4X9DA

High-resolution structure of hfq from methanococcus jannaschii in complex with ump
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'NFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ1435
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
total genus 10
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x9dA00
4WF2A 4C8QF 4EMKB 4XTUA 4X9DA 3L1AA 5I21A 5GMKe 4M7AB 5LJ5j 2JN0A 5GAOr 4M7DA 3INZA 3V7CA 4M77A 4M75G 2DJZA 4MMKA 4EMGA 4EMKA 4XU2A 5LJ5d 1N9RA 5GANf 5GAN4 4OP0A 4JUVA 1B34B 3JCMh 4M75F 3RKYA 1D3BA 2YHTA 4C8QA 3JCMJ 4M78C 5GAOn 1JRIA 2E65A 4M7DD 2EWNA 4M77D 3FIFA 5DY9A 5GANd 3JCMf 3JCMX 3QHSA 4V2SA 5GMKj 4Y91A 2DXUA 4F7UG 4M78E 4M75A 2EAYA 4F7UB 5GMKm 3SWNC 5GAOq 2FB7A 1I4K1 1B34A 4DQ2A 5GMKi 3JB9D 1YCYA 4NL3A 2VXEA 4M7AD 1M8VA 2EJGA 1KQ2A 4C92G 3FJPA 2DTOA 4JRIA 1KQ1A 4M77F 3V7SA 4C92B 4HA8A 5GANe 1WNLA 5GAN8 5GAN7 4PJOC 5LJ5g 3RKWA 2DXTA 4F7UA 3JB9G 3JCMP 3HFNA 4M7AG 4J6YA 2FYKA 4N0AA 4RCCA 3JCMe 3EFRA 1MGQA 3JB9F 4PNOA 4M7AF 3BFMA 5GANg 4PJOE 4C92A 4A54A 4EMKC 5GANj 2I2LA 4X9CA 4HT8A 4XTXA 2RB6A 4JRKA 3RIRA 3SB2A 4C8QC 2DVEA 3JCMg 4M7AA 4C92D 3RESA 2E64A 3L2ZA 3RERA 1TH7A 4M78G 5CAIA 4M78B 2ZGWA 4XU0A 5GAN2 4C8QE 4F7UF 5GMKl 1X01A 4XU3A 4M75C 4A53A 4J6WA 3JCMd 2E10A 3JCMW 2RA2A 3PGGA 3SWNB 4M7DF 4C92F 3HFOA 1Y96B 4EMHA 4M75E 3JB9J 4M78A 3M4GA 5LJ3h 1N9SA 3BDUA 5GAMh 1M5Q1 3QUIA 5GAN5 4XTVA 2YLCA 1WQWA 4J6XA 2RM4A 3JCMQ 4PJOG 3JCMb 3HSBA 2K57A 4PJOB 5LJ3f 5GAMf 1I5LA 4M78D 1HK9A 4M7DC 4HT9A 4M77C 1U1SA 3SWNA 1H641 3BW1A 1Y96A 4QVCA 5GAOm 4M7DE 2E41A 2E1HA 1LJOA 4M77E 3V7RA 1BIAA 4MMLA 3RUXA 4XU1A 1BIBA 1I81A 2DZCA 2RD1A 4XTZA 3JCMc 3V8KA 5LJ5h 4M7AC 4PJOA 4C8QB 4M78F 2QTXA 1LOJA 3BY7A 5LJ5f 4J5YA 5GANh 5GAN6 1WQ7A 2VC8A 5GAMe 5LJ3e 4PJOD 4M7AE 3EFSA 4XQ3A 3QO3A 2HNIA 4XTWA 2EJ9A 4M75B 2DZ9A 1WPYA 4NOYA 3JCMV 3V8LA 3JB9H 5GMKh 3RKXA 3AHUA 3GIBA 3JB9I 3VU3C 2Y90A 2DEQA 4N0AC 2DTIA 5LJ3g 2VXFA 5GAMg 4NL2A 3FB9A 1U1TA 4PJOF 5LJ3j 3V8JA 4JLIA 4C8QD 1JBMA 5GAMj 5GAN3 4C92C 1I8FA 4F7UE 2DKGA 5LJ5e 4RCBA 5LJ3d 5GAMd 4M7DG 1LNXA 4M77G 4M7DB 3QSUA 4M77B 5GAOp 4QVDA 4XTYA 5GAOl 4M75D 4C8QG 4C92E 2EJFA 1D3BB 1HXDA 2CGHA 2YLBA 2DTHA
chains in the Genus database with same CATH superfamily
4RKUE 1AWXA 2JMAA 4MMKA 4EMGA 2XKOC 2RQRA 5D6YA 2M0OA 2QQ9A 5KYUB 1UGRB 4J9CA 3ULRB 1PC0A 3PVQA 1VQ5A 5DLQE 4A4GA 2COYA 4F7UB 2LCSA 5CKBA 2F5KA 2ZPHB 3PT9A 3FRNA 5LL6S 1M27C 1W70A 1X75C 3OS0A 1UE9A 2X3XD 2FRYA 3CCUA 1VQ8Q 1M1GA 1X2KA 4QT7A 3TSWA 2JS2A 4JRKA 4CC2A 3E19A 2LT4A 3M57A 3TVTA 1YHQA 3U23A 2X4WA 3JAME 3VS1A 4C8QE 4F7UF 2EPDA 2LC4A 2YXYA 1JB0E 1VQ5Q 3HRSA 4LXCA 3SWNB 1ARKA 1SRLA 2RI2A 4BUGA 1Y96B 3EGDB 4M75E 4JJCA 2KSSA 4J6XA 2PZ1A 2DM1A 1PKSA 3OYKA 1Q86U 4LD9K 1VQ7Q 2R5AA 1D0YA 1K1ZA 3MKDA 2RNAA 4DA4A 3PMIA 1SHFA 2EQUA 2JXBA 5GAOm 1VIFA 2E1HA 3M0TA 3V8KA 2O9VA 4LDWA 4M7AC 2JM8A 4ZN3A 3FJ5A 3J7AF 4QKUA 1H3ZA 3OSSC 1WQ7A 4FYXB 1YHQQ 3MEUA 5GMKh 3WXMB 1M4ZA 2DETA 2LX7A 3EFOB 3H8ZA 1I8FA 2DKGA 2RK2A 1LNXA 2L3RA 3OY9A 4LD6A 4AT1B 1G3TA 1K8AU 3LGLA 4XU0A 3WVDB 2AKLA 2JTEA 2ZPFB 1QVGP 1YP5A 1JO8A 2K5IA 4J9IA 2EFIA 5HCKA 4ANJA 5GAOr 3EG9B 1WYXA 4M7DA 2BTTA 2KAFA 1Y07A 3M0RA 1PM3A 1FMKA 2DK3A 3QHSA 2D0QB 4FYVB 1M90R 5A0GA 1U06A 4PK4A 4ZTJA 1YWOA 1VQ6T 4HVUA 4JRIA 3QKJA 1M9SA 4PJOC 2GTJA 1XTDA 1AEYA 2OTJA 4D6WA 1MGQA 1WA7A 3VS3A 1NBEB 1NJIU 2I2LA 1RADB 2RB6A 3JCMg 3QJYA 4RG2A 4M7AA 4E7JA 1SSFA 3OQ5A 3JCMd 1X01A 1X2QA 4XU3A 1FX7A 1O9SA 5KYNA 1TTHB 5KCOA 2GFUA 4RMOA 3O5ZA 3PFSA 5GAN5 3CCVA 3PIPA 2AT1B 4FU6A 3ZFJA 2KBTA 2OTJQ 3A1PA 1K4US 1Q7YU 2OX7A 1R8OB 2P0QA 2GBQA 2M02A 5GANh 2AIRB 3MEWA 4LDYA 4AMCA 2HNIA 1SF9A 3HPWA 4PKCC 2DL8A 2KVQG 1VYUA 2D1XA 2O4XA 2JT4A 3L2RA 5KH6A 2E6ZA 1K73R 4F7UE 3G7ZA 1TG0A 3CCVQ 1W2BS 2FZKB 3CCMQ 1K9MR 1V1CA 2HQXA 3IQLA 4PFOA 1ZA1B 2BZYA 3L1AA 2M1HA 1WFWA 2JN0A 2KGTA 1RAEB 3CCRT 5FU6B 3PVLA 1WDXA 2YHTA 2CREA 4M7DD 1X6GA 1JXMA 3CCLA 1G3YA 3HRUA 3JCMX 1M2OA 4CC7A 1LPLA 1B34A 3UPUA 2HBWA 1T3SA 2PUOB 2EQJA 1KQ1A 2GNCA 2CZ0B 3G6ET 3I5SA 2NUTB 3RKWA 1VQOA 4O5VA 3ER0A 1WHHA 2YDLA 3C94A 3GNFB 2CYZB 3OBYA 5GANg 1P92A 2KR3A 1VQNA 5GANj 1G8XA 2D9TA 2KYMA 2DD5A 2CSIA 4OMMA 5CAIA 4M78B 2LRQA 3I56Q 2EBPA 3RR6A 3CCLQ 1TS9A 1QCOA 3NTKA 3OYFA 2QQBA 2DL5A 2FO0A 1D0ZA 3BDUA 4JS4A 1BU1A 3DKMA 2L8DA 3H0IA 3GF5A 4HVVA 1JJ2S 2LJ1A 1C1AA 1QCFA 4J9DA 5FW9A 3CC7T 1ZA2B 1WX6A 3J80E 1WLPB 1KQSP 1LJOA 4EMKB 4XU1A 4XTZA 1VQNQ 4YTLA 4M78F 1TU0B 2CZ1B 3E9FA 5GAN6 2K5FA 1RLPC 2RHUA 3FEOA 3JB9H 3V8LA 1Y57A 2HQHA 3SEMA 2DXCA 2DIQA 3X20B 5GAMg 2LNHB 2YUPA 5GAMj 1I1JA 5A0DA 2NUPB 1X27A 4LDXA 2F2XA 4C92C 5GAMd 1BBZA 4M77B 1TOVA 4XTYA 4PL6A 2VWFA 3C95A 1WGSA 4FYWB 3OYLA 4C0DC 3HHTB 1GCQC 4AFUC 5C0MA 2E65A 2PVDB 1NYGA 1YITQ 9ATCB 3JCMf 2EGCA 3OYDA 3CC2A 1PWTA 1I4K1 5FU7C 1S1NA 2GTOA 3LWIA 2DJQA 1CKBA 2CT4A 5J26A 2LJ3A 4M77F 5GAN7 3I55T 2DBKA 3QWYA 4N0AA 3JCMe 4F16A 3VS2A 1VQ8T 1QVFS 1FWZA 4A54A 1Y0MA 2FHDA 2E3HA 3RIRA 1MV3A 3OSVA 1T0HA 3RESA 2X51A 4A4FA 2K5LA 2L3PA 5I2SA 3NGPA 1VQ5T 1W2BP 5EG2A 2ECZA 1BI0A 2XU8A 3CC2Q 1UDLA 2ZPEB 1M90C 1MMNA 2RHXA 4PJOG 3HSBA 1VQ7T 2ABLA 1H641 5CO7A 3OYJA 2M0YA 1LVKA 4MMLA 1C0MA 5IT9E 1LOJA 4IUUA 2A28A 2RI5A 2DL7A 1BI2A 1GCQA 2MCNA 3QO3A 1K76A 4XTWA 1QW1A 3JCMV 1VQMA 1QVFA 3RKXA 1BCOA 3AHUA 1OYXA 1DJ7B 1JXOA 1D09B 3VRZA 4C8QD 3SDZA 4A63B 3PMTA 2QG9B 3QSUA 1PD1A 4M75D 5HY6A 3VS7A 5IAYA 1XNIA 4WF2A 1X43A 1AOJA 5KYXB 3GBQA 2OAWA 3CCJA 2DJZA 2DA9A 4RTTA 5GANf 1GRIA 2B86A 1UECA 3S6WA 1C6VX 4KGXB 2JTMA 2A08A 3RDVA 1VQMQ 1IREB 1JJ2P 3LWHA 4M78E 3E9GA 1MMGA 2HKQB 4R55A 5GMKi 2RI3A 1XQHA 3JB9D 1ACMB 1Y7XA 2EJGA 5GAN8 3FJPA 1TUGB 4FYYB 5GANe 3C0CA 4HA8A 4N4GA 1OU8A 5GJVB 2PVOB 2DXTA 4F7UA 4FW2A 1M90U 2A0FB 2R5MA 1M8MA 4PNOA 4EPCA 2XD0A 4RUGA 3HRTA 5CQYA 4XTXA 2DVEA 4DBQA 3CCJQ 2CUDA 2BZ8A 5IHKA 5CKFA 2MK5A 3UATA 2QASA 4DBHA 5GMKl 1B3QA 5FRNA 2VGMA 2LVMA 1K9AA 3OYHA 1A0NB 1KIKA 2RK1A 4JZ3A 2PUKB 2YUQA 3QUIA 4LDVA 4ME7A 2D8JA 1ZSGA 3CPWA 2X4XA 5D7UA 5GAMf 3SWNA 2I0NA 3OB9A 3TEEA 2OTLA 1Y96A 2LCCA 2NYSA 3EGDA 4ZN1A 4J9EA 1K0XA 2D0NA 1YCSB 1IGQA 4VUBA 4M77E 2QGFB 2J06A 5HK0A 2E4HA 4HCBA 1WHMA 1GXIE 2QTXA 2ED0A 1G2BA 3VS4A 1RI0A 5GAMe 3EFSA 2DPPB 3OS5A 4NOYA 4C5GA 2BZXA 2CT3A 1BKBA 1UB4A 2DEQA 1U1TA 1H8KA 3MPUB 3CCMT 1NM7A 3NHNA 3JV3A 4PJNA 1MUZA 1PNJA 1QQJA 2QEXT 1MHNA 1MNEA 3P8HA 5CIUA 4WTOB 1AD5A 3OS1A 3CCEA 4XU2A 4LN2A 1UTIA 1K9MU 4IKFA 4HCKA 5CVIA 4CC4B 1M30A 2LCLA 4TVRA 3OA6A 1VQ9T 3QBYA 1RLQC 1U8RA 4C92G 1YWPA 2HSPA 2KQWA 1FYNA 4ESRA 1U5SA 2XICA 1PSEA 3CCSA 1YI2A 4N4HA 3KFVA 4E7HA 1AWOA 3RMSA 1WHKA 4HT8A 3EG3A 2FZCB 5FRMA 4E7KA 2KRMA 4RTZA 3CCEQ 3I56T 2ZGWA 2CSQA 2Y4XA 4PLIA 2DVJA 1IB8A 3M0UA 1K8AC 3H0HA 2DILA 2RQVA 