4X9DA

High-resolution structure of hfq from methanococcus jannaschii in complex with ump
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'NFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ1435
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
total genus 10
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x9dA00
3JCMe 4EMKB 2DZ9A 4OP0A 1WQWA 1HXDA 2YHTA 4M77E 3JCMP 3JB9J 3V8KA 1YCYA 4C92B 2EJGA 4M75A 4C8QC 5GAMe 1WNLA 4F7UG 5GMKi 5GAN4 5GAOp 5GAOr 1MGQA 3JB9G 4MMLA 4M77F 4PNOA 3L2ZA 3SWNA 3V7SA 3JCMb 4EMHA 5GAN2 3L1AA 5GAN7 3JB9I 4M75G 4JLIA 4F7UB 3BW1A 2FB7A 4RCBA 4A54A 5LJ5f 4M77C 1BIBA 4X9CA 4M7AE 1H641 4A53A 5GAN6 5LJ3j 4C8QD 2RB6A 1U1SA 2EAYA 2DEQA 4M75B 4XU1A 5LJ3g 4JRKA 5GAN5 2DXTA 4JUVA 1KQ2A 4M7AF 1Y96B 4C8QA 5LJ5d 3QSUA 3SB2A 3SWNB 3VU3C 3RKWA 4XQ3A 5I21A 4WF2A 2DJZA 2E41A 3GIBA 4PJOA 5GAN3 4M78C 2E65A 1WQ7A 2E10A 4XTYA 1LOJA 4J6YA 4M77D 5GAOm 3RIRA 4C8QG 4M7DC 3BFMA 4JRIA 4N0AC 3INZA 4Y91A 2VC8A 4PJOG 1N9SA 1D3BA 4M77A 4RCCA 4C92E 5LJ3e 5LJ5j 2EWNA 4C8QB 5LJ5g 1JBMA 1U1TA 4NL2A 4XTZA 3JCMf 3JCMc 3RKXA 3AHUA 4PJOB 4M78D 5LJ5h 1HK9A 5GAMf 4V2SA 3HFOA 4F7UE 4M7DD 2K57A 1KQ1A 2QTXA 4M78A 4XTVA 3JCMd 4NL3A 1D3BB 2ZGWA 4F7UF 3JB9F 4M7DA 4M75E 3QO3A 4N0AA 5GANh 5GANf 3JCMV 5GAN8 3QUIA 2EJFA 2RD1A 4M78G 3HFNA 2DVEA 5LJ5e 4M75F 2JN0A 4M7AC 4M7DG 2FYKA 3BDUA 3RUXA 5GANd 2DZCA 1B34A 2VXEA 5DY9A 5GMKl 4M78B 2CGHA 2RA2A 3RKYA 5GMKh 3JB9H 2HNIA 4M75C 5GMKm 4M7DB 3JCMW 3V7CA 4XU3A 2E1HA 4EMGA 2EJ9A 3JCMh 2Y90A 3HSBA 1N9RA 4XTXA 2VXFA 3V8JA 4C92F 4M75D 4X9DA 4C8QE 4QVDA 2E64A 3FIFA 2DTHA 4M77G 4M7AD 5GAMh 2RM4A 1WPYA 4XTUA 5GANj 3FB9A 4PJOE 2DTIA 4J6WA 5LJ3f 4DQ2A 4EMKC 1B34B 5GANg 1LNXA 4HT8A 4M7AA 4C92C 4M77B 4PJOF 3FJPA 5GAMd 3V8LA 1X01A 5LJ3d 4J6XA 3PGGA 3RESA 4QVCA 4J5YA 2I2LA 4M7AG 1M8VA 5GMKj 4NOYA 5CAIA 4PJOC 1Y96A 4XU0A 1I4K1 3QHSA 3EFSA 3JCMJ 2YLBA 2YLCA 5GAOn 1TH7A 1I81A 1JRIA 4M7AB 3JCMg 2DKGA 4C92D 5GANe 5GAMj 4M78E 4EMKA 1I5LA 5GAMg 2DTOA 4C92A 1LJOA 5GAOq 4M7DE 3SWNC 1M5Q1 2DXUA 4XTWA 4M78F 4XU2A 4MMKA 3V7RA 3JCMQ 3JB9D 4PJOD 4HT9A 3RERA 4HA8A 4M7DF 1I8FA 3JCMX 5LJ3h 4C8QF 3BY7A 5GMKe 4C92G 3EFRA 4F7UA 5GAOl 3M4GA 1BIAA
chains in the Genus database with same CATH superfamily
4LDWA 2DZ9A 1WQWA 3JCMP 4C8QC 2X4WA 1Y07A 1FX7A 1QKWA 1PCXA 1JJ2P 2COYA 2GFAA 3CD6T 2XDDA 3WVDB 2KR3A 2ZPFB 3L1AA 2JT4A 4C5HA 5D7UA 1VIEA 4A54A 1WGSA 3NFCA 4FCYA 2CH4W 2LVMA 1WI7A 2P0PA 1OPLA 3SB2A 3NGPA 4C0DC 1WQ7A 2KGTA 1JEGA 2JOYA 5CKBA 4PJOG 1VQ5A 3X25B 5KYYB 4C8QB 1IZ6A 3VYGA 5CKEA 3ULRB 3CCEQ 4M7DD 2K57A 1VQMT 2KT1A 1T0JA 2R5AA 4C0ZA 4N0AA 1UDLA 4KH1B 1O75A 1IREB 3VRYA 1K73R 2MAMA 4IURA 3HFNA 3JSCA 1JXMA 3KBGA 4O5VA 4M7DG 2HKNA 4RTVA 1EIFA 2CYZB 1HSQA 2PVDB 2B8AA 3X28B 2ECZA 2LC4A 2A36A 3JCMh 4XTXA 3V8JA 3C95A 4QT7A 2DTHA 2MMPA 3H0FA 2GFUA 1WPYA 3DB3A 3X26B 2X4JA 2X4XA 1VQ5Q 3S3OA 5GAMd 2JVVA 4JRPA 3CPFA 1M90R 5CAIA 1RL2A 1YFNA 2E3IA 1HJDA 1M2VA 1TH7A 1TTHB 1Z9QA 3CCET 2DILA 3EG0A 5J26A 2YUPA 2DERA 4A4HA 2RK2A 1IHWA 3VYHB 3BY7A 2RHUA 4BY6C 1JB0E 1BCOA 1ZSZA 3E2UA 4M77E 4F7UG 1RABB 3G6EA 1P92A 3HTRA 3MEAA 2MCNA 4M77F 1I5OB 1XTDA 2YDLA 3CCSA 3BW1A 1Q82C 4E7SA 4M7AE 3UDCA 2A28A 3I35A 1VQ5T 2K6DA 1KQ2A 4M7AF 4YTLA 2NLUA 4LN2A 2AHJB 2E10A 5KYWA 2MIOA 4IIMA 2E70A 4BDYA 3RMSA 5M9OA 4M77A 4JJDA 4FYYB 1MNDA 2EW3A 3REBB 4LNPA 2VKNA 2KRMA 3UPUA 3MP6A 2LJ1A 3SD4A 1NM7A 2OI3A 3M0TA 2Z0WA 2ZGWA 1UHCA 2R5MA 3G6EQ 1G3TA 2HDAA 4L6V5 3CCSQ 3H0HA 1M27C 1GCQC 2WSEE 2DYBA 1Q86C 3M54A 1HYOA 1TUGB 2JM8A 3JB9H 4FU6A 1XJWB 3C0CA 2DFUA 2C0TA 2LCSA 4J6WA 5GJVB 2RJEA 4R56A 3UATA 5IAYA 2KXDA 3PGGA 2X4YA 4NOYA 2J06A 2K5FA 2Y4YA 3GOXA 2YUNA 1Q7YR 1VQ9A 2ROTA 1QQJA 1PC0A 2I0NA 4CRIA 1OPKA 1QMCA 3CCMA 2K9GA 1VQ6A 4HA8A 3MO8A 1EX4A 4B9WA 2RHXA 4AFZC 2JS0A 3RESA 1AHJB 2V8KA 5IXFA 2KSSA 2FRWA 1ZUYA 3C12A 1X2QA 4ORZA 1Q81C 3SWNA 2DIQA 1PHTA 3URGA 1H641 3MP1A 3QJYA 2DL4A 3CXCA 2RH2A 1JU5C 3TVTA 1MMGA 1ZSGA 1SKUB 2YRCA 3OBYA 2CP3A 3RKWA 3EG9A 5I21A 4KGXB 1KQSP 1G3WA 4J6YA 2LQWA 3CCUA 1SHGA 3EG3A 2VC8A 1NPRA 1NG2A 4IUVA 4XK8E 3RR6A 4C92E 2HZYA 4BE0A 6AT1B 3CCMQ 3CXCS 1VQ6Q 2F5KA 2QG9B 5CQYA 4HKEA 3GPLA 3VS4A 1HK9A 1V29B 2FPFA 1D0YA 4M78A 2BZYA 3JB9F 2JTEA 3VS0A 5GANh 1H3ZA 3C4SA 2EBPA 3IQLA 1VOMA 2K2MA 2M51A 1OI1A 2GQVA 1M1KR 1OYXA 3V7CA 5IN1A 1N9RA 3OYLA 2AKKA 3QZ5B 4QVDA 3S6WA 4EMKC 2XG8D 2FL7A 3CCUQ 1PD1A 3LGLA 4HT8A 2EQIA 2O01E 3FJPA 2C06A 4RTYA 4ELZC 2I2LA 2PVGB 4RG2A 3OY9A 1OU9A 3G71A 1Y96A 2MK5A 3TSZA 1YITA 5GAMj 1KC8U 1E7OA 1VQKT 4GLKA 4OMLA 1TU0B 4QVZA 5KYXA 1QWFA 4IUUA 5IHKA 1OOTA 2O9VA 5LJ3h 2P0KA 1TWBA 4BD3A 3N5BB 1QVFA 1KSWA 1QCOA 4EMKB 1NYFA 4J7IA 1NJIR 1N8RU 3CMEQ 3KFVA 2ZPIB 2CH4A 2QDYB 5GAN2 2DRKA 2BE7D 3THKA 1N6AA 4LXCA 1JQQA 2JZ2A 3NTKA 5GAN6 3CCUT 2OX7A 2JS2A 1QVFS 2DXTA 4RTZA 3O8VA 3G71Q 2OAUA 2JTFA 3T9NA 2HAXA 1W2BP 1YITQ 1WDXA 2AZVA 5KYNA 5CVIA 3M0SA 2EWNA 4NL2A 2EIFA 2VYTA 1WXUA 3JV3A 2YUOA 2E6ZA 1K0SA 1RAGB 3QUIA 1PD0A 5FRMA 1Q95G 3CMET 1QVFP 4D6WA 1RAEB 1UJ0A 1NEGA 4FL6A 5GJWB 1D0XA 2JMAA 2RQWA 2VXFA 4C8QE 2XD0A 2RJDA 2KYMA 3G71T 4ZNXA 1SSHA 3QWXX 4K11A 3EGXB 5DLQE 2PQWA 2W0ZA 1PNJA 3HRUA 4RTUA 1MMDA 4QVCA 3OYDA 1G3YA 3EGDB 3QHSA 2KQWA 2J7IA 1NEBA 3CC7A 4PJJA 1OZ2A 2K3BA 2G3RA 4HT9A 2CDTA 2M02A 3OYNA 2KAFA 5GMKe 2E6NA 3OB9A 4JS4A 4ESRA 3CCLA 2NUZA 4M75A 3E9FA 1MGQA 2FZCB 2IPOB 4MMLA 1NBEB 3I56A 2LQKA 4ZTFA 1T3SA 3M57A 4BUGA 1C6VX 4KGZB 5CK9A 1D0ZA 2MOXA 4MDWA 2QYZA 2VGMA 4FYVB 2L89A 4WF2A 4J9FA 1YJNT 3GIBA 1K1ZA 4J9HA 4MZTA 2CP0A 4M77D 2DD4A 4D8KA 3CC7Q 4M7DC 5HK0A 2J6OA 1M30A 3OYBA 2RI5A 2AK5A 2V1QA 2LX7A 3RDVA 2RI3A 5FRNA 4E7LA 1U1TA 3JCMf 4PJOB 1X6BA 2QK0A 1IGQA 4HVWA 4LDYA 4V2SA 2GQIA 2LX9A 2HCKA 2XICA 2CSIA 3MEVA 3L2WA 3CD6A 2C0IA 4A63B 3I56Q 5KE3A 2EJFA 2HEQA 1S72A 4HCKA 3J80E 1UHFA 4J7FA 1AZEA 1B34A 2V8IA 3HPWA 3MHXA 2CT4A 4M7DB 4OB1B 2CT3A 2FRYA 2MYSA 1IHVA 1MV3A 2CP5A 1MMNA 3HKSA 2DMOA 3M59A 4XTUA 3CCRQ 1ABOA 4DBRA 3OYJA 3CCJQ 2RN8A 3NPFA 3CC7T 2IVWA 2CSQA 3REAB 1R77A 3ME9A 3AT1B 5IT9E 5FW9A 5KYUB 3EG1A 2DL7A 1VYVA 1JJ2A 2YLBA 5GAOn 1WXBA 1EFNA 1LVKA 1I0CA 4AFQC 1ZX6A 3H6ZA 4JLGA 3CD6Q 1KK7A 2RMOA 1S72Q 4XU2A 1TUCA 1WHMA 1VYTA 3I56T 2A3LA 1N5ZA 1D1AA 1LCKA 1RLQC 1JJ2S 1IGUA 2D8JA 2BIVA 3TEEA 4OP0A 1M4ZA 4HXJA 4NS5A 3BE3A 5J39A 4CI0C 1XOVA 4F7UB 1UB4A 2FB7A 5AYFA 3CCRT 3QKJA 4X9CA 1BIBA 2KK4A 2L3PA 4PLIA 3VS2A 4A53A 5KCOA 3CCJT 2LQ8A 4PK4A 4PFPA 3NTIA 2DJZA 3CCEA 5GAN3 1UEBA 1TG0A 2QGGA 4OVAA 4JRQA 4Y91A 1VA7A 1D3BA 5D6WA 3PIPA 1UGRB 1G5VA 1UTIA 4MZMA 1S72T 4M78D 3J7AF 2OTLA 4J83A 4C0GA 4QKUA 5A0LA 3JCMd 2CZ0B 2H3EB 1D1CA 2LCCA 3MPUB 1GRIA 4M78G 3M53A 1WXTA 2FYKA 2HBWA 4KGVB 2F69A 3CCQT 2KXCA 2JXBA 4M75C 5I11A 4EMGA 5IXBA 1W70A 