4X9DA

High-resolution structure of hfq from methanococcus jannaschii in complex with ump
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
NFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
molecule keywords Uncharacterized protein MJ1435
total genus 10
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x9dA00
4A54A 5LJ3e 3JCMd 4M7AD 3SWNB 4C92D 2JN0A 4M75E 4C8QD 4C92A 4JLIA 4C8QA 4M78B 1D3BA 2YLCA 5GAN2 3JB9F 3BFMA 2EJFA 3RESA 4C92E 5LJ3g 3V8JA 4M78E 5LJ5d 4XU0A 4EMKB 2DEQA 3V7CA 1U1SA 3JB9G 1MGQA 3JCMV 3RIRA 2E64A 2EAYA 3QHSA 1I81A 3V8KA 3FJPA 4MMLA 3JCMg 5GAN5 3VU3C 2DXTA 5GAOq 4WF2A 4M77F 4M75A 5LJ5h 1BIAA 5GMKh 5LJ5f 4EMKC 1B34A 2DJZA 4M77G 1H641 3V7RA 2VXEA 3JCMJ 4M77A 3JCMP 4M77D 4DQ2A 4XTVA 4PJOG 2RD1A 2YHTA 3JB9J 4M7DD 1HXDA 3BDUA 4M7DE 3QUIA 4N0AA 4XTWA 3INZA 4M7AG 1N9SA 4M75D 4NOYA 2DTOA 1BIBA 4M75B 4Y91A 3JCMe 1I4K1 4C92C 1U1TA 4C8QC 5GAOm 4J6XA 5GAN6 4M7AF 2CGHA 4EMHA 5GAMe 5GANh 3FB9A 4C8QF 4QVCA 5LJ5e 4XU2A 4M7DG 4EMKA 3HFNA 2RB6A 5GMKe 4RCCA 4XTZA 4XQ3A 2DZ9A 2DZCA 4EMGA 4F7UF 3AHUA 4PJOC 5GMKj 4M78D 2K57A 4M78A 4C8QB 4JRKA 5GAN3 1WQ7A 4M78G 4C92G 5GMKm 4F7UE 1WNLA 3RKWA 4HT9A 2E41A 1KQ2A 4V2SA 4M7AC 2YLBA 3JCMh 2FYKA 1I8FA 4HT8A 1M8VA 1M5Q1 3JCMb 4M7AE 5GAOn 4NL3A 1WPYA 4J5YA 3QO3A 5GAOl 1HK9A 5GAN4 4HA8A 1LJOA 3BY7A 4XTXA 3RUXA 4JUVA 5I21A 2EWNA 5LJ3j 3JCMQ 3JB9H 3GIBA 3RKYA 4M7DA 4QVDA 3M4GA 4MMKA 5CAIA 2RM4A 3BW1A 2VC8A 1JBMA 1N9RA 1YCYA 5GAMf 3SWNC 2E1HA 4XU3A 5GANj 4OP0A 5GMKl 2HNIA 1I5LA 2DVEA 4M7AA 5GAN8 3PGGA 1KQ1A 4PNOA 2DTHA 5GAOp 2QTXA 4M77E 4PJOA 4C8QE 5GANe 4M78C 4PJOF 3HSBA 5GAMd 4M77B 4XTYA 1JRIA 4JRIA 2RA2A 4XU1A 1LNXA 2ZGWA 4A53A 1B34B 2EJGA 2DXUA 4M75G 1TH7A 4J6YA 4NL2A 4M7DC 1LOJA 3L2ZA 5GAN7 1X01A 