 5HGDA 1X5AA 2VLRD 3BO8A 4YEEA 2H2SC 4ODBD 2X4PB 3T8XA 3EJZD 1QRKA 1VGEH 3WLBB 5C0DB 4F7PA 1UYWL 4OZGE 2A6IB 1NGXA 4Z5RA 4L5FL 2E7MA 3VRIA 4R7DA 3P0YH 2NLJA 1P53A 2IALB 4NUJB 4F58L 5BMFL 1TVHA 1MIEL 2DTSA 2CDGA 2JB6B 4G7VL 4JFXB 4YZFF 1EMTH 1OB1A 1CK0L 1HH9A 2A9MH 1KXQE 4L3AA 5FIEA 3TCXA 3SDAB 4P49A 2XZQL 3MJ6A 2GK0B 2XT1B 4ZXBA 3BH8A 3P11L 3QCTL 1E4JA 4PJCA 1FNGA 5E00B 3RFZC 2WWMD 2CKBB 3V0VB 5BV7L 3LRGA 4TNWF 1HILA 3PIQA 2ZUQB 2IGFH 5CZKA 1NMCB 4Y16B 2EYRB 4N0CD 1NBVH 1P1ZA 2OCFD 4UAOB 5I16B 1T2QH 5D7IE 2G9HB 5TQ2L 2ID5A 5I1AA 1SEQL 1L9NA 1W8OA 4Z7UE 4D2NA 4IHOA 1S9YA 4W6XB 3JBG7 2BSRB 1IKNA 5C0JB 1Q38A 2Y36H 4FQQB 1Y6NR 5E5RB 4D94A 4QRPE 2Z8WC 4KV5F 3ZL4L 4S11A 2F19H 1BECA 4V2CB 3QWRA 3TEUA 1VFUA 2YXMA 3GMNA 4CADA 4M93C 4FG6D 1EERB 2VLME 2P42B 4WCYH 3WL9A 1IFHH 2VZSA 4Q0XL 1EA9C 3VDCA 3WNLA 2A38A 5F72S 5KG9B 1CGUA 1L7TL 5GISL 2O61A 2Y07H 1RHHB 3VMNA 1YEKL 4MJIA 3JWOH 3D39B 1T5XA 1T0NB 1T03L 3TO2B 3QI9C 3RTQD 5EU7C 2OTPA 4HBCL 4AQ1B 3WMSA 1S9VA 1DANT 3EYQC 4J23A 3C2AL 1AIFA 3HZKA 3Q5OA 1C7TA 4LEXL 4KKLD 5CKGA 1A14L 3MV7D 3TO4B 3VFSB 2XZCL 1N5YL 2P48B 4LRNL 5FDWB 3SJVA 4LBEA 4OLWH 4YXKH 3IJSB 4RMTA 5DJDA 2WINA 4YHPB 2HRPH 1FG2B 3H8NA 3WFDL 3KHQA 4OIIL 1MREL 1QRNB 3RWIB 2ILLA 3QB7C 5FV2A 3BEVB 5F9OH 4LPUA 2FLRT 3LPFA 3WKML 1KJ2L 4DKFH 1DVFD 4XTRC 3OXRB 1DQMH 1NAML 7FABH 1FFOA 2AEQL 4PLJC 4ERSL 5HHQB 4ZUTB 5TH2A 4AK1A 1Y0LA 15C8H 2VLJA 3TZVC 3CSPA 4OSUL 5LWYL 1ZANL 1XF2B 3IETA 2GAZA 1NL0H 1PJ9A 5KN5A 3IDGA 2EDDA 3AM8C 3OV6A 3MRPB 2AI0L 1AHWA 1D9KC 2OLDA 4M8QB 2F5BH 3WNKA 2D9CA 2W38A 1U8MA 3KLAB 3WLWC 5D7JA 3JUZA 2VLLB 3U9PL 2AXFA 4ZOEA 1BF2A 4YX2L 5CIPA 5ACZA 3UC0L 25C8L 3FB5A 1R3JB 3ISWA 4QO1A 3VH8B 2DKUA 1F8TL 2F5AH 2PETA 3KVQA 4LQ1A 1MCOL 4AIXA 3MOQA 3FFDB 3LS5L 3WFHA 2GJ6B 2VQ1B 1MRCH 3D39E 4R8WH 1XFPA 3AS1A 1MFNA 1S78D 5IB1A 2CQVA 2VN4A 3MACL 5BRZE 1QFPA 4LNVA 2G5RA 4KMLB 1RK1A 2ZCHH 1A7PL 1ZSDA 4OV5B 4FQLH 4IOFC 1YQ2A 1OTTD 3GSNH 1F4WL 3QEGH 2IF7A 4PGEA 1UZ8A 4X4YB 3RGVD 5I8OH 4JDTH 1X5YA 4HC1A 3M8OH 1FO0B 1VB9A 3QQNA 2V5TA 4XWOD 4FXLA 1OARL 1Z5LB 1H3PH 1OAXH 2VLRE 3RTQB 1MCEA 4O02L 5JXED 2Q3ZA 3PP4L 2XKSA 3B9AA 3CPLA 2KQNA 4G80B 4JM4H 4LLYB 5AG9A 2XWJB 5EA0H 4LFHG 2YN3A 1YJDH 2CJUL 3HR5A 1T2XA 5EU4A 1V3LA 4P48A 3QQ3B 1L0XA 5EBWA 4KVCH 4OF8A 3ARDC 4Y4HD 5ICYB 3FL7A 1QYGH 3TESA 4NO3B 3IDXH 1TVDA 5H37G 5D93C 4QOKB 3NCCB 3CDCA 1DVFB 3ARFC 4NKIH 1A4KB 4WDIA 5FA4A 4EI5D 2WIMA 4MNGB 3EO0A 1F58L 4WU7B 3RVWC 3FB7B 3CFIC 3RVUD 4G6JH 2HJFB 4P23C 4O9HH 3N06B 2VZUA 3VXSA 2M2DA 2NTFA 4RMQA 4MX7A 4DN4L 5FYKH 2J4WL 4GAJH 2HLFC 5EU5B 1LE5A 3H42H 4IIQA 3VGAB 1HZHH 1XR9A 3PP3H 4P5TD 5J13C 4KY1L 4RIRA 4LEOB 5FCUH 3A6OA 1MCFA 1BQUA 4QHLA 4BQ9A 1YEHL 4NZRH 5F96L 3CUPA 3S88H 4PY7B 2H26B 3GKWH 5I6XB 3BPNC 4JFOA 3E3QE 1BOGA 1CG9A 4JANA 1EGJL 5H35A 3LY6A 5CD5C 5KSAC 4HS3B 3UZEA 3VXMA 5ETUA 3W9EB 4W4OA 2I9LB 1MFAH 2B0SH 5TDNB 4OZFG 5CCKL 3CVIL 1DLHB 1F4YL 5CUSH 4MA3B 4MWFA 5EOCL 3Q0HA 2V5MA 4NRZA 2XFXA 4F33A 1DQJA 4YPJA 4L4TB 4ESKA 3L5WB 1A6PA 2EDYA 4W6WB 1TTUA 3OKLB 4IMLA 3CCHB 3F7PC 4XI5D 2ED9A 3HHRB 2ZP0T 5J12C 4CU6A 1ZHBB 3SDDA 1CICC 4JFZH 4DVRL 1WZ1L 5C07B 3HNVH 3L5JA 1VENA 3DROA 3UTSB 1H5BC 4L9LC 4X6DF 3MV7E 1BQHB 4KHTL 4DGIH 1QR4A 2J8UB 5C0RL 2E6PA 2VLKA 1C12B 2GCYA 2PTTB 4KJQC 5GIRA 1ZKAA 3HFMH 4NPYA 2X10A 4IDJH 1MLBB 2M1KA 3H7LA 3SKJH 2NW3B 2XWBA 1I4FB 2F9BT 5ADPL 4WW2C 3SGEH 5TE4L 2VE6A 3MJ7A 4XCYA 3FMGH 4KFZC 1J0IA 2E7LC 3NPSB 3T1FA 4H88L 4MNGE 1P69B 3VFPB 3S4SB 4GKNA 1X6NA 1CGYA 4LQFH 5I1GL 3HI1B 3FB6B 1ED3A 1PDKA 3VFNA 4PS4L 4ENEC 2HTKC 1PZ5B 1IEHA 3WS6C 1AKJD 2PW2A 1P7QD 1M7IB 1KCSH 3VRJA 1Z9LA 2DAVA 5C9JA 3S34L 4OZIF 4DAGL 4Y4HB 1JUFB 1Q9LB 3MJ9L 3IDNB 2K7PA 3A0OA 4OGAD 3NMEA 4OF0A 1KJ2A 4GRLD 3VRLF 4F7TA 5DT1H 4M7KH 5IW3A 1NAMA 3SCMC 4O2EA 1U3HC 1HHJB 2GSGB 5L2JA 3BJLA 3DMMA 1FNEA 2ICWA 3DUSB 2KH2B 3BSZL 3KJ6L 1UB5A 2NXZC 5BJTB 1HK6A 1UCBL 3OKNB 1NANH 1YY9C 1E6OH 4Z76B 4P5TB 5T3XL 5IEHB 2DTMH 1YN6A 4FXGB 3GRWH 4BM7A 2CIIA 5IFAH 2DQCL 1WBZB 5GS0L 4K7PL 5EG6C 3GMMB 