4JZ3A 2XU8A 3OYCA 3FIFA 2EQJA 1VQ8Q 4Z8AA 1QP2A 2EQKA 2MI6A 2NUTA 5DM7R 5D6YA 3F70A 2OTLQ 2CZ1B 3P8DA 3ZFJA 4C0DB 1OX9A 1I81A 3JRZA 1U06A 2W10A 3EHRA 1I1JA 3EFOB 1ABQA 1LJOA 4XTWA 3PVLA 3RERA 3RBBB 1EZZB 1Z9ZA 1ZLMA 3VS7A 2F2WA 3MKDA 1K9MU 1XNIA 2L0AA 3VKIA 1XQHA 2EYZA 5ECAA 2DRMA 2HL3A 3QPHA 3ER0A 3LH0A 1VQ8T 4ZGDB 2DEQA 1NLOC 2DF6A 2XI9A 2FZGB 1NYGA 1ACMB 3H0IA 5HKCA 2O4XB 3OYEA 2RF0A 1WJRA 2ZZDA 2E5QA 2M9UA 2OTLT 1PRLC 3A8HB 1BI1A 2H3JA 2SEMA 2DLPA 3MJXA 2HSEB 4B9XA 4E2FB 1R0BG 2IIMA 4FSXA 4CC3A 1X6OA 3JCMc 2VB6A 3LLRA 5CKDA 2EKHA 2KBTA 4XTVA 3P8HA 3QZ9B 1X27A 3JCMV 4TVRA 4OMNA 1LPLA 1BI0A 1YNZA 3RUXA 3J81E 2DZCA 4BY6B 4X34A 4LDVA 1VQOA 5AT1B 1QVPA 2IG0A 2F5TX 3QIIA 4IUTA 5GAMh 2NWMA 2VUBA 2DTIA 5LJ3f 2LP5A 4M7AA 5L23A 1ARKA 3U23A 1PSFA 2DL3A 1VQLA 3FC3A 2YLCA 5FU6C 3CMAA 1W6XA 1GCPA 2DYIA 2QQSA 2HKQB 1ZBJA 3LGFA 3PNWC 1K8AC 3UA6A 4M75D 1BIAA 4ANJA 4BDZA 1KQSA 1PM3A 3GBQA 1VQOQ 4OGCA 4AFSC 2EJGA 1RAAB 2K5IA 4Y28E 2A37A 4RMOA 3QDFA 1SRLA 4M75G 1M2OA 5FU6B 4II1A 2EYXA 3I55T 5I2MA 4DBQA 2YRDA 5IHNA 1KQSS 2GBQA 3NHNA 4J9CA 4FT2A 4A4KA 1Q7YC 1A0NB 1VQLQ 2RQRA 3A8OB 1TXQA 3CMAQ 1V76A 2LTOA 1VQKA 1Q82U 1Y71A 4JRIA 4N0AC 4AFUC 1MMAA 2CUDA 2L3SA 2KT8A 1KC8R 3WVEB 1WIEA 1IXDA 3UF4A 4J9BA 2K4YA 5IH2A 3QBYA 2DX1A 2F1LA 3C94A 1VQOT 1AWJA 1T3LA 3I5SA 5GAN8 4Q5WA 1N8RR 2JN0A 2KI7A 3BDUA 3QYHB 3TREA 2CGHA 3RKYA 2X3XD 2DL8A 2HBPA 1NPPA 1E6HA 3HSBA 3LYIA 4C92F 2OJ2A 1VQLT 3FJ5A 4PJOE 3DLLA 3CMAT 1VQKQ 1PSEA 4PJOF 1Q86U 1RAFB 3OS1A 2DNUA 2ZCFB 5IHIA 5LJ3d 1JXOA 2ZAEA 4J9IA 2DIGA 3BDLA 4D8DA 4EDUA 1R0CB 1ZSZC 3TCJA 2D1XA 3JCMg 2QAZA 1K8AU 2KRNA 1YHQT 4C92A 4M7DE 3H9NA 1BI2A 3CMEA 5HCKA 4BI3A 3V7RA 5HY6A 1AWOA 4HVUA 4M7DF 4O6JA 1H92A 1M2VB 3M4GA 1QCFA 2RHYA 3JCMe 2NUPB 1GBRA 1W2BA 4L5GA 2EGAA 4JDSA 5KH6A 2K79A 2KVQG 1ZUKA 1K4US 1U8RA 4F16A 4LE9A 2ED1A 4PKCC 2DJQA 3CEYA 4KULA 4M77C 3GNGA 4UC4A 4VUBA 4XU1A 1W2BS 1RADB 1Q81U 1R8OB 3TSWA 2FHDA 1WHHA 2VV5A 2DD5A 1N9SA 2DE0X 1JBMA 2P4RA 2RO0A 4PJNA 5LJ5h 1NJIC 4QQGA 2EYWA 4F7UE 4JJNK 4OMOA 2P4TA 3L42A 1MUZA 3HL8A 4LDXA 4F7UF 3QO3A 2KY9A 3MEWA 4OMQA 2PU9B 2AT1B 4KRTA 4A4EA 3X24B 3P8BB 1Y0MA 1BU1A 4RKUE 1TOVA 3OYFA 2YWWA 1N27A 3LWHA 1YBYA 2L2PA 2HQEA 3S3MA 1F1BB 1GBQA 2AKLA 2ZPEB 3RMQA 1YJNA 4DBHA 4X9DA 2E64A 2LRQA 2XKOC 1IO6A 3VUBA 3PVQA 1UECA 3G1JA 4J9EA 5D6XA 3PIOA 1GL5A 2X9HA 1UJYA 3G7ZA 3V8LA 2O88A 1QW1A 5CIUA 2QQAA 4AG2C 2JNGA 5GMKj 4IUQA 2A08A 4Y92A 2D0QB 4GY5A 2OTJA 4LUDA 2RK1A 2F2XA 4QW2A 3SWNC 4RG8A 4PFOA 3OYAA 1WFWA 3DLMA 2NYSA 1VQ4T 4C8QF 3L2VA 2HSPA 1AZGB 2YRVA 4A4GA 1HXDA 1SPKA 1YCYA 3VJPA 1YJNQ 5GAOp 1ZHIA 3L2ZA 2QA4T 3R6NA 3QG1A 3JB9I 4FYWB 1KD1C 2GGRA 1U1SA 4L59A 1IRXA 3ZL7C 3KUFA 2VASA 5L8RE 1T0HA 4C8QA 5KYYA 1H8KA 3SWNB 1OULA 3META 2LT1A 4B6MA 2CKKA 4M78C 2E65A 2QTVA 2OTJQ 3RIRA 5A0GA 1PWTA 1B3QA 2O31A 2RHZA 2E12A 1W1FA 4XTZA 3RKXA 2WSFE 2CS7A 1TUDA 1WHLA 2EGEA 3CC4T 4KH0B 1M9SA 1WX6A 2V1RA 3A1PA 5FU7C 4NL3A 3DKMA 2R58A 4M4ZA 3EFOA 1QVGA 2XIDA 1QLYA 2FO0A 4PLLA 3VV0A 3CCRA 5C0MA 3X20B 4DA4A 3CCJA 4M78B 2HQXA 2Y90A 4AT1B 1VQNT 4BI4A 4M77G 4M7AD 2HQHA 3M58A 5GANg 1RAIB 2DXBA 4FW2A 2OTJT 2HMAA 2E5KA 2KNBB 4JJBA 4M7AG 5J3BA 3QXEB 2GTOA 3MCAB 2O4XA 4FW1A 3JCMJ 2RPNA 2KE9A 5GANe 4XAXB 2ESWA 2D9TA 4FSSA 1MNEA 1D1BA 1UGPB 3ZBDA 1KG1A 3Q1JA 4Z89A 3CCQA 2LMJA 1QVGP 3FRNA 2M1HA 1AEYA 3E19A 2RQTA 1KD1U 3V8KA 3OBWA 1KJWA 2M0OA 5GAOr 4FT4A 1SRMA 3VS3A 3GF5A 2SRCA 1U5SA 2QI2A 3HRTA 1VQPA 5KCHA 2EAYA 5LJ3g 5EG2A 4HVVA 1O9SA 4JJCA 3VUZA 3I9QA 3UA7A 3FLGA 3EAEA 1WHJA 2FPEA 4DOWA 3BFMA 3ZEHA 1Y7XA 2LZ6B 3M4YA 5LJ3e 5LJ5g 1X2KA 3CCQQ 3OYHA 2M0YA 5GAMf 2GNCA 3RNJA 3M56A 2EPDA 3A5ZB 1OQKA 1KFZA 4A4FA 3CPWP 1BI3A 1UGVA 1K9MR 2RNAA 5LJ5e 1FMWA 2LCLA 2PUKB 1FMVA 1K9AA 5CKHA 1VQ8A 3M0RA 2YT6A 1VQPQ 2CP2A 3MP8A 1YJ9A 1UGQB 4DEYA 2EJ9A 1KHIA 3OW2P 2XDBA 2DAQA 1OX8A 1SF9A 2B86A 1BK2A 2QEXA 4PJLA 2LNVA 1K0XA 2V8JA 1GCQA 4J6XA 1X69A 2XHCA 2PNIA 1M8VA 4XU0A 1I4K1 1RI9A 2J05A 1U3OA 1D09B 3A98A 4ATOA 4C92D 2D0NA 1WJSA 4HCZA 4E7JA 1YIJT 2EQUA 3QDRB 4J9DA 3LWIA 3JB9D 2DBKA 4PJOD 1UG1A 3JCMX 2XK0A 4C92G 1FXXA 1YJ9Q 1K76A 1VQPT 2JUFA 3A8MB 3CCVA 1WNLA 3JB9G 2O2OA 2LNHB 2LDMA 2FZKB 4PNOA 1B07A 4EIKA 2QEXQ 3JCMb 4ZN3A 1G83A 3TU4K 1K73C 4RCBA 3OA6A 1M3CA 2X3WD 3OQ5A 2RB6A 1VYUA 4M75B 3SDZA 4JUVA 5LL6S 4ZN1A 2R57A 4JS5A 2ATCB 1ZUUA 3OSVA 3I5RA 5I22A 4AMCA 1CKAA 1YN8A 2P84A 4QQDA 1FMKA 4KUDK 3CC2A 2EYQA 3HFOA 3OS5A 1M90C 1KQ1A 1VUBA 4Z88A 1YJ9T 3CCVQ 4E7ZA 1NE8A 3MEUA 5GANf 1RACB 2DVEA 1QKXA 3OYGA 2COWA 4OMFB 2XMFA 2QEXT 5I2SA 3I55A 1M1GA 3NMZC 2VXEA 1OU8A 4RTXA 3M0PA 5GMKm 4PL6A 5FROA 2NUPA 2QQ9A 3UWNA 2YSQA 1SEMA 2RM4A 5CO7A 3FB9A 2PVOB 1BCMA 4DQ2A 2HL5C 1E6GA 3OYKA 1B34B 2VVKA 2RJFA 4OMMA 2WACA 3HP9A 1Q82R 1YWOA 2KYBA 3HRSA 3CC2Q 8ATCB 1JRIA 2QGFB 3GP8A 2GTJA 4EMKA 4OF1A 2PTKA 2DTOA 3WXMB 5GAOq 3CCVT 4FM4B 4QQ6A 3OYYA 3QJ6A 1GFDA 3I55Q 4KUIA 5CR2A 5GAOl 3VRZA 1X43A 2JW4A 3CQTA 3OS2A 2DBMA 1K73U 1NZ9A 1WYXA 5GMKi 2BZXA 4ELYC 2A7YA 1Y57A 4LDUA 1V1CA 5CKFA 4EMHA 3PTAA 5CCAA 5LJ5f 1UFFA 4C8QD 2EQMA 2J6KA 3LX7A 4E7HA 5GAN5 1OV3A 1Q86R 1FYNA 2CP6A 1CKBA 3D7SB 3EGUA 3CC2T 2L5QA 4C8QG 1YHQA 3H41A 1M90U 5CQXA 2BUDA 9ATCB 4DOVA 3L2QA 3EH2A 2QQRA 4RCCA 1K8AR 1VQ7A 4OB3B 4BACA 1JO8A 3NTHA 1GXIE 4WTOB 4ZGJB 2KMTA 1D3BB 3ASKA 5DLOA 4IIOA 4C5IA 5GANd 3E9GA 5DY9A 3EGXA 3A8GB 5GMKh 3L2UA 1PKTA 3JCMW 1VIFA 4XU3A 2RJCA 2K7AA 4BB7A 3EGDA 3H8ZA 3G6ET 1PKSA 4R0KA 3CCST 1YHQQ 1Q81R 1KC8C 2WSCE 2ABLA 1AD5A 1VQ7Q 1KIKA 4JPBW 4J5YA 3G4SA 3DB4A 4Z02A 2JJ9A 2D6FA 2F2VA 4M78E 1UGSB 2HD0A 1N8RC 1I5LA 2LQNA 1C1AA 2NUTB 2KDSA 4M78F 4RTWA 1PRMC 5EC7A 3R6OA 5FWBA 4DEXA 1VQ9Q 3JB9J 3EH1A 3VS1A 3KXTA 1WHGA 3S3NA 1OEBA 2CUBA 2LJ0A 5GAN7 2DK3A 1AWXA 2V26A 1YP5A 2O9SA 5FWCA 4JRKA 1PG5B 4ZTJA 3G4SQ 1VQ7T 3FEOA 5LJ5d 1ZBXA 4N4HA 4OMPA 4CC7A 5HK3A 1M1KC 4XQ3A 4P5NA 4PJOA 1TS9A 4BE1A 2D8HA 5GAOm 2PUOB 1YCSB 3FDRA 1ZA1B 1RUWA 1IB8A 4WCIA 4C5EA 1RLPC 1VQ4A 2DA9A 1Q7YU 2RQVA 3GNFB 4IUPA 1ZSZB 1SSFA 3E1SA 3CXCP 2XDPA 2MWPA 2RQUA 4N4IA 1VQ9T 4M7DA 4C5GA 4KT0E 4MZPA 2QA4A 4N4GA 2J6FA 4BI8B 2CREA 2RD1A 2K3XA 4M7AC 3PE0A 4F04B 3CCMT 1VQ6T 2CP7A 2DVJA 2RA2A 5C6SA 4PFZA 5A0DA 2DEUA 5KYUA 1YI2A 1FWZA 1X75C 3G4ST 2EVRA 4RTTA 1WJQA 4HCBA 5KYWB 1G2BA 2QDLA 1LNXA 4JZ4A 4M77B 4RUGA 2EGCA 2Y4XA 1VQ4Q 2E4HA 2EFIA 1MHNA 3CC4A 1C0MA 4M7AB 1MV0B 1NLPC 4CC4B 1BKBA 5GAMg 2QA4Q 2DXUA 3SFMA 4MMKA 2BTTA 2JMCA 2YUQA 4F7UA 1SHFA 2GF7A 1TSFA 3OYIA 3CBOA 1W4SA 1VQNA 5GAMe 5GAN4 1ZQ1A 1OZ3A 2L8DA 1J3TA 1YI2Q 3LH5A 2K5LA 1AT1B 2E3HA 1M3AA 1M1KU 3M5AA 2BKDN 2K2VA 2KRSA 4PJMA 3QYGB 4KBMB 4IKFA 4R55A 3CC4Q 3QSUA 4GLMA 3VU3C 2LT4A 2E41A 3EHQA 3LW5E 1I07A 4XTYA 2DL5A 1BB9A 2DETA 3SHWA 1M3BA 4J9GA 