1N9SA 2YLCA 2KT1A 3JCMQ 5D6WA 2RN8A 4C0FA 2CS7A 4M7DC 1TXQA 2EYWA 1VQLQ 1VYTA 4LE9A 3G71T 1YI2Q 4HT9A 1PCXA 1I81A 2X4YA 3A5ZB 2VUBA 5L8RE 4JRPA 2LJ0A 2NLUA 1RAFB 2QTVA 3OYMA 2E12A 2HKNA 1GBQA 1YFNA 2K3YA 4QVZA 3CQTA 3JB9I 3UF4A 1OULA 2QAZA 2XIDA 1NJIC 1ZBJA 4KH0B 2HMAA 2DX1A 3CCUQ 1RACB 1V76A 1VQKA 2DTHA 2P0PA 4KBMB 2LT1A 1QVPA 1QCNA 1KC8R 4FSXA 1KK7A 4MZPA 3JCMh 1YITT 4F04B 4J9HA 4A4HA 5CQXA 4ZTFA 1G83A 1XOVA 5CR2A 3S3NA 2ZAEA 1Q7YC 4OMFB 2X4JA 3M55A 4DEYA 2A37A 4BACA 2DF6A 2NUZA 3JCMP 3HFNA 1AWWA 2FZGB 4LUDA 1IO6A 1M1KR 1NG2A 1VQKQ 4E2FB 2EGAA 2HBPA 1IHVA 2COWA 1Q82R 1VQ4A 4LUEA 2E64A 1Z9QA 1ABOA 1RL2A 2MYSA 4RTVA 2JZ2A 1NEGA 1NE8A 3EG2A 2CP0A 2RF0A 4BI3A 3P8BB 4M78A 2RH2A 5M9OA 4GLMA 1VQPA 4PFPA 2WACA 3OS2A 2EW3A 3CMEA 3CCQA 2EYXA 1F1BB 3V7RA 1OX9A 3VS6A 3L2QA 1I5OB 2P4RA 1IRXA 3EAEA 2HAXA 2YWWA 1Q81R 1R77A 4J5YA 4JPBW 1VQ4Q 2KEAA 4EIKA 3CXCS 3UT1A 3OYGA 2MMPA 5LJ3g 1NLPC 1AHJB 2DBMA 3LH5A 5LJ3j 4IURA 5LJ3d 1W4SA 1QLYA 3HL8A 1VQPQ 5IN1A 1UGSB 4QVDA 1YJNT 3NFCA 1KD1C 2M9UA 4FCYA 3CMEQ 3CCQQ 2YLBA 2NUPA 4E7IA 5DLOA 1WHLA 4JS5A 4M77A 1TUDA 1N9RA 1S72A 1WXUA 1ZLMA 4JJDA 2L2PA 5GMKm 1MV0B 1EZZB 4DEXA 2Y4YA 3G4SA 1LCKA 4Z8AA 4BDZA 1KG1A 2ROLA 5IHNA 2C06A 3CXCA 3H9NA 1PHTA 4ATOA 2QQAA 3HKSA 3QZ5B 7AT1B 2KRNA 2MPXC 5IXBA 2QA4T 4Z88A 4C8QC 1YIJT 1NYFA 2M16A 4KH1B 2DFUA 3UA7A 1S72Q 4M75C 1RABB 4ZGJB 2RMOA 4KT0E 4ELZC 3JB9J 4K11A 5GAMh 2FPEA 3MP8A 2L3QA 3QXEB 4UC4A 1R0CB 5D6XA 4M78D 2EGEA 1UGQB 3QIIA 1I5LA 3OYAA 3CMAT 3X25B 2MF2A 4BY6C 1PD0A 1G3WA 3QWXX 1KD1U 3RBBB 3RNJA 3I9QA 2RQUA 2K3BA 1O75A 2BIVA 2J6FA 2PVGB 4PJMA 1RAHB 4IUVA 1VOMA 2W0ZA 4QW2A 2GGRA 2KDSA 2DL4A 3QDFA 3SHWA 4N0AC 2JNGA 4HCZA 4JLIA 5GAN3 1VQOQ 3OW2S 1X6OA 4M7DG 1WJSA 1WXTA 2MIOA 1QKWA 2EJFA 1NZ9A 3CC4T 4M7AB 5LJ5j 2BE9B 5LJ5d 2GQIA 1D1CA 3M0PA 4C8QA 4F14A 4M77D 5KYXA 1I0CA 3E1SA 4Z89A 4M75A 1E6HA 3N5BB 3PNWC 2X35A 2LQKA 4M7AG 2FYKA 4M7AF 1ZSZC 2PNIA 4OB2B 1OPKA 5CCAA 1VIEA 2FPFA 5CKDA 3OW2A 5A2QE 4M4ZA 1E6GA 4QQGA 4JJBA 3EGXB 2RQTA 4OMNA 5GAN2 1KC8C 4HVWA 2JS0A 2YRVA 3M5AA 4OMLA 2O4XB 1T3LA 2EYYA 3HFOA 1WJRA 5HKCA 4ZGEB 1PSFA 3GNGA 2RM4A 1VQLT 4IIMA 4BE2A 4PJOB 5LJ3f 1TUCA 2LQ8A 4FIBA 2IG0A 4AFSC 1VQ6A 1KJWA 2DAQA 4J8OA 4QVCA 2KI7A 2A3LA 2E41A 4CC3A 2DYIA 1UUEA 2YRCA 3VJPA 3A8GB 2L0AA 1M1KC 4IIOA 5LJ3e 2CZ6B 1NEBA 1FMWA 4BD3A 2DZ9A 1WPYA 2ZCFB 3MP6A 4JDSA 4ORZA 5C6SA 1UJ0A 4PJOF 2XDDA 4C5IA 2VGNA 4RCBA 3CCUT 3VYGA 3OYYA 1YHQT 2OAUA 1ZSZA 2KK4A 2EYZA 2JM9A 1UFFA 4GY5A 2B8AA 4FT2A 5GAOn 4BE1A 1SRMA 2GCXA 2O9SA 3SWNC 1KC8U 2LMJA 2CH4W 4ELYC 1ZHIA 2RPNA 1QWEA 1VYVA 1PRLC 2E5QA 2ESWA 4J6YA 2HCKA 1OI1A 4X1VA 2KXCA 2CP7A 1M3CA 1GBRA 2KY9A 2OI3A 1SG5A 4J9BA 3CPWS 3VUZA 3CBOA 1AVZC 3MEVA 3CCRA 5KYUA 1N8RR 1M1KU 1UGVA 1KHIA 1Q82U 1UG1A 1R0BG 3NMZC 2DMOA 4GLKA 2HQEA 1M5Q1 1WI7A 1K73C 4OB1B 2J6KA 2AZVA 2L3SA 3JCMb 2CUBA 4AG1C 2EQKA 3F70A 2AK5A 2RJFA 3BW1A 2AHJB 2G3RA 1K9MC 2QYZA 1FXXA 3EH1A 1IHWA 2ENMA 3G6EA 2YT6A 3A98A 1HJDA 3RUXA 2RD1A 3JCMc 4O6JA 2CH4A 1AZEA 1UEBA 3FDRA 1YJ9A 1RAGB 5LJ5f 3ASKA 2JTFA 4M7AE 2BKDN 2K6DA 2DE0X 2RJEA 4FSSA 3TQ7P 3CD6A 4L5GA 1Q81U 3FB9A 2OTJT 1BI3A 1V29B 2DERA 3E2UA 1VQPT 5LJ5e 2LP5A 2OJ2A 2G6FX 3CMET 4RG8A 2XK0A 5DM7R 2DYBA 3ZBDA 5FWBA 4J7IA 1D3BB 2HEQA 4X34A 3VRYA 5I21A 3I35A 3MEAA 3G6EQ 4KUIA 4B6MA 3FC3A 3CC7A 2RHZA 3NPFA 3X24B 2ED1A 2C0OA 2H8HA 3H41A 1YJ9Q 1BCMA 1U3OA 1JRIA 1W6XA 2LTOA 3MHXA 1BYMA 1QVFP 3CCVT 2F2WA 1M3AA 4Y91A 2GF7A 3CD6Q 1QVGS 2PU9B 5J39A 3J81E 4C92B 2RO0A 1WNLA 3EFOA 2OTLQ 2XHCA 3X28B 1SSHA 1K73U 1X6BA 2MWOA 2LX9A 4KUDK 2MAMA 2CDTA 3BDLA 3KBGA 4PJOE 2F69A 1ZUYA 2JW4A 2LDMA 3SFMA 4C0DB 3DLLA 3OBWA 1HYOA 4OMOA 3EG9A 1TH7A 2PQWA 4RTXA 3DB3A 2FG0A 3M9QA 4E6RA 2RA2A 5FU7B 4C92F 3L42A 4B9XA 4OGEA 2DL3A 4RTWA 2LQWA 1WQWA 2XI9A 1BI1A 3UWNA 5I22A 3GLXA 2K4YA 3I55A 2JJ9A 4OVAA 2YUOA 2VYTA 2J05A 1QVGA 1ZBXA 1EX4A 4IUQA 3LX7A 3CCLT 5FU6C 2O88A 2CP3A 1GCPA 2ZPIB 5A0LA 3OYBA 3WVEB 3GP8A 5FROA 2GFAA 1GFCA 3L2UA 3VUBA 3QDRB 1VQOT 1B07A 3NTIA 1B7TA 3PIOA 5KYWB 4JJNK 3CPWP 2FEIA 3CCSQ 1VQNT 1D0XA 2H3JA 5KYYB 4FT4A 1ZQ1A 4AFZC 2YUNA 1VQ7A 3I55Q 3DLMA 4XTUA 2R58A 4IUTA 2F5TX 3V7CA 1H3HA 3PTAA 3M56A 1HSQA 3QZ9B 4IUPA 4JUVA 2EQIA 3A8LB 4M78C 2EWNA 2JMCA 1IGUA 3QYHB 4J9GA 2E70A 4F7UG 5GAOq 4NL3A 4KULA 1M2VB 1UJYA 2MWPA 3GPLA 4OMPA 2D8HA 1AT1B 5I2MA 4FL6A 4OB0B 3MO8A 4EMKC 1YN8A 1M1FA 2FL7A 1KSWA 1SPKA 1WHJA 3EGUA 2FPDA 1EFNA 3M58A 3QG1A 2E10A 3M54A 3UA6A 2DRMA 2KXDA 1JQQA 4F17A 4XAXB 1PKTA 5LJ3h 3DB4A 3AT1B 2HD0A 2EVRA 2JUFA 1HK9A 2C0TA 4M77C 1U1SA 3Q1JA 2NWMA 2NUTA 4QQDA 3QPHA 1BB9A 1N5ZA 2SRCA 4MDXA 4FW1A 5EC7A 1N6AA 2DLPA 4JLGA 2ROTA 3BY7A 1YJWA 3CC2T 2VC8A 1ZUKA 1OOTA 2YRDA 5J3BA 2C0IA 2LNVA 2K2VA 4CRIA 2KYBA 1EIFA 1KQSS 2WSFE 1N8RC 4PFZA 3QYGB 3R6OA 3CPFA 2VB6A 4PJJA 5ECAA 4C92E 1HXDA 4LDUA 3LLRA 1NLOC 4BI4A 5HK3A 4EMKA 4OP0A 2K9GA 1YJWQ 2ZPGB 3OYIA 2E5KA 5DY9A 5GMKj 3EHRA 1TSFA 2DXUA 4EDUA 2KROA 2FB7A 1YCYA 3I5RA 3D7SB 3KXTA 1ABQA 3ZL7C 2QQRA 2EKOA 1CSKA 2DO3A 3CCMA 1KQSA 2EQMA 5IH2A 3TREA 2CP5A 1VQMT 3R6NA 2L5QA 3SB2A 3VV0A 1K0SA 4C5EA 2QEXA 5IHIA 2F2VA 3RERA 3M0QA 1OQKA 3G1JA 2E3IA 1CKAA 4FM4B 4JRQA 2O31A 4BDYA 4EMHA 3EGXA 2QQSA 2DD4A 4XTVA 4QQ6A 1N8RU 1VQ9A 2R57A 3CCJT 1NPPA 3M59A 3MCAB 4HXJA 2K3XA 4MDWA 2X3WD 2M51A 1RUWA 3S3OA 2F1LA 5LJ5h 4NS5A 4PJOA 5I11A 1VA7A 2RJDA 4RTUA 3META 3X26B 2QEXQ 3MP1A 3H6ZA 4XQ3A 2EKHA 2E6NA 2XG8D 1ZX6A 3G4SQ 3I56A 4DBFA 2V8KA 3VU3C 4DOVA 2K7AA 1FMVA 3V8JA 2P4TA 4A4EA 3VYHB 4KGVB 2XMFA 4M7DB 1OU9A 3CBMA 1VQ9Q 2IVWA 2W10A 3A8MB 3QJ6A 3JSCA 4B9WA 2BE7D 2MOXA 4LNPA 3L2WA 3OYCA 3G71A 3A8OB 1YJ9T 1J3TA 1N27A 1WJQA 3HP9A 4OGCA 3OMCA 1GFDA 5GANd 2RQWA 1TWBA 1W2BA 3CD6T 2EAYA 1ZUUA 2CZ7B 4HKEA 1RI9A 4DQ2A 3GOXA 1OZ2A 4M7AD 1H92A 3MJXA 2OTLT 1M8VA 1KQ2A 4M7DF 1KHCA 1QKXA 5LJ5g 1MNDA 2KRSA 1Q95G 4C5HA 1E7OA 2H3EB 2QDYB 3JRZA 4DOWA 2O2OA 3G71Q 3L2ZA 4M78G 1WZOA 2P84A 4A53A 1Q86R 1RAAB 3PGGA 3M53A 2AZSA 4Y92A 1YITA 2QI2A 1BK2A 2QXFA 2CP6A 2K2MA 1OEBA 2EYQA 3CXCP 1UGPB 3CCET 2WSEE 5IXFA 4AG2C 1WIEA 4A4KA 1JEGA 1IZ6A 2DIGA 3LGFA 4PJOD 1Z9ZA 2L89A 2GQVA 4Y28E 1JJ2A 1K8AR 2Y90A 3REBB 2VXFA 2ZZDA 1T0JA 2RHIA 3PE0A 3CCST 1YI2T 2Z0WA 2VV5A 3KUFA 4M77G 1I07A 5GAOl 2HDAA 3TU4K 3P8DA 2DNUA 2A7YA 2JOYA 3UDCA 5GMKe 5KE3A 1AZGB 3CBPA 2KNBB 1Q82C 1B34B 1D3BA 5CK9A 1RAIB 4ZNXA 4GBQA 1YNZA 3VS5A 1KFZA 3OYNA 2JVVA 2V8JA 3O8VA 1PRMC 2VXEA 2FVUA 2DTOA 1NJIR 1PG5B 3LYIA 2QGGA 1OZ3A 1VQ6Q 4D8KA 3TCJA 3THKA 1D1BA 5AT1B 4RCCA 1HD3A 1SKUB 3EFRA 4J9FA 4AFQC 3CEYA 2X9HA 4MZTA 4R0KA 4C92A 2COZA 1YJNA 1AWJA 4XK8E 4Z02A 2HL3A 2HSEB 3ZEHA 1Y71A 3ME9A 1Q81C 2IIMA 5KE2A 2ZPBB 4ZGDB 1D1AA 3T9NA 4J6WA 1VUBA 2SEMA 1OV3A 6AT1B 3VS0A 3M4GA 4JZ4A 4E7LA 