3C5ZA 1I1AC 1KACB 4NO5B 4TPRH 4KZDH 1EAJA 1CFSB 5CJQH 2UYLB 4OAWB 4RFEA 4ZAKD 3NACL 1JYVA 1G6RL 5DUPL 1JN6A 4JG1L 3G6DL 4JPKH 1MAMH 3MLPA 1Q0YH 1PY9A 4K94L 1IJ9A 4Z7VB 4MJ4A 1LO3L 3L3GA 4NQVB 3LN4A 1I7ZA 1IARB 2OJZL 5E8EA 4Z6AT 4HMEA 1EFXA 4QHMB 4Z8FL 3KWWB 2ZUYA 3VFUA 5D71H 1FE8L 3QUZD 1QEWB 4HCRH 5HGAA 4JRYA 4R2GC 4HEPG 3IDJA 4UOW1 5E94B 3NOIA 1Z9SA 3WIIL 4NKMA 4KMQA 3BI9X 3MR9A 1OQOA 4BK5A 4KGJA 4H1LH 3SGJC 4X5WB 1Z3GH 1X5FA 3TH3T 3QUMB 1T0MA 4J4PA 1UWEL 4N8PA 2WP3O 5I18H 4E0RA 5MEND 2BNRA 5KVDH 2RFXB 3MOBH 3FTGB 2GEEA 3O3AB 4HUNB 3K81A 3CXHK 3F12B 3TNMA 1AKJB 4TNVF 3STZA 1RFDL 1P7QB 2VDKL 4C58B 4P2OC 5SWQB 3LQAL 5IMKA 5D1XD 4WEBL 1MHEB 2WIIA 1Y18A 4GRLB 4KUCF 3WIHL 4WW1A 1LO0L 1IC4L 2YA2A 3BN9D 2CLRB 2FGZA 1CD1B 1VFBB 3QZWG 4PJHA 1DE4B 3ZKMD 4MJ6B 2WM0A 3KG5A 1KJMA 1KTLB 3O9WB 5EB9A 3HNTH 2Q7NA 2JCCB 2GUOA 4I2XA 3H9SB 5INCA 4Z7VE 1N6QH 1FDLH 2YEZA 3VI4E 5FA3A 1U8LB 3U0TB 3FT3A 2FCBA 4L9DA 4Y4FA 4QRTA 1KPVA 1QSEB 1HI6B 2ZSWB 4JAMA 5C3TA 5BVPH 1EGJA 1F3DH 2DL9A 3L3KB 1GOGA 5HPMA 4MA7L 3MGAA 4ZAKB 3DARA 5HGHA 1ZLVH 5ITFB 5ADOL 2D7QA 4FQ2H 2JJVA 5J6GB 2EH8L 4EXPX 1YEEH 1CD9B 4EN3A 1A6WH 3O8XC 5DJZA 4JGJA 3RVXD 1H8SA 5J1SC 4G7YH 2IH1B 5DTFA 4U2YA 4AM0B 1CZ8L 4PTUA 3VDAA 2I07B 4NNPL 5KVMC 4Q7DA 1A1NB 4QXWA 4V1DA 4LMQE 3MLRH 3G5ZB 4PLKC 3HAEB 2IANA 4PJXF 3ZO0A 3QUZB 1YYMH 4PJIA 3UTQB 4OV6F 3O3BA 1BWWA 1VGEL 4E41D 4ZNEE 5TPWH 3QQ9D 2MHAB 4PJBF 4LHUA 2Z0BA 5EWIL 3VFTA 1UA6H 3BKMH 3P0YL 5TE6H 1SY6H 5IEKB 3L3JA 3OG4B 5DQ9A 1RZ7H 3B5GA 4GMSH 1DBJH 1EMTL 5E4EC 3TBWB 1KPRA 2A9ML 2G75A 3EYFA 3QXVA 4OZHA 3UMTA 4JGMA 2FB4H 3HUJB 4HWEL 1PLGH 3ZDYF 1IILE 3DTXA 2J5LC 1SYSA 3BP4B 3LKOA 3G08A 1QZ1A 4HXBH 1QHPA 2AK4B 1S7SA 2EE2A 5HHOD 1EAPA 5B4MC 1U41A 4R97B 3MRIA 4P4KB 2JCCE 4R7NB 5C0CA 2X5PA 5I74C 1EO8H 1QUNA 3H9SE 5I1LA 8CGTA 5JW5A 2IGFL 3QEQB 2Z9TA 1NBVL 4N0UB 4M4PA 2GY5A 2L0DA 1T2QL 4RA3A 5D1XB 3BUYB 3MJ9A 3P4NB 1MVFA 4HPYH 3BESR 3QNXB 1G1CA 4HIXL 5D2LE 1NJ9A 4HS8H 3RUGA 2Y36L 1YPZA 5F97E 3RHWK 3DNKA 3KPRA 4F9PA 1CLZH 3F7RA 4U1KB 2OQJB 1ORSB 2F19L 3QFDA 4FMKA 1SBBA 3T2OA 1AD9A 1RIUH 4Z7NE 2QTEA 2HKFH 1IAIM 3DRQA 1CXEA 2IPKA 4WCYL 2VXVH 1IFHL 4U1JB 4Q9RH 1DLFH 3PWUB 3RY6C 4YDKH 3RY4A 3RIAK 1GOHA 2F54A 2AKRB 3UJTH 3IU3B 4HDIA 4UUJB 3FAXA 3BEWB 5IW1A 4EI6B 1QFUH 5CMAA 1UVQB 3UYRH 1OAZL 2Y07L 5B8CA 5JIIA 3MO1A 2WNGA 1CDUA 2XN9D 4NNYA 1JWSA 4XVUC 3P4MA 3OKEA 1CIDA 3JWOL 3SGDH 5LCVH 2DWDB 3RL2B 4D9LH 2F8VA 4PJEF 1G6RA 3PL6B 2HN7B 4JFYB 1EUTA 2H2PD 2PN5A 3ULUD 2VB5A 4HJGA 4KRLB 2AW2A 2J8UF 3WCYA 2YPVH 1YMHB 1N5AB 2AV7B 4MQ7B 5JNYB 5I9QB 3SE9H 1PEWA 4ZFOB 4OLWL 1NCNA 4YXKL 1PGRB 4K7PY 1XF5A 4TSBH 1FNFA 3OKDA 3NFPA 5L0QC 4IRJD 4KK8C 3UO1L 3RI5K 3WHXB 5F9OL 3JTSA 3OWEA 4GAGH 2E7HA 1TQBC 4GKOA 4LLVA 3LSOA 5MENE 4O4YL 3E2HB 3OAYH 3QEHB 2X89A 1DQML 5ICXB 7FABL 1FFNA 1WZMA 1FIEA 4K55A 3T0EC 3FKUS 2R1YA 1HWGB 3ARGA 4POUB 4JZNB 5J7CC 5DWUH 1RZIB 4N0UE 2ITDA 15C8L 5F1NA 1JHLH 3WKNA 3FO2B 3MNVB 1KLGA 2C1OA 2HG5B 2PXYD 3KPPA 3TM6A 1IQDA 1NL0L 4F3FB 4EKXA 3OJMB 4MJ2A 1L0QA 4NZDA 4XBGA 5LGJA 4M7ZB 2CLVB 5HHOB 2GTWB 3E0GA 5HYIA 3W5MA 3KLSA 3L3OA 2F5BL 3HE6A 3VJ6A 3LKNA 4YHNA 2VITA 4KK6D 3SY0A 5E9DA 2JIXD 1NCUA 3LN9A 5J4MA 2P8LB 3QWOB 5ESAA 5C0ND 4HK0B 3MBEB 3O6FA 1YECH 1NGQH 2F5AL 4EIGB 3QDMB 3WIHA 3I6KA 3KDMA 4K8RD 1A02N 3BRGC 4R8WL 3P9LB 2HT4C 1WT5C 5KS9F 4JZJB 2DI7A 1ERNA 3WO4B 3CSYA 1N6UA 4I1NB 5C6PB 4XPTH 2ZCHL 4Y5YB 1UQSA 1JYWA 3BHBB 4FQLL 4NUGH 1ZLUH 3GSNL 4AH2A 2YWZA 4JQVA 3QEGL 1JGVH 4JZOB 2OSLA 1H3XA 5I8OL 1EHNA 3V5HB 4JDTL 1JPST 3MCKA 4MCYB 3M8OL 4DQOH 4PG2C 4UV7L 4O2CB 3FQNB 3IB4A 2XN9B 3IJYA 4RFOH 4LU5H 3VGHA 1H3PL 2QADC 5D4QA 5JW3H 2LFGA 1OAXL 1QD0A 2Q76B 1CDGA 4FQXD 2ORBH 2VXTH 3U46B 2DWEB 4E41E 3F58H 5T3ZH 4KGLA 1QO3A 4JM4L 5L8JB 4UOJA 3SKNA 5HYSG 1NBZB 5EA0L 1UENA 4OB5H 4WFGD 4NBZB 4QEGA 4M7LH 4E42B 2XRAH 3RA7L 1YJDL 4Y4KC 5M95B 3MX0A 2X4SA 4YR6A 1ZA3B 5JW4M 5DMIH 2EICA 1QSFA 1A9BB 2LU3A 5E1AB 4XWGH 2J6EL 4GBXD 3MRGB 1CFNB 4IRJB 5EDXA 3ZHLA 3QA3A 1U91A 4KKCD 3S3PA 1TLKA 1XCTA 