1QP3A 3INZA 3VS5A 4F17A 4LD6A 1G8XA 2ENMA 3A8LB 1QCNA 3AHUA 1RAHB 2MPXC 2QTXA 4OGEA 2L3RA 3O5ZA 1VQNQ 1YITT 2QXFA 4M75E 4ZGEB 1QWEA 2QQBA 4LD9K 1KD1R 4HCCA 2RI2A 1YI2T 2KROA 4M75F 2YXYA 2JM9A 2AIRB 1NJIU 1ZA2B 5FLXE 3OMCA 3CBMA 1UE9A 1KHCA 2VGNA 2X51A 2E1HA 2MF2A 3PFSA 3EG9B 1S1NA 3PMIA 2PZ1A 1G3SA 1DJ7B 5GANj 2L3QA 3L2RA 4BE2A 2ZPHB 1WA7A 4C92C 4ME7A 1BBZA 2FVUA 2MWOA 3PMTA 1X01A 2K3YA 2M16A 2ROLA 4PJOC 3M0UA 3EFSA 2VWFA 1BYMA 4AG1C 2DKGA 3CBPA 2A0FB 2JTMA 1QVGS 1RI0A 2EYYA 3PT9A 2FG0A 1AVZC 3EFRA 4E6RA 4FYXB 5FU7B 1YJWA 2P0QA 2YHTA 3OS0A 2KEAA 4C92B 3M9QA 2QASA 3OYMA 1AWWA 2C0OA 3V7SA 4GBQA 4JLIA 4C0FA 1UUEA 4LUEA 3M0QA 5LJ3j 3CCLQ 4DBFA 3JAME 2OAWA 1SG5A 1Y96B 2LJ3A 3CPWA 2X35A 2AZSA 2DM1A 1LOJA 1YIJA 1M8MA 5KYXB 4EPCA 4CC2A 5LJ5j 2BE9B 2FPDA 3OW2A 1CSKA 2FEIA 1B7TA 3VS6A 2CZ6B 2ZPBB 1M1FA 1YJWQ 3CPWS 3SEMA 2COZA 1H3HA 4J8OA 1WZOA 2G6FX 2DO3A 4FIBA 2RHIA 3EG2A 3TQ7P 4OB2B 3OMGA 1WHKA 3OW2S 7AT1B 1VQMA 5GMKl 8AT1B 2HNIA 4E7IA 3HHTB 3CCLT 3M55A 4E47A 1AOJA 2BZ8A 1YWPA 1YIJQ 4X1VA 4F14A 1GFCA 2H8HA 4MDXA 2ED0A 4E7KA 2CZ7B 5KE2A 3UT1A 3GLXA 2DXCA 3OSSC 1X6GA 1YJWT 1K9MC 4OB0B 1HD3A 2DPPB 2EKOA 1M5Q1 2GCXA 3JCMQ 1I8FA 5A2QE 1WLPB 3QWYA 2ZPGB 1VQMQ
chains in the Genus database with same CATH topology
2RHYA 3JCMe 4LDWA 3CCLA 2DZ9A 1WQWA 1W2BA 1K73U 4L5GA 3JCMP 4C8QC 2X4WA 1NZ9A 4M75A 1Y07A 1FX7A 4JDSA 3E9FA 5GMKi 5KH6A 1MGQA 4ELYC 2A7YA 4MMLA 2GFAA 2KVQG 3CD6T 2XDDA 3WVDB 3I56A 1U8RA 2LQKA 4ZTFA 4LDUA 5CKFA 4EMHA 2ZPFB 3L1AA 3M57A 4C5HA 3PTAA 5CCAA 4PKCC 1VIEA 3CEYA 4A54A 5LJ5f 1WGSA 4KULA 4M77C 4BUGA 3GNGA 4UC4A 3NFCA 4C8QD 2EQMA 4VUBA 4XU1A 2LVMA 5CK9A 3LX7A 4E7HA 2P0PA 5GAN5 4MDWA 1W2BS 3SB2A 2VGMA 1Q81U 2L89A 4WF2A 1R8OB 1YJNT 3GIBA 4C0DC 1WQ7A 4MZTA 2FHDA 4M77D 3CC2T 2DD4A 2L5QA 4C8QG 2VV5A 1YHQA 4M7DC 5GAOl 5HK0A 3OYBA 2RI5A 2DD5A 2JOYA 1N9SA 5CKBA 5CQXA 2BUDA 4PJOG 4DOVA 3L2QA 4RCCA 2QQRA 3X25B 1M90U 1VQ7A 4OB3B 2RI3A 4C8QB 5FRNA 4BACA 1JBMA 1IZ6A 1U1TA 3JCMf 3VYGA 2RO0A 4E7LA 4PJOB 3NTHA 5CKEA 5LJ5h 1NJIC 4LDYA 4QQGA 4V2SA 4F7UE 4M7DD 1GXIE 2LX9A 4JJNK 2K57A 1VQMT 4ZGJB 2P4TA 2XICA 3L42A 2KMTA 3HL8A 4LDXA 3MEVA 1D3BB 4F7UF 3L2WA 3CD6A 2R5AA 4C0ZA 3QO3A 4N0AA 2KY9A 3MEWA 1O75A 1IREB 3ASKA 5KE3A 2EJFA 5DLOA 1S72A 2MAMA 4IURA 2PU9B 3HFNA 3JSCA 4A4EA 3X24B 3J80E 3KBGA 3P8BB 4J7FA 4O5VA 4C5IA 4M7DG 4RKUE 5GANd 1B34A 3E9GA 5DY9A 2V8IA 3OYFA 1N27A 3HPWA 1YBYA 1EIFA 2CYZB 3A8GB 3MHXA 5GMKh 3LWHA 3L2UA 2HQEA 3S3MA 2PVDB 4M7DB 2B8AA 4OB1B 3X28B 1VIFA 3JCMW 4XU3A 2LC4A 2ZPEB 3JCMh 3RMQA 4XTXA 1YJNA 3V8JA 2RJCA 3C95A 4X9DA 4BB7A 2E64A 2LRQA 2DTHA 2MMPA 3H8ZA 2XKOC 3HKSA 3G6ET 2GFUA 3M59A 1WPYA 3DB3A 4XTUA 3VUBA 3X26B 2X4JA 3CCST 5D6XA 1KC8C 2X4XA 2WSCE 3OYJA 3PIOA 4M7DE 3S3OA 3CC7T 3G7ZA 2IVWA 5GAMd 2JVVA 3V8LA 3ME9A 4JRPA 1QW1A 5IT9E 5CIUA 4J5YA 3G4SA 2QQAA 3DB4A 2JNGA 3CPFA 4Z02A 5GMKj 5CAIA 1RL2A 1JJ2A 4IUQA 2YLBA 5GAOn 2D6FA 1TH7A 3H6ZA 3CCET 2D0QB 4GY5A 5J26A 2OTJA 4JLGA 1UGSB 4M78E 2HD0A 2RK1A 4A4HA 1N8RC 1I5LA 4QW2A 3SWNC 2RK2A 2KDSA 4M78F 4RG8A 4XU2A 3OYAA 3VYHB 3DLMA 3I56T 2A3LA 1VQ4T 4C8QF 3R6OA 3BY7A 3L2VA 2RHUA 4BY6C 2YRVA 1JB0E 1JJ2S 2BIVA 3TEEA 4OP0A 4A4GA 1HXDA 4M77E 3JB9J 1M4ZA 1YCYA 3VJPA 3KXTA 4NS5A 4F7UG 5J39A 5GAOp 3G6EA 1P92A 3S3NA 3MEAA 1ZHIA 4M77F 3L2ZA 4CI0C 1XOVA 1XTDA 3CCSA 2QA4T 5GAN7 3QG1A 3JB9I 2DK3A 1UB4A 4F7UB 3BW1A 1Q82C 2FB7A 1KD1C 5AYFA 3CCRT 3QKJA 4X9CA 1BIBA 2KK4A 4PLIA 4A53A 5KCOA 4M7AE 1U1SA 4L59A 3UDCA 3CCJT 1VQ5T 4JRKA 2LQ8A 4ZTJA 1KQ2A 3KUFA 4YTLA 1VQ7T 3FEOA 4M7AF 5L8RE 4C8QA 5LJ5d 1ZBXA 4N4HA 3SWNB 5HK3A 1M1KC 4XQ3A 4P5NA 3META 3NTIA 2DJZA 2LT1A 2NLUA 2CKKA 3CCEA 4BE1A 2AHJB 1UEBA 4M78C 5GAN3 2E65A 2E10A 5GAOm 3RIRA 4OVAA 4JRQA 2PUOB 5A0GA 2E70A 3FDRA 4Y91A 4BDYA 3RMSA 5M9OA 1D3BA 5D6WA 4M77A 3PIPA 1UGRB 1G5VA 2RHZA 4C5EA 1VQ4A 2E12A 1Q7YU 3UPUA 4XTZA 3MP6A 4MZMA 1S72T 3RKXA 2WSFE 2CS7A 4M78D 3GNFB 4IUPA 3SD4A 2OTLA 3J7AF 4J83A 3CC4T 1M9SA 1SSFA 3E1SA 5FU7C 4C0GA 2XDPA 2MWPA 5A0LA 3JCMd 2CZ0B 3DKMA 4NL3A 2R58A 4N4IA 1VQ9T 2ZGWA 4M7DA 2R5MA 2LCCA 4C5GA 1QVGA 2XIDA 4KT0E 4MZPA 2QA4A 4N4GA 4PLLA 4BI8B 2RD1A 1G3TA 4L6V5 4M78G 3VV0A 3M53A 2K3XA 3CCRA 5C0MA 3X20B 4M7AC 2FYKA 3CCMT 1VQ6T 2F69A 2WSEE 4DA4A 1Q86C 3M54A 3CCJA 3CCQT 4M78B 2RA2A 2HQXA 5C6SA 3JB9H 4M75C 4FU6A 4EMGA 2Y90A 5A0DA 1VQNT 2XU8A 3OYCA 1FWZA 1X75C 3FIFA 4BI4A 4M77G 3G4ST 1YI2A 4M7AD 3M58A 1WJQA 4HCBA 2EQJA 4J6WA 5GANg 1LNXA 2DXBA 2RJEA 1QP2A 2EQKA 4M77B 4R56A 2OTJT 2MI6A 5IAYA 2Y4XA 2EFIA 3PGGA 5DM7R 1MHNA 2X4YA 4M7AG 5D6YA 3F70A 4NOYA 3QXEB 5J3BA 3CC4A 3MCAB 2CZ1B 2K5FA 2Y4YA 3P8DA 3GOXA 2O4XA 3JCMJ 3ZFJA 4C0DB 1I81A 3JRZA 4M7AB 1VQ9A 5GANe 4XAXB 2D9TA 1BKBA 5GAMg 1LJOA 1UGPB 3ZBDA 4CRIA 2DXUA 4XTWA 3SFMA 4MMKA 1KG1A 3CCMA 3Q1JA 1VQ6A 3RERA 4HA8A 3MO8A 4B9WA 2RHXA 3CCQA 4F7UA 3RESA 3FRNA 2V8KA 1AHJB 2KSSA 2M1HA 3E19A 3C12A 2GF7A 3OYIA 1KD1U 3CBOA 1W4SA 3V8KA 3OBWA 1K9MU 1VQNA 1XNIA 5GAMe 2M0OA 5GAN4 5GAOr 1ZQ1A 1OZ3A 2L8DA 4FT4A 1Q81C 3VKIA 1XQHA 3SWNA 2K5LA 3GF5A 3QPHA 4PJOA 2DIQA 1M1KU 2QI2A 3ER0A 3URGA 3LH0A 3HRTA 3M5AA 1H641 2BKDN 3MP1A 3QJYA 1VQPA 5KCHA 2K2VA 4ZGDB 3CXCA 1VQ8T 2EAYA 2DEQA 5LJ3g 5EG2A 2RH2A 3QYGB 4KBMB 2XI9A 4IKFA 1O9SA 5HKCA 2O4XB 3VUZA 4R55A 3OYEA 3VU3C 3OBYA 3RKWA 1WJRA 2LT4A 2ZZDA 3FLGA 5I21A 2E41A 2E5QA 2M9UA 3EAEA 3LW5E 4XTYA 2OTLT 1G3WA 4J6YA 4DOWA 3A8HB 3CCUA 3BFMA 1BI1A 3ZEHA 1QP3A 3INZA 2H3JA 1Y7XA 2VC8A 1NPRA 4IUVA 3M4YA 4LD6A 4XK8E 4C92E 5LJ3e 4B9XA 3A8LB 4BE0A 5LJ5g 3CXCS 2F5KA 4FSXA 5CQYA 1X6OA 4HKEA 3JCMc 3AHUA 3GPLA 3OYHA 3LLRA 1HK9A 5GAMf 5CKDA 1V29B 3M56A 2QTXA 4M78A 4OGEA 4XTVA 2L3RA 3A5ZB 3JB9F 3P8HA 1YITT 3QZ9B 2QXFA 4M75E 4ZGEB 4A4FA 5GANh 2QQBA 3JCMV 3C4SA 1BI3A 4TVRA 4LD9K 1H3ZA 4HCCA 5LJ5e 1BI0A 2RI2A 1YI2T 2LCLA 4M75F 2PUKB 5CKHA 3RUXA 3J81E 1OI1A 1VQ8A 2DZCA 4BY6B 1NJIU 5FLXE 2GQVA 4X34A 3OMCA 4LDVA 3MP8A 1YJ9A 3CBMA 1VQOA 1UGQB 1KHCA 1OYXA 3V7CA 2VGNA 1QVPA 2E1HA 2EJ9A 1KHIA 2IG0A 2MF2A 3PFSA 1N9RA 2F5TX 5IN1A 3QZ5B 2DAQA 3QIIA 3OYLA 4QVDA 2XDBA 3PMIA 4IUTA 5GAMh 3S6WA 1G3SA 2QEXA 1DJ7B 5GANj 3L2RA 2VUBA 2DTIA 5LJ3f 4EMKC 2XG8D 2FL7A 4BE2A 2LNVA 4HT8A 2ZPHB 3LGLA 2V8JA 4C92C 4M7AA 4ME7A 2O01E 3FJPA 2FVUA 2C06A 2MWOA 3PMTA 1PSFA 1X01A 2K3YA 4J6XA 2XHCA 4ELZC 1M8VA 2I2LA 2PVGB 2M16A 4RG2A 3OY9A 1VQLA 3G71A 4PJOC 1Y96A 4XU0A 1I4K1 3FC3A 3EFSA 2YLCA 5FU6C 3CMAA 1BYMA 4ATOA 4C92D 2DKGA 1YITA 5GAMj 1KC8U 3CBPA 1WJSA 1VQKT 2QQSA 4GLKA 4HCZA 4QVZA 2EQUA 3QDRB 4E7JA 1YIJT 2JTMA 3LWIA 1QVGS 1RI0A 3LGFA 3JB9D 4PJOD 4IUUA 3PT9A 3PNWC 3JCMX 5LJ3h 1K8AC 2P0KA 2XK0A 4C92G 1FXXA 3EFRA 4BD3A 4M75D 1BIAA 5FU7B 4BDZA 3N5BB 1YJWA 1KQSA 1QVFA 2P0QA 4EMKB 4OGCA 2YHTA 3OS0A 2JUFA 3A8MB 4J7IA 4C92B 3M9QA 