5L23A 4OF1A 1YBYA 4CI0C 1Q7YR 1NPRA 1VQKT 2CP2A 4MZMA 1QMCA 4KRTA 3RMQA 3A8HB 4R56A 4BE0A 1JU5C 4M7DE 1G3SA 1BIBA 3M4YA 3OW2P 3L2VA 4C8QB 1YJNQ 3REAB 1MMAA 5FWCA 1SHGA 1OPLA 2QA4A 4M75B 1YIJA 4HCCA 2DEUA 3URGA 4E7ZA 4KGZB 4NL2A 4J83A 3LH0A 2YSQA 3C4SA 1WXBA 3OMGA 3LW5E 2QDLA 3S3MA 4C8QG 2RHYA 4BY6B 2HL5C 4P5NA 1VQ4T 2V26A 1X69A 2KMTA 4C8QF 4X9DA 5KYWA 4E7SA 4C0ZA 3INZA 4M75G 3CMAA 1UHCA 1YJWT 5KYYA 5GAN4 2VKNA 2J6OA 2K79A 2AKKA 3C12A 5KCHA 4M75F 3RKYA 5CKEA 3OYEA 3CCRQ 3JCMJ 1GL5A 3FIFA 1W1FA 4V2SA 2QA4Q 3HTRA 1MMDA 2LQNA 1YIJQ 2KT8A 2BUDA 2QK0A 2VASA 3CCQT 2D6FA 3V7SA 1XJWB 3NTHA 3EG0A 3JB9G 4C0GA 2HZYA 1KD1R 2J7IA 3JB9F 2V1RA 3FLGA 3BFMA 4OMQA 4D8DA 1M2VA 2WSCE 3M0SA 4X9CA 2V1QA 8ATCB 2XDPA 3H0FA 4C92D 1M3BA 3CMAQ 4BB7A 4PJLA 3CC4A 3SD4A 2FRWA 2DRKA 4OB3B 4WCIA 3JCMW 4L6V5 5CKHA 2LZ6B 4BI8B 2O01E 3VKIA 4E47A 2K57A 2P0KA 2MI6A 2VVKA 2IPOB 4PLLA 3EH2A 1IXDA 1ZSZB 2XDBA 1S72T 3CC7Q 3TSZA 1BIAA 1OX8A 4DBRA 2DZCA 5GJWB 1QP3A 4N4IA 4Q5WA 4J7FA 2ATCB 1UHFA 2EIFA 2PTKA 2CKKA 8AT1B 3CC4Q 3EHQA 2EJ9A 3G4ST 1WHGA 2DXBA 5FLXE 2V8IA 1G5VA 4RTYA 3GIBA 2A36A 2KE9A 2DTIA 5AYFA 4L59A 1Q86C 1SEMA 1QP2A 1JBMA 1QWFA 2RJCA 3EG1A 4II1A 5GAOp 3BE3A 2CGHA 1VQ8A 1VQLA
chains in the Genus database with same CATH topology
4LDUA 4WF2A 3LLRA 4BI4A 4RKUE 4M7AB 5HK3A 5LJ5j 3CCJA 4MMKA 2DJZA 4EMGA 4EMKA 5LJ5d 2XKOC 5GANf 4OP0A 5D6YA 2M0OA 4C8QA 2QQ9A 3S6WA 1UGRB 2ZPGB 3OYIA 4M77D 5DY9A 1VQ5A 5DLQE 2JTMA 3E1SA 4A4GA 5GMKj 1IREB 2DXUA 3LWHA 4M78E 3E9GA 4M75A 4EDUA 4F7UB 2FB7A 4R55A 5CKBA 3N5BB 5GMKi 2RI3A 1XQHA 3PNWC 1YCYA 2F5KA 1Y7XA 2ZPHB 3FRNA 3PT9A 2X35A 3JB9D 2EJGA 5LL6S 5GAN8 3FJPA 5GANe 3KXTA 4HA8A 4N4GA 2LQKA 2PVOB 2QQRA 2DXTA 2EKOA 4F7UA 1M90U 4M7AG 2R5MA 2FYKA 1X75C 3OS0A 4PNOA 4M7AF 4EPCA 2XD0A 2DO3A 4OB2B 3CCUA 5CCAA 3CCMA 1KQSA 2EQMA 1M1GA 1VIEA 3HRTA 5CQYA 3TREA 4XTXA 5CKDA 3OW2A 1VQMT 3VV0A 2L5QA 4JRKA 3SB2A 5A2QE 2DVEA 3E19A 4C5EA 2LT4A 3M57A 2QEXA 1YHQA 3RERA 4QQGA 5CKFA 2X4WA 5GAN2 3JAME 4C8QE 1KC8C 4F7UF 5GMKl 5FRNA 2VGMA 2LC4A 4FM4B 2YRVA 3M5AA 2LVMA 4JRQA 2O4XB 3OYHA 1JB0E 3HRSA 3SWNB 2RK1A 2RI2A 3HFOA 4BUGA 1WJRA 1Y96B 4M75E 4EMHA 4BDYA 2QQSA 5HKCA 2DD4A 2KSSA 2PUKB 4ZGEB 1PSFA 3QUIA 3GNGA 4LDVA 4XTVA 4ME7A 4J6XA 2RM4A 1VQLT 4QQ6A 4BE2A 4PJOB 3CPWA 2X4XA 2LQ8A 5LJ3f 5GAMf 3OYKA 1Q86U 2R57A 4FIBA 1N8RU 1VQ9A 3SWNA 4LD9K 2IG0A 3CCJT 3OB9A 3TEEA 2R5AA 1Y96A 2LCCA 1NPPA 2DAQA 4J8OA 3M59A 3MCAB 3PMIA 4ZN1A 4QVCA 4DA4A 2EQUA 2K3XA 5GAOm 4MDWA 1VIFA 2A3LA 4VUBA 2E41A 2E1HA 4M77E 3S3OA 5HK0A 5LJ5h 4NS5A 3V8KA 4LDWA 4HCBA 4M7AC 4PJOA 4ZN3A 1GXIE 2QTXA 3A8GB 3VJPA 2RJDA 3J7AF 3META 1M1KC 1H3ZA 3OSSC 1RI0A 1WQ7A 3X26B 5GAMe 2CZ6B 5LJ3e 3EFSA 3MP1A 3H6ZA 4XQ3A 2DPPB 3MEUA 3OS5A 4NOYA 2DZ9A 1WPYA 2ZCFB 2E6NA 3MP6A 2XG8D 4C5GA 5GMKh 3WXMB 4JDSA 1BKBA 1M4ZA 1UB4A 3I56A 2V8KA 3VU3C 2DEQA 5C6SA 4DOVA 1U1TA 4PJOF 3V8JA 3H8ZA 2XDDA 2P4TA 1I8FA 2VGNA 2DKGA 3VYHB 4A4EA 4C5IA 2RK2A 4RCBA 3CCMT 3CCUT 1LNXA 2L3RA 3OY9A 4M7DB 3VYGA 4LD6A 1G3TA 3CBMA 3OYYA 1K8AU 2IVWA 3A8MB 3LGLA 3QJ6A 2QEXT 1MHNA 3JSCA 4XU0A 3WVDB 4B9WA 2ZPFB 1YHQT 2OAUA 3P8HA 2K5IA 5CIUA 2EFIA 3L2WA 5GAOr 3OYCA 4M7DA 3G71A 2KK4A 3A8OB 3OS1A 1YJ9T 3CCEA 4XU2A 1N27A 4GY5A 2B8AA 4FT2A 2KAFA 1K9MU 1WJQA 3HP9A 5GAOn 4IKFA 1Y07A 4OGCA 3OMCA 5GANd 4BE1A 2DK3A 5CVIA 1W2BA 3QHSA 2GCXA 2D0QB 2LCLA 4TVRA 3CD6T 5A0GA 2EAYA 2CZ7B 3OA6A 3SWNC 4HKEA 4ZTJA 1VQ9T 1KC8U 4DQ2A 3GOXA 3QBYA 1OZ2A 4M7AD 4ELYC 2OTLT 1ZHIA 1U8RA 1KQ2A 4C92G 1VQ6T 4M7DF 4JRIA 3QKJA 1M8VA 1M9SA 1KHCA 2KQWA 4PJOC 2E5QA 1XTDA 5LJ5g 2XICA 4J6YA 2OTJA 1PSEA 4C5HA 4D6WA 3CCSA 1YI2A 1MGQA 1OI1A 4N4HA 2KY9A 4E7HA 2QDYB 3JRZA 1NJIU 2I2LA 3RMSA 4HT8A 5FRMA 3CPWS 2RB6A 4DOWA 3JCMg 4E7KA 3QJYA 4RG2A 3VUZA 4M7AA 3L2ZA 4E7JA 1SSFA 4M78G 3CBOA 3I56T 3OQ5A 2ZGWA 2Y4XA 3JCMd 1X01A 3MEVA 4XU3A 4A53A 4PLIA 1FX7A 3CCRA 1O9SA 1M1KU 1KHIA 5KCOA 1K8AC 3PGGA 3M53A 2GFUA 1YITA 2QI2A 1Q82U 4RMOA 2QXFA 1N9SA 4GLKA 2HQEA 1M5Q1 3PFSA 5GAN5 3CCVA 1K73C 4OB1B 2YLCA 3JCMQ 3PIPA 3JCMb 5D6WA 4C0FA 2CS7A 4M7DC 2EQKA 3F70A 2EYQA 2RJFA 3BW1A 2AHJB 1UGPB 2G3RA 4FU6A 3G71T 1K9MC 3ZFJA 3CCET 1FXXA 2WSEE 3G6EA 4A4KA 3RUXA 4HT9A 1I81A 2RD1A 4O6JA 3JCMc 1Q7YU 1R8OB 1IZ6A 2P0QA 1UEBA 2DIGA 3FDRA 2X4YA 3A5ZB 1NZ9A 2VUBA 3LGFA 1YJ9A 5L8RE 4JRPA 5LJ5f 5GANh 3ASKA 3MEWA 2NLUA 4PJOD 2JTFA 4M7AE 4LDYA 2BKDN 2HNIA 3OYMA 2E12A 2L89A 2RJEA 2GQVA 3HPWA 4PKCC 4Y28E 1JJ2A 2K3YA 4QVZA 3CD6A 2KVQG 3JB9I 2Y90A 2O4XA 2VXFA 2ZZDA 4L5GA 1Q81U 3FB9A 2OTJT 3L2RA 1BI3A 2RHIA 3CCST 2XIDA 1YI2T 1V29B 1NJIC 1VQPT 5KH6A 2E6ZA 4F7UE 5LJ5e 2VV5A 3G7ZA 3KUFA 1W2BS 4M77G 3CMET 5GAOl 4RG8A 2XK0A 5DM7R 3ZBDA 4J7IA 3TU4K 1D3BB 2HQXA 3P8DA 4X34A 1VQKA 2P0PA 2DTHA 2A7YA 2JOYA 4KBMB 3UDCA 2LT1A 3L1AA 5I21A 2M1HA 3MEAA 5KE3A 5GMKe 2JN0A 3CBPA 1QVPA 4KUIA 3CCRT 3FC3A 3CC7A 5FU6B 2RHZA 1Q82C 3X24B 4FSXA 1B34B 4MZPA 3JCMh 1YITT 1D3BA 2YHTA 5CK9A 1JRIA 4M7DD 2LTOA 3MHXA 4A4HA 3CCLA 1G3YA 3HRUA 1BYMA 3JCMX 5CQXA 3OYNA 3CCVT 4ZTFA 4Y91A 1XOVA 2JVVA 2GF7A 2V8JA 3O8VA 1B34A 5CR2A 3S3NA 1QVGS 3UPUA 2VXEA 2PU9B 2PUOB 5J39A 2EQJA 2FVUA 3J81E 2DTOA 1Q7YC 1KQ1A 3LYIA 2RO0A 4C92B 4OMFB 2X4JA 1WNLA 3M55A 1OZ3A 2CZ0B 3G6ET 2XHCA 3RKWA 3X28B 4BACA 1VQOA 3TCJA 4O5VA 3HFNA 3ER0A 3JCMP 1K73U 4RCCA 3EFRA 2MWOA 3C94A 3GNFB 2CYZB 2LX9A 3CEYA 3OBYA 4KUDK 2MAMA 3BDLA 4MZTA 3KBGA 5GANg 4PJOE 2F69A 4C92A 1P92A 1VQNA 5GANj 2LDMA 3SFMA 2D9TA 4C0DB 3DLLA 1YJNA 2DD5A 3OBWA 4XK8E 2HBPA 4Z02A 3ZEHA 1Y71A 3ME9A 1Q81C 1VQ4A 2E64A 1TH7A 5KE2A 2PQWA 2ZPBB 4M78B 5CAIA 4ZGDB 2LRQA 3DB3A 1RL2A 3M9QA 3T9NA 2JZ2A 4J6WA 1VUBA 1NE8A 2RA2A 3NTKA 3OYFA 2QQBA 5FU7B 4BI3A 4C92F 3L42A 3P8BB 4M78A 2RH2A 3M4GA 3BDUA 4OGEA 4B9XA 5M9OA 4JS4A 4E7LA 4OF1A 1YBYA 4CI0C 1NPRA 1WQWA 3DKMA 2L8DA 1VQKT 4MZMA 1VQPA 2XI9A 1BI1A 3GF5A 3UWNA 2WACA 3OS2A 1JJ2S 3RMQA 3A8HB 4R56A 3GLXA 2K4YA 3CMEA 3CCQA 3CC7T 3I55A 3J80E 4OVAA 4BE0A 4M7DE 2VYTA 1QVGA 3V7RA 1ZBXA 1LJOA 4EMKB 1G3SA 4IUQA 1BIBA 4XTZA 3M4YA 3LX7A 4XU1A 3L2QA 4YTLA 3L2VA 3CCLT 4C8QB 4M78F 3EAEA 2CZ1B 2HAXA 5FU6C 3E9FA 4J5YA 5GAN6 2K5FA 2ZPIB 5A0LA 2RHUA 3FEOA 3WVEB 3OYBA 3GP8A 2QA4A 4M75B 2GFAA 5FROA 2OTLA 3JB9H 3V8LA 1YIJA 4HCCA 3L2UA 3CXCS 3UT1A 3OYGA 2MMPA 2DXCA 3VUBA 2DIQA 3URGA 3X20B 5LJ3g 3QDRB 5GAMg 1VQOT 3NTIA 4NL2A 1AHJB 4J83A 3LH0A 5LJ3j 5GAMj 3PIOA 5A0DA 4LDXA 4C92C 4IURA 4JJNK 5LJ3d 5GAMd 1W4SA 3HL8A 1VQNT 3C4SA 3OMGA 4M77B 3LW5E 2H3JA 5IN1A 1UGSB 4QVDA 4XTYA 4PL6A 3S3MA 1YJNT 3NFCA 1KD1C 2M9UA 4FT4A 4C8QG 2RHYA 1ZQ1A 1WGSA 3C95A 4BY6B 4P5NA 1VQ4T 2YLBA 4E7IA 1VQ7A 2KMTA 4C8QF 3DLMA 4X9DA 4XTUA 2R58A 5DLOA 4IUTA 3OYLA 4C0DC 3HHTB 2F5TX 3INZA 3V7CA 4C0ZA 4M77A 4M75G 3PTAA 3M56A 3CMAA 4JS5A 1YJWT 5C0MA 5GAN4 