2F53A 4GLRI 2R69H 4OI9A 4NKIL 5DHYB 2Z31C 1XCQA 5HHOE 5ICZA 1BVLB 5FUZL 2NR6D 3THML 1DEEA 5DI8A 4G6JL 4S10A 4O9HL 2X41A 5IV2A 3ULVC 4CVZB 5FYKL 2PW1A 3K0WA 3H42L 2QQNH 3F5WA 1HZHL 5MEOA 1DQQB 3OAZK 3N9GH 1K4CB 2YSSA 4I77H 5DRXB 5L2KA 1QBLH 5FCUL 4M1GH 1FFPB 4PV8A 3O4OC 4NZRL 5B39B 3S88L 3GKWL 3VXRD 5HYQB 2VKWA 5F88A 3VXOA 3GSQA 1E4KC 3OGCB 3RKDC 3QISA 3MROA 3SPVA 2OL3H 2CRIA 5LQBH 1JMZA 3QUYC 1KG0B 4JLRA 4K3JH 4FTVD 1MFAL 1T83A 2B0SL 3OKKB 5JIKA 1ES0A 1SJXA 3SDYH 1FQ9C 1IAIH 1G7IB 4NFBA 3WN5B 3HZYB 3JWDC 4KI5D 4PJFF 4WUUB 3RP1A 2XQYG 5HYJD 4C57C 1DFBH 1URLA 2XN9E 4LLUA 4GG6B 4P3CH 4G8GA 4X6CF 3L7FB 3BAEH 1B4JH 4WTZA 3W0WA 4F8QA 1LILA 1OGAD 1NFIB 5F93C 5H94B 1ZA6B 4JFZL 3HNVL 1AXSB 1DBKL 4XBPB 3QHZH 4L8SA 3ULUE 4HEME 4D0BB 3E1F1 1Z0MA 4CN4A 3MA9H 3BRDA 3D0LA 1NGZB 5F7EH 3TVMC 1RZFH 4DGIL 4IRSB 5FYJL 1ZAGA 5B38G 3SDCD 4WHTB 3FRUA 3O81A 3HFML 4I0PB 2A2QT 4IDJL 1S7WA 2DDQH 3FFCB 4PTTA 3SKJL 4Q2ZA 3AAZA 1IMHC 5K59E 4DZBB 1G7HA 1H15A 4YLQT 1MNUH 2BVQA 2RIKA 1YEDB 4U1GB 1LP9A 2DICA 4YAQB 3KPNA 3JV4A 5KJRH 2Q87A 3M07A 3B9EA 2Y72A 2JJUA 4LQFL 2VABA 4MSWB 4U0RC 5D2NB 4XAKD 3RWHB 4C4KT 3IDUA 2XXMB 5E6IC 4GBXB 3B43A 2MMXA 5IMLA 1MQKH 4Z7OE 5JORA 4HJ0D 4ZXBD 5E2UH 3WIFA 1KYOK 5DT1L 4M7KL 1NGYB 5F8RC 2PO6D 5IOPA 4ZPTA 2VN7A 5T5FH 1BGXL 2QV2A 3EYVA 3LN5A 4BZYA 2Y4SA 5GSRB 2H1PH 5IHZB 2K1MA 3X13B 4PRAB 4GRMA 2EDRA 5FGBC 4XCFH 3J7HA 3HZVA 1U92B 1DJSA 4XNQB 5E95B 4OI8A 4OCXH 1E6OL 2DD8H 5HHMD 5MI0C 2QLVB 4M02A 4G8FB 4N8VA 2DTML 1WJ3A 2NY1D 2R1XB 3GRWL 1MCLA 3MLZH 3D25B 5IFAL 1FNSH 5FO7A 1A64A 3LKQA 1V5JA 2FYYB 5EFIA 4TPRL 4N0YH 2HT2C 3NGBC 3DURB 5CJQL 1NCAH 1QKZH 1A9EB 4AL8H 1FVEB 4LLAA 1U8PA 5ENWA 4Y5VA 1A6ZA 2CRMA 3T3PF 1MAML 3IXTA 1Q0YL 2NX5A 1HYSD 1MCJA 1RAMA 3CDYA 2VNCA 1SMAA 1C5DA 5FKAB 2NY4D 3ILPA 4GRWF 3ARED 3D9AH 4MJID 2LVCA 1JPFB 2APWA 5HYJB 1YEFH 5GGVY 4K7PX 3AY4A 1H3TA 5DEFB 3RWJA 5C2UB 4Q97A 1E4XH 1QVOA 1OGTB 3HMXH 1HEZA 1OGAB 1CGWA 4PRPA 5GJTH 3U83A 5D71L 4MZ3A 2A77H 3OR6A 1QSZA 4HCRL 3OKOA 4JFQA 1B0RA 4DZ8B 4WFGE 3GSNA 1QOKA 3N85L 4ELKB 1DN0B 5FECB 2O5YH 5CZXD 3MXVH 1WIPA 1QPPA 4ZFFA 2V9QA 4Q9BA 3PNWA 1UADC 3FZUD 1JBJA 2N7AA 4M1DH 3F7VA 1LDSA 4JY5H 4U0QB 1FZKB 5HGDB 1QHOA 4PJ9A 3BO8B 3T8XB 3LD8C 3MLSH 4XX1E 5I1CH 1Z3GL 2BZDA 4M48H 2FH6A 2R0LL 4LPTA 3WE6A 5I73B 4F7PB 2APFA 4B53A 1NGXB 5I18L 4KDVA 4Z5RB 3VRIB 4R7DB 5H2BA 2AEPH 2NLJB 5C0GA 2RR3A 3MOBL 3VWKD 3ZT6A 4D0CB 2AQ2A 1TVHB 2VLJD 3MLXH 3BGMA 1OB1B 3QIWA 2W91A 1Q9KA 1HH9B 5MEPA 5TJWK 4Z7WF 4P57A 5GGSY 4HLZG 5FYLH 3PHOA 1X5XA 4ZXBB 3BH8B 4PRNA 4UU9A 3QFJD 1F6FB 5DLMH 4PJCB 2WK2A 3VXRE 3ARUA 2ED8A 1HILB 3PIQB 4WVRA 2V6HA 3S4SG 5CBEA 3JWNC 1P1ZB 1NDGA 5IB3A 4FTVE 1BBJA 3HNTL 2IMMA 1KCRL 3SDAC 3T4AA 5I1AB 1J8HA 3ULVF 5H37H 1GPOH 4IHOB 1S9YB 1N6QL 2IBGA 4KI5E 3VG0L 1FDLL 5HHMB 3BZEA 4MA1B 2D3VA 5HYJE 5IBLD 5C0AD 4UZGA 2NY1B 5GGRA 4HKXA 2EE6A 4NP4H 4CL7A 3CLFH 4NT6A 3NFNA 5C0BA 1MCSA 1B9ZA 3KGRA 2K9UA 2DLEA 3B83A 1NMCC 4HQQH 2Q8BH 1OGAE 3TYGH 4H8WC 5BVPL 4UAOC 4CADB 4ORGA 3QH3B 4NQUA 1A6AA 1R3KA 4ZNCD 1XMWA 1L4IA 2R4RH 4KJYA 3N1MC 3QRGH 4FQ2L 3IDIA 5IKCA 2CR3A 5IJKC 2O61B 3ZDXF 1A6WL 2NY4B 1I9IH 4LRIC 4MJIB 3MRNA 3OZ9H 1T5XB 5CLWA 3W39A 1WICA 2UZIH 3L7EA 4OZFH 1S9VB 1O0VA 2V2XA 3QEUA 1AIFB 3GJEA 3HZKB 3L6FA 4FXKA 5F71A 4YE4L 1YYML 4X5XA 1FL5B 3N0PB 1L9MA 3SJVB 4JO2H 4LBEB 4N1EA 4TVPH 4R4ND 4WWKA 4ODTL 2VDLL 2MTPA 5DJDB 2WINB 4LAQH 1T0PB 3AMKA 1UA6L 1OD9A 4XAKE 3BKML 2EIZA 5TE6L 5DK3A 1SY6L 4G5ZH 5D1ZA 3S37H 3PF2A 3U48A 4G6FD 1RZ7L 4M6NH 4X6BA 1DBJL 4AMKH 3O6MH 3EW3B 5JHDD 3TO4C 1T1WA 5ELIA 4PJCE 5DJYB 5DEZA 1FFOB 5D8JH 2FB4L 3BKJH 1PLGL 3T65A 4HXBL 5KVEH 5TH2B 2EO9A 3BD3A 1Y0LB 1YMMA 2VLJB 1F2QA 4WV1A 4OFPA 1VEMA 2AGJH 4U3HA 2B1AH 3IS0X 2IC2A 2GAZB 4AEHH 4U6XA 5SWSD 4MXVF 3O2VL 5HHME 3EJZC 4LSPH 1MWAH 1LK2A 3IDGB 4Z0XA 5D9SA 5KN5B 3I9GH 5BZWA 1V05A 4PB9H 5T33H 1AHWB 3QFJB 4U6TA 3QDJD 1ITBB 4HPYL 2MCPH 1UJ3A 1K2DA 1LQSR 2KDGA 4HS8L 2QSQA 3RPKA 2DB8A 4L1DA 2A6KA 3IDYB 2AEWA 1U8MB 1QSVA 4KXZH 5D7JB 4GXVL 1KTDA 2VRAA 