2EJGA 1VQPT 3CCVA 1N8RU 1WNLA 3JB9G 3OYMA 2LDMA 2K5IA 4Y28E 2ZPIB 4PNOA 3V7SA 3JCMb 4RMOA 2QDYB 5GAN2 4ZN3A 4M75G 4JLIA 4C0FA 3TU4K 1K73C 4RCBA 3OA6A 1N6AA 5FU6B 2JZ2A 4II1A 3NTKA 5I2MA 5GAN6 5LJ3j 3OQ5A 3I55T 2RB6A 3CCUT 4M75B 3SDZA 1KQSS 3JAME 1Q7YC 4A4KA 4FT2A 1QVFS 2DXTA 4JUVA 5LL6S 1Y96B 3O8VA 4ZN1A 2R57A 4JS5A 2OAUA 3CPWA 3A8OB 2X35A 3OSVA 2JTFA 3T9NA 1LOJA 2HAXA 2LTOA 1VQKA 1Q82U 1YIJA 1Y71A 4JRIA 4N0AC 5CVIA 4EPCA 5LJ5j 4QQDA 2EWNA 4NL2A 2EIFA 3OW2A 4KUDK 3WVEB 2VYTA 2CZ6B 2K4YA 3CC2A 2ZPBB 3QBYA 1M1FA 2EYQA 3HFOA 3OS5A 3CPWS 1M90C 1KQ1A 1VUBA 2E6ZA 1YJ9T 3C94A 4J8OA 1VQOT 1NE8A 3MEUA 5GANf 5GAN8 3QUIA 4Q5WA 5FRMA 2DO3A 4FIBA 2RHIA 2DVEA 3OYGA 3CMET 4D6WA 3QSUA 2JN0A 4OB2B 4OMFB 3OMGA 3BDUA 3QYHB 2QEXT 5I2SA 3I55A 1M1GA 1VQ5A 3OW2S 4FL6A 2VXEA 5GMKl 1VQMA 3TREA 2CGHA 3RKYA 2HNIA 5GMKm 4E7IA 4PL6A 5FROA 2HBPA 3HHTB 1NPPA 3CCLT 2QQ9A 3HSBA 3LYIA 2VXFA 3UWNA 4C92F 4C8QE 3M55A 2XD0A 2RJDA 4E47A 1VQLT 3G71T 2RM4A 5CO7A 4PJOE 3FB9A 2PVOB 3DLLA 4DQ2A 3CMAT 3OYKA 1B34B 1PSEA 2RJFA 5DLQE 2PQWA 4PJOF 1Q86U 3HRUA 2WACA 3HP9A 3OS1A 2ZCFB 4MDXA 5LJ3d 4QVCA 4E7KA 3OYDA 1G3YA 2CZ7B 5KE2A 2DIGA 3BDLA 3HRSA 2KQWA 3QHSA 3UT1A 4EDUA 3TCJA 3GLXA 2DXCA 3OSSC 1JRIA 3JCMg 1K8AU 3GP8A 3CC7A 1YJWT 1K9MC 4EMKA 4OB0B 1OZ2A 4OF1A 1YHQT 2DTOA 2G3RA 3WXMB 4C92A 2DPPB 1BI2A 2EKOA 5GAOq 1M5Q1 4FM4B 2GCXA 3CMEA 3CCVT 4BI3A 3V7RA 3JCMQ 5HY6A 4QQ6A 4HT9A 4M7DF 3OYYA 1I8FA 2KAFA 3OYNA 3QJ6A 4O6JA 5A2QE 5GMKe 2E6NA 4KUIA 2ZPGB 3OB9A 5CR2A 3M4GA 3OS2A 4JS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM e;  4EMK B;  2DZ9 A;  4OP0 A;  1WQW A;  1HXD A;  2YHT A;  4M77 E;  3JCM P;  3JB9 J;  3V8K A;  1YCY A;  4C92 B;  2EJG A;  4M75 A;  4C8Q C;  5GAM e;  1WNL A;  4F7U G;  5GMK i;  5GAN 4;  5GAO p;  5GAO r;  1MGQ A;  3JB9 G;  4MML A;  4M77 F;  4PNO A;  3L2Z A;  3SWN A;  3V7S A;  3JCM b;  4EMH A;  5GAN 2;  3L1A A;  5GAN 7;  3JB9 I;  4M75 G;  4JLI A;  4F7U B;  3BW1 A;  2FB7 A;  4RCB A;  4A54 A;  5LJ5 f;  4M77 C;  1BIB A;  4X9C A;  4M7A E;  1H64 1;  4A53 A;  5GAN 6;  5LJ3 j;  4C8Q D;  2RB6 A;  1U1S A;  2EAY A;  2DEQ A;  4M75 B;  4XU1 A;  5LJ3 g;  4JRK A;  5GAN 5;  2DXT A;  4JUV A;  1KQ2 A;  4M7A F;  1Y96 B;  4C8Q A;  5LJ5 d;  3QSU A;  3SB2 A;  3SWN B;  3VU3 C;  3RKW A;  4XQ3 A;  5I21 A;  4WF2 A;  2DJZ A;  2E41 A;  3GIB A;  4PJO A;  5GAN 3;  4M78 C;  2E65 A;  1WQ7 A;  2E10 A;  4XTY A;  1LOJ A;  4J6Y A;  4M77 D;  5GAO m;  3RIR A;  4C8Q G;  4M7D C;  3BFM A;  4JRI A;  4N0A C;  3INZ A;  4Y91 A;  2VC8 A;  4PJO G;  1N9S A;  1D3B A;  4M77 A;  4RCC A;  4C92 E;  5LJ3 e;  5LJ5 j;  2EWN A;  4C8Q B;  5LJ5 g;  1JBM A;  1U1T A;  4NL2 A;  4XTZ A;  3JCM f;  3JCM c;  3RKX A;  3AHU A;  4PJO B;  4M78 D;  5LJ5 h;  1HK9 A;  5GAM f;  4V2S A;  3HFO A;  4F7U E;  4M7D D;  2K57 A;  1KQ1 A;  2QTX A;  4M78 A;  4XTV A;  3JCM d;  4NL3 A;  1D3B B;  2ZGW A;  4F7U F;  3JB9 F;  4M7D A;  4M75 E;  3QO3 A;  4N0A A;  5GAN h;  5GAN f;  3JCM V;  5GAN 8;  3QUI A;  2EJF A;  2RD1 A;  4M78 G;  3HFN A;  2DVE A;  5LJ5 e;  4M75 F;  2JN0 A;  4M7A C;  4M7D G;  2FYK A;  3BDU A;  3RUX A;  5GAN d;  2DZC A;  1B34 A;  2VXE A;  5DY9 A;  5GMK l;  4M78 B;  2CGH A;  2RA2 A;  3RKY A;  5GMK h;  3JB9 H;  2HNI A;  4M75 C;  5GMK m;  4M7D B;  3JCM W;  3V7C A;  4XU3 A;  2E1H A;  4EMG A;  2EJ9 A;  3JCM h;  2Y90 A;  3HSB A;  1N9R A;  4XTX A;  2VXF A;  3V8J A;  4C92 F;  4M75 D;  4X9D A;  4C8Q E;  4QVD A;  2E64 A;  3FIF A;  2DTH A;  4M77 G;  4M7A D;  5GAM h;  2RM4 A;  1WPY A;  4XTU A;  5GAN j;  3FB9 A;  4PJO E;  2DTI A;  4J6W A;  5LJ3 f;  4DQ2 A;  4EMK C;  1B34 B;  5GAN g;  1LNX A;  4HT8 A;  4M7A A;  4C92 C;  4M77 B;  4PJO F;  3FJP A;  5GAM d;  3V8L A;  1X01 A;  5LJ3 d;  4J6X A;  3PGG A;  3RES A;  4QVC A;  4J5Y A;  2I2L A;  4M7A G;  1M8V A;  5GMK j;  4NOY A;  5CAI A;  4PJO C;  1Y96 A;  4XU0 A;  1I4K 1;  3QHS A;  3EFS A;  3JCM J;  2YLB A;  2YLC A;  5GAO n;  1TH7 A;  1I81 A;  1JRI A;  4M7A B;  3JCM g;  2DKG A;  4C92 D;  5GAN e;  5GAM j;  4M78 E;  4EMK A;  1I5L A;  5GAM g;  2DTO A;  4C92 A;  1LJO A;  5GAO q;  4M7D E;  3SWN C;  1M5Q 1;  2DXU A;  4XTW A;  4M78 F;  4XU2 A;  4MMK A;  3V7R A;  3JCM Q;  3JB9 D;  4PJO D;  4HT9 A;  3RER A;  4HA8 A;  4M7D F;  1I8F A;  3JCM X;  5LJ3 h;  4C8Q F;  3BY7 A;  5GMK e;  4C92 G;  3EFR A;  4F7U A;  5GAO l;  3M4G A;  1BIA A; 
#chains in the Genus database with same CATH topology
 4LDW A;  2DZ9 A;  1WQW A;  3JCM P;  4C8Q C;  2X4W A;  1Y07 A;  1FX7 A;  1QKW A;  1PCX A;  1JJ2 P;  2COY A;  2GFA A;  3CD6 T;  2XDD A;  3WVD B;  2KR3 A;  2ZPF B;  3L1A A;  2JT4 A;  4C5H A;  5D7U A;  1VIE A;  4A54 A;  1WGS A;  3NFC A;  4FCY A;  2CH4 W;  2LVM A;  1WI7 A;  2P0P A;  1OPL A;  3SB2 A;  3NGP A;  4C0D C;  1WQ7 A;  2KGT A;  1JEG A;  2JOY A;  5CKB A;  4PJO G;  1VQ5 A;  3X25 B;  5KYY B;  4C8Q B;  1IZ6 A;  3VYG A;  5CKE A;  3ULR B;  3CCE Q;  4M7D D;  2K57 A;  1VQM T;  2KT1 A;  1T0J A;  2R5A A;  4C0Z A;  4N0A A;  1UDL A;  4KH1 B;  1O75 A;  1IRE B;  3VRY A;  1K73 R;  2MAM A;  4IUR A;  3HFN A;  3JSC A;  1JXM A;  3KBG A;  4O5V A;  4M7D G;  2HKN A;  4RTV A;  1EIF A;  2CYZ B;  1HSQ A;  2PVD B;  2B8A A;  3X28 B;  2ECZ A;  2LC4 A;  2A36 A;  3JCM h;  4XTX A;  3V8J A;  3C95 A;  4QT7 A;  2DTH A;  2MMP A;  3H0F A;  2GFU A;  1WPY A;  3DB3 A;  3X26 B;  2X4J A;  2X4X A;  1VQ5 Q;  3S3O A;  5GAM d;  2JVV A;  4JRP A;  3CPF A;  1M90 R;  5CAI A;  1RL2 A;  1YFN A;  2E3I A;  1HJD A;  1M2V A;  1TH7 A;  1TTH B;  1Z9Q A;  3CCE T;  2DIL A;  3EG0 A;  5J26 A;  2YUP A;  2DER A;  4A4H A;  2RK2 A;  1IHW A;  3VYH B;  3BY7 A;  2RHU A;  4BY6 C;  1JB0 E;  1BCO A;  1ZSZ A;  3E2U A;  4M77 E;  4F7U G;  1RAB B;  3G6E A;  1P92 A;  3HTR A;  3MEA A;  2MCN A;  4M77 F;  1I5O B;  1XTD A;  2YDL A;  3CCS A;  3BW1 A;  1Q82 C;  4E7S A;  4M7A E;  3UDC A;  2A28 A;  3I35 A;  1VQ5 T;  2K6D A;  1KQ2 A;  4M7A F;  4YTL A;  2NLU A;  4LN2 A;  2AHJ B;  2E10 A;  5KYW A;  2MIO A;  4IIM A;  2E70 A;  4BDY A;  3RMS A;  5M9O A;  4M77 A;  4JJD A;  4FYY B;  1MND A;  2EW3 A;  3REB B;  4LNP A;  2VKN A;  2KRM A;  3UPU A;  3MP6 A;  2LJ1 A;  3SD4 A;  1NM7 A;  2OI3 A;  3M0T A;  2Z0W A;  2ZGW A;  1UHC A;  2R5M A;  3G6E Q;  1G3T A;  2HDA A;  4L6V 5;  3CCS Q;  3H0H A;  1M27 C;  1GCQ C;  2WSE E;  2DYB A;  1Q86 C;  3M54 A;  1HYO A;  1TUG B;  2JM8 A;  3JB9 H;  4FU6 A;  1XJW B;  3C0C A;  2DFU A;  2C0T A;  2LCS A;  4J6W A;  5GJV B;  2RJE A;  4R56 A;  3UAT A;  5IAY A;  2KXD A;  3PGG A;  2X4Y A;  4NOY A;  2J06 A;  2K5F A;  2Y4Y A;  3GOX A;  2YUN A;  1Q7Y R;  1VQ9 A;  2ROT A;  1QQJ A;  1PC0 A;  2I0N A;  4CRI A;  1OPK A;  1QMC A;  3CCM A;  2K9G A;  1VQ6 A;  4HA8 A;  3MO8 A;  1EX4 A;  4B9W A;  2RHX A;  4AFZ C;  2JS0 A;  3RES A;  1AHJ B;  2V8K A;  5IXF A;  2KSS A;  2FRW A;  1ZUY A;  3C12 A;  1X2Q A;  4ORZ A;  1Q81 C;  3SWN A;  2DIQ A;  1PHT A;  3URG A;  1H64 1;  3MP1 A;  3QJY A;  2DL4 A;  3CXC A;  2RH2 A;  1JU5 C;  3TVT A;  1MMG A;  1ZSG A;  1SKU B;  2YRC A;  3OBY A;  2CP3 A;  3RKW A;  3EG9 A;  5I21 A;  4KGX B;  1KQS P;  1G3W A;  4J6Y A;  2LQW A;  3CCU A;  1SHG A;  3EG3 A;  2VC8 A;  1NPR A;  1NG2 A;  4IUV A;  4XK8 E;  3RR6 A;  4C92 E;  2HZY A;  4BE0 A;  6AT1 B;  3CCM Q;  3CXC S;  1VQ6 Q;  2F5K A;  2QG9 B;  5CQY A;  4HKE A;  3GPL A;  3VS4 A;  1HK9 A;  1V29 B;  2FPF A;  1D0Y A;  4M78 A;  2BZY A;  3JB9 F;  2JTE A;  3VS0 A;  5GAN h;  1H3Z A;  3C4S A;  2EBP A;  3IQL A;  1VOM A;  2K2M A;  2M51 A;  1OI1 A;  2GQV A;  1M1K R;  1OYX A;  3V7C A;  5IN1 A;  1N9R A;  3OYL A;  2AKK A;  3QZ5 B;  4QVD A;  3S6W A;  4EMK C;  2XG8 D;  2FL7 A;  3CCU Q;  1PD1 A;  3LGL A;  4HT8 A;  2EQI A;  2O01 E;  3FJP A;  2C06 A;  4RTY A;  4ELZ C;  2I2L A;  2PVG B;  4RG2 A;  3OY9 A;  1OU9 A;  3G71 A;  1Y96 A;  2MK5 A;  3TSZ A;  1YIT A;  5GAM j;  1KC8 U;  1E7O A;  1VQK T;  4GLK A;  4OML A;  1TU0 B;  4QVZ A;  5KYX A;  1QWF A;  4IUU A;  5IHK A;  1OOT A;  2O9V A;  5LJ3 h;  2P0K A;  1TWB A;  4BD3 A;  3N5B B;  1QVF A;  1KSW A;  1QCO A;  4EMK B;  1NYF A;  4J7I A;  1NJI R;  1N8R U;  3CME Q;  3KFV A;  2ZPI B;  2CH4 A;  2QDY B;  5GAN 2;  2DRK A;  2BE7 D;  3THK A;  1N6A A;  4LXC A;  1JQQ A;  2JZ2 A;  3NTK A;  5GAN 6;  3CCU T;  2OX7 A;  2JS2 A;  1QVF S;  2DXT A;  4RTZ A;  3O8V A;  3G71 Q;  2OAU A;  2JTF A;  3T9N A;  2HAX A;  1W2B P;  1YIT Q;  1WDX A;  2AZV A;  5KYN A;  5CVI A;  3M0S A;  2EWN A;  4NL2 A;  2EIF A;  2VYT A;  1WXU A;  3JV3 A;  2YUO A;  2E6Z A;  1K0S A;  1RAG B;  3QUI A;  1PD0 A;  5FRM A;  1Q95 G;  3CME T;  1QVF P;  4D6W A;  1RAE B;  1UJ0 A;  1NEG A;  4FL6 A;  5GJW B;  1D0X A;  2JMA A;  2RQW A;  2VXF A;  4C8Q E;  2XD0 A;  2RJD A;  2KYM A;  3G71 T;  4ZNX A;  1SSH A;  3QWX X;  4K11 A;  3EGX B;  5DLQ E;  2PQW A;  2W0Z A;  1PNJ A;  3HRU A;  4RTU A;  1MMD A;  4QVC A;  3OYD A;  1G3Y A;  3EGD B;  3QHS A;  2KQW A;  2J7I A;  1NEB A;  3CC7 A;  4PJJ A;  1OZ2 A;  2K3B A;  2G3R A;  4HT9 A;  2CDT A;  2M02 A;  3OYN A;  2KAF A;  5GMK e;  2E6N A;  3OB9 A;  4JS4 A;  4ESR A;  3CCL A;  2NUZ A;  4M75 A;  3E9F A;  1MGQ A;  2FZC B;  2IPO B;  4MML A;  1NBE B;  3I56 A;  2LQK A;  4ZTF A;  1T3S A;  3M57 A;  4BUG A;  1C6V X;  4KGZ B;  5CK9 A;  1D0Z A;  2MOX A;  4MDW A;  2QYZ A;  2VGM A;  4FYV B;  2L89 A;  4WF2 A;  4J9F A;  1YJN T;  3GIB A;  1K1Z A;  4J9H A;  4MZT A;  2CP0 A;  4M77 D;  2DD4 A;  4D8K A;  3CC7 Q;  4M7D C;  5HK0 A;  2J6O A;  1M30 A;  3OYB A;  2RI5 A;  2AK5 A;  2V1Q A;  2LX7 A;  3RDV A;  2RI3 A;  5FRN A;  4E7L A;  1U1T A;  3JCM f;  4PJO B;  1X6B A;  2QK0 A;  1IGQ A;  4HVW A;  4LDY A;  4V2S A;  2GQI A;  2LX9 A;  2HCK A;  2XIC A;  2CSI A;  3MEV A;  3L2W A;  3CD6 A;  2C0I A;  4A63 B;  3I56 Q;  5KE3 A;  2EJF A;  2HEQ A;  1S72 A;  4HCK A;  3J80 E;  1UHF A;  4J7F A;  1AZE A;  1B34 A;  2V8I A;  3HPW A;  3MHX A;  2CT4 A;  4M7D B;  4OB1 B;  2CT3 A;  2FRY A;  2MYS A;  1IHV A;  1MV3 A;  2CP5 A;  1MMN A;  3HKS A;  2DMO A;  3M59 A;  4XTU A;  3CCR Q;  1ABO A;  4DBR A;  3OYJ A;  3CCJ Q;  2RN8 A;  3NPF A;  3CC7 T;  2IVW A;  2CSQ A;  3REA B;  1R77 A;  3ME9 A;  3AT1 B;  5IT9 E;  5FW9 A;  5KYU B;  3EG1 A;  2DL7 A;  1VYV A;  1JJ2 A;  2YLB A;  5GAO n;  1WXB A;  1EFN A;  1LVK A;  1I0C A;  4AFQ C;  1ZX6 A;  3H6Z A;  4JLG A;  3CD6 Q;  1KK7 A;  2RMO A;  1S72 Q;  4XU2 A;  1TUC A;  1WHM A;  1VYT A;  3I56 T;  2A3L A;  1N5Z A;  1D1A A;  1LCK A;  1RLQ C;  1JJ2 S;  1IGU A;  2D8J A;  2BIV A;  3TEE A;  4OP0 A;  1M4Z A;  4HXJ A;  4NS5 A;  3BE3 A;  5J39 A;  4CI0 C;  1XOV A;  4F7U B;  1UB4 A;  2FB7 A;  5AYF A;  3CCR T;  3QKJ A;  4X9C A;  1BIB A;  2KK4 A;  2L3P A;  4PLI A;  3VS2 A;  4A53 A;  5KCO A;  3CCJ T;  2LQ8 A;  4PK4 A;  4PFP A;  3NTI A;  2DJZ A;  3CCE A;  5GAN 3;  1UEB A;  1TG0 A;  2QGG A;  4OVA A;  4JRQ A;  4Y91 A;  1VA7 A;  1D3B A;  5D6W A;  3PIP A;  1UGR B;  1G5V A;  1UTI A;  4MZM A;  1S72 T;  4M78 D;  3J7A F;  2OTL A;  4J83 A;  4C0G A;  4QKU A;  5A0L A;  3JCM d;  2CZ0 B;  2H3E B;  1D1C A;  2LCC A;  3MPU B;  1GRI A;  4M78 G;  3M53 A;  1WXT A;  2FYK A;  2HBW A;  4KGV B;  2F69 A;  3CCQ T;  2KXC A;  2JXB A;  4M75 C;  5I11 A;  4EMG A;  5IXB A;  1W70 A;  4JZ3 A;  2XU8 A;  3OYC A;  3FIF A;  2EQJ A;  1VQ8 Q;  4Z8A A;  1QP2 A;  2EQK A;  2MI6 A;  2NUT A;  5DM7 R;  5D6Y A;  3F70 A;  2OTL Q;  2CZ1 B;  3P8D A;  3ZFJ A;  4C0D B;  1OX9 A;  1I81 A;  3JRZ A;  1U06 A;  2W10 A;  3EHR A;  1I1J A;  3EFO B;  1ABQ A;  1LJO A;  4XTW A;  3PVL A;  3RER A;  3RBB B;  1EZZ B;  1Z9Z A;  1ZLM A;  3VS7 A;  2F2W A;  3MKD A;  1K9M U;  1XNI A;  2L0A A;  3VKI A;  1XQH A;  2EYZ A;  5ECA A;  2DRM A;  2HL3 A;  3QPH A;  3ER0 A;  3LH0 A;  1VQ8 T;  4ZGD B;  2DEQ A;  1NLO C;  2DF6 A;  2XI9 A;  2FZG B;  1NYG A;  1ACM B;  3H0I A;  5HKC A;  2O4X B;  3OYE A;  2RF0 A;  1WJR A;  2ZZD A;  2E5Q A;  2M9U A;  2OTL T;  1PRL C;  3A8H B;  1BI1 A;  2H3J A;  2SEM A;  2DLP A;  3MJX A;  2HSE B;  4B9X A;  4E2F B;  1R0B G;  2IIM A;  4FSX A;  4CC3 A;  1X6O A;  3JCM c;  2VB6 A;  3LLR A;  5CKD A;  2EKH A;  2KBT A;  4XTV A;  3P8H A;  3QZ9 B;  1X27 A;  3JCM V;  4TVR A;  4OMN A;  1LPL A;  1BI0 A;  1YNZ A;  3RUX A;  3J81 E;  2DZC A;  4BY6 B;  4X34 A;  4LDV A;  1VQO A;  5AT1 B;  1QVP A;  2IG0 A;  2F5T X;  3QII A;  4IUT A;  5GAM h;  2NWM A;  2VUB A;  2DTI A;  5LJ3 f;  2LP5 A;  4M7A A;  5L23 A;  1ARK A;  3U23 A;  1PSF A;  2DL3 A;  1VQL A;  3FC3 A;  2YLC A;  5FU6 C;  3CMA A;  1W6X A;  1GCP A;  2DYI A;  2QQS A;  2HKQ B;  1ZBJ A;  3LGF A;  3PNW C;  1K8A C;  3UA6 A;  4M75 D;  1BIA A;  4ANJ A;  4BDZ A;  1KQS A;  1PM3 A;  3GBQ A;  1VQO Q;  4OGC A;  4AFS C;  2EJG A;  1RAA B;  2K5I A;  4Y28 E;  2A37 A;  4RMO A;  3QDF A;  1SRL A;  4M75 G;  1M2O A;  5FU6 B;  4II1 A;  2EYX A;  3I55 T;  5I2M A;  4DBQ A;  2YRD A;  5IHN A;  1KQS S;  2GBQ A;  3NHN A;  4J9C A;  4FT2 A;  4A4K A;  1Q7Y C;  1A0N B;  1VQL Q;  2RQR A;  3A8O B;  1TXQ A;  3CMA Q;  1V76 A;  2LTO A;  1VQK A;  1Q82 U;  1Y71 A;  4JRI A;  4N0A C;  4AFU C;  1MMA A;  2CUD A;  2L3S A;  2KT8 A;  1KC8 R;  3WVE B;  1WIE A;  1IXD A;  3UF4 A;  4J9B A;  2K4Y A;  5IH2 A;  3QBY A;  2DX1 A;  2F1L A;  3C94 A;  1VQO T;  1AWJ A;  1T3L A;  3I5S A;  5GAN 8;  4Q5W A;  1N8R R;  2JN0 A;  2KI7 A;  3BDU A;  3QYH B;  3TRE A;  2CGH A;  3RKY A;  2X3X D;  2DL8 A;  2HBP A;  1NPP A;  1E6H A;  3HSB A;  3LYI A;  4C92 F;  2OJ2 A;  1VQL T;  3FJ5 A;  4PJO E;  3DLL A;  3CMA T;  1VQK Q;  1PSE A;  4PJO F;  1Q86 U;  1RAF B;  3OS1 A;  2DNU A;  2ZCF B;  5IHI A;  5LJ3 d;  1JXO