1D3BB 4M7DF 2VXFA 2DKGA 4M7AB 3V8LA 4XTUA 4C92B 5LJ5j 5GAMj 5GAMh 4J6WA 4M75F 5LJ3h 4C8QG 4PJOE 2E10A 5LJ5g 5LJ3f 3RKXA 5GAMg 2DTIA 3V7SA 5GMKi 2FB7A 5GANd 3JCMf 4PJOB 3JCMX 3JB9I 4PJOD 3RERA 5DY9A 2EJ9A 3JCMW 3SWNA 3JCMc 3EFRA 5GAOr 5LJ3d 3L1AA 1Y96A 3HFOA 4F7UB 4M77C 4X9CA 1WQWA 3EFSA 4M7DB 4M78F 2Y90A 4F7UG 4C92F 5GANf 2E65A 3SB2A 4N0AC 4X9DA 4F7UA 3QSUA 3JB9D 4M75C 1Y96B 3FIFA 2I2LA 4RCBA 5GANg
chains in the Genus database with same CATH superfamily
4A54A 1K8AU 5AYFA 1IGQA 2AKLA 3S3MA 1YHQA 1GL5A 5J3BA 5LJ3g 4N4GA 1KC8U 3AT1B 2ENMA 2I0NA 1I81A 2XDPA 5FW9A 1VQ7T 4HCZA 5LJ5h 3H6ZA 5C0MA 4II1A 3S3OA 3M9QA 5HCKA 1NG2A 4N0AA 3CCRA 4E7ZA 4HKEA 1WXUA 2CP6A 5FU6B 5FLXE 2X4YA 4OGCA 1B7TA 4XTZA 5FU7C 3C95A 2QQ9A 3AHUA 3ZL7C 1J3TA 4PKCC 1CSKA 2GGRA 3FJ5A 2YUQA 3OYJA 3OW2A 2E3IA 1MNEA 2P0QA 2QA4T 3M0UA 3JCMb 4HA8A 1WJSA 3J7AF 2EKOA 1VQ5T 3TU4K 2YWWA 1TSFA 2VC8A 3CC7T 3CBOA 3OS5A 2HQEA 2Z0WA 4M77E 4E7SA 2CP2A 3HSBA 4CC7A 1AWOA 3PFSA 3A5ZB 2RK2A 2QEXT 3SEMA 1VQ5A 5GAN7 3M0PA 2HL5C 3WVEB 4CRIA 1RACB 4J6WA 4KGVB 4M75F 5LJ3h 1UGRB 2DTIA 3RMSA 2O01E 3CCRQ 3M54A 5A0GA 2KMTA 2F2WA 5CR2A 2QEXA 1D0YA 2DLPA 1ZHIA 4LDVA 4B6MA 1TUDA 4J9FA 2YUNA 1X27A 3RESA 3E9GA 1I0CA 2J05A 2FO0A 3M4YA 4EPCA 2LQNA 6AT1B 3H41A 2CT4A 3M0SA 1GFDA 2BE9B 1GXIE 2XDDA 4IUVA 2VB6A 2COZA 3VJPA 3FLGA 3G6ET 3SD4A 3T9NA 1BU1A 2V8JA 3BDUA 1YJWA 3Q1JA 4LN2A 1ZBJA 4M4ZA 3QWXX 1F1BB 1IHWA 1QCFA 2LJ3A 1TUGB 4AFSC 5KYXA 3MEVA 2RPNA 2RI2A 3I55Q 3OY9A 2K5LA 2J7IA 2GFAA 4DBFA 1VQ7Q 1UECA 5L8RE 4WCIA 5AT1B 3OW2P 1N27A 4PJJA 4BE1A 2K4YA 4BE2A 1M1KC 2D0QB 1QKXA 4FW2A 1VQ9T 2C0OA 1WXBA 1NPPA 1QCNA 5KYWA 4JDSA 2DVEA 4RG2A 2RMOA 2GBQA 1KC8R 4C8QE 3VS5A 3CCSA 3BE3A 5GAMd 1AD5A 5CVIA 2D8JA 1UGVA 2P4TA 2EYZA 