4JM2D 1A1OB 4X7DC 4UOW0 3ARBA 5CIPB 1T3FA 5ACZB 1RIUL 4X5LA 3FB5B 2HKFL 1D6EA 4FRWA 1TTGA 3WFHB 5IJVB 1JNJA 4Q9RL 1DLFL 4YDKL 5FHBH 4MJIE 2WWMC 1KEGH 3ZTJH 5BQ7A 1TJHH 2FSEA 5IB1B 1FLRL 3GRWA 3U2SA 1QFUL 3QHTC 3UYRL 1MOEA 1JZ6A 4OI7A 1KIPB 1RK1B 1PY4A 4K7FB 1ZSDB 4U1IA 4W81A 3T3ME 1PVHA 5LCVL 4D9LL 4PGEB 1UZ8B 3SJVE 2VLKD 3CAFA 1AJ7H 5DHXB 3C6LA 3WUZA 3BW9A 4QRQA 4ZOBA 4MVBD 3VMOA 5DURB 3E3QC 1A3QA 3SE9L 1EVUA 2IEPA 4IBLT 4GRWH 4EUPG 1UACH 4OKDA 4TSBL 4LLDA 3QUXD 4ONGH 4EDXA 4FG6C 3W82A 4AZ8A 2ZZUT 3CPLB 3ZT7A 4P9HC 4P0DA 4GAGL 3MV9A 3CFBA 3S35X 4HCRA 4JY4B 4OLZH 2AAVA 4Y2DA 1I1YB 3HR5B 5EU4B 5F7LB 4NRYA 2VLJE 1EBPA 1GJIA 5HJ3A 6CGTA 1TENA 1I7RA 4XP5H 5D70H 4U1HA 4ALAL 2XA3A 1G0DA 4L8BA 5DWUL 5FUCE 3RTQC 3QSKB 2JJTA 3C5SA 1JHLL 1WVZA 3QFJE 3WV0A 4KKLC 4WDIB 4IJ3C 1UZ6F 1CLYH 1PG7H 5FA4B 3C2SA 3EO0B 3DMMD 5DHVH 4AY0A 3L95B 4GO6B 5HHPA 1JK8A 3VXSB 2NTFB 4MX7B 1LE5B 3UJJH 2D0FA 4IIQB 5EU3A 1XR9B 2EDWA 3T0WA 2GITA 1CCZA 3EIFA 4DKDC 4EJ1C 1NMBL 4MQXD 1KIQB 2Y23A 1DVFC 4QHLB 1D5XA 4C55A 1ZWIA 3CUPB 4NC2B 3AS2A 4GW5A 1TVBA 2AJUH 2XA8H 5C0AE 4JFOB 1JF5A 1N3NB 4YFDB 5C0IA 1BOGB 3C5ZD 4FNLH 5EO0A 3QDJB 1CG9B 1YECL 4JANB 4LVHB 1NGQL 4HS6A 5H35B 43C9A 4PY8J 5FKPA 3KPSD 1MJ8H 1XGUA 3VXMB 2GI7A 5BZDA 5D6CA 3VD5A 5ETUB 4OBSA 3VGAC 1W72H 2CDFA 2YC1A 3ORJA 3VD4A 3U6RA 3GO1H 4XPTL 3K80A 4MWFB 4ACPA 2KBGA 3H9ZA 3E6HA 4NUGL 2IG2H 4NRZB 3ULVH 1TETH 4F33B 5TF0A 1DQJB 1JGVL 5AZ2H 3CX5K 2ARWA 2VDNH 3LV3A 1A22B 5F70A 4I13B 1EFXD 4IMLB 1YNTA 2ZUUA 3LIZL 4DQOL 4G6MH 3TBVA 2GTZA 3INUL 1SVCP 4OLYH 1BJMA 4RMSA 4M3KB 4KRMB 4U3CA 3DROB 4RFOL 4JRYD 1T2JA 4LU5L 2EDNA 5JW3L 4WNQA 2ORBL 2VXTL 2VLKB 5GIRB 3F58L 4U33A 4NHCH 4NPYB 4OB5L 1S78C 5ALBH 4KK9D 1ZVHA 4LL9A 4M7LL 2VQUA 2XWBB 5DEGA 2XRAL 1G9MH 2K3TA 3X12A 2DL2A 2VE6B 3MJ7B 3FT4A 4XCYB 2ZCLH 5JHDE 4XWGL 2EYSA 5TQ0H 3JZ7A 1NGPH 3T1FB 5E2VH 4J7RA 2BNRD 4R26L 2DQDH 2FHBA 4PIRF 5I0DA 1YDPA 4TVSa 1ACZA 2R69L 3VFNB 4H25A 4XWOC 4X6DA 1KT2A 3VFGH 2N56A 2PW2B 1B3JA 5FO9A 3VRJB 5C9JB 5EULV 1EEYA 5DK2A 1SY6A 5SWSE 4L8DB 3NPSC 2YZ8A 4NQCA 3ZE2F 1KJ2B 2VXUL 3N9GL 4BSWA 4F7TB 4I77L 3QDJE 4TUOA 1F3RB 1HHHA 4Y19D 4LCCC 1QBLL 1NAMB 4M1GL 4O2EB 1U3YA 1HDMA 5L2JB 3VDBA 3DMMB 1FNEB 2ICWB 3QI9A 2NPLX 5E5UB 1UB5B 4LKXA 4X9HA 4QNPF 3LH2H 1KPUA 1IGFH 4Y4HC 3HRPA 3NAAH 2OL3L 3TA3A 1U8OA 5LQBL 2NNAA 1GC1H 2YD1A 4K3JL 2PUQT 4LLMA 1TQCB 1YN6B 1IAIL 3PWPA 2EH7H 2CIIB 4EI5C 4OZIA 2FNBA 2HJKA 4Y4FD 1OAUH 1E28A 4HXAH 3C5ZB 3RVUC 2VXSH 2Y7QA 1RUPL 3O0RH 5TDOB 3VE0A 1DFBL 4P3CL 4HV8A 5DD1L 1NANI 3UTPD 3BAEL 2FIRT 1B4JL 3K74B 1JN6B 4P5TC 2XICA 3VMPA 2VLKE 1KENH 3WXWL 5HPOA 1TZGH 3GJFB 5JDJA 3L3GB 3MA9L 1CU4H 2R39A 3LN4B 5F7EL 1V7NL 1I7ZB 1RZFL 3TZVA 4XP9H 3RJDA 5E8EB 1EFXB 3RPIA 5IP4A 1C16A 4UDUA 4V1DD 5JLZA 2C4XA 3VFUB 4YXHH 1H8NA 1I8IA 2IAND 4L29A 1KB9K 5HGAB 4JRYB 1L7IH 3IDJB 4LHUD 3C87A 5A16A 1H0DA 5KJRL 2BVYA 1U8KA 4NKMB 5B21A 3ULSA 4NJAH 3GKZA 3U36A 1BPVA 3MZGB 3MR9B 2LU4A 4XI5C 2JJWA 4XAWH 1JTPA 2XTLA 2OJEA 4FFYH 5IHBA 4P3WA 1OTUD 2E9JA 2Q8AH 4AIOA 2AJZA 1AY1H 1T0MB 4CVWA 1ND0A 5EH1A 3WDJA 1MQKL 3RIFF 4NM8H 3TF7C 4E0RB 2O93L 2BNRB 2YUZA 5F21B 5E2UL 1MI5A 1JWMB 1H9VA 1OT2A 4M8VA 2UY6A 3FO1A 4HHAB 4XCNA 5GXBB 1DCLA 1IKFH 5T5FL 3TNMB 5C0EA 3STZB 2H1PL 2VR5A 5KSBF 2DQHH 1ZOXA 3NVQA 4HG4K 3IXAA 1B90A 5IMKB 1S7UA 3BVNA 3CX5J 4XCFL 5DVKA 4KHXH 4NC0B 2B7DT 2WIIB 5SWZA 1Y18B 1NCCH 5DMKB 4OCXL 2HLFD 1NFDE 4WW1B 1BZ9A 2DD8L 5CD3A 3S98A 3KPSE 3KR3H 3MRRB 4HH9A 4PJHB 4CBPA 3TN0A 3F7YB 3MLZL 1F4XH 1T20A 4EOWH 1DSFL 1FNSL 1HKFA 1BJ1J 1KJMB 4HFWB 1XF1A 2GUOB 4I2XB 4N0YL 1UT9A 4B0MM 5INCB 3LCYA 3I75A 5CEZH 1NCAL 1QKZL 4HIIA 4LSTL 4OGAC 5T3XD 3S96B 4AL8L 3IF1A 5E2JA 1PKQA 4GRLC 5DMYA 2AXJA 4XZUA 5FA3B 3L5IA 3QNYA 1QBMH 4XCCH 5AYQA 1FYTA 3FT3B 3U30B 2YKLH 4PRID 4X83A 5GS0D 4Y4FB 4QRTB 1KPVB 3ARDA 1WTGT 4I3SH 4H20H 3D9AL 4JAMB 3DETD 5B39G 4X4XA 3MSPA 1DUZB 1YEFL 1KIUA 3CFJB 4RMRA 5HPMB 4JRYE 5HDLA 5MERA 4KUZH 1E4XL 2PYFA 5HGHB 3HMXL 4Y1AA 4FMFA 4YUEL 3EUUA 2C26A 1LD9A 2A77L 2AV1A 1H3WM 