A;  2ZAE A;  4J9I A;  2DIG A;  3BDL A;  4D8D A;  4EDU A;  1R0C B;  1ZSZ C;  3TCJ A;  2D1X A;  3JCM g;  2QAZ A;  1K8A U;  2KRN A;  1YHQ T;  4C92 A;  4M7D E;  3H9N A;  1BI2 A;  3CME A;  5HCK A;  4BI3 A;  3V7R A;  5HY6 A;  1AWO A;  4HVU A;  4M7D F;  4O6J A;  1H92 A;  1M2V B;  3M4G A;  1QCF A;  2RHY A;  3JCM e;  2NUP B;  1GBR A;  1W2B A;  4L5G A;  2EGA A;  4JDS A;  5KH6 A;  2K79 A;  2KVQ G;  1ZUK A;  1K4U S;  1U8R A;  4F16 A;  4LE9 A;  2ED1 A;  4PKC C;  2DJQ A;  3CEY A;  4KUL A;  4M77 C;  3GNG A;  4UC4 A;  4VUB A;  4XU1 A;  1W2B S;  1RAD B;  1Q81 U;  1R8O B;  3TSW A;  2FHD A;  1WHH A;  2VV5 A;  2DD5 A;  1N9S A;  2DE0 X;  1JBM A;  2P4R A;  2RO0 A;  4PJN A;  5LJ5 h;  1NJI C;  4QQG A;  2EYW A;  4F7U E;  4JJN K;  4OMO A;  2P4T A;  3L42 A;  1MUZ A;  3HL8 A;  4LDX A;  4F7U F;  3QO3 A;  2KY9 A;  3MEW A;  4OMQ A;  2PU9 B;  2AT1 B;  4KRT A;  4A4E A;  3X24 B;  3P8B B;  1Y0M A;  1BU1 A;  4RKU E;  1TOV A;  3OYF A;  2YWW A;  1N27 A;  3LWH A;  1YBY A;  2L2P A;  2HQE A;  3S3M A;  1F1B B;  1GBQ A;  2AKL A;  2ZPE B;  3RMQ A;  1YJN A;  4DBH A;  4X9D A;  2E64 A;  2LRQ A;  2XKO C;  1IO6 A;  3VUB A;  3PVQ A;  1UEC A;  3G1J A;  4J9E A;  5D6X A;  3PIO A;  1GL5 A;  2X9H A;  1UJY A;  3G7Z A;  3V8L A;  2O88 A;  1QW1 A;  5CIU A;  2QQA A;  4AG2 C;  2JNG A;  5GMK j;  4IUQ A;  2A08 A;  4Y92 A;  2D0Q B;  4GY5 A;  2OTJ A;  4LUD A;  2RK1 A;  2F2X A;  4QW2 A;  3SWN C;  4RG8 A;  4PFO A;  3OYA A;  1WFW A;  3DLM A;  2NYS A;  1VQ4 T;  4C8Q F;  3L2V A;  2HSP A;  1AZG B;  2YRV A;  4A4G A;  1HXD A;  1SPK A;  1YCY A;  3VJP A;  1YJN Q;  5GAO p;  1ZHI A;  3L2Z A;  2QA4 T;  3R6N A;  3QG1 A;  3JB9 I;  4FYW B;  1KD1 C;  2GGR A;  1U1S A;  4L59 A;  1IRX A;  3ZL7 C;  3KUF A;  2VAS A;  5L8R E;  1T0H A;  4C8Q A;  5KYY A;  1H8K A;  3SWN B;  1OUL A;  3MET A;  2LT1 A;  4B6M A;  2CKK A;  4M78 C;  2E65 A;  2QTV A;  2OTJ Q;  3RIR A;  5A0G A;  1PWT A;  1B3Q A;  2O31 A;  2RHZ A;  2E12 A;  1W1F A;  4XTZ A;  3RKX A;  2WSF E;  2CS7 A;  1TUD A;  1WHL A;  2EGE A;  3CC4 T;  4KH0 B;  1M9S A;  1WX6 A;  2V1R A;  3A1P A;  5FU7 C;  4NL3 A;  3DKM A;  2R58 A;  4M4Z A;  3EFO A;  1QVG A;  2XID A;  1QLY A;  2FO0 A;  4PLL A;  3VV0 A;  3CCR A;  5C0M A;  3X20 B;  4DA4 A;  3CCJ A;  4M78 B;  2HQX A;  2Y90 A;  4AT1 B;  1VQN T;  4BI4 A;  4M77 G;  4M7A D;  2HQH A;  3M58 A;  5GAN g;  1RAI B;  2DXB A;  4FW2 A;  2OTJ T;  2HMA A;  2E5K A;  2KNB B;  4JJB A;  4M7A G;  5J3B A;  3QXE B;  2GTO A;  3MCA B;  2O4X A;  4FW1 A;  3JCM J;  2RPN A;  2KE9 A;  5GAN e;  4XAX B;  2ESW A;  2D9T A;  4FSS A;  1MNE A;  1D1B A;  1UGP B;  3ZBD A;  1KG1 A;  3Q1J A;  4Z89 A;  3CCQ A;  2LMJ A;  1QVG P;  3FRN A;  2M1H A;  1AEY A;  3E19 A;  2RQT A;  1KD1 U;  3V8K A;  3OBW A;  1KJW A;  2M0O A;  5GAO r;  4FT4 A;  1SRM A;  3VS3 A;  3GF5 A;  2SRC A;  1U5S A;  2QI2 A;  3HRT A;  1VQP A;  5KCH A;  2EAY A;  5LJ3 g;  5EG2 A;  4HVV A;  1O9S A;  4JJC A;  3VUZ A;  3I9Q A;  3UA7 A;  3FLG A;  3EAE A;  1WHJ A;  2FPE A;  4DOW A;  3BFM A;  3ZEH A;  1Y7X A;  2LZ6 B;  3M4Y A;  5LJ3 e;  5LJ5 g;  1X2K A;  3CCQ Q;  3OYH A;  2M0Y A;  5GAM f;  2GNC A;  3RNJ A;  3M56 A;  2EPD A;  3A5Z B;  1OQK A;  1KFZ A;  4A4F A;  3CPW P;  1BI3 A;  1UGV A;  1K9M R;  2RNA A;  5LJ5 e;  1FMW A;  2LCL A;  2PUK B;  1FMV A;  1K9A A;  5CKH A;  1VQ8 A;  3M0R A;  2YT6 A;  1VQP Q;  2CP2 A;  3MP8 A;  1YJ9 A;  1UGQ B;  4DEY A;  2EJ9 A;  1KHI A;  3OW2 P;  2XDB A;  2DAQ A;  1OX8 A;  1SF9 A;  2B86 A;  1BK2 A;  2QEX A;  4PJL A;  2LNV A;  1K0X A;  2V8J A;  1GCQ A;  4J6X A;  1X69 A;  2XHC A;  2PNI A;  1M8V A;  4XU0 A;  1I4K 1;  1RI9 A;  2J05 A;  1U3O A;  1D09 B;  3A98 A;  4ATO A;  4C92 D;  2D0N A;  1WJS A;  4HCZ A;  4E7J A;  1YIJ T;  2EQU A;  3QDR B;  4J9D A;  3LWI A;  3JB9 D;  2DBK A;  4PJO D;  1UG1 A;  3JCM X;  2XK0 A;  4C92 G;  1FXX A;  1YJ9 Q;  1K76 A;  1VQP T;  2JUF A;  3A8M B;  3CCV A;  1WNL A;  3JB9 G;  2O2O A;  2LNH B;  2LDM A;  2FZK B;  4PNO A;  1B07 A;  4EIK A;  2QEX Q;  3JCM b;  4ZN3 A;  1G83 A;  3TU4 K;  1K73 C;  4RCB A;  3OA6 A;  1M3C A;  2X3W D;  3OQ5 A;  2RB6 A;  1VYU A;  4M75 B;  3SDZ A;  4JUV A;  5LL6 S;  4ZN1 A;  2R57 A;  4JS5 A;  2ATC B;  1ZUU A;  3OSV A;  3I5R A;  5I22 A;  4AMC A;  1CKA A;  1YN8 A;  2P84 A;  4QQD A;  1FMK A;  4KUD K;  3CC2 A;  2EYQ A;  3HFO A;  3OS5 A;  1M90 C;  1KQ1 A;  1VUB A;  4Z88 A;  1YJ9 T;  3CCV Q;  4E7Z A;  1NE8 A;  3MEU A;  5GAN f;  1RAC B;  2DVE A;  1QKX A;  3OYG A;  2COW A;  4OMF B;  2XMF A;  2QEX T;  5I2S A;  3I55 A;  1M1G A;  3NMZ C;  2VXE A;  1OU8 A;  4RTX A;  3M0P A;  5GMK m;  4PL6 A;  5FRO A;  2NUP A;  2QQ9 A;  3UWN A;  2YSQ A;  1SEM A;  2RM4 A;  5CO7 A;  3FB9 A;  2PVO B;  1BCM A;  4DQ2 A;  2HL5 C;  1E6G A;  3OYK A;  1B34 B;  2VVK A;  2RJF A;  4OMM A;  2WAC A;  3HP9 A;  1Q82 R;  1YWO A;  2KYB A;  3HRS A;  3CC2 Q;  8ATC B;  1JRI A;  2QGF B;  3GP8 A;  2GTJ A;  4EMK A;  4OF1 A;  2PTK A;  2DTO A;  3WXM B;  5GAO q;  3CCV T;  4FM4 B;  4QQ6 A;  3OYY A;  3QJ6 A;  1GFD A;  3I55 Q;  4KUI A;  5CR2 A;  5GAO l;  3VRZ A;  1X43 A;  2JW4 A;  3CQT A;  3OS2 A;  2DBM A;  1K73 U;  1NZ9 A;  1WYX A;  5GMK i;  2BZX A;  4ELY C;  2A7Y A;  1Y57 A;  4LDU A;  1V1C A;  5CKF A;  4EMH A;  3PTA A;  5CCA A;  5LJ5 f;  1UFF A;  4C8Q D;  2EQM A;  2J6K A;  3LX7 A;  4E7H A;  5GAN 5;  1OV3 A;  1Q86 R;  1FYN A;  2CP6 A;  1CKB A;  3D7S B;  3EGU A;  3CC2 T;  2L5Q A;  4C8Q G;  1YHQ A;  3H41 A;  1M90 U;  5CQX A;  2BUD A;  9ATC B;  4DOV A;  3L2Q A;  3EH2 A;  2QQR A;  4RCC A;  1K8A R;  1VQ7 A;  4OB3 B;  4BAC A;  1JO8 A;  3NTH A;  1GXI E;  4WTO B;  4ZGJ B;  2KMT A;  1D3B B;  3ASK A;  5DLO A;  4IIO A;  4C5I A;  5GAN d;  3E9G A;  5DY9 A;  3EGX A;  3A8G B;  5GMK h;  3L2U A;  1PKT A;  3JCM W;  1VIF A;  4XU3 A;  2RJC A;  2K7A A;  4BB7 A;  3EGD A;  3H8Z A;  3G6E T;  1PKS A;  4R0K A;  3CCS T;  1YHQ Q;  1Q81 R;  1KC8 C;  2WSC E;  2ABL A;  1AD5 A;  1VQ7 Q;  1KIK A;  4JPB W;  4J5Y A;  3G4S A;  3DB4 A;  4Z02 A;  2JJ9 A;  2D6F A;  2F2V A;  4M78 E;  1UGS B;  2HD0 A;  1N8R C;  1I5L A;  2LQN A;  1C1A A;  2NUT B;  2KDS A;  4M78 F;  4RTW A;  1PRM C;  5EC7 A;  3R6O A;  5FWB A;  4DEX A;  1VQ9 Q;  3JB9 J;  3EH1 A;  3VS1 A;  3KXT A;  1WHG A;  3S3N A;  1OEB A;  2CUB A;  2LJ0 A;  5GAN 7;  2DK3 A;  1AWX A;  2V26 A;  1YP5 A;  2O9S A;  5FWC A;  4JRK A;  1PG5 B;  4ZTJ A;  3G4S Q;  1VQ7 T;  3FEO A;  5LJ5 d;  1ZBX A;  4N4H A;  4OMP A;  4CC7 A;  5HK3 A;  1M1K C;  4XQ3 A;  4P5N A;  4PJO A;  1TS9 A;  4BE1 A;  2D8H A;  5GAO m;  2PUO B;  1YCS B;  3FDR A;  1ZA1 B;  1RUW A;  1IB8 A;  4WCI A;  4C5E A;  1RLP C;  1VQ4 A;  2DA9 A;  1Q7Y U;  2RQV A;  3GNF B;  4IUP A;  1ZSZ B;  1SSF A;  3E1S A;  3CXC P;  2XDP A;  2MWP A;  2RQU A;  4N4I