1N9RA 3C12A 3QZ9B 4IUPA 4JUVA 4M75F 3RKYA 5CKEA 5KCHA 3OYEA 3JCMJ 1S72A 3A8LB 4M78C 2E65A 2PVDB 2EWNA 3FIFA 3QYHB 2E70A 3JCMf 4V2SA 3OYDA 4F7UG 3CC2A 5GMKm 2BUDA 5GAOq 1I4K1 5FU7C 3LWIA 2Y4YA 4NL3A 4KULA 5J26A 3G4SA 3CCQT 2D6FA 3V7SA 4M77F 4BD3A 2MWPA 5GAN7 3I55T 3NTHA 3GPLA 4BDZA 1KG1A 2C06A 5I2MA 3JB9G 4C0GA 4N0AA 3CXCA 3JCMe 4FL6A 1VQ8T 3JB9F 3FLGA 3BFMA 4OB0B 1QVFS 3MO8A 1FWZA 4ATOA 2QQAA 3HKSA 4A54A 2WSCE 3QZ5B 4EMKC 4X9CA 2FHDA 1M1FA 2QA4T 2FL7A 2XDPA 3RIRA 4C8QC 1YIJT 2M16A 4C92D 3OSVA 3RESA 4BB7A 3CC4A 3SD4A 4A4FA 1VQ6A 2K5LA 5I2SA 4OB3B 1VQ5T 3JCMW 3M58A 3QG1A 4M75C 2E10A 3M54A 5EG2A 4L6V5 4ZGJB 5CKHA 1BI0A 2XU8A 4KT0E 4XAXB 4ELZC 3JB9J 2ZPEB 5LJ3h 4BI8B 3DB4A 5GAMh 1M90C 3MP8A 2O01E 2RHXA 3QXEB 3VKIA 2HD0A 4PJOG 4E47A 3HSBA 2K57A 4UC4A 1VQ7T 2JUFA 5D6XA 4M78D 1HK9A 1UGQB 2P0KA 2MI6A 3QIIA 4M77C 1U1SA 1I5LA 1H641 3OYAA 4PLLA 3CMAT 3Q1JA 3X25B 2MF2A 4QQDA 4BY6C 2XDBA 3QPHA 5CO7A 3OYJA 1S72T 1G3WA 1BIAA 4MMLA 1KD1U 2DZCA 4MDXA 5IT9E 1N6AA 1QP3A 4N4IA 4Q5WA 4J7FA 1LOJA 4JLGA 4IUUA 1O75A 2BIVA 3BY7A 2RI5A 1YJWA 3CC2T 2PVGB 2VC8A 2EIFA 1BI2A 2CKKA 4IUVA 5J3BA 3QO3A 4QW2A 4XTWA 1QW1A 2EJ9A 3JCMV 3G4ST 2LNVA 2DXBA 2K2VA 1VQMA 4CRIA 3RKXA 1EIFA 2KDSA 5FLXE 1QVFA 2V8IA 1G5VA 3AHUA 3GIBA 1OYXA 1DJ7B 4N0AC 2DTIA 5AYFA 1KQSS 2WSFE 4L59A 1N8RC 1Q86C 2JNGA 1QP2A 4HCZA 4JLIA 1JBMA 2RJCA 3QYGB 3R6OA 3SDZA 4C8QD 5GAN3 3OW2S 3CPFA 1X6OA 3PMTA 4M7DG 4II1A 3QSUA 5GAOp 1WJSA 4M75D 5HY6A 4C92E 2EJFA 5IAYA 2CGHA 1HXDA 1VQ8A 1VQLA 1XNIA 3CC4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF2 A;  4C8Q F;  4EMK B;  4XTU A;  4X9D A;  3L1A A;  5I21 A;  5GMK e;  4M7A B;  5LJ5 j;  2JN0 A;  5GAO r;  4M7D A;  3INZ A;  3V7C A;  4M77 A;  4M75 G;  2DJZ A;  4MMK A;  4EMG A;  4EMK A;  4XU2 A;  5LJ5 d;  1N9R A;  5GAN f;  5GAN 4;  4OP0 A;  4JUV A;  1B34 B;  3JCM h;  4M75 F;  3RKY A;  1D3B A;  2YHT A;  4C8Q A;  3JCM J;  4M78 C;  5GAO n;  1JRI A;  2E65 A;  4M7D D;  2EWN A;  4M77 D;  3FIF A;  5DY9 A;  5GAN d;  3JCM f;  3JCM X;  3QHS A;  4V2S A;  5GMK j;  4Y91 A;  2DXU A;  4F7U G;  4M78 E;  4M75 A;  2EAY A;  4F7U B;  5GMK m;  3SWN C;  5GAO q;  2FB7 A;  1I4K 1;  1B34 A;  4DQ2 A;  5GMK i;  3JB9 D;  1YCY A;  4NL3 A;  2VXE A;  4M7A D;  1M8V A;  2EJG A;  1KQ2 A;  4C92 G;  3FJP A;  2DTO A;  4JRI A;  1KQ1 A;  4M77 F;  3V7S A;  4C92 B;  4HA8 A;  5GAN e;  1WNL A;  5GAN 8;  5GAN 7;  4PJO C;  5LJ5 g;  3RKW A;  2DXT A;  4F7U A;  3JB9 G;  3JCM P;  3HFN A;  4M7A G;  4J6Y A;  2FYK A;  4N0A A;  4RCC A;  3JCM e;  3EFR A;  1MGQ A;  3JB9 F;  4PNO A;  4M7A F;  3BFM A;  5GAN g;  4PJO E;  4C92 A;  4A54 A;  4EMK C;  5GAN j;  2I2L A;  4X9C A;  4HT8 A;  4XTX A;  2RB6 A;  4JRK A;  3RIR A;  3SB2 A;  4C8Q C;  2DVE A;  3JCM g;  4M7A A;  4C92 D;  3RES A;  2E64 A;  3L2Z A;  3RER A;  1TH7 A;  4M78 G;  5CAI A;  4M78 B;  2ZGW A;  4XU0 A;  5GAN 2;  4C8Q E;  4F7U F;  5GMK l;  1X01 A;  4XU3 A;  4M75 C;  4A53 A;  4J6W A;  3JCM d;  2E10 A;  3JCM W;  2RA2 A;  3PGG A;  3SWN B;  4M7D F;  4C92 F;  3HFO A;  1Y96 B;  4EMH A;  4M75 E;  3JB9 J;  4M78 A;  3M4G A;  5LJ3 h;  1N9S A;  3BDU A;  5GAM h;  1M5Q 1;  3QUI A;  5GAN 5;  4XTV A;  2YLC A;  1WQW A;  4J6X A;  2RM4 A;  3JCM Q;  4PJO G;  3JCM b;  3HSB A;  2K57 A;  4PJO B;  5LJ3 f;  5GAM f;  1I5L A;  4M78 D;  1HK9 A;  4M7D C;  4HT9 A;  4M77 C;  1U1S A;  3SWN A;  1H64 1;  3BW1 A;  1Y96 A;  4QVC A;  5GAO m;  4M7D E;  2E41 A;  2E1H A;  1LJO A;  4M77 E;  3V7R A;  1BIA A;  4MML A;  3RUX A;  4XU1 A;  1BIB A;  1I81 A;  2DZC A;  2RD1 A;  4XTZ A;  3JCM c;  3V8K A;  5LJ5 h;  4M7A C;  4PJO A;  4C8Q B;  4M78 F;  2QTX A;  1LOJ A;  3BY7 A;  5LJ5 f;  4J5Y A;  5GAN h;  5GAN 6;  1WQ7 A;  2VC8 A;  5GAM e;  5LJ3 e;  4PJO D;  4M7A E;  3EFS A;  4XQ3 A;  3QO3 A;  2HNI A;  4XTW A;  2EJ9 A;  4M75 B;  2DZ9 A;  1WPY A;  4NOY A;  3JCM V;  3V8L A;  3JB9 H;  5GMK h;  3RKX A;  3AHU A;  3GIB A;  3JB9 I;  3VU3 C;  2Y90 A;  2DEQ A;  4N0A C;  2DTI A;  5LJ3 g;  2VXF A;  5GAM g;  4NL2 A;  3FB9 A;  1U1T A;  4PJO F;  5LJ3 j;  3V8J A;  4JLI A;  4C8Q D;  1JBM A;  5GAM j;  5GAN 3;  4C92 C;  1I8F A;  4F7U E;  2DKG A;  5LJ5 e;  4RCB A;  5LJ3 d;  5GAM d;  4M7D G;  1LNX A;  4M77 G;  4M7D B;  3QSU A;  4M77 B;  5GAO p;  4QVD A;  4XTY A;  5GAO l;  4M75 D;  4C8Q G;  4C92 E;  2EJF A;  1D3B B;  1HXD A;  2CGH A;  2YLB A;  2DTH A; 
#chains in the Genus database with same CATH topology
 4RKU E;  1AWX A;  2JMA A;  4MMK A;  4EMG A;  2XKO C;  2RQR A;  5D6Y A;  2M0O A;  2QQ9 A;  5KYU B;  1UGR B;  4J9C A;  3ULR B;  1PC0 A;  3PVQ A;  1VQ5 A;  5DLQ E;  4A4G A;  2COY A;  4F7U B;  2LCS A;  5CKB A;  2F5K A;  2ZPH B;  3PT9 A;  3FRN A;  5LL6 S;  1M27 C;  1W70 A;  1X75 C;  3OS0 A;  1UE9 A;  2X3X D;  2FRY A;  3CCU A;  1VQ8 Q;  1M1G A;  1X2K A;  4QT7 A;  3TSW A;  2JS2 A;  4JRK A;  4CC2 A;  3E19 A;  2LT4 A;  3M57 A;  3TVT A;  1YHQ A;  3U23 A;  2X4W A;  3JAM E;  3VS1 A;  4C8Q E;  4F7U F;  2EPD A;  2LC4 A;  2YXY A;  1JB0 E;  1VQ5 Q;  3HRS A;  4LXC A;  3SWN B;  1ARK A;  1SRL A;  2RI2 A;  4BUG A;  1Y96 B;  3EGD B;  4M75 E;  4JJC A;  2KSS A;  4J6X A;  2PZ1 A;  2DM1 A;  1PKS A;  3OYK A;  1Q86 U;  4LD9 K;  1VQ7 Q;  2R5A A;  1D0Y A;  1K1Z A;  3MKD A;  2RNA A;  4DA4 A;  3PMI A;  1SHF A;  2EQU A;  2JXB A;  5GAO m;  1VIF A;  2E1H A;  3M0T A;  3V8K A;  2O9V A;  4LDW A;  4M7A C;  2JM8 A;  4ZN3 A;  3FJ5 A;  3J7A F;  4QKU A;  1H3Z A;  3OSS C;  1WQ7 A;  4FYX B;  1YHQ Q;  3MEU A;  5GMK h;  3WXM B;  1M4Z A;  2DET A;  2LX7 A;  3EFO B;  3H8Z A;  1I8F A;  2DKG A;  2RK2 A;  1LNX A;  2L3R A;  3OY9 A;  4LD6 A;  4AT1 B;  1G3T A;  1K8A U;  3LGL A;  4XU0 A;  3WVD B;  2AKL A;  2JTE A;  2ZPF B;  1QVG P;  1YP5 A;  1JO8 A;  2K5I A;  4J9I A;  2EFI A;  5HCK A;  4ANJ A;  5GAO r;  3EG9 B;  1WYX A;  4M7D A;  2BTT A;  2KAF A;  1Y07 A;  3M0R A;  1PM3 A;  1FMK A;  2DK3 A;  3QHS A;  2D0Q B;  4FYV B;  1M90 R;  5A0G A;  1U06 A;  4PK4 A;  4ZTJ A;  1YWO A;  1VQ6 T;  4HVU A;  4JRI A;  3QKJ A;  1M9S A;  4PJO C;  2GTJ A;  1XTD A;  1AEY A;  2OTJ A;  4D6W A;  1MGQ A;  1WA7 A;  3VS3 A;  1NBE B;  1NJI U;  2I2L A;  1RAD B;  2RB6 A;  3JCM g;  3QJY A;  4RG2 A;  4M7A A;  4E7J A;  1SSF A;  3OQ5 A;  3JCM d;  1X01 A;  1X2Q A;  4XU3 A;  1FX7 A;  1O9S A;  5KYN A;  1TTH B;  5KCO A;  2GFU A;  4RMO A;  3O5Z A;  3PFS A;  5GAN 5;  3CCV A;  3PIP A;  2AT1 B;  4FU6 A;  3ZFJ A;  2KBT A;  2OTJ Q;  3A1P A;  1K4U S;  1Q7Y U;  2OX7 A;  1R8O B;  2P0Q A;  2GBQ A;  2M02 A;  5GAN h;  2AIR B;  3MEW A;  4LDY A;  4AMC A;  2HNI A;  1SF9 A;  3HPW A;  4PKC C;  2DL8 A;  2KVQ G;  1VYU A;  2D1X A;  2O4X A;  2JT4 A;  3L2R A;  5KH6 A;  2E6Z A;  1K73 R;  4F7U E;  3G7Z A;  1TG0 A;  3CCV Q;  1W2B S;  2FZK B;  3CCM