3HE7A 3MYZA 4EN3B 5DVMA 3GIZH 5DJZB 3VW3H 2NCMA 3L5XH 4NGHH 4HUUA 3VI3E 3GDBA 5DTFB 4G9DB 2O5YL 4PTUB 1J0HA 3MXVL 4ZAKC 1OY3B 4CNIA 4V1DB 5KSUA 4M1DL 4UTBH 4JY6A 2CH8A 2IANB 2BNRE 2CRZA 4XXCC 4PJIB 1CDHA 3MLSL 5I1CL 2X89D 3O3BB 4H8WH 5IBUG 4M48L 4XNZC 2HFTA 4LHUB 1WBYA 3VFTB 2D7NA 3ARGD 3EYSH 3QIUA 2AEPL 1IC7H 1UWGH 3L3JB 1T1XB 3W11D 5DQ9B 5AG8A 3MLXL 1LEGA 1UXSA 3ZT5A 1RV6X 2CUIA 1KPRB 2KUTA 2G75B 3MA7A 1J12A 4OZHB 3QUZC 1S3KH 4OCNC 1QA9A 1QFOA 1TFHA 3DTXB 4Y19E 2ZUXA 5FYLL 1SYSB 5DR5H 3LKOB 4PJHE 3G08B 3QAZB 3BPOB 1S7SB 5DLML 1EAPB 3MCLL 3KAAA 4ZO9A 1LO4H 3NIDE 3MRIB 4BUHA 4H26A 5C0CB 1PBYA 5GHWH 2X40A 1H5BA 4P46A 5I1LB 5JW5B 1WV7T 4PJBA 5L88H 43CAB 2P49B 1J1XL 4ZUSA 1GPOL 2P5WD 2XIDA 5F8QC 3TNNA 4OQTH 3UX9B 2HJLA 5C09A 1G7QA 1NJ9B 3RUGB 5DJ2A 1GXEA 1YPZB 3KXFA 4R97C 4XX1G 1R6VA 3KPRB 4NP4L 3UTPE 5T1DH 1NKOA 2E7LA 4QXUH 4HQQL 2Q8BL 3TYGL 2NY5H 4BFIA 4PRBA 5D1XC 3DRQB 3J8F7 1VADA 2IPKB 2ADJA 2OL3A 5I71C 4ZODA 2BJMH 4RGMB 2DJSA 3F65A 1GGTA 5IW1B 3BN9C 1I1CA 3QRGL 4XHJD 2E3VA 3H3KA 5B8CB 3MO1B 1JGEA 4NNYB 3ZKMC 1I9IL 2BXYA 4V1DE 4XP4H 4Q9QH 1JWSB 3OSKA 3P4MB 3OKEB 1I9EA 3OZ9L 2IANE 4I5BA 2BRRH 2Z93A 2I24N 2R8SH 4CMMA 1G6RB 1IBGH 1LEIA 5I17A 4HJGB 2B1HH 1MJJA 1BIIB 4UTAH 1T6VN 3IU4H 1R3HA 1IRAY 4HG4J 4JKPH 1G0XA 4TVPL 1PX3A 3GBML 3T2NH 1XF5B 2CRYA 4LAQL 3OKDB 4KJWC 4M6OH 4G5ZL 2R29H 1NLDH 3GJFK 3S37L 1X44A 3JTSB 4M6NL 4K9EC 4J3WA 4AMKL 3O6ML 4LLVB 3LSOB 4HZAA 4MNHA 3KNBA 5AD0A 1P84J 1P9MC 4ONFH 1KCVH 1I1AA 1FFNB 5D8JL 3BKJL 5KOMC 1MCIA 3DV4A 4KAQH 4JG0H 2R1YB 4PJEA 1IGJA 3ARGB 3V4VH 4DWHA 4FFZH 2ZOLA 1I85A 2ITDB 2XY2A 4YDJA 5F1NB 3MRFA 3SQOH 1MFDH 1KLGB 2B1AL 5A3ID 5L2KD 2IAMA 2A73A 3E2HC 3KPPB 1IQDB 3RUGE 3Q5YA 5L9DH 1LMKA 2A83A 3AXLA 4LSPL 3VD9A 1YPZE 3QQ9C 3D2UA 1KIRA 2UUDH 3I9GL 4XBGB 2MOVA 5LGJB 4PB9L 4FQPA 32C2A 3PDOA 4P9HH 3MRHA 1NBYA 4PFEA 2R2EB 2MCPL 1AO7A 4HGWA 3L3OB 4XMLH 1FO0H 5T1LD 1HSBA 1K5NA 1DUYA 1KLFA 5ACMA 3UXFA 1B2WL 3LKNB 2VITB 3T0VA 3SY0B 1BFOB 4P2CG 5T3XE 1DQLL 3S36X 4U1SA 2DI8A 3QPQD 5ESAB 2ZSVA 4YDLC 1WWWX 3KYNA 3CH8A 3O6FB 4X6EA 4PRIE 3UZQA 2VAAA 1SHMA 3KDMB 3MUY1 5FHBL 1NEUA 4G8GD 3LHPH 1KEGL 2KKQA 1TJHL 1EEZA 5C70A 4G3YH 1CS6A 2ZPKH 3CSYB 5D1QA 4MGXA 3FOLA 1UQSB 2H8PA 1UB6A 4OBRA 2X4QA 4AH2B 1NEZG 3MBEC 5DVLA 2OSLB 4O58L 1AJ7L 3P0VH 1B0GA 1ADQH 3MCKB 5GS3A 4RBPH 2DM2A 5FOJA 4JZJC 4QLRA 4N90D 1IQWH 3IJYB 1BX2A 3WO4C 5EO9A 4QYOA 5CZVH 4KMTH 4Y5YC 4XNXH 4ONGL 5E7BA 4F9LC 3HMXA 5AAWA 4OD2A 1QO3B 3TT3H 3SKNB 2XPGA 1S7TA 4OLZL 3QCVL 2VL4A 5DSCA 2BMKA 2X4SB 4YR6B 3UYPA 1NUGA 1QSFB 1I1RA 2FJFB 5D2LF 4X4MA 1NKRA 4XP5L 5D70L 4R96A 1U6AH 2Z4QA 2LAGB 3QA3B 1U91B 4DN3H 5C08A 3UJIH 1XCTB 2F53B 3C8KA 2H2PC 3ULUC 1NLBH 4AG4H 1S9WA 2X1XR 4KI1A 1XCQB 4ZFZA 1PG7L 5ICZB 4PRHA 4OUUA 3PUCA 1DEEB 3AFLA 5DI8B 3VWJD 5IV2B 12E8H 4MNQD 3DI3B 2UZXB 4IRJC 2PW1B 5J11B 1X4ZA 3UJJL 1BMGA 1IL1A 1MY7A 3F5WB 5MEOB 5ESVA 4M6AA 2VIRA 1JPTH 5L2KB 2P5WE 5LVEA 2B4CC 4PV8B 1MAJA 3VD3A 5LAXA 1BBDH 1R3IH 2XA8L 2RQ8A 5F88B 3VXOB 5JHLH 3GSQB 3U7WH 1KELH 4HUWA 1MJ8L 3MROB 3C60D 3GSWA 3SPVB 1KEMH 4JKLA 3MJ8A 2D7TH 2XWTA 4JLRB 4D9QD 3B6SA 1W72L 3HTLX 4R4FL 4BH7B 1ES0B 5GRUL 5SX5K 4HLZH 2BOBA 1QNZH 2NX5D 3GO1L 2PXYC 1U8JA 5EZIH 3OTTA 5JA8B 3ULVL 1TETL 2NXYB 2VSCA 2Q1EA 4F7CA 3UBXG 4LLUB 4PBWD 4G8GB 4JR9H 4MB5A 4G6ML 5BV7H 3PDGA 2X4TA 1LGVA 4M7LT 4OLYL 4QTHA 3EDDA 1NCTA 4KK6C 3AC0A 1AC6A 5I76B 5J3HD 2Y5EA 4XH2A 1MSPA 3VXUA 5C0NC 3D0LB 5DZLA 1U2HA 2V5SA 4MB3A 1GGIH 4X0KA 5LGKA 5CAYB 3FRUB 4K8RC 1UWXK 2BERA 1S7WB 5ALBL 4Q2ZB 3AAZB 3ZE0F 1G7HB 1G9ML 4PJ9D 1H15B 1YC7A 4PJFA 4R9HA 3JWDL 2F53E 2ZCLL 2YPKA 2BVQB 1LP9B 1JIBA 4X6CA 5TQ0L 4OZFA 1NGPL 3C6SA 3JV4B 2HH0H 5E2VL 4IRSC 3RWDA 2DQDL 1IGMH 4YHOH 3QIBD 5DRZA 1WAAF 5ISZD 2VABB 4O51A 5I1DA 4HBQA 5FUOH 2V7HA 2ARJA 4N1CA 1MHPH 4GW1A 3CMGA 3VFGL 4XPGH 1QBAA 4BFEA 3HC0A 5CWSA 4GMTH 5FOBA 5DXWA 5L2KE 1MH5A 1LHZA 5JORB 1JF1A 4FQXC 4LNRA 4NFCA 4X9FA 3B2VH 3V0WH 5IOPB 4ZPTB 2PR4H 1N0LA 3LN5B 3V4UH 4MZ2A 2P8PA 4LRNH 3F6IA 3HPLA 1TZIA 1DANU 4GRMB 