4X9DA

High-resolution structure of hfq from methanococcus jannaschii in complex with ump
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
NFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ1435
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
total genus 10
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x9dA00
4M75A 3JB9J 5I21A 5LJ3j 4EMKC 4C8QB 1LNXA 3M4GA 3RKWA 2RD1A 3AHUA 1TH7A 1D3BA 5LJ3d 4M77E 4PJOB 4M7AD 3SWNA 5GAN4 4M7DG 4Y91A 3QHSA 1LOJA 2DKGA 2K57A 3BY7A 4M75B 2RA2A 1N9RA 3V7RA 4C8QE 2E64A 1H641 4M78F 5LJ3g 3JCMP 3SWNC 2EJFA 3L1AA 4M77G 4XTVA 4PNOA 4PJOE 4M7AE 4A53A 4M7DC 4A54A 5LJ5h 3EFSA 4XQ3A 3RUXA 1JBMA 3QSUA 2YLBA 4M75E 2RM4A 3JB9F 4XU3A 5GAOq 3JCMW 5LJ5d 4C8QG 5GANf 4HT8A 1M8VA 5GMKh 4M77C 1Y96A 4C8QA 1HK9A 4PJOG 2EWNA 2DTOA 2E10A 3JCMe 1MGQA 2Y90A 1I8FA 3BDUA 3V8JA 5LJ5g 2YHTA 4M75G 3VU3C 1M5Q1 4XTWA 4M78B 1KQ2A 1U1TA 5LJ3h 3FIFA 4C8QD 5GAOm 1Y96B 3FJPA 4M7AC 4PJOC 5GAOr 3JB9I 4PJOD 1B34B 4M75C 3JB9D 1BIAA 5GAMe 3RKYA 4NL3A 4HT9A 4M78E 4M75D 2E65A 4XU0A 5LJ3f 4X9CA 3JCMQ 2E41A 1I4K1 2DVEA 3JCMb 3JCMg 4EMGA 3V8KA 5GAMj 3V7SA 4N0AA 2VC8A 2I2LA 4M78G 4C92B 2DJZA 4F7UF 2EJ9A 4M78A 3RIRA 5GAN6 2FYKA 4OP0A 4XTYA 4NOYA 3JB9G 2E1HA 5LJ5f 1WQWA 4MMKA 1B34A 4M78C 2DZCA 5GAOl 5GANe 5GMKi 1I81A 2EAYA 2YLCA 3JCMc 1YCYA 4M78D 4C8QC 4EMKB 4C92F 5GAOn 2JN0A 3BFMA 3GIBA 3INZA 5DY9A 4XU2A 3JCMh 3RERA 4J6WA 5GANj 4F7UB 4RCCA 5GMKm 3JCMd 4C92A 4DQ2A 2DZ9A 3JB9H 2DTHA 5GAN2 5CAIA 3QUIA 4M7DB 1U1SA 1WPYA 3HSBA 4JLIA 4JRIA 5GAMh 4F7UE 2HNIA 4JUVA 4J6XA 2RB6A 4C92D 5GAMd 4EMKA 4M77B 5GAN5 4V2SA 5GAN8 4NL2A 4N0AC 2EJGA 3FB9A 4F7UG 2VXEA 3V7CA 5GAMg 2DXTA 4M7DF 4F7UA 3EFRA 4QVCA 4C92E 4EMHA 2QTXA 4QVDA 4JRKA 4M7AB 1LJOA 4XTZA 5GAOp 2ZGWA 2VXFA 4M77F 2DTIA 5GMKl 5LJ5e 4M7DA 1JRIA 4X9DA 3BW1A 1HXDA 5GANh 4C92G 3HFNA 4J6YA 2FB7A 2CGHA 4RCBA 5GMKe 1D3BB 4XTUA 4C8QF 5GAN7 4XU1A 5GANd 1WNLA 4M77A 3SWNB 5LJ5j 1X01A 4J5YA 4PJOF 3JCMf 4M7AF 3V8LA 1KQ1A 3PGGA 2DEQA 4M7DD 3JCMV 1I5LA 4WF2A 4C92C 3RKXA 3HFOA 5GMKj 1BIBA 4M75F 4XTXA 5GANg 3QO3A 5LJ3e 5GAN3 3L2ZA 1N9SA 4HA8A 4M7AG 2DXUA 3RESA 3JCMX 1WQ7A 4M77D 4PJOA 3SB2A 4M7AA 4MMLA 4M7DE 3JCMJ 5GAMf
chains in the Genus database with same CATH superfamily
4FT2A 2HBPA 1WXTA 1UJ0A 3TEEA 4M7AD 4PK4A 2K57A 3L2WA 3VKIA 2C0IA 5LJ3g 3CCRT 8ATCB 2EJFA 1G8XA 2GTOA 3OYIA 5L8RE 1EFNA 4JRPA 4WCIA 4ZGDB 3VYGA 2CZ6B 1Y96A 4PJOG 3PVQA 2LQNA 3NGPA 1QVGS 3A8GB 1NZ9A 1PKTA 1VIEA 3X28B 4OB1B 3OSVA 4DOVA 4LDYA 2O88A 2EQMA 1D1CA 2QDYB 1YHQT 4E7IA 4XAXB 1KD1U 1VQLA 1VQPT 5GJWB 4XTYA 2P4RA 2J7IA 2O9SA 4Z89A 1OI1A 1DJ7B 3BFMA 4E6RA 5FU7C 2EPDA 4DQ2A 2L3SA 1VUBA 5CAIA 4B9XA 4X34A 2V1RA 2GCXA 3HSBA 2DD5A 3CCRA 2MK5A 4EMKA 4KBMB 4Y92A 1FWZA 2LQKA 2R5AA 5CKBA 4XTZA 2KXDA 3ZL7C 3CBOA 4OMMA 4J9EA 2AK5A 4FCYA 2RN8A 4FIBA 3LWHA 4M7AF 3C95A 1YHQA 4DBRA 5GAN3 4E7LA 2LCSA 4HA8A 5CCAA 2ZPEB 2LDMA 1VQOT 1S72T 1SEMA 1K4US 4DEYA 1WHJA 3VS3A 4DBFA 1HJDA 1QCNA 1VQ5Q 5LJ3d 1YJWT 2JJ9A 1RAHB 4QKUA 1EZZB 1Y7XA 3V7RA 4FL6A 3CCQT 2PUOB 3JSCA 4PNOA 4J8OA 4M7AE 4JDSA 1OPLA 2A36A 3O5ZA 3EAEA 4CC4B 2C0TA 3CCMT 2CP2A 1VQ7Q 1U1TA 5LJ3h 4C8QD 4M7AC 1G3TA 2KT1A 3CD6Q 1AWJA 4M75D 2C0OA 5LJ3f 3QIIA 2M1HA 4C0DC 1PG5B 1QVGA 1NJIC 3JCMg 1IRXA 3PIOA 2CT4A 1H8KA 2DJZA 4RG8A 2X4XA 2QEXT 3EG2A 2HKNA 3C12A 3OYFA 3J7AF 3M58A 2A28A 2FZCB 2DZCA 1VQOA 1ZHIA 4J9GA 3I5SA 1BYMA 2P0PA 3A98A 3RERA 1G3YA 4KH0B 4BACA 2HSEB 4RCCA 2QDLA 1UEBA 4L6V5 4AFQC 1YJWA 4JRIA 2VUBA 2RH2A 4C92D 3OMCA 2D9TA 1RACB 1Q7YR 3ULRB 4NL2A 5CO7A 5KYYB 4ESRA 1YIJQ 4CC2A 4DBQA 3P8BB 1RAIB 3CCUT 4M7AB 1LJOA 1JRIA 1W6XA 1D3BB 4C0DB 1WJRA 2D1XA 2KAFA 5CKEA 1KQ1A 1I5LA 3HFOA 5GMKj 5GANg 4JPBW 4OMOA 4RTVA 2JXBA 4C0FA 4M77D 1YFNA 2V8JA 3M53A 5HKCA 3ZBDA 2F2VA 1YCSB 1HSQA 4HVVA 2QQAA 5D6WA 3JCMP 1MNEA 2LRQA 3L1AA 3EFSA 3RUXA 2CZ1B 2YUPA 3M0QA 4K11A 4QQGA 2RJEA 1VYTA 1QP2A 2FPDA 3VU3C 2ABLA 4HVWA 4CC7A 1CKBA 2CKKA 1FYNA 2ZPHB 4KUDK 4PJOD 5IXBA 3JB9D 1VQLQ 1FMKA 4BY6B 3WVDB 3CCUA 3H0HA 5HY6A 2X4JA 2MAMA 1XQHA 1OZ3A 4OB2B 3VRYA 1H92A 2DLPA 3GBQA 2DFUA 4LD6A 2DPPB 1QKXA 5GANe 4CI0C 3MP8A 4C8QC 4ME7A 2LMJA 4C92F 3CCRQ 4R0KA 2QTVA 3EFOB 3JCMh 3CC7T 1WJQA 2XK0A 4OF1A 4PFOA 2OTLT 1FX7A 4BB7A 1YITT 2F5TX 4J9HA 4AG2C 1ZQ1A 4A4GA 2ZZDA 2HNIA 2A3LA 2RHUA 1M3BA 5GAN8 3EHQA 3WVEB 3FB9A 1PRMC 3V7CA 1VYVA 4C92E 1NLPC 3EH2A 1YHQQ 2F2WA 4M77F 1WHLA 3TSZA 4LE9A 2CGHA 3HP9A 2WSEE 4XU1A 5GANd 4HCKA 5D7UA 2COYA 1YI2A 1WFWA 3V8LA 1ZBJA 4C92C 3LH5A 2KI7A 5KYYA 4LN2A 4DBHA 2X9HA 4M7AA 3EGXB 2KDSA 3FDRA 3MJXA 3M0UA 4C0GA 2V8IA 4C8QB 2XDPA 1SF9A 1SHGA 2XI9A 1D3BA 4J9IA 4M77E 5GAN4 5HK3A 4M75B 2EKHA 2DKGA 4J83A 1VIFA 3CPFA 2JMAA 4M78F 3SWNC 3QBYA 3CC7A 2YDLA 2RI5A 3FEOA 2IG0A 5LJ5h 2OTLA 2YLBA 3LLRA 3JB9F 1YITA 1SKUB 3E1SA 5GANf 1TOVA 1K1ZA 3X20B 4M77C 1AVZC 1KSWA 2KBTA 2E10A 2Y90A 3C4SA 3BE3A 3GLXA 4MZPA 3TSWA 3FIFA 5GAOm 2EIFA 2QI2A 3R6NA 2LC4A 4M78E 4XU0A 5C6SA 3CCET 2DVEA 1VQOQ 1G83A 4FYVB 3V7SA 1RAFB 5KCOA 4C92B 2NUTB 2FG0A 1UB4A 3OS1A 1YJWQ 4M78C 4ZN3A 3DLMA 4J6WA 1P92A 1WXBA 3MEUA 3CC4T 3RMSA 5J39A 3VRZA 2BE9B 2ECZA 5KYNA 1LVKA 4L59A 3J81E 1OYXA 1M1KC 4JJCA 2IIMA 4M77B 5L23A 4RUGA 3ZFJA 1MMGA 4HKEA 3EFOA 1NE8A 2JMCA 1K76A 3CBPA 3CMET 2CH4A 2R58A 4F16A 3VYHB 3HKSA 2D8JA 4F14A 1PRLC 1UGRB 2RI2A 2E70A 2F69A 4FYWB 3OYHA 2B8AA 4XTXA 3VS2A 1EIFA 2X51A 1OV3A 3HTRA 3LGFA 4LDWA 3JB9J 1VQ6T 4MZMA 3RKWA 1H3HA 4KUIA 2HZYA 3UPUA 4PJOB 2CDTA 3LGLA 3M5AA 2MPXC 3EHRA 3QHSA 3M55A 1X69A 2XMFA 2E64A 2SEMA 2VKNA 3PVLA 2AZVA 3A8MB 1Q81C 2P4TA 3EGXA 2X35A 3BDLA 3CC4A 2F2XA 4N4HA 1M90R 1CKAA 4C8QA 3CCUQ 2RQWA 1I8FA 1QVGP 2JOYA 1K9MU 2KK4A 4FYXB 1Q82R 1KQ2A 4NS5A 3TCJA 1CSKA 1Y96B 3CMEA 1VQKT 5ECAA 4PL6A 2CZ0B 2VC8A 3OYYA 4JRQA 3VS0A 4R56A 3UA6A 1WA7A 3L2VA 2JTMA 3M0PA 3CCST 3T9NA 3CCLT 4A63B 3M54A 3GIBA 3A8LB 2H3EB 1VQ6A 3REAB 3S3NA 5GANj 4C92A 2EQUA 2NUTA 4DOWA 4AMCA 2KY9A 1M4ZA 3OYGA 1KK7A 3FC3A 1Y71A 1IREB 4JUVA 4J6XA 1C1AA 3X24B 1UGQB 5GAN5 3AT1B 3I9QA 2ATCB 2A7YA 4ZGEB 2L8DA 1KHCA 1YI2Q 2LNHB 4KRTA 2ED0A 1ZBXA 2PVOB 4C92G 1GCPA 4VUBA 4EPCA 2ROTA 4M77A 2RK2A 1VQKA 2KYMA 1GRIA 1UG1A 1K0XA 2QK0A 3CQTA 3SB2A 1IB8A 4MMLA 5IT9E 2HL3A 4HVUA 3CC7Q 2RK1A 3HRUA 2OTLQ 1LNXA 2LQWA 4PJMA 1YITQ 3EH1A 3VS4A 2MOXA 3GNGA 4M77G 1GBRA 2GBQA 4XU3A 1Y57A 1K73C 1IHWA 2K3XA 2HL5C 3OYCA 4QVZA 1RL2A 1Q86U 2KNBB 2M0OA 3QZ5B 3QDFA 4C5EA 3GNFB 5GAOr 1RAGB 2YXYA 3I56T 4IIMA 2CP0A 2BZ8A 2E41A 1ZSGA 2LVMA 2JZ2A 4J7FA 2LCLA 4M78G 4IUVA 1T0JA 1KC8U 2FYKA 1YJNA 1R0CB 3JB9G 4CRIA 1HD3A 2JN0A 2RHYA 4XU2A 4JZ4A 4F04B 4PJNA 2XU8A 4E2FB 2CZ7B 5KE2A 1BKBA 2JM8A 4JLIA 2YUOA 5GAMh 2DYBA 3OW2P 3VS6A 1X2QA 1Q81U 2L3RA 1WDXA 4ELYC 5I11A 2X4WA 3VS1A 3NHNA 2XIDA 3ZEHA 