Q;  1K9M R;  1V1C A;  2HQX A;  3IQL A;  4PFO A;  1ZA1 B;  2BZY A;  3L1A A;  2M1H A;  1WFW A;  2JN0 A;  2KGT A;  1RAE B;  3CCR T;  5FU6 B;  3PVL A;  1WDX A;  2YHT A;  2CRE A;  4M7D D;  1X6G A;  1JXM A;  3CCL A;  1G3Y A;  3HRU A;  3JCM X;  1M2O A;  4CC7 A;  1LPL A;  1B34 A;  3UPU A;  2HBW A;  1T3S A;  2PUO B;  2EQJ A;  1KQ1 A;  2GNC A;  2CZ0 B;  3G6E T;  3I5S A;  2NUT B;  3RKW A;  1VQO A;  4O5V A;  3ER0 A;  1WHH A;  2YDL A;  3C94 A;  3GNF B;  2CYZ B;  3OBY A;  5GAN g;  1P92 A;  2KR3 A;  1VQN A;  5GAN j;  1G8X A;  2D9T A;  2KYM A;  2DD5 A;  2CSI A;  4OMM A;  5CAI A;  4M78 B;  2LRQ A;  3I56 Q;  2EBP A;  3RR6 A;  3CCL Q;  1TS9 A;  1QCO A;  3NTK A;  3OYF A;  2QQB A;  2DL5 A;  2FO0 A;  1D0Z A;  3BDU A;  4JS4 A;  1BU1 A;  3DKM A;  2L8D A;  3H0I A;  3GF5 A;  4HVV A;  1JJ2 S;  2LJ1 A;  1C1A A;  1QCF A;  4J9D A;  5FW9 A;  3CC7 T;  1ZA2 B;  1WX6 A;  3J80 E;  1WLP B;  1KQS P;  1LJO A;  4EMK B;  4XU1 A;  4XTZ A;  1VQN Q;  4YTL A;  4M78 F;  1TU0 B;  2CZ1 B;  3E9F A;  5GAN 6;  2K5F A;  1RLP C;  2RHU A;  3FEO A;  3JB9 H;  3V8L A;  1Y57 A;  2HQH A;  3SEM A;  2DXC A;  2DIQ A;  3X20 B;  5GAM g;  2LNH B;  2YUP A;  5GAM j;  1I1J A;  5A0D A;  2NUP B;  1X27 A;  4LDX A;  2F2X A;  4C92 C;  5GAM d;  1BBZ A;  4M77 B;  1TOV A;  4XTY A;  4PL6 A;  2VWF A;  3C95 A;  1WGS A;  4FYW B;  3OYL A;  4C0D C;  3HHT B;  1GCQ C;  4AFU C;  5C0M A;  2E65 A;  2PVD B;  1NYG A;  1YIT Q;  9ATC B;  3JCM f;  2EGC A;  3OYD A;  3CC2 A;  1PWT A;  1I4K 1;  5FU7 C;  1S1N A;  2GTO A;  3LWI A;  2DJQ A;  1CKB A;  2CT4 A;  5J26 A;  2LJ3 A;  4M77 F;  5GAN 7;  3I55 T;  2DBK A;  3QWY A;  4N0A A;  3JCM e;  4F16 A;  3VS2 A;  1VQ8 T;  1QVF S;  1FWZ A;  4A54 A;  1Y0M A;  2FHD A;  2E3H A;  3RIR A;  1MV3 A;  3OSV A;  1T0H A;  3RES A;  2X51 A;  4A4F A;  2K5L A;  2L3P A;  5I2S A;  3NGP A;  1VQ5 T;  1W2B P;  5EG2 A;  2ECZ A;  1BI0 A;  2XU8 A;  3CC2 Q;  1UDL A;  2ZPE B;  1M90 C;  1MMN A;  2RHX A;  4PJO G;  3HSB A;  1VQ7 T;  2ABL A;  1H64 1;  5CO7 A;  3OYJ A;  2M0Y A;  1LVK A;  4MML A;  1C0M A;  5IT9 E;  1LOJ A;  4IUU A;  2A28 A;  2RI5 A;  2DL7 A;  1BI2 A;  1GCQ A;  2MCN A;  3QO3 A;  1K76 A;  4XTW A;  1QW1 A;  3JCM V;  1VQM A;  1QVF A;  3RKX A;  1BCO A;  3AHU A;  1OYX A;  1DJ7 B;  1JXO A;  1D09 B;  3VRZ A;  4C8Q D;  3SDZ A;  4A63 B;  3PMT A;  2QG9 B;  3QSU A;  1PD1 A;  4M75 D;  5HY6 A;  3VS7 A;  5IAY A;  1XNI A;  4WF2 A;  1X43 A;  1AOJ A;  5KYX B;  3GBQ A;  2OAW A;  3CCJ A;  2DJZ A;  2DA9 A;  4RTT A;  5GAN f;  1GRI A;  2B86 A;  1UEC A;  3S6W A;  1C6V X;  4KGX B;  2JTM A;  2A08 A;  3RDV A;  1VQM Q;  1IRE B;  1JJ2 P;  3LWH A;  4M78 E;  3E9G A;  1MMG A;  2HKQ B;  4R55 A;  5GMK i;  2RI3 A;  1XQH A;  3JB9 D;  1ACM B;  1Y7X A;  2EJG A;  5GAN 8;  3FJP A;  1TUG B;  4FYY B;  5GAN e;  3C0C A;  4HA8 A;  4N4G A;  1OU8 A;  5GJV B;  2PVO B;  2DXT A;  4F7U A;  4FW2 A;  1M90 U;  2A0F B;  2R5M A;  1M8M A;  4PNO A;  4EPC A;  2XD0 A;  4RUG A;  3HRT A;  5CQY A;  4XTX A;  2DVE A;  4DBQ A;  3CCJ Q;  2CUD A;  2BZ8 A;  5IHK A;  5CKF A;  2MK5 A;  3UAT A;  2QAS A;  4DBH A;  5GMK l;  1B3Q A;  5FRN A;  2VGM A;  2LVM A;  1K9A A;  3OYH A;  1A0N B;  1KIK A;  2RK1 A;  4JZ3 A;  2PUK B;  2YUQ A;  3QUI A;  4LDV A;  4ME7 A;  2D8J A;  1ZSG A;  3CPW A;  2X4X A;  5D7U A;  5GAM f;  3SWN A;  2I0N A;  3OB9 A;  3TEE A;  2OTL A;  1Y96 A;  2LCC A;  2NYS A;  3EGD A;  4ZN1 A;  4J9E A;  1K0X A;  2D0N A;  1YCS B;  1IGQ A;  4VUB A;  4M77 E;  2QGF B;  2J06 A;  5HK0 A;  2E4H A;  4HCB A;  1WHM A;  1GXI E;  2QTX A;  2ED0 A;  1G2B A;  3VS4 A;  1RI0 A;  5GAM e;  3EFS A;  2DPP B;  3OS5 A;  4NOY A;  4C5G A;  2BZX A;  2CT3 A;  1BKB A;  1UB4 A;  2DEQ A;  1U1T A;  1H8K A;  3MPU B;  3CCM T;  1NM7 A;  3NHN A;  3JV3 A;  4PJN A;  1MUZ A;  1PNJ A;  1QQJ A;  2QEX T;  1MHN A;  1MNE A;  3P8H A;  5CIU A;  4WTO B;  1AD5 A;  3OS1 A;  3CCE A;  4XU2 A;  4LN2 A;  1UTI A;  1K9M U;  4IKF A;  4HCK A;  5CVI A;  4CC4 B;  1M30 A;  2LCL A;  4TVR A;  3OA6 A;  1VQ9 T;  3QBY A;  1RLQ C;  1U8R A;  4C92 G;  1YWP A;  2HSP A;  2KQW A;  1FYN A;  4ESR A;  1U5S A;  2XIC A;  1PSE A;  3CCS A;  1YI2 A;  4N4H A;  3KFV A;  4E7H A;  1AWO A;  3RMS A;  1WHK A;  4HT8 A;  3EG3 A;  2FZC B;  5FRM A;  4E7K A;  2KRM A;  4RTZ A;  3CCE Q;  3I56 T;  2ZGW A;  2CSQ A;  2Y4X A;  4PLI A;  2DVJ A;  1IB8 A;  3M0U A;  1K8A C;  3H0H A;  2DIL A;  2RQV A;  1N9S A;  2YLC A;  2KT1 A;  3JCM Q;  5D6W A;  2RN8 A;  4C0F A;  2CS7 A;  4M7D C;  1TXQ A;  2EYW A;  1VQL Q;  1VYT A;  4LE9 A;  3G71 T;  1YI2 Q;  4HT9 A;  1PCX A;  1I81 A;  2X4Y A;  3A5Z B;  2VUB A;  5L8R E;  4JRP A;  2LJ0 A;  2NLU A;  1RAF B;  2QTV A;  3OYM A;  2E12 A;  2HKN A;  1GBQ A;  1YFN A;  2K3Y A;  4QVZ A;  3CQT A;  3JB9 I;  3UF4 A;  1OUL A;  2QAZ A;  2XID A;  1NJI C;  1ZBJ A;  4KH0 B;  2HMA A;  2DX1 A;  3CCU Q;  1RAC B;  1V76 A;  1VQK A;  2DTH A;  2P0P A;  4KBM B;  2LT1 A;  1QVP A;  1QCN A;  1KC8 R;  4FSX A;  1KK7 A;  4MZP A;  3JCM h;  1YIT T;  4F04 B;  4J9H A;  4A4H A;  5CQX A;  4ZTF A;  1G83 A;  1XOV A;  5CR2 A;  3S3N A;  2ZAE A;  1Q7Y C;  4OMF B;  2X4J A;  3M55 A;  4DEY A;  2A37 A;  4BAC A;  2DF6 A;  2NUZ A;  3JCM P;  3HFN A;  1AWW A;  2FZG B;  4LUD A;  1IO6 A;  1M1K R;  1NG2 A;  1VQK Q;  4E2F B;  2EGA A;  2HBP A;  1IHV A;  2COW A;  1Q82 R;  1VQ4 A;  4LUE A;  2E64 A;  1Z9Q A;  1ABO A;  1RL2 A;  2MYS A;  4RTV A;  2JZ2 A;  1NEG A;  1NE8 A;  3EG2 A;  2CP0 A;  2RF0 A;  4BI3 A;  3P8B B;  4M78 A;  2RH2 A;  5M9O A;  4GLM A;  1VQP A;  4PFP A;  2WAC A;  3OS2 A;  2EW3 A;  3CME A;  3CCQ A;  2EYX A;  1F1B B;  3V7R A;  1OX9 A;  3VS6 A;  3L2Q A;  1I5O B;  2P4R A;  1IRX A;  3EAE A;  2HAX A;  2YWW A;  1Q81 R;  1R77 A;  4J5Y A;  4JPB W;  1VQ4 Q;  2KEA A;  4EIK A;  3CXC S;  3UT1 A;  3OYG A;  2MMP A;  5LJ3 g;  1NLP C;  1AHJ B;  2DBM A;  3LH5 A;  5LJ3 j;  4IUR A;  5LJ3 d;  1W4S A;  1QLY A;  3HL8 A;  1VQP Q;  5IN1 A;  1UGS B;  4QVD A;  1YJN T;  3NFC A;  1KD1 C;  2M9U A;  4FCY A;  3CME Q;  3CCQ Q;  2YLB A;  2NUP A;  4E7I A;  5DLO A;  1WHL A;  4JS5 A;  4M77 A;  1TUD A;  1N9R A;  1S72 A;  1WXU A;  1ZLM A;  4JJD A;  2L2P A;  5GMK m;  1MV0 B;  1EZZ B;  4DEX A;  2Y4Y A;  3G4S A;  1LCK A;  4Z8A A;  4BDZ A;  1KG1 A;  2ROL A;  5IHN A;  2C06 A;  3CXC A;  3H9N A;  1PHT A;  4ATO A;  2QQA A;  3HKS A;  3QZ5 B;  7AT1 B;  2KRN A;  2MPX C;  5IXB A;  2QA4 T;  4Z88 A;  4C8Q C;  1YIJ T;  1NYF A;  2M16 A;  4KH1 B;  2DFU A;  3UA7 A;  1S72 Q;  4M75 C;  1RAB B;  4ZGJ B;  2RMO A;  4KT0 E;  4ELZ C;  3JB9 J;  4K11 A;  5GAM h;  2FPE A;  3MP8 A;  2L3Q A;  3QXE B;  4UC4 A;  1R0C B;  5D6X A;  4M78 D;  2EGE A;  1UGQ B;  3QII A;  1I5L A;  3OYA A;  3CMA T;  3X25 B;  2MF2 A;  4BY6 C;  1PD0 A;  1G3W A;  3QWX