3LH2L 4YK4B 1IGFL 4GBXC 2NY2B 4E5XA 2W07A 1MHHA 3HZVB 1JGLH 5IMOA 4PP1D 1MCNA 1QQDA 3RU8H 5F1SA 1GC1L 4XVSL 5GRWA 1RHFA 2Y6SD 4UIKH 4XHQA 4D8PA 4N8VB 1XH3B 1K3IA 3WKMH 1JV5A 2EH7L 4G8GE 5D6DC 5JTWA 1Q0XL 2G2RA 5C0BD 5KVFH 3IT8D 2NR6C 5FO7B 3LKQB 3QDHA 4HXAL 5EFIB 2VXSL 2X2YA 3O0RL 1TTFA 4KRPD 5IB2A 3C60B 4PR5A 1CFVH 4JRXA 5ANMA 1TNNA 5FXCH 5DFWH 4YFEA 1U8PB 4I48A 5ENWB 4Y5VB 1A6ZB 1I7UB 3T0EA 1MCHA 3IXTB 2NX5B 5DJCA 1I9RH 1JF6A 4WO4A 1TZGL 1C5DB 3ILPB 1DL7H 5CP3H 5IVOA 3ZYZA 3KJ4B 3RNKB 4N90E 2DS4A 4XP9L 3H9HA 3RWJB 1QVOB 2RB8A 3IFLH 3RL1A 1CE6A 4PRPB 1J87A 4YXHL 5KAQG 4MAYA 3MLUH 4XBEH 3KS0J 4NZUH 3MUJA 4NN5B 3OKOB 4JFQB 1L7IL 1B0RB 1TJIH 2ZUVA 3GSNB 3I2CH 4KI5C 3U7AA 1CXLA 2A1WH 4Y88A 1KNOA 1JFQH 4U1MA 3Q1SH 1YC8A 4HFUH 3LS5H 4NJAL 2AJXL 4RFNB 1HNGA 4ZFFB 3PNWB 1G7LB 1TDQA 3SDXE 1FL3A 3OKMA 5JW4R 1WEJH 5L6YH 3LS4H 5IROC 4HKZA 4PJ9B 5FEBA 3OXSB 4FFYL 3FQXA 1ZGLA 2CUMA 2Q8AL 1M71A 3BGFB 3WE6B 1AY1L 3C5JA 3DIFA 1MCBA 3ELAT 4NM8L 3QBTB 5IESH 5H2BB 1CGSH 2EDLA 1SM3H 5C0GB 5LBSH 3SDCC 2Y9RT 2OMNA 1REIA 4MNQE 1Q9KB 1IKFL 2C1PA 5F3HA 5MEPB 4EUPH 2I9TA 1CD0A 2DQHL 3FO0H 1FV1A 4P57B 1G1YA 1N26A 4HWUA 1P7KA 3PHOB 5I73C 1WFNA 4KHXL 4PRNB 5IQ9A 4UU9B 3RVVD 5IGXH 4PG2A 4NBXB 1NCCL 3VD7A 5JXAH 3ULUF 2DBLL 2AJYH 3KR3L 3WS3A 4F15B 1J11A 3EZ8A 5CBEB 4N9OB 5DHVA 1RUMH 1FL6A 4GXUN 4EOWL 1NDGB 4K2UL 4D9QE 4DTGH 5IB3B 1BBJB 1F4AA 4PJDA 5FM5O 3ARBD 3S6CA 1YN7A 3T4AB 2CGRH 1E0OB 2NX5E 4HJ0C 2WANA 3FRPG 4ZXBC 5CEZL 1T6WA 3C09B 3RX7A 2QQLH 3SOBH 3VXNA 2UWEF 2YUWA 3DBXA 1QBML 4XCCL 1G84A 3EYUH 5GGRB 4HKXB 4Z7WA 4J8RA 1QTYT 4NT6B 3NFNB 5C0BB 1IGTA 1FNHA 4NO0D 2YKLL 3ARWA 2DQIH 4BUGA 4JREB 3QXUA 4I3SL 4H20L 2BC4A 4PD4K 4ZUVA 5I66A 4KRPB 5KVGH 1A6AB 5JR1H 1R3KB 3H7BA 3MUGB 4KUZL 4LDEB 2X6MA 3DGGA 1W72A 1WC7A 4RZCA 1IKNC 2L4OA 2MJWA 4YGVA 4KJYB 3IDIB 5IKCB 4KY1H 4Z7OF 2NY1C 2CK2A 3GIZL 3VW3L 2H6PA 2LU7A 3MRNB 3L5XL 3HG1D 4NGHL 4NQDA 3I3BA 4PG9A 3ZSSA 3L7EB 1EGJH 5E56A 2V2XB 3VXPA 3QEUB 2YD5A 4XPBL 3L6FB 4UTBL 2B2XH 4FXKB 3CFDA 1OW0A 4DKAA 2MKWA 5CCKH 4X5XB 3CVIH 2DLHA 2FHCA 4H8WL 4WWKB 1E4KA 1F4HA 4XP6L 1CTNA 2NY4C 1AGCA 3AREC 4YH6A 3QUYA 2E8YA 3EYSL 4WENB 1G7PA 5C86A 2EIZB 1IC7L 1UWGL 3MRCA 5IVXF 4X6BB 2HLAA 3WEXB 1T1WB 2X1PA 1S3KL 5DJ6A 5FF6A 3T65B 5DR5L 1SMOA 3B2UD 4A6YH 1GVIA 4KTDH 5CZXC 2ZG2A 3TCLA 3Q3GA 2OMBA 1YMMB 1HSAB 4WV1B 1AXTH 1RJZA 4GQ9H 3FZUC 5GHWL 3DVGB 1I75A 4GLRH 4YZFE 3EJJX 5EUKB 4U6XB 5L88L 3CX2A 4JQXA 3TVMA 1ZVSA 3U9UA 5ADPH 1XT5A 3ALWA 1LK2B 5D9SB 5BZWB 4PJ8D 5IR1A 3NCYS 5HYEA 5C0BE 1UJ3B 4H88H 1K2DB 4OQTL 3VWKC 2HFEA 2A6KB 1J88A 2R56H 2ZJSL 3B9KA 1KTDB 2NZIA 4OIAA 1EDQA 5T1DL 1U8QA 1JYNA 1RZ8A 4QXUL 4LCWA 5FUCC 3ARBB 2AQ1A 1JVKA 1T3FB 2R0ZL 4OM1H 3QNZA 3PWJA 4LASH 1PYWA 1D6EB 5F9WB 1AHWC 1UXWA 2BJML 4NSKA 3RRQA 1BD2D 3NZ8A 5CSZA 3WD5H 1FIGL 5BQ7B 2FSEB 2FX9H 3DUUA 3IDYC 1LEKA 5E6IA 3DSNA 3V6ZA 4DJMA 5DC9B 2BHZA 4M61A 4XP4L 5E4IA 4U1IB 5C6WH 4Q9QL 4BFBD 4KV5E 3SE3A 4KC3B 4NZJA 2BRRL 2R8SL 4UILL 2PTUA 1OSPH 1ETZA 2I25N 4JB9H 5I8CA 4HIHB 1FC1A 3BP6A 3D3VD 3BW9B 1JP5A 4QRQB 2B1HL 5IBLC 1UM5H 4UTAL 5IM7A 1EHLH 1HXMA 5HVHB 3T2NL 3GMPA 5BS0A 1PFCA 4LLDB 1JRHH 1B6UA 2B8OT 4EDXB 1RIHH 3VFMA 4M6OL 2R29L 4PBXA 1NLDL 5DJ0A 2HA1A 1BP3B 1LP9F 4JFHD 3ILQD 2BVPA 3MV9B 3GSVB 4S1QL 3CFBB 4K71C 4Y2DB 4S2SA 3B4NA 4NN6B 4UINH 1HQ4A 3G6DH 4ONFL 1KCVL 3BZ4A 1WLHA 1X7QA 2EO1A 4NRYB 2ZCKL 5D5MF 3TJHC 5HJ3B 4Y7MA 2GK2A 4KAQL 1NCDH 4JG0L 1I7RB 1LO3H 4OFYA 4U3XA 4U1HB 4L8BB 4LF3A 3V4VL 2F74A 4FFZL 2H3NB 2BY1A 3NCEB 1BJ8A 1P4BH 3C5SB 1R5WA 4KKNA 4H1LB 4GUPA 3D85D 1UH2A 1MFDL 2HT3D 4AYFA 2DJUA 1HXYA 4O00A 5L9DL 4LCUA 3T4YB 1RZJH 4R4NC 4ZO8A 5EZJA 1HQRA 2W60B 1JK8B 4P2RA 4QHUB 4P9HL 2W1NA 2DJ4A 4QY8A 2DYPD 5EC1A 4DK3A 5EU3B 5HDOA 3TA3D 4XMLL 1FO0L 4JDVA 2AXGA 2GITB 3DYPA 3QXTA 5D7LA 3GMQA 3S8WA 3PWPD 1JL8A 1ZWIB 4OLVH 4GW5B 1TVBB 2FZ3A 4DUWA 5EZOH 1B4RA 3WFEL 2W0LA 4WI2A 1E27A 4QRPA 5C0IB 5EO0B 2DKMA 43C9B 4HS6B 4J1UB 3K2UH 5FKPB 1F13A 2H32H 4QKXB 4RMVA 3ULUH 5BZDB 5D6CB 2OS7A 1KCKA 3NH7H 2X09A 