1SG5A 2EGCA 4TVRA 1AWXA 1PSEA 2M51A 5M9OA 3QXEB 1WNLA 3I56A 1N8RU 4M7DD 5EC7A 4PLLA 1UGVA 7AT1B 1BIBA 3QJ6A 1TU0B 3CCVT 5LJ3e 3L2ZA 1N9SA 4MZTA 5DLOA 1TXQA 3RESA 2JTEA 1LCKA 2B86A 1AT1B 1PD0A 5I21A 2RI3A 2AKLA 3CC4Q 2QGFB 4Y91A 1XNIA 3BY7A 2RA2A 1N9RA 1M3AA 4XTVA 2HAXA 1ZSZC 1JBMA 1KJWA 1NJIR 2RM4A 3OS0A 2FZKB 3CMEQ 2VV5A 5IAYA 1TS9A 2EQKA 2ZCFB 8AT1B 1OQKA 1VQPA 3H0IA 1GFCA 1OU8A 2CP7A 2XDBA 5CQXA 3RKYA 2RQTA 3PIPA 4EDUA 3JCMQ 5FU7B 2AZSA 3EG9B 2ZPIB 2KE9A 5FLXE 2M0YA 2O4XB 1VQ6Q 1Z9ZA 2COWA 2CREA 1OX8A 2F1LA 3LW5E 4QQDA 1WQWA 3CCVA 5GAOn 4XK8E 1U3OA 5J3BA 2SRCA 2RQUA 3UDCA 2LQ8A 1ZSZB 1BCOA 4BD3A 5KH6A 1K73U 2DE0X 1O75A 3L2QA 2EJGA 4R55A 2W0ZA 1VQKQ 4M7DF 2HKQB 1S72A 2LJ0A 1D0YA 4EIKA 1FXXA 5IHIA 1K8AU 2LT1A 2X3XD 3EG3A 4J6YA 4QT7A 2VB6A 3CCSQ 5KYXB 3CCQA 2GQVA 2QGGA 1BBZA 3OW2S 3UF4A 3OY9A 2DXUA 1I07A 2KSSA 4M7DE 2KMTA 1PNJA 1GL5A 3O8VA 3M4GA 1X6OA 3CCMA 3QJYA 3CMAT 2LX9A 5FU6C 1VQNT 4ATOA 2KGTA 2K5IA 2DILA 4BI4A 2NLUA 5D6XA 2PUKB 4M7DC 1T3LA 1M8VA 5IHNA 1MV3A 4ANJA 2DETA 4AFZC 3IQLA 3JCMe 1YNZA 3V8JA 5LJ5g 1UUEA 5A2QE 3CC2T 2DIGA 4GLKA 2FHDA 5LL6S 2QEXA 3OBYA 4J9DA 4ELZC 2PTKA 4A4EA 1JB0E 3LH0A 1V1CA 1YJNQ 4HT9A 3THKA 4X9CA 1NEGA 1MNDA 2FO0A 4F7UF 2D0NA 4OP0A 4DA4A 2JS2A 2EW3A 5CVIA 2ZPBB 5GMKi 2VGMA 4M78D 9ATCB 1M2OA 3EG9A 3MEWA 1D0XA 5FU6B 2XKOC 2E3HA 1RAEB 1ACMB 4PJLA 5A0LA 3JCMd 3OYNA 1VOMA 1UHFA 2O4XA 1QVFP 5GAN2 4KT0E 4M7DB 3F70A 4F7UE 2GFUA 1WI7A 4RTTA 1RUWA 1JEGA 2GF7A 2E3IA 3QDRB 3I56Q 3QWXX 4A4HA 2E5QA 2ZGWA 5GMKl 5LJ5e 3CC2A 4AFUC 2DF6A 1ZSZA 1NYGA 5FWCA 3CPWP 2RQVA 2KRNA 3JCMf 4AT1B 2AT1B 2FRWA 2DL3A 2YRVA 1YP5A 1OEBA 1K9MC 2DERA 5KYWB 5LJ3j 3J80E 3OW2A 4D6WA 1Q95G 3QG1A 2YWWA 2DK3A 4X1VA 5KYXA 1KG1A 2DRKA 1S1NA 4E7SA 1VQPQ 2ENMA 2L5QA 1TUDA 3GPLA 3DB3A 5LJ5d 4JZ3A 1ZUKA 1GXIE 1PC0A 2OAWA 1I1JA 1M5Q1 2XICA 4BE2A 2DRMA 3VUZA 2FEIA 2ZPGB 4HCBA 3UA7A 1B34B 2EQJA 4OMNA 4J7IA 1YBYA 3CCVQ 2YUQA 2ZPFB 5IH2A 3JCMb 2L0AA 2I2LA 4IUQA 1X6GA 2DO3A 1D1AA 5A0GA 3MKDA 4PJJA 2GGRA 1M1KR 3ASKA 4RMOA 5LJ5f 2J6OA 4LUDA 4O5VA 2K3BA 1ZX6A 2IVWA 4CC3A 4JS5A 4C5IA 2MIOA 2QG9B 2QA4T 4J9BA 2KEAA 1S72Q 1WPYA 3DB4A 1WGSA 2PZ1A 3KXTA 3I35A 1SRMA 2OTJT 1SPKA 2JM9A 4J9CA 4RTZA 1F1BB 1VQ4T 2QQ9A 2K2MA 2DXTA 1BB9A 4QVCA 2FPEA 3CCQQ 2LT4A 2HCKA 3M56A 2RJCA 4M7DA 1WLPB 3MCAB 4N4IA 2FL7A 4XTUA 1YN8A 3M59A 3QYGB 3SWNB 2EQIA 1X01A 1QVFS 3DKMA 2NUZA 1XTDA 2HQEA 4E7ZA 3CCJT 3CCMQ 3PGGA 1AOJA 3JCMV 1KD1R 2YUNA 3OYEA 2DYIA 2GQIA 3JCMX 3PE0A 5CKDA 1X2KA 1Q86C 3I5RA 1I0CA 3OYMA 1FMVA 4OMFB 2G6FX 1X75C 3D7SB 4M7DG 3X26B 4BDZA 1B3QA 3REBB 1U8RA 4B9WA 4LD9K 3RNJA 1H641 3CPWS 1UGPB 2J6FA 2QEXQ 1QW1A 3CCEA 2QA4A 1KC8C 3ER0A 5KYWA 5DM7R 1Q7YU 2CYZB 2EWNA 1N27A 3NPFA 1T3SA 4M78B 1W2BP 3TREA 1M2VB 1VQ4A 1WHGA 3VUBA 1RLPC 3GF5A 1NEBA 2J06A 3A8HB 2EYXA 2V26A 1XJWB 2MF2A 1RADB 3OYLA 1AEYA 2CS7A 1QWFA 4Q5WA 3UT1A 4BI3A 3CCJA 2KQWA 3RMQA 1OZ2A 1R8OB 2DA9A 1B34A 2EGAA 1I81A 1VQMT 4FM4B 3N5BB 3OYAA 3INZA 4OGCA 4BE0A 1M3CA 3OYJA 4JLGA 1W1FA 2DZ9A 1N8RC 2DTHA 1GBQA 2EYYA 4OB0B 2ROLA 3ME9A 1BI1A 1I5OB 3CC2Q 3G71T 2NUPB 3M9QA 4ORZA 1QKWA 4F7UG 2MI6A 5GAMg 4QVDA 3PMTA 2DM1A 2LX7A 3M0RA 3EG1A 4DEXA 5I2SA 4IIOA 2WSCE 4C0ZA 3CXCP 1K0SA 2P0QA 2KXCA 5LJ5j 1WX6A 1X27A 1JU5C 2QXFA 5CKFA 1QP3A 3HL8A 5GJVB 2K79A 5KYUB 1AHJB 1TUCA 1QVFA 4BI8B 1VYUA 2P0KA 4OVAA 3AHUA 3JRZA 4E47A 4A4FA 3SWNA 3PNWC 4FT4A 1VQMA 2KYBA 1U06A 4IURA 3FRNA 1IZ6A 3SEMA 4A53A 5IXFA 4A54A 3QSUA 1QQJA 1C0MA 4JJNK 5I22A 1VQ9T 2QQBA 1UFFA 1HYOA 3CPWA 3BDUA 2YHTA 3VJPA 3G71A 3VS5A 3CEYA 1NBEB 5CR2A 3CCSA 2DXCA 5GAMe 2OI3A 3CCLA 4FYYB 4GLMA 4BDYA 4E7HA 2HD0A 2G3RA 5C0MA 3UWNA 4M78A 3RIRA 1A0NB 4UC4A 1M2VA 4IUUA 1D0ZA 2NYSA 4MMKA 2K5LA 1R0BG 2CP6A 1OULA 3SHWA 1W2BS 1K8AC 5DY9A 3MHXA 2BE7D 2EFIA 3QYHB 5KE3A 1OX9A 5J26A 4WTOB 4KULA 3A5ZB 1JJ2P 2K4YA 3LX7A 1PSFA 2L2PA 2A37A 5GAMd 1AZGB 3H9NA 1R77A 1TWBA 1O9SA 4N0AC 1VQ9A 5CKHA 3G4ST 2P84A 2BIVA 3EGUA 1WHMA 1ARKA 3PT9A 5GAOp 4Z88A 6AT1B 2VXFA 3OYBA 2DL5A 3OYDA 1UHCA 2CT3A 2NUPA 1BCMA 1LPLA 4J5YA 2D0QB 2DEQA 2K9GA 2GTJA 4WF2A 3RKXA 3JAME 3M0SA 2LJ3A 3S3OA 2OAUA 2BKDN 5GAMf 2JNGA 3L42A 4J9FA 2E4HA 3TVTA 3CCEQ 2QA4Q 2RJDA 4AG1C 1E7OA 1ZA2B 1LOJA 1JXOA 2AIRB 2OTJQ 3I55T 5KYUA 3CXCS 2O31A 2DAQA 1VQ4Q 3PMIA 1IHVA 4OMPA 5GMKh 2DVJA 1M1GA 1WZOA 1MHNA 1UECA 2I0NA 3EGDB 3JV3A 1M27C 1UE9A 2WACA 4XTWA 2K3YA 2RNAA 1RABB 2FPFA 4E7JA 2JS0A 5HCKA 3G4SA 1BIAA 2J05A 3CCJQ 3A1PA 5FRNA 3SFMA 4EMGA 3META 2PQWA 3PTAA 1ABQA 2YSQA 2EJ9A 2R5MA 2CUBA 2DL7A 2OJ2A 5GAOl 2L89A 3JCMc 1YCYA 1OOTA 2XG8D 5IN1A 4FSSA 4HCZA 3OBWA 3PFSA 2D8HA 2XD0A 1GFDA 3MPUB 2IPOB 1U1SA 4GY5A 1W2BA 3I55A 1M90U 1Y07A 4OGEA 2WSFE 1WXUA 5HK0A 2VXEA 4Y28E 4LDXA 1Q82U 2QTXA 1RAAB 1VA7A 4ZN1A 1G3SA 3BW1A 1NLOC 4ZGJB 1W70A 5GAN7 5GAOq 3TU4K 1JJ2S 2VASA 4C5GA 3VS7A 4RG2A 2PNIA 4IUPA 2M9UA 3RR6A 2H8HA 3MP1A 1VQMQ 1NYFA 2XHCA 2JT4A 1QMCA 3H8ZA 1KQSP 4E7KA 1NPPA 4ZTJA 4QW2A 5DLQE 1TG0A 2QQRA 5CQYA 2LZ6B 2MYSA 4FU6A 2L3PA 2LP5A 4JJDA 3G71Q 1UDLA 3NTHA 2VWFA 1N5ZA 1RI0A 2EKOA 4O6JA 3CBMA 1WIEA 3CCLQ 2L3QA 2J6KA 1X6BA 3S3MA 2K5FA 3CXCA 2GFAA 1PM3A 2E12A 2YRDA 1PHTA 3QKJA 2ZAEA 1UJYA 1JXMA 1V29B 2E65A 2JVVA 3HRTA 1I4K1 2ED1A 4QQ6A 3EGDA 4KGZB 5GAMj 3WXMB 4N0AA 2W10A 2E5KA 3LYIA 1GCQC 2CH4W 1ZLMA 4LUEA 3OS2A 2DEUA 1XOVA 4RTUA 1M30A 2O9VA 4BY6C 3EG0A 3NTIA 1BI3A 3H6ZA 2C06A 4LNPA 1VQ9Q 2RHZA 2JUFA 4JJBA 3C94A 2EVRA 1X43A 1YWOA 3E9FA 4KGXB 2HQHA 1WHHA 3GOXA 2CSIA 3EFRA 1K9MR 3P8DA 2HQXA 2A0FB 1RLQC 1C6VX 2DTIA 4OMQA 1PCXA 3FLGA 2F5KA 2GNCA 2PU9B 3CMAA 4C8QF 1VQNA 4II1A 5CIUA 1Q7YC 4M75F 2JTFA 1TUGB 3KBGA 3S6WA 1D09B 1PD1A 4PFZA 4YTLA 1JJ2A 1VQ8T 4IKFA 1KHIA 3NFCA 2DD4A 2V8KA 2M02A 2DNUA 1YI2T 4HXJA 4RTWA 4C8QE 4OB3B 3U23A 4M75E 1QWEA 3G4SQ 3JCMW 4HT8A 2CP5A 1HK9A 3L2RA 2KRMA 2DTOA 1YJ9T 4RTXA 3OS5A 3NTKA 1KQSS 5A0DA 3OYKA 3JB9I 4M75C 2VYTA 4D8DA 4NL3A 2VGNA 3QZ9B 1ZA1B 5I2MA 2MCNA 1M9SA 4KGVB 4M4ZA 4Z02A 2EBPA 3V8KA 2DX1A 5IHKA 4BE1A 2EYWA 3G6ET 1TTHB 1RI9A 1EX4A 2PVDB 4D8KA 3VV0A 4PKCC 2DXBA 3I55Q 2Y4YA 1VQ8A 3E2UA 2CUDA 3LWIA 4F7UB 2KRSA 4LXCA 2EGEA 2HDAA 1IGQA 1ABOA 3MEVA 2DIQA 1G2BA 2RJFA 1NJIU 3FJ5A 1SRLA 4MDWA 1KIKA 2RHIA 2DL8A 1AWOA 2AHJB 1WYXA 3HHTB 5D6YA 3SD4A 1Q86R 4EMHA 4A4KA 1YJ9A 2A08A 2VVKA 5EG2A 4X9DA 5GANh 2HEQA 3HFNA 3C0CA 1SSHA 4PJOF 1UGSB 1MUZA 1AWWA 4M7AG 1J3TA 1WQ7A 1KC8R 2CP3A 5AT1B 3DLLA 4FW1A 2LNVA 3G6EA 3H41A 3JCMJ 3NMZC 5FROA 1JQQA 1TH7A 3L2UA 4PLIA 2BZYA 4ZTFA 1PWTA 1BI0A 1QCOA 1BI2A 2K2VA 1PKSA 2XDDA 2LCCA 4PJOE 4JS4A 1GCQA 2CSQA 2DMOA 4L5GA 1U5SA 4GBQA 1Q81R 5KCHA 5CK9A 3OMGA 1OU9A 2QAZA 2K6DA 1ZUUA 4PJOC 2MMPA 4F17A 3SDZA 2YT6A 2RMOA 2KT8A 1QCFA 2QASA 1KQSA 1FMWA 1N8RR 2BZXA 1OPKA 3G7ZA 1QVPA 3E9GA 4LDUA 