X;  1KD1 U;  3RBB B;  3RNJ A;  3I9Q A;  2RQU A;  2K3B A;  1O75 A;  2BIV A;  2J6F A;  2PVG B;  4PJM A;  1RAH B;  4IUV A;  1VOM A;  2W0Z A;  4QW2 A;  2GGR A;  2KDS A;  2DL4 A;  3QDF A;  3SHW A;  4N0A C;  2JNG A;  4HCZ A;  4JLI A;  5GAN 3;  1VQO Q;  3OW2 S;  1X6O A;  4M7D G;  1WJS A;  1WXT A;  2MIO A;  1QKW A;  2EJF A;  1NZ9 A;  3CC4 T;  4M7A B;  5LJ5 j;  2BE9 B;  5LJ5 d;  2GQI A;  1D1C A;  3M0P A;  4C8Q A;  4F14 A;  4M77 D;  5KYX A;  1I0C A;  3E1S A;  4Z89 A;  4M75 A;  1E6H A;  3N5B B;  3PNW C;  2X35 A;  2LQK A;  4M7A G;  2FYK A;  4M7A F;  1ZSZ C;  2PNI A;  4OB2 B;  1OPK A;  5CCA A;  1VIE A;  2FPF A;  5CKD A;  3OW2 A;  5A2Q E;  4M4Z A;  1E6G A;  4QQG A;  4JJB A;  3EGX B;  2RQT A;  4OMN A;  5GAN 2;  1KC8 C;  4HVW A;  2JS0 A;  2YRV A;  3M5A A;  4OML A;  2O4X B;  1T3L A;  2EYY A;  3HFO A;  1WJR A;  5HKC A;  4ZGE B;  1PSF A;  3GNG A;  2RM4 A;  1VQL T;  4IIM A;  4BE2 A;  4PJO B;  5LJ3 f;  1TUC A;  2LQ8 A;  4FIB A;  2IG0 A;  4AFS C;  1VQ6 A;  1KJW A;  2DAQ A;  4J8O A;  4QVC A;  2KI7 A;  2A3L A;  2E41 A;  4CC3 A;  2DYI A;  1UUE A;  2YRC A;  3VJP A;  3A8G B;  2L0A A;  1M1K C;  4IIO A;  5LJ3 e;  2CZ6 B;  1NEB A;  1FMW A;  4BD3 A;  2DZ9 A;  1WPY A;  2ZCF B;  3MP6 A;  4JDS A;  4ORZ A;  5C6S A;  1UJ0 A;  4PJO F;  2XDD A;  4C5I A;  2VGN A;  4RCB A;  3CCU T;  3VYG A;  3OYY A;  1YHQ T;  2OAU A;  1ZSZ A;  2KK4 A;  2EYZ A;  2JM9 A;  1UFF A;  4GY5 A;  2B8A A;  4FT2 A;  5GAO n;  4BE1 A;  1SRM A;  2GCX A;  2O9S A;  3SWN C;  1KC8 U;  2LMJ A;  2CH4 W;  4ELY C;  1ZHI A;  2RPN A;  1QWE A;  1VYV A;  1PRL C;  2E5Q A;  2ESW A;  4J6Y A;  2HCK A;  1OI1 A;  4X1V A;  2KXC A;  2CP7 A;  1M3C A;  1GBR A;  2KY9 A;  2OI3 A;  1SG5 A;  4J9B A;  3CPW S;  3VUZ A;  3CBO A;  1AVZ C;  3MEV A;  3CCR A;  5KYU A;  1N8R R;  1M1K U;  1UGV A;  1KHI A;  1Q82 U;  1UG1 A;  1R0B G;  3NMZ C;  2DMO A;  4GLK A;  2HQE A;  1M5Q 1;  1WI7 A;  1K73 C;  4OB1 B;  2J6K A;  2AZV A;  2L3S A;  3JCM b;  2CUB A;  4AG1 C;  2EQK A;  3F70 A;  2AK5 A;  2RJF A;  3BW1 A;  2AHJ B;  2G3R A;  1K9M C;  2QYZ A;  1FXX A;  3EH1 A;  1IHW A;  2ENM A;  3G6E A;  2YT6 A;  3A98 A;  1HJD A;  3RUX A;  2RD1 A;  3JCM c;  4O6J A;  2CH4 A;  1AZE A;  1UEB A;  3FDR A;  1YJ9 A;  1RAG B;  5LJ5 f;  3ASK A;  2JTF A;  4M7A E;  2BKD N;  2K6D A;  2DE0 X;  2RJE A;  4FSS A;  3TQ7 P;  3CD6 A;  4L5G A;  1Q81 U;  3FB9 A;  2OTJ T;  1BI3 A;  1V29 B;  2DER A;  3E2U A;  1VQP T;  5LJ5 e;  2LP5 A;  2OJ2 A;  2G6F X;  3CME T;  4RG8 A;  2XK0 A;  5DM7 R;  2DYB A;  3ZBD A;  5FWB A;  4J7I A;  1D3B B;  2HEQ A;  4X34 A;  3VRY A;  5I21 A;  3I35 A;  3MEA A;  3G6E Q;  4KUI A;  4B6M A;  3FC3 A;  3CC7 A;  2RHZ A;  3NPF A;  3X24 B;  2ED1 A;  2C0O A;  2H8H A;  3H41 A;  1YJ9 Q;  1BCM A;  1U3O A;  1JRI A;  1W6X A;  2LTO A;  3MHX A;  1BYM A;  1QVF P;  3CCV T;  2F2W A;  1M3A A;  4Y91 A;  2GF7 A;  3CD6 Q;  1QVG S;  2PU9 B;  5J39 A;  3J81 E;  4C92 B;  2RO0 A;  1WNL A;  3EFO A;  2OTL Q;  2XHC A;  3X28 B;  1SSH A;  1K73 U;  1X6B A;  2MWO A;  2LX9 A;  4KUD K;  2MAM A;  2CDT A;  3BDL A;  3KBG A;  4PJO E;  2F69 A;  1ZUY A;  2JW4 A;  2LDM A;  3SFM A;  4C0D B;  3DLL A;  3OBW A;  1HYO A;  4OMO A;  3EG9 A;  1TH7 A;  2PQW A;  4RTX A;  3DB3 A;  2FG0 A;  3M9Q A;  4E6R A;  2RA2 A;  5FU7 B;  4C92 F;  3L42 A;  4B9X A;  4OGE A;  2DL3 A;  4RTW A;  2LQW A;  1WQW A;  2XI9 A;  1BI1 A;  3UWN A;  5I22 A;  3GLX A;  2K4Y A;  3I55 A;  2JJ9 A;  4OVA A;  2YUO A;  2VYT A;  2J05 A;  1QVG A;  1ZBX A;  1EX4 A;  4IUQ A;  3LX7 A;  3CCL T;  5FU6 C;  2O88 A;  2CP3 A;  1GCP A;  2ZPI B;  5A0L A;  3OYB A;  3WVE B;  3GP8 A;  5FRO A;  2GFA A;  1GFC A;  3L2U A;  3VUB A;  3QDR B;  1VQO T;  1B07 A;  3NTI A;  1B7T A;  3PIO A;  5KYW B;  4JJN K;  3CPW P;  2FEI A;  3CCS Q;  1VQN T;  1D0X A;  2H3J A;  5KYY B;  4FT4 A;  1ZQ1 A;  4AFZ C;  2YUN A;  1VQ7 A;  3I55 Q;  3DLM A;  4XTU A;  2R58 A;  4IUT A;  2F5T X;  3V7C A;  1H3H A;  3PTA A;  3M56 A;  1HSQ A;  3QZ9 B;  4IUP A;  4JUV A;  2EQI A;  3A8L B;  4M78 C;  2EWN A;  2JMC A;  1IGU A;  3QYH B;  4J9G A;  2E70 A;  4F7U G;  5GAO q;  4NL3 A;  4KUL A;  1M2V B;  1UJY A;  2MWP A;  3GPL A;  4OMP A;  2D8H A;  1AT1 B;  5I2M A;  4FL6 A;  4OB0 B;  3MO8 A;  4EMK C;  1YN8 A;  1M1F A;  2FL7 A;  1KSW A;  1SPK A;  1WHJ A;  3EGU A;  2FPD A;  1EFN A;  3M58 A;  3QG1 A;  2E10 A;  3M54 A;  3UA6 A;  2DRM A;  2KXD A;  1JQQ A;  4F17 A;  4XAX B;  1PKT A;  5LJ3 h;  3DB4 A;  3AT1 B;  2HD0 A;  2EVR A;  2JUF A;  1HK9 A;  2C0T A;  4M77 C;  1U1S A;  3Q1J A;  2NWM A;  2NUT A;  4QQD A;  3QPH A;  1BB9 A;  1N5Z A;  2SRC A;  4MDX A;  4FW1 A;  5EC7 A;  1N6A A;  2DLP A;  4JLG A;  2ROT A;  3BY7 A;  1YJW A;  3CC2 T;  2VC8 A;  1ZUK A;  1OOT A;  2YRD A;  5J3B A;  2C0I A;  2LNV A;  2K2V A;  4CRI A;  2KYB A;  1EIF A;  1KQS S;  2WSF E;  1N8R C;  4PFZ A;  3QYG B;  3R6O A;  3CPF A;  2VB6 A;  4PJJ A;  5ECA A;  4C92 E;  1HXD A;  4LDU A;  3LLR A;  1NLO C;  4BI4 A;  5HK3 A;  4EMK A;  4OP0 A;  2K9G A;  1YJW Q;  2ZPG B;  3OYI A;  2E5K A;  5DY9 A;  5GMK j;  3EHR A;  1TSF A;  2DXU A;  4EDU A;  2KRO A;  2FB7 A;  1YCY A;  3I5R A;  3D7S B;  3KXT A;  1ABQ A;  3ZL7 C;  2QQR A;  2EKO A;  1CSK A;  2DO3 A;  3CCM A;  1KQS A;  2EQM A;  5IH2 A;  3TRE A;  2CP5 A;  1VQM T;  3R6N A;  2L5Q A;  3SB2 A;  3VV0 A;  1K0S A;  4C5E A;  2QEX A;  5IHI A;  2F2V A;  3RER A;  3M0Q A;  1OQK A;  3G1J A;  2E3I A;  1CKA A;  4FM4 B;  4JRQ A;  2O31 A;  4BDY A;  4EMH A;  3EGX A;  2QQS A;  2DD4 A;  4XTV A;  4QQ6 A;  1N8R U;  1VQ9 A;  2R57 A;  3CCJ T;  1NPP A;  3M59 A;  3MCA B;  4HXJ A;  2K3X A;  4MDW A;  2X3W D;  2M51 A;  1RUW A;  3S3O A;  2F1L A;  5LJ5 h;  4NS5 A;  4PJO A;  5I11 A;  1VA7 A;  2RJD A;  4RTU A;  3MET A;  3X26 B;  2QEX Q;  3MP1 A;  3H6Z A;  4XQ3 A;  2EKH A;  2E6N A;  2XG8 D;  1ZX6 A;  3G4S Q;  3I56 A;  4DBF A;  2V8K A;  3VU3 C;  4DOV A;  2K7A A;  1FMV A;  3V8J A;  2P4T A;  4A4E A;  3VYH B;  4KGV B;  2XMF A;  4M7D B;  1OU9 A;  3CBM A;  1VQ9 Q;  2IVW A;  2W10 A;  3A8M B;  3QJ6 A;  3JSC A;  4B9W A;  2BE7 D;  2MOX A;  4LNP A;  3L2W A;  3OYC A;  3G71 A;  3A8O B;  1YJ9 T;  1J3T A;  1N27 A;  1WJQ A;  3HP9 A;  4OGC A;  3OMC A;  1GFD A;  5GAN d;  2RQW A;  1TWB A;  1W2B A;  3CD6 T;  2EAY A;  1ZUU A;  2CZ7 B;  4HKE A;  1RI9 A;  4DQ2 A;  3GOX A;  1OZ2 A;  4M7A D;  1H92 A;  3MJX A;  2OTL T;  1M8V A;  1KQ2 A;  4M7D F;  1KHC A;  1QKX A;  5LJ5 g;  1MND A;  2KRS A;  1Q95 G;  4C5H A;  1E7O A;  2H3E B;  2QDY B;  3JRZ A;  4DOW A;  2O2O A;  3G71 Q;  3L2Z A;  4M78 G;  1WZO A;  2P84 A;  4A53 A;  1Q86 R;  1RAA B;  3PGG A;  3M53 A;  2AZS A;  4Y92 A;  1YIT A;  2QI2 A;  1BK2 A;  2QXF A;  2CP6 A;  2K2M A;  1OEB A;  2EYQ A;  3CXC P;  1UGP B;  3CCE T;  2WSE E;  5IXF