3LHPL 1INEH 3Q6FB 4IIQC 1YQVL 3W5NA 3ARYA 2CDFB 3X3GH 3LKRA 2YC1B 4XMPH 4G3YL 2ZPKL 3LRSA 4I18A 3U6RB 1OT1A 5B3JF 4B41A 4Y16D 2E8ZA 4HWBL 3E6HB 1GYAA 4LP5A 4MD0A 2P5ED 3LV3B 2QSVA 1BD2B 3P0VL 1ADQL 3TPUA 2HTLD 4OKVA 3HG1E 4MD5A 1KUMA 5DUMH 3TBVB 1LO0H 2X4UA 2B4CH 4OFDA 3LQZA 2V2WB 4Z0BH 2JTDA 1IQWL 4JM2C 3QQ4B 3PP3K 3GBNL 3DX7B 3A6CH 5CZVL 3PGCA 4KMTL 3V6OE 4XNXL 2P7TA 4WNQB 1U8IA 3P2TA 3MODL 1FZOA 2WV3A 2EDQA 3SKOA 5DEGB 3VG9B 4B5EA 3CC5A 3H0TB 4LSVH 3SDAA 5HYFA 4TNWK 3WUWG 3X12B 2E5EA 3FT4B 1EIBA 4S1SH 2EYSB 1U6AL 4UI2A 5BOZG 4DN3L 3R8BB 3UJIL 1LE9A 1MI5D 1O7SA 4M9OA 3PXHA 1NLBL 4AG4L 5FCSH 2P44B 4JVUA 4L3CA 4H25B 4MVBC 4TULH 4X6DB 1KT2B 4NKDA 4NC1E 1J0KA 5FO9B 3HA0A 3PE9A 2NQCA 1ZK9A 4XXDB 1H8OA 5DK2B 3GFUA 3QUXC 4MA8H 3RX5A 12E8L 5A2LH 4FQQA 3MRKB 1RQ5A 2BNQA 4NQCB 1NCBH 2YMXH 1WGOA 5IJKA 4ZPVA 1QRND 3OQ3B 4BSWB 1BWMA 4OFIA 4HZLB 4HW6A 4LRIA 4TUOB 1HHHB 1JPTL 2Z91A 1SVZA 3M17A 1CXHA 1HDMB 3DYOA 3TN0D 4UMGA 3QI9B 1BBDL 1R3IL 5I75B 1FGNH 3MGTA 1PG7X 3IGAA 4LKXB 3HRZA 5HYSA 1KPUB 5IG7A 4N0FA 3X11B 5JHLL 4PJAF 5EWIH 3U7WL 3V9FA 1KELL 3WNMA 2DYPB 2VL5A 1HYRC 1AXIB 1KEML 1U8OB 2G60H 3TA3B 2NNAB 2D7TL 1RJLA 1I8MB 3LAFA 4KQ4H 4LLMB 5KZCD 1K8DA 3PWPB 1QNZL 1BD2E 4OZIB 1N0XH 1Y6MR 2MFNA 2HJKB 3REWA 1KGCD 2IPUK 3DMMC 1JZ8A 1TITA 5EZIL 1E28B 3V5DA 3TO2A 1CL7H 4HWEH 4WHYG 5BRZA 5F7WC 4OQTA 4R4BA 4RGOH 4HV8B 4JR9L 3TO4A 4EZMA 1A7BA 1P5UA 4BK4A 3I6GA 3V5KA 3DJ9A 4MQXC 4LSSH 4PGCA 3HE7D 3D3VE 2OXGA 4HGMA 2P5EB 3C5ZC 1N64H 1BFVH 4QRUA 2L7UA 1GGIL 3LOWA 3OX8A 5GRZA 5J9PA 3RPIB 1C16B 2GJ6D 3LKPB 3PHQA 3VGEA 1WIOA 4HIXH 4UDUB 2VLRA 3L5HA 5JLZB 1I8IB 3G6JF 4IEFB 4JFHE 2OK0H 3EAKA 3HS0A 3FOMA 4M7JH 2Y1VA 4X6DE 2HH0L 5A16B 1H0DB 4DGVH 5T3ZD 3FN9A 3QIUD 1IGML 1U8KB 1L6ZA 3ULSB 4YHOL 1Z9MA 3TBTA 4HULB 2IQAA 5FUOL 1MHPL 2R9HD 4XPGL 1OAZH 3VU2A 4ORZC 1E4WH 4LKCA 4GMTL 2AJZB 5JIHA 3GMOA 1ND0B 2XKUA 4DGYH 4XC1L 4FQIH 4WUKH 4GT7A 1WFTA 3I02A 4JFPB 4U1NA 1MI5B 2FIKA 3TH2T 3S35H 1T7YA 2W59A 3BOVA 3MRBA 3ALPA 4W70A 3FO1B 3TBYA 4M62H 4XCNB 1CGTA 3V0WL 3B2VL 2XY1A 7CGTA 2PR4L 4P46D 4KK9C 3V4UL 3CFEA 4FP8L 1CLOH 5B38A 4IOIA 1LVEA 3IXAB 3O3EA 1S7UB 3BVNB 3EJYD 2VQ1A 2MNUA 4BZ2H 1MCWM 3PWPE 4FQHB 4GS7C 4OZIE 1JGLL 3C08H 4Z7QF 2P8MA 1A21A 3UO1H 3RU8L 1BZ9B 4Z18A 4YDVA 5CD3B 4UIKL 4HH9B 5E03A 1BOYA 3UDWA 3VRLE 4QOKD 4O4YH 4UBDD 3TN0B 5KVFL 1T20B 3G9AB 2FX7H 2XACC 3MXWL 4RRPG 1Q9WA 2XYCA 5F7DA 1CFVL 3H3BC 3I75B 5E6ZA 1JZ4A 1FO0A 4HIIB 2EDTA 3IF1B 3RBGA 1PKQB 4ZUUA 2P5EE 5KZCB 2BX5A 3QNYB 5KSBA 4BJLA 1FYTB 5K9OB 1I9RL 4WFHD 5AYUH 3ARDB 1DL7L 3TH4T 1TMCB 4X4XB 1T1YA 1I1FA 5KTEH 4NCC1 2ZUTA 4BQ6A 5MERB 5GGVH 1S9XB 2VERN 4YHIA 1FJ1A 2PYFB 3MV7A 4Y1AB 2W65A 1EEUA 4BELD 3IFLL 5BCAA 1LD9B 3KYOA 2FECL 3MLUL 4XBEL 4NZUL 3P0GB 3HE7B 2W92A 1OQXA 1TJIL 3QG7H 3I2CL 4Y4FC 4X9GA 3EOAA 4HUUB 2A1WL 1JFQL 1GAFL 5J13B 1ADQA 3Q1SL 1HE7A 3QHFL 1AR2A 2DMKA 4HFUL 4L4TD 4CNIB 5KSUB 1OLZA 2VWEE 5ALCL 3MLYH 4JY6B 1WEJL 4DVBB 3LS4L 5L6YL 4WTZG 4OCLC 4JM2F 2IPTH 1MI5E 3SE8H 5C07D 3UTSD 1WBYB 4NQEA 5SX4H 2Y06H 4DCQA 5IESL 3QIUB 1CGSL 1SM3L 2R4SH 2HYMA 5LBSL 4X9IA 1DQDH 1LEGB 1UXSB 1BJ1H 1YNKH 1MIMH 4UV7H 1PEZA 2IAMD 3MA7B 1J05A 4ODUA 2EXWD 1ZLVK 3FO0L 1QRNE 1QA9B 4QRRD 3D2UD 2OTUB 2BHYA 5HI3D 5IGXL 3NPZB 5ECJE 1I9JH 1GH7A 1EXUA 3W9EA 5E7FA 5JXAL 1AO7D 4PJXB 3NCJL 4H26B 2HFGL 2AJYL 4P46B 3BWUC 1A7QL 5E2WH 3RNQA 4PJBB 5IW6A 1RUML 3RA7H 4DTGL 1OTUC 1PKQE 2FEDD 1YY8A 4XGZA 4ZUSB 3L5WA 2CGRL 1MFEH 4NYLA 2D31B 2VISA 2OX5A 2J6EH 3IAPA 3OKLA 3QAZC 1KGCE 1RJYA 2YXFA 3TNNB 2HJLB 5C09B 1G7QB 5DJ2B 1ZHBA 2QQLL 3SOBL 4WIQA 3EYUL 3BDYH 1JHTB 4UQ3A 3Q6GH 2DQIL 5FUZH 5D1QD 1RUKH 4TUKL 3THMH 3RGVA 4BFIB 2P47B 4PRBB 3VFOA 1VADB 5KVGL 2ERJC 2ADJB 2OL3B 4DFIA 2WBJA 4Z78A 5JR1L 1ZHKB 3KPMB 3FHQA 3QJHB 4WHDA 1JI1A 4RX4D 2Q6WB 1UCTA 3SE4C 4MXQC 3VFRA 5DRNA 3JV5A 1PG7W 2GJ6E 2HP4A 1AD0A 1JGEB 3GB7A 3UAJD 1OSZA 4F9PC 4JFDA 2JJSC 5JUEL 2FGWH 3OPZH 5JXEA 2A74A 4OGYL 4I5BB 3S4SA 1S5IH 4AQOA 2RAMA 4NKOA 4CMMB 4LCCA 1LEIB 2Z8VC 5I17B 1EPFA 2B2XL 1MJJB 