2E6NA 2X3WD 4RTYA 5GAN6 4NOYA 2OTJA 1G5VA 2EAYA 3R6OA 2O2OA 4PFPA 1H3ZA 2EYQA 3RDVA 2KR3A 2D6FA 2NWMA 2BUDA 1VQ5T 4RKUE 3QUIA 1UTIA 4AFSC 1NPRA 1WHKA 3E19A 4V2SA 4BUGA 2COZA 3CMAQ 3KUFA 1WJSA 4F7UA 2HSPA 1VQNQ 2RPNA 4JRKA 2ESWA 2RO0A 1VQ7T 1BU1A 2BTTA 1Y0MA 5FRMA 5AYFA 4ZNXA 3OQ5A 3TQ7P 4KH1B 2FVUA 1KD1C 3CD6T 2RHXA 1MV0B 3QWYA 2FZGB 3HPWA 1BK2A 3OSSC 1IO6A 1N6AA 2K7AA 1M1FA 4LDVA 4M75A 1D1BA 4EMKC 2R57A 1IXDA 2RD1A 1AZEA 1V76A 2JW4A 2YRCA 1NG2A 3GP8A 1MMDA 2DBKA 1T0HA 3MP6A 5FWBA 1SHFA 4XQ3A 1VQ5A 4C8QG 2DBMA 2M16A 4HCCA 2DL4A 4P5NA 1K73R 1MGQA 1MMNA 4M75G 3X25B 2O01E 3P8HA 4Z8AA 3FJPA 4IUTA 5FW9A 2OX7A 2DJQA 1YIJT 1K8AR 3M57A 1VQ7A 2FRYA 1M90C 4FW2A 2H3JA 1K9AA 2QQSA 1VQ8Q 3M0TA 2KROA 3CD6A 2PVGB 2HBWA 2Z0WA 2E1HA 2RF0A 1Q82C 1KFZA 1QLYA 3UATA 1YWPA 3URGA 2YLCA 1AD5A 4EMKB 1M8MA 4FSXA 3OA6A 2RQRA 1G3WA 4OMLA 3QPHA 2LTOA 5GMKm 2HMAA 2V1QA 3JB9H 1B7TA 2Y4XA 1B07A 1YJNT 1E6HA 1YJ9Q 1NM7A 1SSFA 3OB9A 2RB6A 3RBBB 1Z9QA 3H0FA 2MWPA 2X4YA 3M4YA 2MWOA 2EYZA 1ZUYA 1MMAA 2E6ZA 4B6MA 3HRSA 1HXDA 5GMKe 2AKKA 2FB7A 1W4SA 4RCBA 3G6EQ 1IGUA 2QYZA 1JO8A 3MEAA 1YIJA 3A8OB 1VQLT 4N4GA 3KFVA 4MDXA 1E6GA 2LJ1A 3G1JA 3QO3A 3Q1JA 2KVQG 1M1KU 4C5HA 4PJOA 1TSFA 3MO8A
chains in the Genus database with same CATH topology
3LGFA 4LDWA 4FT2A 3JB9J 1VQ6T 4MZMA 5LJ3j 4E7KA 1NPPA 4ZTJA 2HBPA 3RKWA 4QW2A 3TEEA 4KUIA 3J80E 4PJOB 3UPUA 3OW2A 4M7AD 4D6WA 3LGLA 5DLQE 3M5AA 2QQRA 5CQYA 3QHSA 3M55A 2K57A 3QG1A 3L2WA 2DK3A 3VKIA 4FU6A 5LJ3g 2E64A 1KG1A 3CCRT 2EJFA 3NTHA 3A8MB 1Q81C 2L5QA 2P4TA 1RI0A 3OYIA 2X35A 3BDLA 2EKOA 5L8RE 4N4HA 4O6JA 3GPLA 3DB3A 4JRPA 3CC4A 5LJ5d 3CBMA 4ZGDB 3VYGA 2CZ6B 4C8QA 1Y96A 4PJOG 3S3MA 2K5FA 1GXIE 1I8FA 2XICA 1M5Q1 3CXCA 4BE2A 2JOYA 3A8GB 1NZ9A 2GFAA 1QVGS 1K9MU 2KK4A 1KQ2A 2E12A 4NS5A 3VUZA 1VIEA 3TCJA 1Y96B 4OB1B 3X28B 2ZPGB 4HCBA 3QKJA 3OSVA 4DOVA 4LDYA 1B34B 2EQJA 3CMEA 1VQKT 2EQMA 4J7IA 1YBYA 1V29B 2E65A 2JVVA 2QDYB 3HRTA 4PL6A 1YHQT 2ZPFB 1I4K1 3JCMb 4E7IA 4QQ6A 5GAMj 4XAXB 3WXMB 4N0AA 2CZ0B 2VC8A 3OYYA 2I2LA 4IUQA 4JRQA 4R56A 1KD1U 2DO3A 3LYIA 5A0GA 1VQPT 1VQLA 4XTYA 2JTMA 3ASKA 4RMOA 3L2VA 5LJ5f 3CCST 3T9NA 3CCLT 4O5VA 1OI1A 3M54A 1DJ7B 3BFMA 3A8LB 3OS2A 3GIBA 1XOVA 1VQ6A 4BY6C 3S3NA 5GANj 2IVWA 3NTIA 5FU7C 1BI3A 3H6ZA 4C92A 4C5IA 2EQUA 4DOWA 4DQ2A 2RHZA 4JS5A 2C06A 2JUFA 2KY9A 2QA4T 3C94A 1M4ZA 1VUBA 5CAIA 4B9XA 4X34A 1WPYA 2GCXA 3OYGA 3HSBA 2DD5A 3DB4A 1WGSA 3E9FA 3KXTA 3FC3A 3CCRA 1Y71A 1IREB 4JUVA 4J6XA 2OTJT 3X24B 4EMKA 1UGQB 5GAN5 4KBMB 2A7YA 4ZGEB 1VQ4T 1FWZA 2L8DA 2QQ9A 3GOXA 1KHCA 2DXTA 4QVCA 3EFRA 2LQKA 2R5AA 3P8DA 5CKBA 2HQXA 4XTZA 2LT4A 3M56A 3CBOA 1ZBXA 2DTIA 2RJCA 4M7DA 2PVOB 3FLGA 3MCAB 2F5KA 2PU9B 4N4IA 4C92G 2FL7A 4VUBA 4XTUA 4EPCA 4C8QF 3CMAA 3M59A 3QYGB 4M77A 2RK2A 3SWNB 1X01A 1VQKA 3DKMA 4FIBA 3LWHA 1XTDA 2HQEA 3CCJT 1QVFS 1VQNA 3PGGA 4M7AF 3C95A 4II1A 5CIUA 3JCMV 1YHQA 1Q7YC 5GAN3 4M75F 4E7LA 2JTFA 4HA8A 5CCAA 2ZPEB 2LDMA 3OYEA 3JCMX 1VQOT 3KBGA 1S72T 3SB2A 3S6WA 5CKDA 1Q86C 4MMLA 5IT9E 2RK1A 3HRUA 4YTLA 3OYMA 1JJ2A 1VQ8T 4IKFA 1KHIA 3NFCA 2DD4A 1LNXA 4OMFB 2V8KA 5LJ3d 1X75C 1YJWT 4M7DG 3X26B 4BDZA 1YI2T 1U8RA 1Y7XA 4B9WA 4LD9K 3V7RA 4FL6A 4C8QE 3CCQT 1H641 2PUOB 4OB3B 3CPWS 3JSCA 3GNGA 4M77G 4PNOA 1UGPB 4J8OA 4M7AE 4JDSA 1QW1A 4M75E 4XU3A 3CCEA 3JCMW 2QA4A 1K73C 1KC8C 3ER0A 4HT8A 5DM7R 3EAEA 1Q7YU 1HK9A 2CYZB 3L2RA 3CCMT 2EWNA 2DTOA 2K3XA 1YJ9T 1N27A 3OS5A 3NTKA 4QVZA 1RL2A 3OYCA 1Q86U 4M78B 2M0OA 3QZ5B 1KQSS 1U1TA 5LJ3h 3TREA 5A0DA 4C5EA 4C8QD 3OYKA 1VQ4A 1G3TA 3GNFB 4M7AC 5GAOr 3JB9I 3VUBA 4M75C 2VYTA 4NL3A 2VGNA 3QZ9B 3GF5A 5I2MA 3I56T 4M75D 5LJ3f 3A8HB 3QIIA 2M1HA 2E41A 4C0DC 1M9SA 2MF2A 4Z02A 2LVMA 1QVGA 2JZ2A 1NJIC 3JCMg 3OYLA 3V8KA 3PIOA 4J7FA 2LCLA 4M78G 4BE1A 2CS7A 2DJZA 4RG8A 3G6ET 3UT1A 4Q5WA 4BI3A 4IUVA 2X4XA 2QEXT 3CCJA 1KC8U 2FYKA 1YJNA 2KQWA 3RMQA 3C12A 3JB9G 1OZ2A 1R8OB 4CRIA 3OYFA 3M58A 3J7AF 1B34A 2PVDB 2DZCA 1VQOA 1ZHIA 1I81A 4PKCC 3VV0A 1VQMT 4FM4B 1BYMA 2P0PA 3N5BB 2JN0A 2DXBA 3OYAA 2RHYA 3INZA 2Y4YA 4OGCA 4XU2A 4BE0A 1VQ8A 3OYJA 3RERA 4JLGA 1G3YA 3LWIA 4BACA 2XU8A 4F7UB 4RCCA 1UEBA 4L6V5 2CZ7B 5KE2A 2DZ9A 1YJWA 1N8RC 2DTHA 1BKBA 2DIQA 3MEVA 4OB0B 4JLIA 2RJFA 4JRIA 5GAMh 1NJIU 2VUBA 1BI1A 2RH2A 3ME9A 4MDWA 1Q81U 2L3RA 2RHIA 3OMCA 4C92D 3G71T 2AHJB 2D9TA 4ELYC 3HHTB 3M9QA 5D6YA 4NL2A 2X4WA 5CO7A 4F7UG 2MI6A 5GAMg 3SD4A 3P8BB 4QVDA 4EMHA 3PMTA 2XIDA 4A4KA 3ZEHA 1YJ9A 3CCUT 4M7AB 1LJOA 5EG2A 5I2SA 1JRIA 4X9DA 4TVRA 2WSCE 1PSEA 5GANh 3HFNA 5M9OA 3QXEB 4C0ZA 1D3BB 4C0DB 1WJRA 2P0QA 1WNLA 2KAFA 5LJ5j 3I56A 4PJOF 1N8RU 5CKEA 4M7DD 1KQ1A 2QXFA 4PLLA 5CKFA 1I5LA 3HFOA 5GMKj 1BIBA 1QP3A 3HL8A 3QJ6A 1UGSB 5LJ3e 5GANg 3L2ZA 1N9SA 4MZTA 3CCVT 4M7AG 5DLOA 1AHJB 3RESA 4C0FA 1WQ7A 4M77D 3DLLA 2LNVA 2V8JA 3M53A 5HKCA 3ZBDA 3G6EA 5FROA 3JCMJ 1QVFA 5I21A 2RI3A 4BI8B 2P0KA 4OVAA 3AHUA 3JRZA 4E47A 1TH7A 3L2UA 4PLIA 4A4FA 3SWNA 4ZTFA 3PNWC 4FT4A 1VQMA 1BI0A 4Y91A 1XNIA 2QQAA 1BI2A 3BY7A 4IURA 2K2VA 1N9RA 2RA2A 5D6WA 2LRQA 3JCMP 3FRNA 3L1AA 1IZ6A 4XTVA 2LCCA 2XDDA 4PJOE 4JS4A 4A53A 4A54A 4L5GA 3EFSA 2HAXA 3QSUA 3RUXA 1JBMA 2CZ1B 2RM4A 4QQGA 4JJNK 3OS0A 1VQ9T 2QQBA 5KCHA 2VV5A 2RJEA 5CK9A 1QP2A 3OMGA 5IAYA 3CPWA 3BDUA 2YHTA 2EQKA 3VJPA 2ZCFB 3VU3C 3G71A 3CEYA 1VQPA 2CKKA 4PJOC 2MMPA 2ZPHB 4KUDK 5CR2A 3CCSA 4PJOD 3JB9D 2DXCA 5GAMe 2XDBA 5CQXA 3RKYA 3SDZA 3CCLA 4BY6B 3WVDB 3CCUA 3PIPA 4EDUA 3JCMQ 4BDYA 5FU7B 4E7HA 2HD0A 1KQSA 2G3RA 2ZPIB 5C0MA 5HY6A 5FLXE 2X4JA 2MAMA 1XQHA 1OZ3A 4OB2B 3UWNA 2O4XB 3G7ZA 4M78A 1QVPA 3RIRA 3E9GA 4LDUA 2E6NA 4IUUA 4UC4A 5GAN6 3LW5E 4NOYA 4QQDA 4LD6A 1WQWA 3CCVA 2DPPB 2K5LA 4MMKA 2OTJA 5GANe 4CI0C 3MP8A 2EAYA 3R6OA 4C8QC 4ME7A 5GAOn 1G5VA 4C92F 1W2BS 1H3ZA 1K8AC 4XK8E 2EYQA 5DY9A 3MHXA 3JCMh 3CC7T 1WJQA 2XK0A 2EFIA 4OF1A 3QYHB 5KE3A 5J26A 2OTLT 2D6FA 1FX7A 2BUDA 5J3BA 4KULA 3A5ZB 4BB7A 1YITT 1VQ5T 4RKUE 2F5TX 3UDCA 3QUIA 2K4YA 2LQ8A 1ZQ1A 4A4GA 3LX7A 1PSFA 2ZZDA 2HNIA 2A3LA 4BD3A 5KH6A 5GAMd 1NPRA 3E19A 4V2SA 2RHUA 5GAN8 1K73U 1O75A 3WVEB 1O9SA 4N0AC 4BUGA 3L2QA 2EJGA 3FB9A 3KUFA 4R55A 5CKHA 1VQ9A 3V7CA 1WJSA 3G4ST 4M7DF 4F7UA 4C92E 2BIVA 4JRKA 1S72A 3PT9A 5GAOp 2RO0A 1FXXA 1VQ7T 2VXFA 4M77F 1K8AU 2LT1A 3OYBA 4J6YA 2CGHA 3HP9A 5FRMA 3OYDA 5AYFA 2WSEE 3OQ5A 4XU1A 5GANd 2FVUA 1KD1C 1YI2A 4J5YA 3CD6T 3V8LA 2D0QB 2DEQA 4WF2A 4C92C 3RKXA 3CCQA 2RHXA 3JAME 2GQVA 3OW2S 3OY9A 3HPWA 2DXUA 3OSSC 3S3OA 1N6AA 4M7AA 2KSSA 2KDSA 2OAUA 3FDRA 1M1FA 4M7DE 4LDVA 2KMTA 2BKDN 5GAMf 4M75A 2JNGA 3L42A 4C0GA 4EMKC 2V8IA 2R57A 2XDPA 3O8VA 4C8QB 3M4GA 1X6OA 2RD1A 2XI9A 3QJYA 3CCMA 1D3BA 4M77E 3CMAT 2LX9A 5FU6C 5GAN4 5HK3A 2RJDA 1VQNT 4ATOA 4M75B 1LOJA 2DKGA 2K5IA 4J83A 4BI4A 1VIFA 3CPFA 4M78F 3GP8A 2NLUA 