A;  4AG2 C;  1WIE A;  4A4K A;  1JEG A;  1IZ6 A;  2DIG A;  3LGF A;  4PJO D;  1Z9Z A;  2L89 A;  2GQV A;  4Y28 E;  1JJ2 A;  1K8A R;  2Y90 A;  3REB B;  2VXF A;  2ZZD A;  1T0J A;  2RHI A;  3PE0 A;  3CCS T;  1YI2 T;  2Z0W A;  2VV5 A;  3KUF A;  4M77 G;  1I07 A;  5GAO l;  2HDA A;  3TU4 K;  3P8D A;  2DNU A;  2A7Y A;  2JOY A;  3UDC A;  5GMK e;  5KE3 A;  1AZG B;  3CBP A;  2KNB B;  1Q82 C;  1B34 B;  1D3B A;  5CK9 A;  1RAI B;  4ZNX A;  4GBQ A;  1YNZ A;  3VS5 A;  1KFZ A;  3OYN A;  2JVV A;  2V8J A;  3O8V A;  1PRM C;  2VXE A;  2FVU A;  2DTO A;  1NJI R;  1PG5 B;  3LYI A;  2QGG A;  1OZ3 A;  1VQ6 Q;  4D8K A;  3TCJ A;  3THK A;  1D1B A;  5AT1 B;  4RCC A;  1HD3 A;  1SKU B;  3EFR A;  4J9F A;  4AFQ C;  3CEY A;  2X9H A;  4MZT A;  4R0K A;  4C92 A;  2COZ A;  1YJN A;  1AWJ A;  4XK8 E;  4Z02 A;  2HL3 A;  2HSE B;  3ZEH A;  1Y71 A;  3ME9 A;  1Q81 C;  2IIM A;  5KE2 A;  2ZPB B;  4ZGD B;  1D1A A;  3T9N A;  4J6W A;  1VUB A;  2SEM A;  1OV3 A;  6AT1 B;  3VS0 A;  3M4G A;  4JZ4 A;  4E7L A;  5L23 A;  4OF1 A;  1YBY A;  4CI0 C;  1Q7Y R;  1NPR A;  1VQK T;  2CP2 A;  4MZM A;  1QMC A;  4KRT A;  3RMQ A;  3A8H B;  4R56 A;  4BE0 A;  1JU5 C;  4M7D E;  1G3S A;  1BIB A;  3M4Y A;  3OW2 P;  3L2V A;  4C8Q B;  1YJN Q;  3REA B;  1MMA A;  5FWC A;  1SHG A;  1OPL A;  2QA4 A;  4M75 B;  1YIJ A;  4HCC A;  2DEU A;  3URG A;  4E7Z A;  4KGZ B;  4NL2 A;  4J83 A;  3LH0 A;  2YSQ A;  3C4S A;  1WXB A;  3OMG A;  3LW5 E;  2QDL A;  3S3M A;  4C8Q G;  2RHY A;  4BY6 B;  2HL5 C;  4P5N A;  1VQ4 T;  2V26 A;  1X69 A;  2KMT A;  4C8Q F;  4X9D A;  5KYW A;  4E7S A;  4C0Z A;  3INZ A;  4M75 G;  3CMA A;  1UHC A;  1YJW T;  5KYY A;  5GAN 4;  2VKN A;  2J6O A;  2K79 A;  2AKK A;  3C12 A;  5KCH A;  4M75 F;  3RKY A;  5CKE A;  3OYE A;  3CCR Q;  3JCM J;  1GL5 A;  3FIF A;  1W1F A;  4V2S A;  2QA4 Q;  3HTR A;  1MMD A;  2LQN A;  1YIJ Q;  2KT8 A;  2BUD A;  2QK0 A;  2VAS A;  3CCQ T;  2D6F A;  3V7S A;  1XJW B;  3NTH A;  3EG0 A;  3JB9 G;  4C0G A;  2HZY A;  1KD1 R;  2J7I A;  3JB9 F;  2V1R A;  3FLG A;  3BFM A;  4OMQ A;  4D8D A;  1M2V A;  2WSC E;  3M0S A;  4X9C A;  2V1Q A;  8ATC B;  2XDP A;  3H0F A;  4C92 D;  1M3B A;  3CMA Q;  4BB7 A;  4PJL A;  3CC4 A;  3SD4 A;  2FRW A;  2DRK A;  4OB3 B;  4WCI A;  3JCM W;  4L6V 5;  5CKH A;  2LZ6 B;  4BI8 B;  2O01 E;  3VKI A;  4E47 A;  2K57 A;  2P0K A;  2MI6 A;  2VVK A;  2IPO B;  4PLL A;  3EH2 A;  1IXD A;  1ZSZ B;  2XDB A;  1S72 T;  3CC7 Q;  3TSZ A;  1BIA A;  1OX8 A;  4DBR A;  2DZC A;  5GJW B;  1QP3 A;  4N4I A;  4Q5W A;  4J7F A;  2ATC B;  1UHF A;  2EIF A;  2PTK A;  2CKK A;  8AT1 B;  3CC4 Q;  3EHQ A;  2EJ9 A;  3G4S T;  1WHG A;  2DXB A;  5FLX E;  2V8I A;  1G5V A;  4RTY A;  3GIB A;  2A36 A;  2KE9 A;  2DTI A;  5AYF A;  4L59 A;  1Q86 C;  1SEM A;  1QP2 A;  1JBM A;  1QWF A;  2RJC A;  3EG1 A;  4II1 A;  5GAO p;  3BE3 A;  2CGH A;  1VQ8 A;  1VQL A; 
#chains in the Genus database with same CATH homology
 4LDU A;  4WF2 A;  3LLR A;  4BI4 A;  4RKU E;  4M7A B;  5HK3 A;  5LJ5 j;  3CCJ A;  4MMK A;  2DJZ A;  4EMG A;  4EMK A;  5LJ5 d;  2XKO C;  5GAN f;  4OP0 A;  5D6Y A;  2M0O A;  4C8Q A;  2QQ9 A;  3S6W A;  1UGR B;  2ZPG B;  3OYI A;  4M77 D;  5DY9 A;  1VQ5 A;  5DLQ E;  2JTM A;  3E1S A;  4A4G A;  5GMK j;  1IRE B;  2DXU A;  3LWH A;  4M78 E;  3E9G A;  4M75 A;  4EDU A;  4F7U B;  2FB7 A;  4R55 A;  5CKB A;  3N5B B;  5GMK i;  2RI3 A;  1XQH A;  3PNW C;  1YCY A;  2F5K A;  1Y7X A;  2ZPH B;  3FRN A;  3PT9 A;  2X35 A;  3JB9 D;  2EJG A;  5LL6 S;  5GAN 8;  3FJP A;  5GAN e;  3KXT A;  4HA8 A;  4N4G A;  2LQK A;  2PVO B;  2QQR A;  2DXT A;  2EKO A;  4F7U A;  1M90 U;  4M7A G;  2R5M A;  2FYK A;  1X75 C;  3OS0 A;  4PNO A;  4M7A F;  4EPC A;  2XD0 A;  2DO3 A;  4OB2 B;  3CCU A;  5CCA A;  3CCM A;  1KQS A;  2EQM A;  1M1G A;  1VIE A;  3HRT A;  5CQY A;  3TRE A;  4XTX A;  5CKD A;  3OW2 A;  1VQM T;  3VV0 A;  2L5Q A;  4JRK A;  3SB2 A;  5A2Q E;  2DVE A;  3E19 A;  4C5E A;  2LT4 A;  3M57 A;  2QEX A;  1YHQ A;  3RER A;  4QQG A;  5CKF A;  2X4W A;  5GAN 2;  3JAM E;  4C8Q E;  1KC8 C;  4F7U F;  5GMK l;  5FRN A;  2VGM A;  2LC4 A;  4FM4 B;  2YRV A;  3M5A A;  2LVM A;  4JRQ A;  2O4X B;  3OYH A;  1JB0 E;  3HRS A;  3SWN B;  2RK1 A;  2RI2 A;  3HFO A;  4BUG A;  1WJR A;  1Y96 B;  4M75 E;  4EMH A;  4BDY A;  2QQS A;  5HKC A;  2DD4 A;  2KSS A;  2PUK B;  4ZGE B;  1PSF A;  3QUI A;  3GNG A;  4LDV A;  4XTV A;  4ME7 A;  4J6X A;  2RM4 A;  1VQL T;  4QQ6 A;  4BE2 A;  4PJO B;  3CPW A;  2X4X A;  2LQ8 A;  5LJ3 f;  5GAM f;  3OYK A;  1Q86 U;  2R57 A;  4FIB A;  1N8R U;  1VQ9 A;  3SWN A;  4LD9 K;  2IG0 A;  3CCJ T;  3OB9 A;  3TEE A;  2R5A A;  1Y96 A;  2LCC A;  1NPP A;  2DAQ A;  4J8O A;  3M59 A;  3MCA B;  3PMI A;  4ZN1 A;  4QVC A;  4DA4 A;  2EQU A;  2K3X A;  5GAO m;  4MDW A;  1VIF A;  2A3L A;  4VUB A;  2E41 A;  2E1H A;  4M77 E;  3S3O A;  5HK0 A;  5LJ5 h;  4NS5 A;  3V8K A;  4LDW A;  4HCB A;  4M7A C;  4PJO A;  4ZN3 A;  1GXI E;  2QTX A;  3A8G B;  3VJP A;  2RJD A;  3J7A F;  3MET A;  1M1K C;  1H3Z A;  3OSS C;  1RI0 A;  1WQ7 A;  3X26 B;  5GAM e;  2CZ6 B;  5LJ3 e;  3EFS A;  3MP1 A;  3H6Z A;  4XQ3 A;  2DPP B;  3MEU A;  3OS5 A;  4NOY A;  2DZ9 A;  1WPY A;  2ZCF B;  2E6N A;  3MP6 A;  2XG8 D;  4C5G A;  5GMK h;  3WXM B;  4JDS A;  1BKB A;  1M4Z A;  1UB4 A;  3I56 A;  2V8K A;  3VU3 C;  2DEQ A;  5C6S A;  4DOV A;  1U1T A;  4PJO F;  3V8J A;  3H8Z A;  2XDD A;  2P4T A;  1I8F A;  2VGN A;  2DKG A;  3VYH B;  4A4E A;  4C5I A;  2RK2 A;  4RCB A;  3CCM T;  3CCU T;  1LNX A;  2L3R A;  3OY9 A;  4M7D B;  3VYG A;  4LD6 A;  1G3T A;  3CBM A;  3OYY A;  1K8A U;  2IVW A;  3A8M B;  3LGL A;  3QJ6 A;  2QEX T;  1MHN A;  3JSC A;  4XU0 A;  3WVD B;  4B9W A;  2ZPF B;  1YHQ T;  2OAU A;  3P8H A;  2K5I A;  5CIU A;  2EFI A;  3L2W A;  5GAO r;  3OYC A;  4M7D A;  3G71 A;  2KK4 A;  3A8O B;  3OS1 A;  1YJ9 T;  3CCE A;  4XU2 A;  1N27 A;  4GY5 A;  2B8A A;  4FT2 A;  2KAF A;  1K9M U;  1WJQ A;  3HP9 A;  5GAO n;  4IKF A;  1Y07 A;  4OGC A;  3OMC A;  5GAN d;  4BE1 A;  2DK3 A;  5CVI A;  1W2B A;  3QHS A;  2GCX A;  2D0Q B;  2LCL A;  4TVR A;  3CD6 T;  5A0G A;  2EAY A;  2CZ7 B;  3OA6 A;  3SWN C;  4HKE A;  4ZTJ A;  1VQ9 T;  1KC8 U;  4DQ2 A;  3GOX A;  3QBY A;  1OZ2 A;  4M7A D;  4ELY C;  2OTL T;  1ZHI A;  1U8R A;  1KQ2 A;  4C92 G;  1VQ6 T;  4M7D F;  4JRI A;  3QKJ A;  1M8V A;  1M9S A;  1KHC A;  2KQW A;  4PJO C;  2E5Q A;  1XTD A;  5LJ5 g;  2XIC A;  4J6Y A;  2OTJ A;  1PSE A;  4C5H A;  4D6W A;  3CCS A;  1YI2 A;  1MGQ A;  1OI1 A;  4N4H A;  2KY9 A;  4E7H A;  2QDY B;  3JRZ A;  1NJI U;  2I2L A;  3RMS A;  4HT8 A;  5FRM A;  3CPW S;  2RB6 A;  4DOW A;  3JCM g;  4E7K A;  3QJY A;  4RG2 A;  3VUZ A;  4M7A A;  3L2Z A;  4E7J A;  1SSF A;  4M78 G;  3CBO A;  3I56 T;  3OQ5 A;  2ZGW