A;  1VQ9 T;  4M7D A;  4C5G A;  4KT0 E;  4MZP A;  2QA4 A;  4N4G A;  2J6F A;  4BI8 B;  2CRE A;  2RD1 A;  2K3X A;  4M7A C;  3PE0 A;  4F04 B;  3CCM T;  1VQ6 T;  2CP7 A;  2DVJ A;  2RA2 A;  5C6S A;  4PFZ A;  5A0D A;  2DEU A;  5KYU A;  1YI2 A;  1FWZ A;  1X75 C;  3G4S T;  2EVR A;  4RTT A;  1WJQ A;  4HCB A;  5KYW B;  1G2B A;  2QDL A;  1LNX A;  4JZ4 A;  4M77 B;  4RUG A;  2EGC A;  2Y4X A;  1VQ4 Q;  2E4H A;  2EFI A;  1MHN A;  3CC4 A;  1C0M A;  4M7A B;  1MV0 B;  1NLP C;  4CC4 B;  1BKB A;  5GAM g;  2QA4 Q;  2DXU A;  3SFM A;  4MMK A;  2BTT A;  2JMC A;  2YUQ A;  4F7U A;  1SHF A;  2GF7 A;  1TSF A;  3OYI A;  3CBO A;  1W4S A;  1VQN A;  5GAM e;  5GAN 4;  1ZQ1 A;  1OZ3 A;  2L8D A;  1J3T A;  1YI2 Q;  3LH5 A;  2K5L A;  1AT1 B;  2E3H A;  1M3A A;  1M1K U;  3M5A A;  2BKD N;  2K2V A;  2KRS A;  4PJM A;  3QYG B;  4KBM B;  4IKF A;  4R55 A;  3CC4 Q;  3QSU A;  4GLM A;  3VU3 C;  2LT4 A;  2E41 A;  3EHQ A;  3LW5 E;  1I07 A;  4XTY A;  2DL5 A;  1BB9 A;  2DET A;  3SHW A;  1M3B A;  4J9G A;  1QP3 A;  3INZ A;  3VS5 A;  4F17 A;  4LD6 A;  1G8X A;  2ENM A;  3A8L B;  1QCN A;  3AHU A;  1RAH B;  2MPX C;  2QTX A;  4OGE A;  2L3R A;  3O5Z A;  1VQN Q;  1YIT T;  2QXF A;  4M75 E;  4ZGE B;  1QWE A;  2QQB A;  4LD9 K;  1KD1 R;  4HCC A;  2RI2 A;  1YI2 T;  2KRO A;  4M75 F;  2YXY A;  2JM9 A;  2AIR B;  1NJI U;  1ZA2 B;  5FLX E;  3OMC A;  3CBM A;  1UE9 A;  1KHC A;  2VGN A;  2X51 A;  2E1H A;  2MF2 A;  3PFS A;  3EG9 B;  1S1N A;  3PMI A;  2PZ1 A;  1G3S A;  1DJ7 B;  5GAN j;  2L3Q A;  3L2R A;  4BE2 A;  2ZPH B;  1WA7 A;  4C92 C;  4ME7 A;  1BBZ A;  2FVU A;  2MWO A;  3PMT A;  1X01 A;  2K3Y A;  2M16 A;  2ROL A;  4PJO C;  3M0U A;  3EFS A;  2VWF A;  1BYM A;  4AG1 C;  2DKG A;  3CBP A;  2A0F B;  2JTM A;  1QVG S;  1RI0 A;  2EYY A;  3PT9 A;  2FG0 A;  1AVZ C;  3EFR A;  4E6R A;  4FYX B;  5FU7 B;  1YJW A;  2P0Q A;  2YHT A;  3OS0 A;  2KEA A;  4C92 B;  3M9Q A;  2QAS A;  3OYM A;  1AWW A;  2C0O A;  3V7S A;  4GBQ A;  4JLI A;  4C0F A;  1UUE A;  4LUE A;  3M0Q A;  5LJ3 j;  3CCL Q;  4DBF A;  3JAM E;  2OAW A;  1SG5 A;  1Y96 B;  2LJ3 A;  3CPW A;  2X35 A;  2AZS A;  2DM1 A;  1LOJ A;  1YIJ A;  1M8M A;  5KYX B;  4EPC A;  4CC2 A;  5LJ5 j;  2BE9 B;  2FPD A;  3OW2 A;  1CSK A;  2FEI A;  1B7T A;  3VS6 A;  2CZ6 B;  2ZPB B;  1M1F A;  1YJW Q;  3CPW S;  3SEM A;  2COZ A;  1H3H A;  4J8O A;  1WZO A;  2G6F X;  2DO3 A;  4FIB A;  2RHI A;  3EG2 A;  3TQ7 P;  4OB2 B;  3OMG A;  1WHK A;  3OW2 S;  7AT1 B;  1VQM A;  5GMK l;  8AT1 B;  2HNI A;  4E7I A;  3HHT B;  3CCL T;  3M55 A;  4E47 A;  1AOJ A;  2BZ8 A;  1YWP A;  1YIJ Q;  4X1V A;  4F14 A;  1GFC A;  2H8H A;  4MDX A;  2ED0 A;  4E7K A;  2CZ7 B;  5KE2 A;  3UT1 A;  3GLX A;  2DXC A;  3OSS C;  1X6G A;  1YJW T;  1K9M C;  4OB0 B;  1HD3 A;  2DPP B;  2EKO A;  1M5Q 1;  2GCX A;  3JCM Q;  1I8F A;  5A2Q E;  1WLP B;  3QWY A;  2ZPG B;  1VQM Q; 
#chains in the Genus database with same CATH homology
 2RHY A;  3JCM e;  4LDW A;  3CCL A;  2DZ9 A;  1WQW A;  1W2B A;  1K73 U;  4L5G A;  3JCM P;  4C8Q C;  2X4W A;  1NZ9 A;  4M75 A;  1Y07 A;  1FX7 A;  4JDS A;  3E9F A;  5GMK i;  5KH6 A;  1MGQ A;  4ELY C;  2A7Y A;  4MML A;  2GFA A;  2KVQ G;  3CD6 T;  2XDD A;  3WVD B;  3I56 A;  1U8R A;  2LQK A;  4ZTF A;  4LDU A;  5CKF A;  4EMH A;  2ZPF B;  3L1A A;  3M57 A;  4C5H A;  3PTA A;  5CCA A;  4PKC C;  1VIE A;  3CEY A;  4A54 A;  5LJ5 f;  1WGS A;  4KUL A;  4M77 C;  4BUG A;  3GNG A;  4UC4 A;  3NFC A;  4C8Q D;  2EQM A;  4VUB A;  4XU1 A;  2LVM A;  5CK9 A;  3LX7 A;  4E7H A;  2P0P A;  5GAN 5;  4MDW A;  1W2B S;  3SB2 A;  2VGM A;  1Q81 U;  2L89 A;  4WF2 A;  1R8O B;  1YJN T;  3GIB A;  4C0D C;  1WQ7 A;  4MZT A;  2FHD A;  4M77 D;  3CC2 T;  2DD4 A;  2L5Q A;  4C8Q G;  2VV5 A;  1YHQ A;  4M7D C;  5GAO l;  5HK0 A;  3OYB A;  2RI5 A;  2DD5 A;  2JOY A;  1N9S A;  5CKB A;  5CQX A;  2BUD A;  4PJO G;  4DOV A;  3L2Q A;  4RCC A;  2QQR A;  3X25 B;  1M90 U;  1VQ7 A;  4OB3 B;  2RI3 A;  4C8Q B;  5FRN A;  4BAC A;  1JBM A;  1IZ6 A;  1U1T A;  3JCM f;  3VYG A;  2RO0 A;  4E7L A;  4PJO B;  3NTH A;  5CKE A;  5LJ5 h;  1NJI C;  4LDY A;  4QQG A;  4V2S A;  4F7U E;  4M7D D;  1GXI E;  2LX9 A;  4JJN K;  2K57 A;  1VQM T;  4ZGJ B;  2P4T A;  2XIC A;  3L42 A;  2KMT A;  3HL8 A;  4LDX A;  3MEV A;  1D3B B;  4F7U F;  3L2W A;  3CD6 A;  2R5A A;  4C0Z A;  3QO3 A;  4N0A A;  2KY9 A;  3MEW A;  1O75 A;  1IRE B;  3ASK A;  5KE3 A;  2EJF A;  5DLO A;  1S72 A;  2MAM A;  4IUR A;  2PU9 B;  3HFN A;  3JSC A;  4A4E A;  3X24 B;  3J80 E;  3KBG A;  3P8B B;  4J7F A;  4O5V A;  4C5I A;  4M7D G;  4RKU E;  5GAN d;  1B34 A;  3E9G A;  5DY9 A;  2V8I A;  3OYF A;  1N27 A;  3HPW A;  1YBY A;  1EIF A;  2CYZ B;  3A8G B;  3MHX A;  5GMK h;  3LWH A;  3L2U A;  2HQE A;  3S3M A;  2PVD B;  4M7D B;  2B8A A;  4OB1 B;  3X28 B;  1VIF A;  3JCM W;  4XU3 A;  2LC4 A;  2ZPE B;  3JCM h;  3RMQ A;  4XTX A;  1YJN A;  3V8J A;  2RJC A;  3C95 A;  4X9D A;  4BB7 A;  2E64 A;  2LRQ A;  2DTH A;  2MMP A;  3H8Z A;  2XKO C;  3HKS A;  3G6E T;  2GFU A;  3M59 A;  1WPY A;  3DB3 A;  4XTU A;  3VUB A;  3X26 B;  2X4J A;  3CCS T;  5D6X A;  1KC8 C;  2X4X A;  2WSC E;  3OYJ A;  3PIO A;  4M7D E;  3S3O A;  3CC7 T;  3G7Z A;  2IVW A;  5GAM d;  2JVV A;  3V8L A;  3ME9 A;  4JRP A;  1QW1 A;  5IT9 E;  5CIU A;  4J5Y A;  3G4S A;  2QQA A;  3DB4 A;  2JNG A;  3CPF A;  4Z02 A;  5GMK j;  5CAI A;  1RL2 A;  1JJ2 A;  4IUQ A;  2YLB A;  5GAO n;  2D6F A;  1TH7 A;  3H6Z A;  3CCE T;  2D0Q B;  4GY5 A;  5J26 A;  2OTJ A;  4JLG A;  1UGS B;  4M78 E;  2HD0 A;  2RK1 A;  4A4H A;  1N8R C;  1I5L A;  4QW2 A;  3SWN C;  2RK2 A;  2KDS A;  4M78 F;  4RG8 A;  4XU2 A;  3OYA A;  3VYH B;  3DLM A;  3I56 T;  2A3L A;  1VQ4 T;  4C8Q F;  3R6O A;  3BY7 A;  3L2V A;  2RHU A;  4BY6 C;  2YRV A;  1JB0 E;  1JJ2 S;  2BIV A;  3TEE A;  4OP0 A;  4A4G A;  1HXD A;  4M77 E;  3JB9 J;  1M4Z A;  1YCY A;  3VJP A;  3KXT A;  4NS5 A;  4F7U G;  5J39 A;  5GAO p;  3G6E A;  1P92 A;  3S3N A;  3MEA A;  1ZHI A;  4M77 F;  3L2Z A;  4CI0 C;  1XOV A;  1XTD A;  3CCS A;  2QA4 T;  5GAN 7;  3QG1 A;  3JB9 I;  2DK3 A;  1UB4 A;  4F7U B;  3BW1 A;  1Q82 C;  2FB7 A;  1KD1 C;  5AYF A;  3CCR T;  3QKJ A;  4X9C A;  1BIB A;  2KK4 A;  4PLI A;  4A53 A;  5KCO A;  4M7A E;  1U1S A;  4L59 A;  3UDC A;  3CCJ T;  1VQ5 T;  4JRK A;  2LQ8 A;  4ZTJ A;  1KQ2 A;  3KUF A;  4YTL A;  1VQ7 T;  3FEO A;  4M7A F;  5L8R E;  4C8Q A;  5LJ5 d;  1ZBX A;  4N4H A;  3SWN B;  5HK3 A;  1M1K C;  4XQ3 A;  4P5N A;  3MET A;  3NTI A;  2DJZ A;  2LT1 A;  2NLU A;  2CKK A;  3CCE A;  4BE1 A;  2AHJ B;  1UEB A;  4M78 C;  5GAN 3;  2E65 A;  2E10 A;  5GAO m;  3RIR A;  4OVA A;  4JRQ A;  2PUO B;  5A0G A;  2E70 A;  3FDR A;  4Y91 A;  4BDY A;  3RMS A;  5M9O A;  1D3B A;  5D6W A;  4M77 A;  3PIP A;  1UGR