3SWNC 3QBYA 5D6XA 3I55T 3CC7A 3CXCS 2RI5A 3MP6A 2PUKB 3FEOA 4M7DC 2IG0A 5LJ5h 2OTLA 2DAQA 4XQ3A 3PMIA 2YLBA 3LLRA 3JB9F 1YITA 1VQ5A 3E1SA 4C8QG 5GANf 1M8VA 5GMKh 1M1GA 3X20B 1MHNA 4M77C 2M16A 4HCCA 4P5NA 2E10A 3JCMe 1MGQA 2Y90A 3C4SA 3V8JA 5LJ5g 4M75G 3X25B 3GLXA 4MZPA 2WACA 4XTWA 5A2QE 2K3YA 2DIGA 3CC2T 4GLKA 2O01E 2FHDA 3P8HA 5LL6S 2QEXA 3FIFA 5GAOm 4E7JA 3FJPA 3OBYA 4IUTA 4ELZC 4A4EA 1JB0E 3G4SA 2EIFA 3LH0A 2QI2A 1YIJT 1BIAA 2LC4A 4HT9A 4M78E 4XU0A 5FRNA 4X9CA 3M57A 5C6SA 3CCET 1VQ7A 3SFMA 2DVEA 4EMGA 3META 3V7SA 1M90C 2PQWA 3PTAA 5KCOA 4C92B 2H3JA 4F7UF 2EJ9A 2QQSA 2R5MA 3CD6A 2PVGB 4OP0A 4DA4A 1UB4A 2E1HA 3OS1A 1Q82C 4M78C 5CVIA 3URGA 4ZN3A 5GAOl 2ZPBB 3DLMA 5GMKi 2L89A 2VGMA 2YLCA 3JCMc 1YCYA 4M78D 4EMKB 4FSXA 3OA6A 2XG8D 3MEWA 5FU6B 5IN1A 1G3WA 2LTOA 1P92A 2XKOC 3QPHA 4HCZA 3OBWA 4J6WA 3PFSA 3MEUA 5A0LA 5GMKm 3JCMd 2XD0A 3OYNA 3CC4T 3RMSA 2O4XA 3JB9H 5J39A 5GAN2 4KT0E 2Y4XA 4M7DB 1U1SA 1YJNT 3F70A 4GY5A 1W2BA 4L59A 4F7UE 2GFUA 3J81E 1OYXA 1SSFA 3I55A 3OB9A 1M1KC 2RB6A 1M90U 2MWPA 2X4YA 3M4YA 4M77B 1Y07A 4OGEA 3ZFJA 2GF7A 2WSFE 2MWOA 4HKEA 5HK0A 1NE8A 2VXEA 4Y28E 3QDRB 4LDXA 3CBPA 1Q82U 2QTXA 4A4HA 3CMET 2R58A 2E6ZA 2E5QA 3HRSA 3VYHB 2ZGWA 5GMKl 5LJ5e 3CC2A 4ZN1A 1G3SA 3BW1A 1HXDA 3HKSA 4ZGJB 5GMKe 5GAN7 2FB7A 1W4SA 4RCBA 5GAOq 3TU4K 3MEAA 1YIJA 1JJ2S 4C5GA 3A8OB 1VQLT 1UGRB 4RG2A 3JCMf 4N4GA 2RI2A 2E70A 2F69A 2M9UA 4IUPA 4MDXA 3OYHA 2B8AA 4XTXA 3QO3A 1EIFA 3MP1A 3Q1JA 2KVQG 2XHCA 2YRVA 1M1KU 4C5HA 4PJOA 3H8ZA 1K9MC 3MO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 A;  3JB9 J;  5I21 A;  5LJ3 j;  4EMK C;  4C8Q B;  1LNX A;  3M4G A;  3RKW A;  2RD1 A;  3AHU A;  1TH7 A;  1D3B A;  5LJ3 d;  4M77 E;  4PJO B;  4M7A D;  3SWN A;  5GAN 4;  4M7D G;  4Y91 A;  3QHS A;  1LOJ A;  2DKG A;  2K57 A;  3BY7 A;  4M75 B;  2RA2 A;  1N9R A;  3V7R A;  4C8Q E;  2E64 A;  1H64 1;  4M78 F;  5LJ3 g;  3JCM P;  3SWN C;  2EJF A;  3L1A A;  4M77 G;  4XTV A;  4PNO A;  4PJO E;  4M7A E;  4A53 A;  4M7D C;  4A54 A;  5LJ5 h;  3EFS A;  4XQ3 A;  3RUX A;  1JBM A;  3QSU A;  2YLB A;  4M75 E;  2RM4 A;  3JB9 F;  4XU3 A;  5GAO q;  3JCM W;  5LJ5 d;  4C8Q G;  5GAN f;  4HT8 A;  1M8V A;  5GMK h;  4M77 C;  1Y96 A;  4C8Q A;  1HK9 A;  4PJO G;  2EWN A;  2DTO A;  2E10 A;  3JCM e;  1MGQ A;  2Y90 A;  1I8F A;  3BDU A;  3V8J A;  5LJ5 g;  2YHT A;  4M75 G;  3VU3 C;  1M5Q 1;  4XTW A;  4M78 B;  1KQ2 A;  1U1T A;  5LJ3 h;  3FIF A;  4C8Q D;  5GAO m;  1Y96 B;  3FJP A;  4M7A C;  4PJO C;  5GAO r;  3JB9 I;  4PJO D;  1B34 B;  4M75 C;  3JB9 D;  1BIA A;  5GAM e;  3RKY A;  4NL3 A;  4HT9 A;  4M78 E;  4M75 D;  2E65 A;  4XU0 A;  5LJ3 f;  4X9C A;  3JCM Q;  2E41 A;  1I4K 1;  2DVE A;  3JCM b;  3JCM g;  4EMG A;  3V8K A;  5GAM j;  3V7S A;  4N0A A;  2VC8 A;  2I2L A;  4M78 G;  4C92 B;  2DJZ A;  4F7U F;  2EJ9 A;  4M78 A;  3RIR A;  5GAN 6;  2FYK A;  4OP0 A;  4XTY A;  4NOY A;  3JB9 G;  2E1H A;  5LJ5 f;  1WQW A;  4MMK A;  1B34 A;  4M78 C;  2DZC A;  5GAO l;  5GAN e;  5GMK i;  1I81 A;  2EAY A;  2YLC A;  3JCM c;  1YCY A;  4M78 D;  4C8Q C;  4EMK B;  4C92 F;  5GAO n;  2JN0 A;  3BFM A;  3GIB A;  3INZ A;  5DY9 A;  4XU2 A;  3JCM h;  3RER A;  4J6W A;  5GAN j;  4F7U B;  4RCC A;  5GMK m;  3JCM d;  4C92 A;  4DQ2 A;  2DZ9 A;  3JB9 H;  2DTH A;  5GAN 2;  5CAI A;  3QUI A;  4M7D B;  1U1S A;  1WPY A;  3HSB A;  4JLI A;  4JRI A;  5GAM h;  4F7U E;  2HNI A;  4JUV A;  4J6X A;  2RB6 A;  4C92 D;  5GAM d;  4EMK A;  4M77 B;  5GAN 5;  4V2S A;  5GAN 8;  4NL2 A;  4N0A C;  2EJG A;  3FB9 A;  4F7U G;  2VXE A;  3V7C A;  5GAM g;  2DXT A;  4M7D F;  4F7U A;  3EFR A;  4QVC A;  4C92 E;  4EMH A;  2QTX A;  4QVD A;  4JRK A;  4M7A B;  1LJO A;  4XTZ A;  5GAO p;  2ZGW A;  2VXF A;  4M77 F;  2DTI A;  5GMK l;  5LJ5 e;  4M7D A;  1JRI A;  4X9D A;  3BW1 A;  1HXD A;  5GAN h;  4C92 G;  3HFN A;  4J6Y A;  2FB7 A;  2CGH A;  4RCB A;  5GMK e;  1D3B B;  4XTU A;  4C8Q F;  5GAN 7;  4XU1 A;  5GAN d;  1WNL A;  4M77 A;  3SWN B;  5LJ5 j;  1X01 A;  4J5Y A;  4PJO F;  3JCM f;  4M7A F;  3V8L A;  1KQ1 A;  3PGG A;  2DEQ A;  4M7D D;  3JCM V;  1I5L A;  4WF2 A;  4C92 C;  3RKX A;  3HFO A;  5GMK j;  1BIB A;  4M75 F;  4XTX A;  5GAN g;  3QO3 A;  5LJ3 e;  5GAN 3;  3L2Z A;  1N9S A;  4HA8 A;  4M7A G;  2DXU A;  3RES A;  3JCM X;  1WQ7 A;  4M77 D;  4PJO A;  3SB2 A;  4M7A A;  4MML A;  4M7D E;  3JCM J;  5GAM f; 
#chains in the Genus database with same CATH topology
 4FT2 A;  2HBP A;  1WXT A;  1UJ0 A;  3TEE A;  4M7A D;  4PK4 A;  2K57 A;  3L2W A;  3VKI A;  2C0I A;  5LJ3 g;  3CCR T;  8ATC B;  2EJF A;  1G8X A;  2GTO A;  3OYI A;  5L8R E;  1EFN A;  4JRP A;  4WCI A;  4ZGD B;  3VYG A;  2CZ6 B;  1Y96 A;  4PJO G;  3PVQ A;  2LQN A;  3NGP A;  1QVG S;  3A8G B;  1NZ9 A;  1PKT A;  1VIE A;  3X28 B;  4OB1 B;  3OSV A;  4DOV A;  4LDY A;  2O88 A;  2EQM A;  1D1C A;  2QDY B;  1YHQ T;  4E7I A;  4XAX B;  1KD1 U;  1VQL A;  1VQP T;  5GJW B;  4XTY A;  2P4R A;  2J7I A;  2O9S A;  4Z89 A;  1OI1 A;  1DJ7 B;  3BFM A;  4E6R A;  5FU7 C;  2EPD A;  4DQ2 A;  2L3S A;  1VUB A;  5CAI A;  4B9X A;  4X34 A;  2V1R A;  2GCX A;  3HSB A;  2DD5 A;  3CCR A;  2MK5 A;  4EMK A;  4KBM B;  4Y92 A;  1FWZ A;  2LQK A;  2R5A A;  5CKB A;  4XTZ A;  2KXD A;  3ZL7 C;  3CBO A;  4OMM A;  4J9E A;  2AK5 A;  4FCY A;  2RN8 A;  4FIB A;  3LWH A;  4M7A F;  3C95 A;  1YHQ A;  4DBR A;  5GAN 3;  4E7L A;  2LCS A;  4HA8 A;  5CCA A;  2ZPE B;  2LDM A;  1VQO T;  1S72 T;  1SEM A;  1K4U S;  4DEY A;  1WHJ A;  3VS3 A;  4DBF A;  1HJD A;  1QCN A;  1VQ5 Q;  5LJ3 d;  1YJW T;  2JJ9 A;  1RAH B;  4QKU A;  1EZZ B;  1Y7X A;  3V7R A;  4FL6 A;  3CCQ T;  2PUO B;  3JSC A;  4PNO A;  4J8O A;  4M7A E;  4JDS A;  1OPL A;  2A36 A;  3O5Z A;  3EAE A;  4CC4 B;  2C0T A;  3CCM T;  2CP2 A;  1VQ7 Q;  1U1T A;  5LJ3 h;  4C8Q D;  4M7A C;  1G3T A;  2KT1 A;  3CD6 Q;  1AWJ A;  4M75 D;  2C0O A;  5LJ3 f;  3QII A;  2M1H A;  4C0D C;  1PG5 B;  1QVG A;  1NJI C;  3JCM g;  1IRX A;  3PIO A;  2CT4 A;  1H8K A;  2DJZ A;  4RG8 A;  2X4X A;  2QEX T;  3EG2 A;  2HKN A;  3C12 A;  3OYF A;  3J7A F;  3M58 A;  2A28 A;  2FZC B;  2DZC A;  1VQO A;  1ZHI A;  4J9G A;  3I5S A;  1BYM A;  2P0P A;  3A98 A;  3RER A;  1G3Y A;  4KH0 B;  4BAC A;  2HSE B;  4RCC A;  2QDL A;  1UEB A;  4L6V 5;  4AFQ C;  1YJW A;  4JRI A;  2VUB A;  2RH2 A;  4C92 D;  3OMC A;  2D9T A;  1RAC B;  1Q7Y R;  3ULR B;  4NL2 A;  5CO7 A;  5KYY B;  4ESR A;  1YIJ Q;  4CC2 A;  4DBQ A;  3P8B B;  1RAI B;  3CCU T;  4M7A B;  1LJO A;  1JRI A;  1W6X A;  1D3B B;  4C0D B;  1WJR A;  2D1X A;  2KAF A;  5CKE A;  1KQ1 A;  1I5L A;  3HFO A;  5GMK j;  5GAN g;  4JPB W;  4OMO A;  4RTV A;  2JXB A;  4C0F A;  4M77 D;  1YFN A;  2V8J A;  3M53 A;  5HKC A;  3ZBD A;  2F2V A;  1YCS B;  1HSQ A;  4HVV