4J3VA 5T3ZE 1P4LB 1R3HB 3X14A 4P99A 5B8CC 1A5FH 3I84A 3NA9H 5GS0C 1D6VH 2AERT 3IKKA 1NFDF 1MEXL 5HSFA 5HHNA 3DETC 1G9NC 1XGTA 1JI2A 2CXKA 3U0WL 3UYOD 3GBLA 1HHKA 3AB0B 3K2MC 4YBLB 3WJJA 1OCWH 4EI5A 5BVJA 3P30L 3KNBB 2QQQA 4PJGF 4J3TA 5AD0B 4HSQA 1BQLH 4NRXA 1I1AB 5C3LD 5AZEH 4PJXE 3CU1A 3DV4B 1DBKH 1S8DB 3W9DA 5I15H 3RQ3A 4PJEB 1IGJB 1MJUH 3CVHH 4PJBE 4A6YL 4Z76A 2YBRA 4CN1A 5FYJH 4KTDL 5IK3A 1X5LA 4YDJB 1AXTL 3MRFB 3LVEA 4GQ9L 1WQVT 3BT2H 4WWID 2IAMB 2QJDA 3N1GC 3MCG1 2A73B 1TIUA 3UCRA 1P5VA 4QRRB 4U49A 4X8JA 2A83B 5JQHC 4NO5A 3AXLB 4RAVA 3D2UB 1KIRB 4QOKE 1G7MA 1CFSA 4KJPD 3PDOB 4LFHD 3MRHB 1B0WA 1NBYB 4H0IA 3ZDYE 3ARGC 3BISA 4WFED 1AO7B 4K9EL 3NIGF 4HGWB 3W11C 4JFEA 4F57H 1A7NH 1HSBB 1K5NB 1DUYB 2R56L 2WWKO 4LVNC 4BQ8A 4U1SB 1UM6H 2ZSVB 4OM1L 3OAYK 2IBBA 4L3EA 3KYNB 4GJTB 4LASL 4WFHE 4X6EB 3RZWA 2WP3T 3K8MA 3WD5L 1EEZB 2FX9L 4YIQA 1Y6KR 5EIQA 4OT1L 2R2BA 1HNFA 1BGXH 1VFMA 5D1QB 3PXJA 5F3BA 2NW2A 2F15A 3FOLB 3FQTA 5DJAA 5EZLA 3QO0A 2H8PB 1UB6B 5I1EH 2X4QB 3O9WD 3FQUA 1IGYA 2DQFA 3MREA 1OSPL 3H9SD 2VR4A 4PGDA 1B0GB 4UB0L 3V8CA 4JB9L 1OP3K 2BSED 1QLRA 1WSST 3GMLA 1XIWA 5I1KH 1XGQA 4P2QA 1ACYH 2DN7A 1UM5L 3R1GL 1O7VA 4PJ5A 2VYRE 4L4TE 5CP3A 1BX2B 2B20A 5DVNA 5EO9B 4QYOB 1HOCA 4KWUA 1OP5K 1EHLL 1M1SA 4TNVK 2DQTH 1QSED 1JRHL 2VH5H 3PGDA 1W0VA 1RIHL 4H0HB 4K23H 4JQVC 5C07E 4NOBA 1CFQA 5DJXA 5IB4A 4O2FA 4OD2B 3UTSE 5KS9B 4PJEE 2KQMA 1I8KA 2XPGB 3ZE1F 1ZLWH 1S7TB 4CMHB 4UINL 4XNMA 4XHJC 2Q86B 1OWRM 2J8UE 4U6VH 2BMKB 5GGQH 5JOFA 1I7TA 3MLTA 1FG9C 4L4VD 1NCDL 1NC4A 2K7QA 3BD4A 4NOFA 3RDTA 3K1KC 3O3DB 4R96B 3VGGA 2Z4QB 4JN2A 3HNSH 4QRRE 1ZLUK 1P4BL 5C08B 4ZYKB 5JMRA 3C8KB 4Y8AA 3VFWA 1XGPA 3D5OF 1CDBA 1S9WB 4C83A 4ZFZB 2VXQH 4M6ML 3WFCH 4PRHB 1AO7E 1KTLA 2WQRA 2AQ3A 4OUUB 4JRWA 1KB5H 2JCCA 1RZJL 2J7LA 1S7QA 3B8YA 2ICCA 3HCVA 3JVGC 4APQA 5A1AA 3N85H 1XEDA 3GEWB 4S1DD 4ZDHA 1UKTA 1MAKA 2I5YL 1IL1B 3VGFA 1PAMA 1X4XA 4EUPA 3U0TA 5ESVB 2IBZY 2VIRB 5MHSD 1OF2A 4L4JA 1NSNH 1ZHLA 5D2LA 4OLVL 5LAXB 5TDPB 3L3KA 2WW8A 5EZOL 2IWGA 2R0LH 5CGTA 3K8LA 3K2UL 4HUWB 3GSWB 4XXCA 3ULUL 4JRXD 2AK4D 5J11C 4G8IA 1R3LA 2XWTB 3NH7L 3GM0A 1INEL 3B6SB 1G6VK 3X3GL 4P4KD 5DRWB 4XMPL 5A3IC 1ZS8A 4AENA 3ET9F 2BOBB 4QGYA 3RJQB 4UIMB 4WO4D 5H8DA 1U8JB 3QEQD 3MV01 1T04A 5HD8D 4J3UA 3MLVH 3WNNA 4F7CB 4TUJA 4B7IA 4RSVA 1ZT1A 3HZMA 2YPLA 4LSRH 5DUML 4P59H 3UTQA 2B4CL 2X4TB 4QTHB 4N68A 4Z0BL 4POYA 4LIQH 2ZOKA 3PABB 4MAYD 3BYTA 5KS9E 4LCYB 3A6CL 4YHYB 3VXUB 3QPQC 4JPVH 1KCRH 3SKMA 4X0KB 5LGHL 2ESVA 5FV1L 4G9FD 3BXNA 3VG0H 5E8OA 2FWOA 2YUVA 4LSVL 4PJFB 2MWCA 4M4RA 4TRPH 3TP4A 3BP4A 4IMKA 5MENA 2YPKB 1BAFH 3EOBA 4S1SL 4X6CB 4OZFB 3C6SB 3STLA 4KJWD 1CGVA 5DK0A 2ICEA 4L8CA 3RWDB 4ZFGH 5DRZB 3PL6D 3W2DH 4AJ0A 4O51B 5I1DB 2ZUSA 2V7HB 1VEPA 2ARJB 4N0UA 4TULL 2YRZA 4GW1B 3ARTA 4QGTA 3Q5TA 2IFGA 5GRVK 3HC0B 3P9MA 2VUOA 3JWOC 4L4VB 5AEAA 5FOBB 4ODHL 4MA8L 3QR2A 1JF1B 4K8RL 1NCBL 2YMXL 3MTRA 1FC2D 2DMCA 2JB5L 4KVNL 1X5GA 4NWUH 4WFEE 4YE4H 2P8PB 1AGBA 1KTRL 3GJFH 4GH7B 1FGNL 3HPLB 1TZIB 3FN0H 4PV9A 1UM4H 4ODTH 2VDLH 4A6YA 4I0CC 4D3CH 4NQXA 4E5XB 1FRGH 1MHHB 3EO9H 4KKBD 5IMOB 2AKRA 3AROA 1WAAA 2NY6D 3IU3A 2G60L 1QQDB 4UNVA 4JO3H 1UVQA 4KQ4L 5GPRA 4D8PB 1D5ZA 4H1LG 1JV5B 4YWGL 1MWAB 1N0XL 2G2RB 1MRDH 4WW2F 1W0WB 1CL7L 3VWJC 2OI9C 4YK4C 1TQBB 4RGOL 4JQIH 4JRXB 2P24A 5ANMB 1YMHA 4NO2A 3NTCH 5JNYA 4HIJA 4I48B 3T0EB 3S36H 2IJ0C 4WI4A 1GIGH 5DJCB 4LSSL 5DYOB 4WO4B 4POZD 4V2BA 3RAJH 1CF8H 3O2VH 2RBLA 3H3PH 1EJOH 5CEYB 1N64L 1BFVL 3MBED 4PJFE 3H9HB 3MC0A 4EEEA 1RZGA 3C60C 3IVKA 3QDMD 5IIEA 1QSEE 3KLHD 3RL1B 1CE6B 3OF6D 4MLSA 2ED7A 4E41A 4EVNA 2NYYD 4Y5VC 4XB7A 4MAYB 2Y5TA 4GXVH 1BEYH 5B22A 2OK0L 3T0XA 3S97C 4JZNA 4LMQI 5L8KB 3AGVA 1WCQA 2JLLA 3ARZA 4M7JL 3KJ4C 1KNOB 4DGVL 4U1MB 1T21B 1A8JH 4G9FB 4L4VE 2WQ8A 3EFDH 1FL3B 3OKMB 1RMFH 2FECI 4HKZB 1FLRH 4GRWB 3K4AA 3FQXB 5HI4D 5J3HC 1E4WL 1M71B 3WFZA 3BQUA 5FK9A 4YPGA 4DGYL 2XKNA 1A2YA 3C5JB 3DIFB 1EH9A 4FQIL 4WUKL 5J8OA 5F1KC 5C92A 3S5LG 4HLJA 4HWZA 4P3DA 5CEXA 3DX9A 4Z95H 3S35L