A;  2Y4X A;  3JCM d;  1X01 A;  3MEV A;  4XU3 A;  4A53 A;  4PLI A;  1FX7 A;  3CCR A;  1O9S A;  1M1K U;  1KHI A;  5KCO A;  1K8A C;  3PGG A;  3M53 A;  2GFU A;  1YIT A;  2QI2 A;  1Q82 U;  4RMO A;  2QXF A;  1N9S A;  4GLK A;  2HQE A;  1M5Q 1;  3PFS A;  5GAN 5;  3CCV A;  1K73 C;  4OB1 B;  2YLC A;  3JCM Q;  3PIP A;  3JCM b;  5D6W A;  4C0F A;  2CS7 A;  4M7D C;  2EQK A;  3F70 A;  2EYQ A;  2RJF A;  3BW1 A;  2AHJ B;  1UGP B;  2G3R A;  4FU6 A;  3G71 T;  1K9M C;  3ZFJ A;  3CCE T;  1FXX A;  2WSE E;  3G6E A;  4A4K A;  3RUX A;  4HT9 A;  1I81 A;  2RD1 A;  4O6J A;  3JCM c;  1Q7Y U;  1R8O B;  1IZ6 A;  2P0Q A;  1UEB A;  2DIG A;  3FDR A;  2X4Y A;  3A5Z B;  1NZ9 A;  2VUB A;  3LGF A;  1YJ9 A;  5L8R E;  4JRP A;  5LJ5 f;  5GAN h;  3ASK A;  3MEW A;  2NLU A;  4PJO D;  2JTF A;  4M7A E;  4LDY A;  2BKD N;  2HNI A;  3OYM A;  2E12 A;  2L89 A;  2RJE A;  2GQV A;  3HPW A;  4PKC C;  4Y28 E;  1JJ2 A;  2K3Y A;  4QVZ A;  3CD6 A;  2KVQ G;  3JB9 I;  2Y90 A;  2O4X A;  2VXF A;  2ZZD A;  4L5G A;  1Q81 U;  3FB9 A;  2OTJ T;  3L2R A;  1BI3 A;  2RHI A;  3CCS T;  2XID A;  1YI2 T;  1V29 B;  1NJI C;  1VQP T;  5KH6 A;  2E6Z A;  4F7U E;  5LJ5 e;  2VV5 A;  3G7Z A;  3KUF A;  1W2B S;  4M77 G;  3CME T;  5GAO l;  4RG8 A;  2XK0 A;  5DM7 R;  3ZBD A;  4J7I A;  3TU4 K;  1D3B B;  2HQX A;  3P8D A;  4X34 A;  1VQK A;  2P0P A;  2DTH A;  2A7Y A;  2JOY A;  4KBM B;  3UDC A;  2LT1 A;  3L1A A;  5I21 A;  2M1H A;  3MEA A;  5KE3 A;  5GMK e;  2JN0 A;  3CBP A;  1QVP A;  4KUI A;  3CCR T;  3FC3 A;  3CC7 A;  5FU6 B;  2RHZ A;  1Q82 C;  3X24 B;  4FSX A;  1B34 B;  4MZP A;  3JCM h;  1YIT T;  1D3B A;  2YHT A;  5CK9 A;  1JRI A;  4M7D D;  2LTO A;  3MHX A;  4A4H A;  3CCL A;  1G3Y A;  3HRU A;  1BYM A;  3JCM X;  5CQX A;  3OYN A;  3CCV T;  4ZTF A;  4Y91 A;  1XOV A;  2JVV A;  2GF7 A;  2V8J A;  3O8V A;  1B34 A;  5CR2 A;  3S3N A;  1QVG S;  3UPU A;  2VXE A;  2PU9 B;  2PUO B;  5J39 A;  2EQJ A;  2FVU A;  3J81 E;  2DTO A;  1Q7Y C;  1KQ1 A;  3LYI A;  2RO0 A;  4C92 B;  4OMF B;  2X4J A;  1WNL A;  3M55 A;  1OZ3 A;  2CZ0 B;  3G6E T;  2XHC A;  3RKW A;  3X28 B;  4BAC A;  1VQO A;  3TCJ A;  4O5V A;  3HFN A;  3ER0 A;  3JCM P;  1K73 U;  4RCC A;  3EFR A;  2MWO A;  3C94 A;  3GNF B;  2CYZ B;  2LX9 A;  3CEY A;  3OBY A;  4KUD K;  2MAM A;  3BDL A;  4MZT A;  3KBG A;  5GAN g;  4PJO E;  2F69 A;  4C92 A;  1P92 A;  1VQN A;  5GAN j;  2LDM A;  3SFM A;  2D9T A;  4C0D B;  3DLL A;  1YJN A;  2DD5 A;  3OBW A;  4XK8 E;  2HBP A;  4Z02 A;  3ZEH A;  1Y71 A;  3ME9 A;  1Q81 C;  1VQ4 A;  2E64 A;  1TH7 A;  5KE2 A;  2PQW A;  2ZPB B;  4M78 B;  5CAI A;  4ZGD B;  2LRQ A;  3DB3 A;  1RL2 A;  3M9Q A;  3T9N A;  2JZ2 A;  4J6W A;  1VUB A;  1NE8 A;  2RA2 A;  3NTK A;  3OYF A;  2QQB A;  5FU7 B;  4BI3 A;  4C92 F;  3L42 A;  3P8B B;  4M78 A;  2RH2 A;  3M4G A;  3BDU A;  4OGE A;  4B9X A;  5M9O A;  4JS4 A;  4E7L A;  4OF1 A;  1YBY A;  4CI0 C;  1NPR A;  1WQW A;  3DKM A;  2L8D A;  1VQK T;  4MZM A;  1VQP A;  2XI9 A;  1BI1 A;  3GF5 A;  3UWN A;  2WAC A;  3OS2 A;  1JJ2 S;  3RMQ A;  3A8H B;  4R56 A;  3GLX A;  2K4Y A;  3CME A;  3CCQ A;  3CC7 T;  3I55 A;  3J80 E;  4OVA A;  4BE0 A;  4M7D E;  2VYT A;  1QVG A;  3V7R A;  1ZBX A;  1LJO A;  4EMK B;  1G3S A;  4IUQ A;  1BIB A;  4XTZ A;  3M4Y A;  3LX7 A;  4XU1 A;  3L2Q A;  4YTL A;  3L2V A;  3CCL T;  4C8Q B;  4M78 F;  3EAE A;  2CZ1 B;  2HAX A;  5FU6 C;  3E9F A;  4J5Y A;  5GAN 6;  2K5F A;  2ZPI B;  5A0L A;  2RHU A;  3FEO A;  3WVE B;  3OYB A;  3GP8 A;  2QA4 A;  4M75 B;  2GFA A;  5FRO A;  2OTL A;  3JB9 H;  3V8L A;  1YIJ A;  4HCC A;  3L2U A;  3CXC S;  3UT1 A;  3OYG A;  2MMP A;  2DXC A;  3VUB A;  2DIQ A;  3URG A;  3X20 B;  5LJ3 g;  3QDR B;  5GAM g;  1VQO T;  3NTI A;  4NL2 A;  1AHJ B;  4J83 A;  3LH0 A;  5LJ3 j;  5GAM j;  3PIO A;  5A0D A;  4LDX A;  4C92 C;  4IUR A;  4JJN K;  5LJ3 d;  5GAM d;  1W4S A;  3HL8 A;  1VQN T;  3C4S A;  3OMG A;  4M77 B;  3LW5 E;  2H3J A;  5IN1 A;  1UGS B;  4QVD A;  4XTY A;  4PL6 A;  3S3M A;  1YJN T;  3NFC A;  1KD1 C;  2M9U A;  4FT4 A;  4C8Q G;  2RHY A;  1ZQ1 A;  1WGS A;  3C95 A;  4BY6 B;  4P5N A;  1VQ4 T;  2YLB A;  4E7I A;  1VQ7 A;  2KMT A;  4C8Q F;  3DLM A;  4X9D A;  4XTU A;  2R58 A;  5DLO A;  4IUT A;  3OYL A;  4C0D C;  3HHT B;  2F5T X;  3INZ A;  3V7C A;  4C0Z A;  4M77 A;  4M75 G;  3PTA A;  3M56 A;  3CMA A;  4JS5 A;  1YJW T;  5C0M A;  5GAN 4;  1N9R A;  3C12 A;  3QZ9 B;  4IUP A;  4JUV A;  4M75 F;  3RKY A;  5CKE A;  5KCH A;  3OYE A;  3JCM J;  1S72 A;  3A8L B;  4M78 C;  2E65 A;  2PVD B;  2EWN A;  3FIF A;  3QYH B;  2E70 A;  3JCM f;  4V2S A;  3OYD A;  4F7U G;  3CC2 A;  5GMK m;  2BUD A;  5GAO q;  1I4K 1;  5FU7 C;  3LWI A;  2Y4Y A;  4NL3 A;  4KUL A;  5J26 A;  3G4S A;  3CCQ T;  2D6F A;  3V7S A;  4M77 F;  4BD3 A;  2MWP A;  5GAN 7;  3I55 T;  3NTH A;  3GPL A;  4BDZ A;  1KG1 A;  2C06 A;  5I2M A;  3JB9 G;  4C0G A;  4N0A A;  3CXC A;  3JCM e;  4FL6 A;  1VQ8 T;  3JB9 F;  3FLG A;  3BFM A;  4OB0 B;  1QVF S;  3MO8 A;  1FWZ A;  4ATO A;  2QQA A;  3HKS A;  4A54 A;  2WSC E;  3QZ5 B;  4EMK C;  4X9C A;  2FHD A;  1M1F A;  2QA4 T;  2FL7 A;  2XDP A;  3RIR A;  4C8Q C;  1YIJ T;  2M16 A;  4C92 D;  3OSV A;  3RES A;  4BB7 A;  3CC4 A;  3SD4 A;  4A4F A;  1VQ6 A;  2K5L A;  5I2S A;  4OB3 B;  1VQ5 T;  3JCM W;  3M58 A;  3QG1 A;  4M75 C;  2E10 A;  3M54 A;  5EG2 A;  4L6V 5;  4ZGJ B;  5CKH A;  1BI0 A;  2XU8 A;  4KT0 E;  4XAX B;  4ELZ C;  3JB9 J;  2ZPE B;  5LJ3 h;  4BI8 B;  3DB4 A;  5GAM h;  1M90 C;  3MP8 A;  2O01 E;  2RHX A;  3QXE B;  3VKI A;  2HD0 A;  4PJO G;  4E47 A;  3HSB A;  2K57 A;  4UC4 A;  1VQ7 T;  2JUF A;  5D6X A;  4M78 D;  1HK9 A;  1UGQ B;  2P0K A;  2MI6 A;  3QII A;  4M77 C;  1U1S A;  1I5L A;  1H64 1;  3OYA A;  4PLL A;  3CMA T;  3Q1J A;  3X25 B;  2MF2 A;  4QQD A;  4BY6 C;  2XDB A;  3QPH A;  5CO7 A;  3OYJ A;  1S72 T;  1G3W A;  1BIA A;  4MML A;  1KD1 U;  2DZC A;  4MDX A;  5IT9 E;  1N6A A;  1QP3 A;  4N4I A;  4Q5W A;  4J7F A;  1LOJ A;  4JLG A;  4IUU A;  1O75 A;  2BIV A;  3BY7 A;  2RI5 A;  1YJW A;  3CC2 T;  2PVG B;  2VC8 A;  2EIF A;  1BI2 A;  2CKK A;  4IUV A;  5J3B A;  3QO3 A;  4QW2 A;  4XTW A;  1QW1 A;  2EJ9 A;  3JCM V;  3G4S T;  2LNV A;  2DXB A;  2K2V A;  1VQM A;  4CRI A;  3RKX A;  1EIF A;  2KDS A;  5FLX E;  1QVF A;  2V8I A;  1G5V A;  3AHU A;  3GIB A;  1OYX A;  1DJ7 B;  4N0A C;  2DTI A;  5AYF A;  1KQS S;  2WSF E;  4L59 A;  1N8R C;  1Q86 C;  2JNG A;  1QP2 A;  4HCZ A;  4JLI A;  1JBM A;  2RJC A;  3QYG B;  3R6O A;  3SDZ A;  4C8Q D;  5GAN 3;  3OW2 S;  3CPF A;  1X6O A;  3PMT A;  4M7D G;  4II1 A;  3QSU A;  5GAO p;  1WJS A;  4M75 D;  5HY6 A;  4C92 E;  2EJF A;  5IAY A;  2CGH A;  1HXD A;  1VQ8 A;  1VQL A;  1XNI A;  3CC4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...