A;  2QQA A;  5D6W A;  3JCM P;  1MNE A;  2LRQ A;  3L1A A;  3EFS A;  3RUX A;  2CZ1 B;  2YUP A;  3M0Q A;  4K11 A;  4QQG A;  2RJE A;  1VYT A;  1QP2 A;  2FPD A;  3VU3 C;  2ABL A;  4HVW A;  4CC7 A;  1CKB A;  2CKK A;  1FYN A;  2ZPH B;  4KUD K;  4PJO D;  5IXB A;  3JB9 D;  1VQL Q;  1FMK A;  4BY6 B;  3WVD B;  3CCU A;  3H0H A;  5HY6 A;  2X4J A;  2MAM A;  1XQH A;  1OZ3 A;  4OB2 B;  3VRY A;  1H92 A;  2DLP A;  3GBQ A;  2DFU A;  4LD6 A;  2DPP B;  1QKX A;  5GAN e;  4CI0 C;  3MP8 A;  4C8Q C;  4ME7 A;  2LMJ A;  4C92 F;  3CCR Q;  4R0K A;  2QTV A;  3EFO B;  3JCM h;  3CC7 T;  1WJQ A;  2XK0 A;  4OF1 A;  4PFO A;  2OTL T;  1FX7 A;  4BB7 A;  1YIT T;  2F5T X;  4J9H A;  4AG2 C;  1ZQ1 A;  4A4G A;  2ZZD A;  2HNI A;  2A3L A;  2RHU A;  1M3B A;  5GAN 8;  3EHQ A;  3WVE B;  3FB9 A;  1PRM C;  3V7C A;  1VYV A;  4C92 E;  1NLP C;  3EH2 A;  1YHQ Q;  2F2W A;  4M77 F;  1WHL A;  3TSZ A;  4LE9 A;  2CGH A;  3HP9 A;  2WSE E;  4XU1 A;  5GAN d;  4HCK A;  5D7U A;  2COY A;  1YI2 A;  1WFW A;  3V8L A;  1ZBJ A;  4C92 C;  3LH5 A;  2KI7 A;  5KYY A;  4LN2 A;  4DBH A;  2X9H A;  4M7A A;  3EGX B;  2KDS A;  3FDR A;  3MJX A;  3M0U A;  4C0G A;  2V8I A;  4C8Q B;  2XDP A;  1SF9 A;  1SHG A;  2XI9 A;  1D3B A;  4J9I A;  4M77 E;  5GAN 4;  5HK3 A;  4M75 B;  2EKH A;  2DKG A;  4J83 A;  1VIF A;  3CPF A;  2JMA A;  4M78 F;  3SWN C;  3QBY A;  3CC7 A;  2YDL A;  2RI5 A;  3FEO A;  2IG0 A;  5LJ5 h;  2OTL A;  2YLB A;  3LLR A;  3JB9 F;  1YIT A;  1SKU B;  3E1S A;  5GAN f;  1TOV A;  1K1Z A;  3X20 B;  4M77 C;  1AVZ C;  1KSW A;  2KBT A;  2E10 A;  2Y90 A;  3C4S A;  3BE3 A;  3GLX A;  4MZP A;  3TSW A;  3FIF A;  5GAO m;  2EIF A;  2QI2 A;  3R6N A;  2LC4 A;  4M78 E;  4XU0 A;  5C6S A;  3CCE T;  2DVE A;  1VQO Q;  1G83 A;  4FYV B;  3V7S A;  1RAF B;  5KCO A;  4C92 B;  2NUT B;  2FG0 A;  1UB4 A;  3OS1 A;  1YJW Q;  4M78 C;  4ZN3 A;  3DLM A;  4J6W A;  1P92 A;  1WXB A;  3MEU A;  3CC4 T;  3RMS A;  5J39 A;  3VRZ A;  2BE9 B;  2ECZ A;  5KYN A;  1LVK A;  4L59 A;  3J81 E;  1OYX A;  1M1K C;  4JJC A;  2IIM A;  4M77 B;  5L23 A;  4RUG A;  3ZFJ A;  1MMG A;  4HKE A;  3EFO A;  1NE8 A;  2JMC A;  1K76 A;  3CBP A;  3CME T;  2CH4 A;  2R58 A;  4F16 A;  3VYH B;  3HKS A;  2D8J A;  4F14 A;  1PRL C;  1UGR B;  2RI2 A;  2E70 A;  2F69 A;  4FYW B;  3OYH A;  2B8A A;  4XTX A;  3VS2 A;  1EIF A;  2X51 A;  1OV3 A;  3HTR A;  3LGF A;  4LDW A;  3JB9 J;  1VQ6 T;  4MZM A;  3RKW A;  1H3H A;  4KUI A;  2HZY A;  3UPU A;  4PJO B;  2CDT A;  3LGL A;  3M5A A;  2MPX C;  3EHR A;  3QHS A;  3M55 A;  1X69 A;  2XMF A;  2E64 A;  2SEM A;  2VKN A;  3PVL A;  2AZV A;  3A8M B;  1Q81 C;  2P4T A;  3EGX A;  2X35 A;  3BDL A;  3CC4 A;  2F2X A;  4N4H A;  1M90 R;  1CKA A;  4C8Q A;  3CCU Q;  2RQW A;  1I8F A;  1QVG P;  2JOY A;  1K9M U;  2KK4 A;  4FYX B;  1Q82 R;  1KQ2 A;  4NS5 A;  3TCJ A;  1CSK A;  1Y96 B;  3CME A;  1VQK T;  5ECA A;  4PL6 A;  2CZ0 B;  2VC8 A;  3OYY A;  4JRQ A;  3VS0 A;  4R56 A;  3UA6 A;  1WA7 A;  3L2V A;  2JTM A;  3M0P A;  3CCS T;  3T9N A;  3CCL T;  4A63 B;  3M54 A;  3GIB A;  3A8L B;  2H3E B;  1VQ6 A;  3REA B;  3S3N A;  5GAN j;  4C92 A;  2EQU A;  2NUT A;  4DOW A;  4AMC A;  2KY9 A;  1M4Z A;  3OYG A;  1KK7 A;  3FC3 A;  1Y71 A;  1IRE B;  4JUV A;  4J6X A;  1C1A A;  3X24 B;  1UGQ B;  5GAN 5;  3AT1 B;  3I9Q A;  2ATC B;  2A7Y A;  4ZGE B;  2L8D A;  1KHC A;  1YI2 Q;  2LNH B;  4KRT A;  2ED0 A;  1ZBX A;  2PVO B;  4C92 G;  1GCP A;  4VUB A;  4EPC A;  2ROT A;  4M77 A;  2RK2 A;  1VQK A;  2KYM A;  1GRI A;  1UG1 A;  1K0X A;  2QK0 A;  3CQT A;  3SB2 A;  1IB8 A;  4MML A;  5IT9 E;  2HL3 A;  4HVU A;  3CC7 Q;  2RK1 A;  3HRU A;  2OTL Q;  1LNX A;  2LQW A;  4PJM A;  1YIT Q;  3EH1 A;  3VS4 A;  2MOX A;  3GNG A;  4M77 G;  1GBR A;  2GBQ A;  4XU3 A;  1Y57 A;  1K73 C;  1IHW A;  2K3X A;  2HL5 C;  3OYC A;  4QVZ A;  1RL2 A;  1Q86 U;  2KNB B;  2M0O A;  3QZ5 B;  3QDF A;  4C5E A;  3GNF B;  5GAO r;  1RAG B;  2YXY A;  3I56 T;  4IIM A;  2CP0 A;  2BZ8 A;  2E41 A;  1ZSG A;  2LVM A;  2JZ2 A;  4J7F A;  2LCL A;  4M78 G;  4IUV A;  1T0J A;  1KC8 U;  2FYK A;  1YJN A;  1R0C B;  3JB9 G;  4CRI A;  1HD3 A;  2JN0 A;  2RHY A;  4XU2 A;  4JZ4 A;  4F04 B;  4PJN A;  2XU8 A;  4E2F B;  2CZ7 B;  5KE2 A;  1BKB A;  2JM8 A;  4JLI A;  2YUO A;  5GAM h;  2DYB A;  3OW2 P;  3VS6 A;  1X2Q A;  1Q81 U;  2L3R A;  1WDX A;  4ELY C;  5I11 A;  2X4W A;  3VS1 A;  3NHN A;  2XID A;  3ZEH A;  1SG5 A;  2EGC A;  4TVR A;  1AWX A;  1PSE A;  2M51 A;  5M9O A;  3QXE B;  1WNL A;  3I56 A;  1N8R U;  4M7D D;  5EC7 A;  4PLL A;  1UGV A;  7AT1 B;  1BIB A;  3QJ6 A;  1TU0 B;  3CCV T;  5LJ3 e;  3L2Z A;  1N9S A;  4MZT A;  5DLO A;  1TXQ A;  3RES A;  2JTE A;  1LCK A;  2B86 A;  1AT1 B;  1PD0 A;  5I21 A;  2RI3 A;  2AKL A;  3CC4 Q;  2QGF B;  4Y91 A;  1XNI A;  3BY7 A;  2RA2 A;  1N9R A;  1M3A A;  4XTV A;  2HAX A;  1ZSZ C;  1JBM A;  1KJW A;  1NJI R;  2RM4 A;  3OS0 A;  2FZK B;  3CME Q;  2VV5 A;  5IAY A;  1TS9 A;  2EQK A;  2ZCF B;  8AT1 B;  1OQK A;  1VQP A;  3H0I A;  1GFC A;  1OU8 A;  2CP7 A;  2XDB A;  5CQX A;  3RKY A;  2RQT A;  3PIP A;  4EDU A;  3JCM Q;  5FU7 B;  2AZS A;  3EG9 B;  2ZPI B;  2KE9 A;  5FLX E;  2M0Y A;  2O4X B;  1VQ6 Q;  1Z9Z A;  2COW A;  2CRE A;  1OX8 A;  2F1L A;  3LW5 E;  4QQD A;  1WQW A;  3CCV A;  5GAO n;  4XK8 E;  1U3O A;  5J3B A;  2SRC A;  2RQU A;  3UDC A;  2LQ8 A;  1ZSZ B;  1BCO A;  4BD3 A;  5KH6 A;  1K73 U;  2DE0 X;  1O75 A;  3L2Q A;  2EJG A;  4R55 A;  2W0Z A;  1VQK Q;  4M7D F;  2HKQ B;  1S72 A;  2LJ0 A;  1D0Y A;  4EIK A;  1FXX A;  5IHI A;  1K8A U;  2LT1 A;  2X3X D;  3EG3 A;  4J6Y A;  4QT7 A;  2VB6 A;  3CCS Q;  5KYX B;  3CCQ A;  2GQV A;  2QGG A;  1BBZ A;  3OW2 S;  3UF4 A;  3OY9 A;  2DXU A;  1I07 A;  2KSS A;  4M7D E;  2KMT A;  1PNJ A;  1GL5 A;  3O8V A;  3M4G A;  1X6O A;  3CCM A;  3QJY A;  3CMA T;  2LX9 A;  5FU6 C;  1VQN T;  4ATO A;  2KGT A;  2K5I A;  2DIL A;  4BI4 A;  2NLU A;  5D6X A;  2PUK B;  4M7D C;  1T3L A;  1M8V A;  5IHN A;  1MV3 A;  4ANJ A;  2DET A;  4AFZ C;  3IQL A;  3JCM e;  1YNZ A;  3V8J A;  5LJ5 g;  1UUE A;  5A2Q E;  3CC2 T;  2DIG A;  4GLK A;  2FHD A;  5LL6 S;  2QEX A;  3OBY A;  4J9D A;  4ELZ C;  2PTK A;  4A4E A;  1JB0 E;  3LH0 A;  1V1C A;  1YJN Q;  4HT9 A;  3THK A;  4X9C A;  1NEG A;  1MND A;  2FO0 A;  4F7U F;  2D0N A;  4OP0 A;  4DA4 A;  2JS2 A;  2EW3 A;  5CVI A;  2ZPB B;  5GMK i;  2VGM A;  4M78 D;  9ATC B;  1M2O A;  3EG9 A;  3MEW A;  1D0X A;  5FU6 B;  2XKO C;  2E3H A;  1RAE B;  1ACM B;  4PJL A;  5A0L A;  3JCM d;  3OYN A;  1VOM A;  1UHF A;  2O4X A;  1QVF P;  5GAN 2;  4KT0 E;  4M7D B;  3F70 A;  4F7U E;  2GFU A;  1WI7 A;  4RTT A;  1RUW A;  1JEG A;  2GF7 A;  2E3I A;  3QDR B;  3I56 Q;  3QWX X;  4A4H A;  2E5Q A;  2ZGW A;  5GMK l;  5LJ5 e;  3CC2 A;  4AFU