B;  1G5V A;  2RHZ A;  4C5E A;  1VQ4 A;  2E12 A;  1Q7Y U;  3UPU A;  4XTZ A;  3MP6 A;  4MZM A;  1S72 T;  3RKX A;  2WSF E;  2CS7 A;  4M78 D;  3GNF B;  4IUP A;  3SD4 A;  2OTL A;  3J7A F;  4J83 A;  3CC4 T;  1M9S A;  1SSF A;  3E1S A;  5FU7 C;  4C0G A;  2XDP A;  2MWP A;  5A0L A;  3JCM d;  2CZ0 B;  3DKM A;  4NL3 A;  2R58 A;  4N4I A;  1VQ9 T;  2ZGW A;  4M7D A;  2R5M A;  2LCC A;  4C5G A;  1QVG A;  2XID A;  4KT0 E;  4MZP A;  2QA4 A;  4N4G A;  4PLL A;  4BI8 B;  2RD1 A;  1G3T A;  4L6V 5;  4M78 G;  3VV0 A;  3M53 A;  2K3X A;  3CCR A;  5C0M A;  3X20 B;  4M7A C;  2FYK A;  3CCM T;  1VQ6 T;  2F69 A;  2WSE E;  4DA4 A;  1Q86 C;  3M54 A;  3CCJ A;  3CCQ T;  4M78 B;  2RA2 A;  2HQX A;  5C6S A;  3JB9 H;  4M75 C;  4FU6 A;  4EMG A;  2Y90 A;  5A0D A;  1VQN T;  2XU8 A;  3OYC A;  1FWZ A;  1X75 C;  3FIF A;  4BI4 A;  4M77 G;  3G4S T;  1YI2 A;  4M7A D;  3M58 A;  1WJQ A;  4HCB A;  2EQJ A;  4J6W A;  5GAN g;  1LNX A;  2DXB A;  2RJE A;  1QP2 A;  2EQK A;  4M77 B;  4R56 A;  2OTJ T;  2MI6 A;  5IAY A;  2Y4X A;  2EFI A;  3PGG A;  5DM7 R;  1MHN A;  2X4Y A;  4M7A G;  5D6Y A;  3F70 A;  4NOY A;  3QXE B;  5J3B A;  3CC4 A;  3MCA B;  2CZ1 B;  2K5F A;  2Y4Y A;  3P8D A;  3GOX A;  2O4X A;  3JCM J;  3ZFJ A;  4C0D B;  1I81 A;  3JRZ A;  4M7A B;  1VQ9 A;  5GAN e;  4XAX B;  2D9T A;  1BKB A;  5GAM g;  1LJO A;  1UGP B;  3ZBD A;  4CRI A;  2DXU A;  4XTW A;  3SFM A;  4MMK A;  1KG1 A;  3CCM A;  3Q1J A;  1VQ6 A;  3RER A;  4HA8 A;  3MO8 A;  4B9W A;  2RHX A;  3CCQ A;  4F7U A;  3RES A;  3FRN A;  2V8K A;  1AHJ B;  2KSS A;  2M1H A;  3E19 A;  3C12 A;  2GF7 A;  3OYI A;  1KD1 U;  3CBO A;  1W4S A;  3V8K A;  3OBW A;  1K9M U;  1VQN A;  1XNI A;  5GAM e;  2M0O A;  5GAN 4;  5GAO r;  1ZQ1 A;  1OZ3 A;  2L8D A;  4FT4 A;  1Q81 C;  3VKI A;  1XQH A;  3SWN A;  2K5L A;  3GF5 A;  3QPH A;  4PJO A;  2DIQ A;  1M1K U;  2QI2 A;  3ER0 A;  3URG A;  3LH0 A;  3HRT A;  3M5A A;  1H64 1;  2BKD N;  3MP1 A;  3QJY A;  1VQP A;  5KCH A;  2K2V A;  4ZGD B;  3CXC A;  1VQ8 T;  2EAY A;  2DEQ A;  5LJ3 g;  5EG2 A;  2RH2 A;  3QYG B;  4KBM B;  2XI9 A;  4IKF A;  1O9S A;  5HKC A;  2O4X B;  3VUZ A;  4R55 A;  3OYE A;  3VU3 C;  3OBY A;  3RKW A;  1WJR A;  2LT4 A;  2ZZD A;  3FLG A;  5I21 A;  2E41 A;  2E5Q A;  2M9U A;  3EAE A;  3LW5 E;  4XTY A;  2OTL T;  1G3W A;  4J6Y A;  4DOW A;  3A8H B;  3CCU A;  3BFM A;  1BI1 A;  3ZEH A;  1QP3 A;  3INZ A;  2H3J A;  1Y7X A;  2VC8 A;  1NPR A;  4IUV A;  3M4Y A;  4LD6 A;  4XK8 E;  4C92 E;  5LJ3 e;  4B9X A;  3A8L B;  4BE0 A;  5LJ5 g;  3CXC S;  2F5K A;  4FSX A;  5CQY A;  1X6O A;  4HKE A;  3JCM c;  3AHU A;  3GPL A;  3OYH A;  3LLR A;  1HK9 A;  5GAM f;  5CKD A;  1V29 B;  3M56 A;  2QTX A;  4M78 A;  4OGE A;  4XTV A;  2L3R A;  3A5Z B;  3JB9 F;  3P8H A;  1YIT T;  3QZ9 B;  2QXF A;  4M75 E;  4ZGE B;  4A4F A;  5GAN h;  2QQB A;  3JCM V;  3C4S A;  1BI3 A;  4TVR A;  4LD9 K;  1H3Z A;  4HCC A;  5LJ5 e;  1BI0 A;  2RI2 A;  1YI2 T;  2LCL A;  4M75 F;  2PUK B;  5CKH A;  3RUX A;  3J81 E;  1OI1 A;  1VQ8 A;  2DZC A;  4BY6 B;  1NJI U;  5FLX E;  2GQV A;  4X34 A;  3OMC A;  4LDV A;  3MP8 A;  1YJ9 A;  3CBM A;  1VQO A;  1UGQ B;  1KHC A;  1OYX A;  3V7C A;  2VGN A;  1QVP A;  2E1H A;  2EJ9 A;  1KHI A;  2IG0 A;  2MF2 A;  3PFS A;  1N9R A;  2F5T X;  5IN1 A;  3QZ5 B;  2DAQ A;  3QII A;  3OYL A;  4QVD A;  2XDB A;  3PMI A;  4IUT A;  5GAM h;  3S6W A;  1G3S A;  2QEX A;  1DJ7 B;  5GAN j;  3L2R A;  2VUB A;  2DTI A;  5LJ3 f;  4EMK C;  2XG8 D;  2FL7 A;  4BE2 A;  2LNV A;  4HT8 A;  2ZPH B;  3LGL A;  2V8J A;  4C92 C;  4M7A A;  4ME7 A;  2O01 E;  3FJP A;  2FVU A;  2C06 A;  2MWO A;  3PMT A;  1PSF A;  1X01 A;  2K3Y A;  4J6X A;  2XHC A;  4ELZ C;  1M8V A;  2I2L A;  2PVG B;  2M16 A;  4RG2 A;  3OY9 A;  1VQL A;  3G71 A;  4PJO C;  1Y96 A;  4XU0 A;  1I4K 1;  3FC3 A;  3EFS A;  2YLC A;  5FU6 C;  3CMA A;  1BYM A;  4ATO A;  4C92 D;  2DKG A;  1YIT A;  5GAM j;  1KC8 U;  3CBP A;  1WJS A;  1VQK T;  2QQS A;  4GLK A;  4HCZ A;  4QVZ A;  2EQU A;  3QDR B;  4E7J A;  1YIJ T;  2JTM A;  3LWI A;  1QVG S;  1RI0 A;  3LGF A;  3JB9 D;  4PJO D;  4IUU A;  3PT9 A;  3PNW C;  3JCM X;  5LJ3 h;  1K8A C;  2P0K A;  2XK0 A;  4C92 G;  1FXX A;  3EFR A;  4BD3 A;  4M75 D;  1BIA A;  5FU7 B;  4BDZ A;  3N5B B;  1YJW A;  1KQS A;  1QVF A;  2P0Q A;  4EMK B;  4OGC A;  2YHT A;  3OS0 A;  2JUF A;  3A8M B;  4J7I A;  4C92 B;  3M9Q A;  2EJG A;  1VQP T;  3CCV A;  1N8R U;  1WNL A;  3JB9 G;  3OYM A;  2LDM A;  2K5I A;  4Y28 E;  2ZPI B;  4PNO A;  3V7S A;  3JCM b;  4RMO A;  2QDY B;  5GAN 2;  4ZN3 A;  4M75 G;  4JLI A;  4C0F A;  3TU4 K;  1K73 C;  4RCB A;  3OA6 A;  1N6A A;  5FU6 B;  2JZ2 A;  4II1 A;  3NTK A;  5I2M A;  5GAN 6;  5LJ3 j;  3OQ5 A;  3I55 T;  2RB6 A;  3CCU T;  4M75 B;  3SDZ A;  1KQS S;  3JAM E;  1Q7Y C;  4A4K A;  4FT2 A;  1QVF S;  2DXT A;  4JUV A;  5LL6 S;  1Y96 B;  3O8V A;  4ZN1 A;  2R57 A;  4JS5 A;  2OAU A;  3CPW A;  3A8O B;  2X35 A;  3OSV A;  2JTF A;  3T9N A;  1LOJ A;  2HAX A;  2LTO A;  1VQK A;  1Q82 U;  1YIJ A;  1Y71 A;  4JRI A;  4N0A C;  5CVI A;  4EPC A;  5LJ5 j;  4QQD A;  2EWN A;  4NL2 A;  2EIF A;  3OW2 A;  4KUD K;  3WVE B;  2VYT A;  2CZ6 B;  2K4Y A;  3CC2 A;  2ZPB B;  3QBY A;  1M1F A;  2EYQ A;  3HFO A;  3OS5 A;  3CPW S;  1M90 C;  1KQ1 A;  1VUB A;  2E6Z A;  1YJ9 T;  3C94 A;  4J8O A;  1VQO T;  1NE8 A;  3MEU A;  5GAN f;  5GAN 8;  3QUI A;  4Q5W A;  5FRM A;  2DO3 A;  4FIB A;  2RHI A;  2DVE A;  3OYG A;  3CME T;  4D6W A;  3QSU A;  2JN0 A;  4OB2 B;  4OMF B;  3OMG A;  3BDU A;  3QYH B;  2QEX T;  5I2S A;  3I55 A;  1M1G A;  1VQ5 A;  3OW2 S;  4FL6 A;  2VXE A;  5GMK l;  1VQM A;  3TRE A;  2CGH A;  3RKY A;  2HNI A;  5GMK m;  4E7I A;  4PL6 A;  5FRO A;  2HBP A;  3HHT B;  1NPP A;  3CCL T;  2QQ9 A;  3HSB A;  3LYI A;  2VXF A;  3UWN A;  4C92 F;  4C8Q E;  3M55 A;  2XD0 A;  2RJD A;  4E47 A;  1VQL T;  3G71 T;  2RM4 A;  5CO7 A;  4PJO E;  3FB9 A;  2PVO B;  3DLL A;  4DQ2 A;  3CMA T;  3OYK A;  1B34 B;  1PSE A;  2RJF A;  5DLQ E;  2PQW A;  4PJO F;  1Q86 U;  3HRU A;  2WAC A;  3HP9 A;  3OS1 A;  2ZCF B;  4MDX A;  5LJ3 d;  4QVC A;  4E7K A;  3OYD A;  1G3Y A;  2CZ7 B;  5KE2 A;  2DIG A;  3BDL A;  3HRS A;  2KQW A;  3QHS A;  3UT1 A;  4EDU A;  3TCJ A;  3GLX A;  2DXC A;  3OSS C;  1JRI A;  3JCM g;  1K8A U;  3GP8 A;  3CC7 A;  1YJW T;  1K9M C;  4EMK A;  4OB0 B;  1OZ2 A;  4OF1 A;  1YHQ T;  2DTO A;  2G3R A;  3WXM B;  4C92 A;  2DPP B;  1BI2 A;  2EKO A;  5GAO q;  1M5Q 1;  4FM4 B;  2GCX A;  3CME A;  3CCV T;  4BI3 A;  3V7R A;  3JCM Q;  5HY6 A;  4QQ6 A;  4HT9 A;  4M7D F;  3OYY A;  1I8F A;  2KAF A;  3OYN A;  3QJ6 A;  4O6J A;  5A2Q E;  5GMK e;  2E6N A;  4KUI A;  2ZPG B;  3OB9 A;  5CR2 A;  3M4G A;  3OS2 A;  4JS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...