C;  2DF6 A;  1ZSZ A;  1NYG A;  5FWC A;  3CPW P;  2RQV A;  2KRN A;  3JCM f;  4AT1 B;  2AT1 B;  2FRW A;  2DL3 A;  2YRV A;  1YP5 A;  1OEB A;  1K9M C;  2DER A;  5KYW B;  5LJ3 j;  3J80 E;  3OW2 A;  4D6W A;  1Q95 G;  3QG1 A;  2YWW A;  2DK3 A;  4X1V A;  5KYX A;  1KG1 A;  2DRK A;  1S1N A;  4E7S A;  1VQP Q;  2ENM A;  2L5Q A;  1TUD A;  3GPL A;  3DB3 A;  5LJ5 d;  4JZ3 A;  1ZUK A;  1GXI E;  1PC0 A;  2OAW A;  1I1J A;  1M5Q 1;  2XIC A;  4BE2 A;  2DRM A;  3VUZ A;  2FEI A;  2ZPG B;  4HCB A;  3UA7 A;  1B34 B;  2EQJ A;  4OMN A;  4J7I A;  1YBY A;  3CCV Q;  2YUQ A;  2ZPF B;  5IH2 A;  3JCM b;  2L0A A;  2I2L A;  4IUQ A;  1X6G A;  2DO3 A;  1D1A A;  5A0G A;  3MKD A;  4PJJ A;  2GGR A;  1M1K R;  3ASK A;  4RMO A;  5LJ5 f;  2J6O A;  4LUD A;  4O5V A;  2K3B A;  1ZX6 A;  2IVW A;  4CC3 A;  4JS5 A;  4C5I A;  2MIO A;  2QG9 B;  2QA4 T;  4J9B A;  2KEA A;  1S72 Q;  1WPY A;  3DB4 A;  1WGS A;  2PZ1 A;  3KXT A;  3I35 A;  1SRM A;  2OTJ T;  1SPK A;  2JM9 A;  4J9C A;  4RTZ A;  1F1B B;  1VQ4 T;  2QQ9 A;  2K2M A;  2DXT A;  1BB9 A;  4QVC A;  2FPE A;  3CCQ Q;  2LT4 A;  2HCK A;  3M56 A;  2RJC A;  4M7D A;  1WLP B;  3MCA B;  4N4I A;  2FL7 A;  4XTU A;  1YN8 A;  3M59 A;  3QYG B;  3SWN B;  2EQI A;  1X01 A;  1QVF S;  3DKM A;  2NUZ A;  1XTD A;  2HQE A;  4E7Z A;  3CCJ T;  3CCM Q;  3PGG A;  1AOJ A;  3JCM V;  1KD1 R;  2YUN A;  3OYE A;  2DYI A;  2GQI A;  3JCM X;  3PE0 A;  5CKD A;  1X2K A;  1Q86 C;  3I5R A;  1I0C A;  3OYM A;  1FMV A;  4OMF B;  2G6F X;  1X75 C;  3D7S B;  4M7D G;  3X26 B;  4BDZ A;  1B3Q A;  3REB B;  1U8R A;  4B9W A;  4LD9 K;  3RNJ A;  1H64 1;  3CPW S;  1UGP B;  2J6F A;  2QEX Q;  1QW1 A;  3CCE A;  2QA4 A;  1KC8 C;  3ER0 A;  5KYW A;  5DM7 R;  1Q7Y U;  2CYZ B;  2EWN A;  1N27 A;  3NPF A;  1T3S A;  4M78 B;  1W2B P;  3TRE A;  1M2V B;  1VQ4 A;  1WHG A;  3VUB A;  1RLP C;  3GF5 A;  1NEB A;  2J06 A;  3A8H B;  2EYX A;  2V26 A;  1XJW B;  2MF2 A;  1RAD B;  3OYL A;  1AEY A;  2CS7 A;  1QWF A;  4Q5W A;  3UT1 A;  4BI3 A;  3CCJ A;  2KQW A;  3RMQ A;  1OZ2 A;  1R8O B;  2DA9 A;  1B34 A;  2EGA A;  1I81 A;  1VQM T;  4FM4 B;  3N5B B;  3OYA A;  3INZ A;  4OGC A;  4BE0 A;  1M3C A;  3OYJ A;  4JLG A;  1W1F A;  2DZ9 A;  1N8R C;  2DTH A;  1GBQ A;  2EYY A;  4OB0 B;  2ROL A;  3ME9 A;  1BI1 A;  1I5O B;  3CC2 Q;  3G71 T;  2NUP B;  3M9Q A;  4ORZ A;  1QKW A;  4F7U G;  2MI6 A;  5GAM g;  4QVD A;  3PMT A;  2DM1 A;  2LX7 A;  3M0R A;  3EG1 A;  4DEX A;  5I2S A;  4IIO A;  2WSC E;  4C0Z A;  3CXC P;  1K0S A;  2P0Q A;  2KXC A;  5LJ5 j;  1WX6 A;  1X27 A;  1JU5 C;  2QXF A;  5CKF A;  1QP3 A;  3HL8 A;  5GJV B;  2K79 A;  5KYU B;  1AHJ B;  1TUC A;  1QVF A;  4BI8 B;  1VYU A;  2P0K A;  4OVA A;  3AHU A;  3JRZ A;  4E47 A;  4A4F A;  3SWN A;  3PNW C;  4FT4 A;  1VQM A;  2KYB A;  1U06 A;  4IUR A;  3FRN A;  1IZ6 A;  3SEM A;  4A53 A;  5IXF A;  4A54 A;  3QSU A;  1QQJ A;  1C0M A;  4JJN K;  5I22 A;  1VQ9 T;  2QQB A;  1UFF A;  1HYO A;  3CPW A;  3BDU A;  2YHT A;  3VJP A;  3G71 A;  3VS5 A;  3CEY A;  1NBE B;  5CR2 A;  3CCS A;  2DXC A;  5GAM e;  2OI3 A;  3CCL A;  4FYY B;  4GLM A;  4BDY A;  4E7H A;  2HD0 A;  2G3R A;  5C0M A;  3UWN A;  4M78 A;  3RIR A;  1A0N B;  4UC4 A;  1M2V A;  4IUU A;  1D0Z A;  2NYS A;  4MMK A;  2K5L A;  1R0B G;  2CP6 A;  1OUL A;  3SHW A;  1W2B S;  1K8A C;  5DY9 A;  3MHX A;  2BE7 D;  2EFI A;  3QYH B;  5KE3 A;  1OX9 A;  5J26 A;  4WTO B;  4KUL A;  3A5Z B;  1JJ2 P;  2K4Y A;  3LX7 A;  1PSF A;  2L2P A;  2A37 A;  5GAM d;  1AZG B;  3H9N A;  1R77 A;  1TWB A;  1O9S A;  4N0A C;  1VQ9 A;  5CKH A;  3G4S T;  2P84 A;  2BIV A;  3EGU A;  1WHM A;  1ARK A;  3PT9 A;  5GAO p;  4Z88 A;  6AT1 B;  2VXF A;  3OYB A;  2DL5 A;  3OYD A;  1UHC A;  2CT3 A;  2NUP A;  1BCM A;  1LPL A;  4J5Y A;  2D0Q B;  2DEQ A;  2K9G A;  2GTJ A;  4WF2 A;  3RKX A;  3JAM E;  3M0S A;  2LJ3 A;  3S3O A;  2OAU A;  2BKD N;  5GAM f;  2JNG A;  3L42 A;  4J9F A;  2E4H A;  3TVT A;  3CCE Q;  2QA4 Q;  2RJD A;  4AG1 C;  1E7O A;  1ZA2 B;  1LOJ A;  1JXO A;  2AIR B;  2OTJ Q;  3I55 T;  5KYU A;  3CXC S;  2O31 A;  2DAQ A;  1VQ4 Q;  3PMI A;  1IHV A;  4OMP A;  5GMK h;  2DVJ A;  1M1G A;  1WZO A;  1MHN A;  1UEC A;  2I0N A;  3EGD B;  3JV3 A;  1M27 C;  1UE9 A;  2WAC A;  4XTW A;  2K3Y A;  2RNA A;  1RAB B;  2FPF A;  4E7J A;  2JS0 A;  5HCK A;  3G4S A;  1BIA A;  2J05 A;  3CCJ Q;  3A1P A;  5FRN A;  3SFM A;  4EMG A;  3MET A;  2PQW A;  3PTA A;  1ABQ A;  2YSQ A;  2EJ9 A;  2R5M A;  2CUB A;  2DL7 A;  2OJ2 A;  5GAO l;  2L89 A;  3JCM c;  1YCY A;  1OOT A;  2XG8 D;  5IN1 A;  4FSS A;  4HCZ A;  3OBW A;  3PFS A;  2D8H A;  2XD0 A;  1GFD A;  3MPU B;  2IPO B;  1U1S A;  4GY5 A;  1W2B A;  3I55 A;  1M90 U;  1Y07 A;  4OGE A;  2WSF E;  1WXU A;  5HK0 A;  2VXE A;  4Y28 E;  4LDX A;  1Q82 U;  2QTX A;  1RAA B;  1VA7 A;  4ZN1 A;  1G3S A;  3BW1 A;  1NLO C;  4ZGJ B;  1W70 A;  5GAN 7;  5GAO q;  3TU4 K;  1JJ2 S;  2VAS A;  4C5G A;  3VS7 A;  4RG2 A;  2PNI A;  4IUP A;  2M9U A;  3RR6 A;  2H8H A;  3MP1 A;  1VQM Q;  1NYF A;  2XHC A;  2JT4 A;  1QMC A;  3H8Z A;  1KQS P;  4E7K A;  1NPP A;  4ZTJ A;  4QW2 A;  5DLQ E;  1TG0 A;  2QQR A;  5CQY A;  2LZ6 B;  2MYS A;  4FU6 A;  2L3P A;  2LP5 A;  4JJD A;  3G71 Q;  1UDL A;  3NTH A;  2VWF A;  1N5Z A;  1RI0 A;  2EKO A;  4O6J A;  3CBM A;  1WIE A;  3CCL Q;  2L3Q A;  2J6K A;  1X6B A;  3S3M A;  2K5F A;  3CXC A;  2GFA A;  1PM3 A;  2E12 A;  2YRD A;  1PHT A;  3QKJ A;  2ZAE A;  1UJY A;  1JXM A;  1V29 B;  2E65 A;  2JVV A;  3HRT A;  1I4K 1;  2ED1 A;  4QQ6 A;  3EGD A;  4KGZ B;  5GAM j;  3WXM B;  4N0A A;  2W10 A;  2E5K A;  3LYI A;  1GCQ C;  2CH4 W;  1ZLM A;  4LUE A;  3OS2 A;  2DEU A;  1XOV A;  4RTU A;  1M30 A;  2O9V A;  4BY6 C;  3EG0 A;  3NTI A;  1BI3 A;  3H6Z A;  2C06 A;  4LNP A;  1VQ9 Q;  2RHZ A;  2JUF A;  4JJB A;  3C94 A;  2EVR A;  1X43 A;  1YWO A;  3E9F A;  4KGX B;  2HQH A;  1WHH A;  3GOX A;  2CSI A;  3EFR A;  1K9M R;  3P8D A;  2HQX A;  2A0F B;  1RLQ C;  1C6V X;  2DTI A;  4OMQ A;  1PCX A;  3FLG A;  2F5K A;  2GNC A;  2PU9 B;  3CMA A;  4C8Q F;  1VQN A;  4II1 A;  5CIU A;  1Q7Y C;  4M75 F;  2JTF A;  1TUG B;  3KBG A;  3S6W A;  1D09 B;  1PD1 A;  4PFZ A;  4YTL A;  1JJ2 A;  1VQ8 T;  4IKF A;  1KHI A;  3NFC A;  2DD4 A;  2V8K A;  2M02 A;  2DNU A;  1YI2 T;  4HXJ A;  4RTW A;  4C8Q E;  4OB3 B;  3U23 A;  4M75 E;  1QWE A;  3G4S Q;  3JCM W;  4HT8 A;  2CP5 A;  1HK9 A;  3L2R A;  2KRM A;  2DTO A;  1YJ9 T;  4RTX A;  3OS5 A;  3NTK A;  1KQS S;  5A0D A;  3OYK A;  3JB9 I;  4M75 C;  2VYT A;  4D8D A;  4NL3 A;  2VGN A;  3QZ9 B;  1ZA1 B;  5I2M A;  2MCN A;  1M9S A;  4KGV B;  4M4Z A;  4Z02 A;  2EBP A;  3V8K A;  2DX1 A;  5IHK A;  4BE1 A;  2EYW A;  3G6E T;  1TTH B;  1RI9 A;  1EX4 A;  2PVD B;  4D8K A;  3VV0 A;  4PKC C;  2DXB A;  3I55 Q;  2Y4Y A;  1VQ8 A;  3E2U A;  2CUD A;  3LWI A;  4F7U B;  2KRS A;  4LXC A;  2EGE A;  2HDA A;  1IGQ A;  1ABO A;  3MEV A;  2DIQ A;  1G2B A;  2RJF A;  1NJI U;  3FJ5 A;  1SRL A;  4MDW A;  1KIK A;  2RHI A;  2DL8 A;  1AWO A;  2AHJ B;  1WYX A;  3HHT B;  5D6Y A;  3SD4 A;  1Q86 R;  4EMH A;  4A4K A;  1YJ9 A;  2A08 A;  2VVK A;  5EG2 A;  4X9D A;  5GAN h;  2HEQ A;  3HFN A;  3C0C A;  1SSH A;  4PJO F;  1UGS B;  1MUZ A;  1AWW A;  4M7A G;  1J3T A;  1WQ7 A;  1KC8 R;  2CP3 A;  5AT1 B;  3DLL A;  4FW1 A;  2LNV A;  3G6E A;  3H41 A;  3JCM J;  3NMZ C;  5FRO A;  1JQQ A;  1TH7 A;  3L2U A;  4PLI A;  2BZY A;  4ZTF A;  1PWT A;  1BI0 A;  1QCO A;  1BI2 A;  2K2V A;  1PKS A;  2XDD A;  2LCC A;  4PJO E;  4JS4 A;  1GCQ A;  2CSQ A;  2DMO A;  4L5G A;  1U5S A;  4GBQ A;  1Q81 R;  5KCH A;  5CK9 A;  3OMG A;  1OU9 A;  2QAZ A;  2K6D A;  1ZUU A;  4PJO C;  2MMP A;  4F17 A;  3SDZ A;  2YT6 A;  2RMO A;  2KT8 A;  1QCF A;  2QAS A;  1KQS A;  1FMW A;  1N8R R;  2BZX A;  1OPK A;  3G7Z A;  1QVP A;  3E9G A;  4LDU A;  2E6N A;  2X3W D;  4RTY A;  5GAN 6;  4NOY A;  2OTJ A;  1G5V A;  2EAY A;  3R6O A;  2O2O A;  4PFP A;  1H3Z A;  2EYQ A;  3RDV A;  2KR3 A;  2D6F A;  2NWM A;  2BUD A;  1VQ5 T;  4RKU E;  3QUI A;  1UTI A;  4AFS C;  1NPR A;  1WHK A;  3E19 A;  4V2S A;  4BUG A;  2COZ A;  3CMA Q;  3KUF A;  1WJS A;  4F7U A;  2HSP A;  1VQN Q;  2RPN A;  4JRK A;  2ESW A;  2RO0 A;  1VQ7 T;  1BU1 A;  2BTT A;  1Y0M A;  5FRM A;  5AYF A;  4ZNX A;  3OQ5 A;  3TQ7 P;  4KH1 B;  2FVU A;  1KD1 C;  3CD6 T;  2RHX A;  1MV0 B;  3QWY A;  2FZG B;  3HPW A;  1BK2 A;  3OSS C;  1IO6 A;  1N6A A;  2K7A A;  1M1F A;  4LDV A;  4M75 A;  1D1B A;  4EMK C;  2R57 A;  1IXD A;  2RD1 A;  1AZE A;  1V76 A;  2JW4 A;  2YRC A;  1NG2 A;  3GP8 A;  1MMD A;  2DBK A;  1T0H A;  3MP6 A;  5FWB A;  1SHF A;  4XQ3 A;  1VQ5 A;  4C8Q G;  2DBM A;  2M16 A;  4HCC A;  2DL4 A;  4P5N A;  1K73 R;  1MGQ A;  1MMN A;  4M75 G;  3X25 B;  2O01 E;  3P8H A;  4Z8A A;  3FJP A;  4IUT A;  5FW9 A;  2OX7 A;  2DJQ A;  1YIJ T;  1K8A R;  3M57 A;  1VQ7 A;  2FRY A;  1M90 C;  4FW2 A;  2H3J A;  1K9A A;  2QQS A;  1VQ8 Q;  3M0T A;  2KRO A;  3CD6 A;  2PVG B;  2HBW A;  2Z0W A;  2E1H A;  2RF0 A;  1Q82 C;  1KFZ A;  1QLY A;  3UAT A;  1YWP A;  3URG A;  2YLC A;  1AD5 A;  4EMK B;  1M8M A;  4FSX A;  3OA6 A;  2RQR A;  1G3W A;  4OML A;  3QPH A;  2LTO A;  5GMK m;  2HMA A;  2V1Q A;  3JB9 H;  1B7T A;  2Y4X A;  1B07 A;  1YJN T;  1E6H A;  1YJ9 Q;  1NM7 A;  1SSF A;  3OB9 A;  2RB6 A;  3RBB B;  1Z9Q A;  3H0F A;  2MWP A;  2X4Y A;  3M4Y A;  2MWO A;  2EYZ A;  1ZUY A;  1MMA A;  2E6Z A;  4B6M A;  3HRS A;  1HXD A;  5GMK e;  2AKK A;  2FB7 A;  1W4S A;  4RCB A;  3G6E Q;  1IGU A;  2QYZ A;  1JO8 A;  3MEA A;  1YIJ A;  3A8O B;  1VQL T;  4N4G A;  3KFV A;  4MDX A;  1E6G A;  2LJ1 A;  3G1J A;  3QO3 A;  3Q1J A;  2KVQ G;  1M1K U;  4C5H A;  4PJO A;  1TSF A;  3MO8 A; 
#chains in the Genus database with same CATH homology
 3LGF A;  4LDW A;  4FT2 A;  3JB9 J;  1VQ6 T;  4MZM A;  5LJ3 j;  4E7K A;  1NPP A;  4ZTJ A;  2HBP A;  3RKW A;  4QW2 A;  3TEE A;  4KUI A;  3J80 E;  4PJO B;  3UPU A;  3OW2 A;  4M7A D;  4D6W A;  3LGL A;  5DLQ E;  3M5A A;  2QQR A;  5CQY A;  3QHS A;  3M55 A;  2K57 A;  3QG1 A;  3L2W A;  2DK3 A;  3VKI A;  4FU6 A;  5LJ3 g;  2E64 A;  1KG1 A;  3CCR T;  2EJF A;  3NTH A;  3A8M B;  1Q81 C;  2L5Q A;  2P4T A;  1RI0 A;  3OYI A;  2X35 A;  3BDL A;  2EKO A;  5L8R E;  4N4H A;  4O6J A;  3GPL A;  3DB3 A;  4JRP A;  3CC4 A;  5LJ5 d;  3CBM A;  4ZGD B;  3VYG A;  2CZ6 B;  4C8Q A;  1Y96 A;  4PJO G;  3S3M A;  2K5F A;  1GXI E;  1I8F A;  2XIC A;  1M5Q 1;  3CXC A;  4BE2 A;  2JOY A;  3A8G B;  1NZ9 A;  2GFA A;  1QVG S;  1K9M U;  2KK4 A;  1KQ2 A;  2E12 A;  4NS5 A;  3VUZ A;  1VIE A;  3TCJ A;  1Y96 B;  4OB1 B;  3X28 B;  2ZPG B;  4HCB A;  3QKJ A;  3OSV A;  4DOV A;  4LDY A;  1B34 B;  2EQJ A;  3CME A;  1VQK T;  2EQM A;  4J7I A;  1YBY A;  1V29 B;  2E65 A;  2JVV A;  2QDY B;  3HRT A;  4PL6 A;  1YHQ T;  2ZPF B;  1I4K 1;  3JCM b;  4E7I A;  4QQ6 A;  5GAM j;  4XAX B;  3WXM B;  4N0A A;  2CZ0 B;  2VC8 A;  3OYY A;  2I2L A;  4IUQ A;  4JRQ A;  4R56 A;  1KD1 U;  2DO3 A;  3LYI A;  5A0G A;  1VQP T;  1VQL A;  4XTY A;  2JTM A;  3ASK A;  4RMO A;  3L2V A;  5LJ5 f;  3CCS T;  3T9N A;  3CCL T;  4O5V A;  1OI1 A;  3M54 A;  1DJ7 B;  3BFM A;  3A8L B;  3OS2 A;  3GIB A;  1XOV A;  1VQ6 A;  4BY6 C;  3S3N A;  5GAN j;  2IVW A;  3NTI A;  5FU7 C;  1BI3 A;  3H6Z A;  4C92 A;  4C5I A;  2EQU A;  4DOW A;  4DQ2 A;  2RHZ A;  4JS5 A;  2C06 A;  2JUF A;  2KY9 A;  2QA4 T;  3C94 A;  1M4Z A;  1VUB A;  5CAI A;  4B9X A;  4X34 A;  1WPY A;  2GCX A;  3OYG A;  3HSB A;  2DD5 A;  3DB4 A;  1WGS A;  3E9F A;  3KXT A;  3FC3 A;  3CCR A;  1Y71 A;  1IRE B;  4JUV A;  4J6X A;  2OTJ T;  3X24 B;  4EMK A;  1UGQ B;  5GAN 5;  4KBM B;  2A7Y A;  4ZGE B;  1VQ4 T;  1FWZ A;  2L8D A;  2QQ9 A;  3GOX A;  1KHC A;  2DXT A;  4QVC A;  3EFR A;  2LQK A;  2R5A A;  3P8D A;  5CKB A;  2HQX A;  4XTZ A;  2LT4 A;  3M56 A;  3CBO A;  1ZBX A;  2DTI A;  2RJC A;  4M7D A;  2PVO B;  3FLG A;  3MCA B;  2F5K A;  2PU9 B;  4N4I A;  4C92 G;  2FL7 A;  4VUB A;  4XTU A;  4EPC A;  4C8Q F;  3CMA A;  3M59 A;  3QYG B;  4M77 A;  2RK2 A;  3SWN B;  1X01 A;  1VQK A;  3DKM A;  4FIB A;  3LWH A;  1XTD A;  2HQE A;  3CCJ T;  1QVF S;  1VQN A;  3PGG A;  4M7A F;  3C95 A;  4II1 A;  5CIU A;  3JCM V;  1YHQ A;  1Q7Y C;  5GAN 3;  4M75 F;  4E7L A;  2JTF A;  4HA8 A;  5CCA A;  2ZPE B;  2LDM A;  3OYE A;  3JCM X;  1VQO T;  3KBG A;  1S72 T;  3SB2 A;  3S6W A;  5CKD A;  1Q86 C;  4MML A;  5IT9 E;  2RK1 A;  3HRU A;  4YTL A;  3OYM A;  1JJ2 A;  1VQ8 T;  4IKF A;  1KHI A;  3NFC A;  2DD4 A;  1LNX A;  4OMF B;  2V8K A;  5LJ3 d;  1X75 C;  1YJW T;  4M7D G;  3X26 B;  4BDZ A;  1YI2 T;  1U8R A;  1Y7X A;  4B9W A;  4LD9 K;  3V7R A;  4FL6 A;  4C8Q E;  3CCQ T;  1H64 1;  2PUO B;  4OB3 B;  3CPW S;  3JSC A;  3GNG A;  4M77 G;  4PNO A;  1UGP B;  4J8O A;  4M7A E;  4JDS A;  1QW1 A;  4M75 E;  4XU3 A;  3CCE A;  3JCM W;  2QA4 A;  1K73 C;  1KC8 C;  3ER0 A;  4HT8 A;  5DM7 R;  3EAE A;  1Q7Y U;  1HK9 A;  2CYZ B;  3L2R A;  3CCM T;  2EWN A;  2DTO A;  2K3X A;  1YJ9 T;  1N27 A;  3OS5 A;  3NTK A;  4QVZ A;  1RL2 A;  3OYC A;  1Q86 U;  4M78 B;  2M0O A;  3QZ5 B;  1KQS S;  1U1T A;  5LJ3 h;  3TRE A;  5A0D A;  4C5E A;  4C8Q D;  3OYK A;  1VQ4 A;  1G3T A;  3GNF B;  4M7A C;  5GAO r;  3JB9 I;  3VUB A;  4M75 C;  2VYT A;  4NL3 A;  2VGN A;  3QZ9 B;  3GF5 A;  5I2M A;  3I56 T;  4M75 D;  5LJ3 f;  3A8H B;  3QII A;  2M1H A;  2E41 A;  4C0D C;  1M9S A;  2MF2 A;  4Z02 A;  2LVM A;  1QVG A;  2JZ2 A;  1NJI C;  3JCM g;  3OYL A;  3V8K A;  3PIO A;  4J7F A;  2LCL A;  4M78 G;  4BE1 A;  2CS7 A;  2DJZ A;  4RG8 A;  3G6E T;  3UT1 A;  4Q5W A;  4BI3 A;  4IUV A;  2X4X A;  2QEX T;  3CCJ A;  1KC8 U;  2FYK A;  1YJN A;  2KQW A;  3RMQ A;  3C12 A;  3JB9 G;  1OZ2 A;  1R8O B;  4CRI A;  3OYF A;  3M58 A;  3J7A F;  1B34 A;  2PVD B;  2DZC A;  1VQO A;  1ZHI A;  1I81 A;  4PKC C;  3VV0 A;  1VQM T;  4FM4 B;  1BYM A;  2P0P A;  3N5B B;  2JN0 A;  2DXB A;  3OYA A;  2RHY A;  3INZ A;  2Y4Y A;  4OGC A;  4XU2 A;  4BE0 A;  1VQ8 A;  3OYJ A;  3RER A;  4JLG A;  1G3Y A;  3LWI A;  4BAC A;  2XU8 A;  4F7U B;  4RCC A;  1UEB A;  4L6V 5;  2CZ7 B;  5KE2 A;  2DZ9 A;  1YJW A;  1N8R C;  2DTH A;  1BKB A;  2DIQ A;  3MEV A;  4OB0 B;  4JLI A;  2RJF A;  4JRI A;  5GAM h;  1NJI U;  2VUB A;  1BI1 A;  2RH2 A;  3ME9 A;  4MDW A;  1Q81 U;  2L3R A;  2RHI A;  3OMC A;  4C92 D;  3G71 T;  2AHJ B;  2D9T A;  4ELY C;  3HHT B;  3M9Q A;  5D6Y A;  4NL2 A;  2X4W A;  5CO7 A;  4F7U G;  2MI6 A;  5GAM g;  3SD4 A;  3P8B B;  4QVD A;  4EMH A;  3PMT A;  2XID A;  4A4K A;  3ZEH A;  1YJ9 A;  3CCU T;  4M7A B;  1LJO A;  5EG2 A;  5I2S A;  1JRI A;  4X9D A;  4TVR A;  2WSC E;  1PSE A;  5GAN h;  3HFN A;  5M9O A;  3QXE B;  4C0Z A;  1D3B B;  4C0D B;  1WJR A;  2P0Q A;  1WNL A;  2KAF A;  5LJ5 j;  3I56 A;  4PJO F;  1N8R U;  5CKE A;  4M7D D;  1KQ1 A;  2QXF A;  4PLL A;  5CKF A;  1I5L A;  3HFO A;  5GMK j;  1BIB A;  1QP3 A;  3HL8 A;  3QJ6 A;  1UGS B;  5LJ3 e;  5GAN g;  3L2Z A;  1N9S A;  4MZT A;  3CCV T;  4M7A G;  5DLO A;  1AHJ B;  3RES A;  4C0F A;  1WQ7 A;  4M77 D;  3DLL A;  2LNV A;  2V8J A;  3M53 A;  5HKC A;  3ZBD A;  3G6E A;  5FRO A;  3JCM J;  1QVF A;  5I21 A;  2RI3 A;  4BI8 B;  2P0K A;  4OVA A;  3AHU A;  3JRZ A;  4E47 A;  1TH7 A;  3L2U A;  4PLI A;  4A4F A;  3SWN A;  4ZTF A;  3PNW C;  4FT4 A;  1VQM A;  1BI0 A;  4Y91 A;  1XNI A;  2QQA A;  1BI2 A;  3BY7 A;  4IUR A;  2K2V A;  1N9R A;  2RA2 A;  5D6W A;  2LRQ A;  3JCM P;  3FRN A;  3L1A A;  1IZ6 A;  4XTV A;  2LCC A;  2XDD A;  4PJO E;  4JS4 A;  4A53 A;  4A54 A;  4L5G A;  3EFS A;  2HAX A;  3QSU A;  3RUX A;  1JBM A;  2CZ1 B;  2RM4 A;  4QQG A;  4JJN K;  3OS0 A;  1VQ9 T;  2QQB A;  5KCH A;  2VV5 A;  2RJE A;  5CK9 A;  1QP2 A;  3OMG A;  5IAY A;  3CPW A;  3BDU A;  2YHT A;  2EQK A;  3VJP A;  2ZCF B;  3VU3 C;  3G71 A;  3CEY A;  1VQP A;  2CKK A;  4PJO C;  2MMP A;  2ZPH B;  4KUD K;  5CR2 A;  3CCS A;  4PJO D;  3JB9 D;  2DXC A;  5GAM e;  2XDB A;  5CQX A;  3RKY A;  3SDZ A;  3CCL A;  4BY6 B;  3WVD B;  3CCU A;  3PIP A;  4EDU A;  3JCM Q;  4BDY A;  5FU7 B;  4E7H A;  2HD0 A;  1KQS A;  2G3R A;  2ZPI B;  5C0M A;  5HY6 A;  5FLX E;  2X4J A;  2MAM A;  1XQH A;  1OZ3 A;  4OB2 B;  3UWN A;  2O4X B;  3G7Z A;  4M78 A;  1QVP A;  3RIR A;  3E9G A;  4LDU A;  2E6N A;  4IUU A;  4UC4 A;  5GAN 6;  3LW5 E;  4NOY A;  4QQD A;  4LD6 A;  1WQW A;  3CCV A;  2DPP B;  2K5L A;  4MMK A;  2OTJ A;  5GAN e;  4CI0 C;  3MP8 A;  2EAY A;  3R6O A;  4C8Q C;  4ME7 A;  5GAO n;  1G5V A;  4C92 F;  1W2B S;  1H3Z A;  1K8A C;  4XK8 E;  2EYQ A;  5DY9 A;  3MHX A;  3JCM h;  3CC7 T;  1WJQ A;  2XK0 A;  2EFI A;  4OF1 A;  3QYH B;  5KE3 A;  5J26 A;  2OTL T;  2D6F A;  1FX7 A;  2BUD A;  5J3B A;  4KUL A;  3A5Z B;  4BB7 A;  1YIT T;  1VQ5 T;  4RKU E;  2F5T X;  3UDC A;  3QUI A;  2K4Y A;  2LQ8 A;  1ZQ1 A;  4A4G A;  3LX7 A;  1PSF A;  2ZZD A;  2HNI A;  2A3L A;  4BD3 A;  5KH6 A;  5GAM d;  1NPR A;  3E19 A;  4V2S A;  2RHU A;  5GAN 8;  1K73 U;  1O75 A;  3WVE B;  1O9S A;  4N0A C;  4BUG A;  3L2Q A;  2EJG A;  3FB9 A;  3KUF A;  4R55 A;  5CKH A;  1VQ9 A;  3V7C A;  1WJS A;  3G4S T;  4M7D F;  4F7U A;  4C92 E;  2BIV A;  4JRK A;  1S72 A;  3PT9 A;  5GAO p;  2RO0 A;  1FXX A;  1VQ7 T;  2VXF A;  4M77 F;  1K8A U;  2LT1 A;  3OYB A;  4J6Y A;  2CGH A;  3HP9 A;  5FRM A;  3OYD A;  5AYF A;  2WSE E;  3OQ5 A;  4XU1 A;  5GAN d;  2FVU A;  1KD1 C;  1YI2 A;  4J5Y A;  3CD6 T;  3V8L A;  2D0Q B;  2DEQ A;  4WF2 A;  4C92 C;  3RKX A;  3CCQ A;  2RHX A;  3JAM E;  2GQV A;  3OW2 S;  3OY9 A;  3HPW A;  2DXU A;  3OSS C;  3S3O A;  1N6A A;  4M7A A;  2KSS A;  2KDS A;  2OAU A;  3FDR A;  1M1F A;  4M7D E;  4LDV A;  2KMT A;  2BKD N;  5GAM f;  4M75 A;  2JNG A;  3L42 A;  4C0G A;  4EMK C;  2V8I A;  2R57 A;  2XDP A;  3O8V A;  4C8Q B;  3M4G A;  1X6O A;  2RD1 A;  2XI9 A;  3QJY A;  3CCM A;  1D3B A;  4M77 E;  3CMA T;  2LX9 A;  5FU6 C;  5GAN 4;  5HK3 A;  2RJD A;  1VQN T;  4ATO A;  4M75 B;  1LOJ A;  2DKG A;  2K5I A;  4J83 A;  4BI4 A;  1VIF A;  3CPF A;  4M78 F;  3GP8 A;  2NLU A;  3SWN C;  3QBY A;  5D6X A;  3I55 T;  3CC7 A;  3CXC S;  2RI5 A;  3MP6 A;  2PUK B;  3FEO A;  4M7D C;  2IG0 A;  5LJ5 h;  2OTL A;  2DAQ A;  4XQ3 A;  3PMI A;  2YLB A;  3LLR A;  3JB9 F;  1YIT A;  1VQ5 A;  3E1S A;  4C8Q G;  5GAN f;  1M8V A;  5GMK h;  1M1G A;  3X20 B;  1MHN A;  4M77 C;  2M16 A;  4HCC A;  4P5N A;  2E10 A;  3JCM e;  1MGQ A;  2Y90 A;  3C4S A;  3V8J A;  5LJ5 g;  4M75 G;  3X25 B;  3GLX A;  4MZP A;  2WAC A;  4XTW A;  5A2Q E;  2K3Y A;  2DIG A;  3CC2 T;  4GLK A;  2O01 E;  2FHD A;  3P8H A;  5LL6 S;  2QEX A;  3FIF A;  5GAO m;  4E7J A;  3FJP A;  3OBY A;  4IUT A;  4ELZ C;  4A4E A;  1JB0 E;  3G4S A;  2EIF A;  3LH0 A;  2QI2 A;  1YIJ T;  1BIA A;  2LC4 A;  4HT9 A;  4M78 E;  4XU0 A;  5FRN A;  4X9C A;  3M57 A;  5C6S A;  3CCE T;  1VQ7 A;  3SFM A;  2DVE A;  4EMG A;  3MET A;  3V7S A;  1M90 C;  2PQW A;  3PTA A;  5KCO A;  4C92 B;  2H3J A;  4F7U F;  2EJ9 A;  2QQS A;  2R5M A;  3CD6 A;  2PVG B;  4OP0 A;  4DA4 A;  1UB4 A;  2E1H A;  3OS1 A;  1Q82 C;  4M78 C;  5CVI A;  3URG A;  4ZN3 A;  5GAO l;  2ZPB B;  3DLM A;  5GMK i;  2L89 A;  2VGM A;  2YLC A;  3JCM c;  1YCY A;  4M78 D;  4EMK B;  4FSX A;  3OA6 A;  2XG8 D;  3MEW A;  5FU6 B;  5IN1 A;  1G3W A;  2LTO A;  1P92 A;  2XKO C;  3QPH A;  4HCZ A;  3OBW A;  4J6W A;  3PFS A;  3MEU A;  5A0L A;  5GMK m;  3JCM d;  2XD0 A;  3OYN A;  3CC4 T;  3RMS A;  2O4X A;  3JB9 H;  5J39 A;  5GAN 2;  4KT0 E;  2Y4X A;  4M7D B;  1U1S A;  1YJN T;  3F70 A;  4GY5 A;  1W2B A;  4L59 A;  4F7U E;  2GFU A;  3J81 E;  1OYX A;  1SSF A;  3I55 A;  3OB9 A;  1M1K C;  2RB6 A;  1M90 U;  2MWP A;  2X4Y A;  3M4Y A;  4M77 B;  1Y07 A;  4OGE A;  3ZFJ A;  2GF7 A;  2WSF E;  2MWO A;  4HKE A;  5HK0 A;  1NE8 A;  2VXE A;  4Y28 E;  3QDR B;  4LDX A;  3CBP A;  1Q82 U;  2QTX A;  4A4H A;  3CME T;  2R58 A;  2E6Z A;  2E5Q A;  3HRS A;  3VYH B;  2ZGW A;  5GMK l;  5LJ5 e;  3CC2 A;  4ZN1 A;  1G3S A;  3BW1 A;  1HXD A;  3HKS A;  4ZGJ B;  5GMK e;  5GAN 7;  2FB7 A;  1W4S A;  4RCB A;  5GAO q;  3TU4 K;  3MEA A;  1YIJ A;  1JJ2 S;  4C5G A;  3A8O B;  1VQL T;  1UGR B;  4RG2 A;  3JCM f;  4N4G A;  2RI2 A;  2E70 A;  2F69 A;  2M9U A;  4IUP A;  4MDX A;  3OYH A;  2B8A A;  4XTX A;  3QO3 A;  1EIF A;  3MP1 A;  3Q1J A;  2KVQ G;  2XHC A;  2YRV A;  1M1K U;  4C5H A;  4PJO A;  3H8Z A;  1K9M C;  3MO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...