5J26A 3LH5A 4BD3A 3V8LA 2RF0A 4RUGA 3D7SB 4FT2A 5LJ3f 1VQPQ 3OSSC 1VQ4T 2L3SA 1GFCA 3L2VA 3NHNA 3RNJA 3JB9I 3TEEA 1MMAA 4E7IA 1H8KA 2MF2A 3JCMc 4HXJA 3L1AA 3JV3A 4M77C 1M9SA 2DYIA 4C92F 3CCJQ 1ABQA 1NLOC 4C5IA 2DAQA 1TUCA 4KT0E 2EYYA 3V8JA 1YITQ 4Z02A 4D8KA 2LVMA 1FMVA 4RMOA 1RAGB 3UF4A 1T3SA 2HAXA 2D1XA 3CCVQ 3OYCA 1ZQ1A 1BIAA 4FIBA 1JU5C 2K2MA 4J9EA 1PHTA 3M5AA 2LNHB 1M27C 2CP5A 4KUDK 4AMCA 3HKSA 2X3WD 2ROTA 3A8HB 2RB6A 2E70A 4BB7A 2X9HA 3HTRA 1GBQA 3EG9B 4M78G 4IUUA 1EFNA 3OS0A 3G4ST 3JRZA 1WHLA 1M8VA 1IREB 3CPWS 4FYXB 1D09B 1AZEA 1UB4A 2R58A 3OSVA 4JUVA 3QJ6A 3P8DA 4QVDA 3CCMT 2PTKA 1MUZA 1N9RA 2DD4A 2X51A 2A3LA 2LT4A 2D9TA 4PJLA 2C0TA 1JRIA 2CS7A 3CC2T 1JJ2A 4R0KA 5FRMA 1Q82U 2VYTA 5HY6A 3CCMA 2F2XA 2KT8A 2G3RA 1IRXA 2E10A 3UA6A 1VQKQ 1ZSZB 2EJ9A 1KG1A 3HL8A 2K9GA 2YSQA 4DBRA 2JNGA 4IURA 1WQWA 2FRWA 1X69A 5GANf 4N0AC 3QSUA 3JB9D 3LH0A 2J6FA 2KQWA 1D3BA 3CCEA 2COYA 5IN1A 3CPWP 2CP0A 2GTJA 2P4RA 4P5NA 5LJ5d 4ZTFA 3MPUB 4EMKB 1NJIU 2DEQA 2LDMA 1QLYA 2X35A 3VRZA 1KIKA 2ZPEB 3QHSA 3J80E 4A4GA 2DXBA 4ESRA 1VQOA 1RAHB 1JJ2P 2PVOB 3NTHA 1AHJB 2YHTA 1BK2A 2CSQA 2A0FB 1K9AA 2EYQA 5KYWB 4KUIA 4L5GA 2D0NA 2YT6A 4EMHA 1SSHA 1VQ6Q 1M1FA 1I1JA 2OI3A 4XQ3A 5KYUA 3OYAA 3VS4A 3UWNA 2OX7A 4D6WA 3M57A 2LCCA 1G3SA 2O4XA 3TSWA 1ACMB 4QKUA 3GOXA 1M5Q1 2CYZB 3CPWA 4KBMB 3CPFA 5GAN4 2K3YA 1M4ZA 2R5AA 1WHMA 1D1AA 3GNFB 3VYHB 3H8ZA 2RM4A 4LDWA 4EDUA 1YCYA 1Y0MA 4M7AA 2DRMA 5EG2A 3OYGA 5CKBA 1YWOA 2IVWA 3OA6A 4GLMA 2XKOC 1OU9A 1TOVA 1OEBA 5HK0A 3G4SQ 3LX7A 1AWWA 4IIMA 1ARKA 3CC7Q 3O8VA 2VXFA 2FRYA 3MEAA 2CREA 4C8QG 4BY6C 2EQJA 1X6BA 3CMEQ 1NM7A 5GJVB 2EYXA 5GMKi 2FB7A 3JCMX 1ZBXA 2JVVA 3G71T 1PRMC 1M3CA 3EFRA 3P8HA 3WVDB 2MOXA 4JRQA 1Y71A 4J9IA 4F7UA 1K73R 3OBWA 4M7AD 4DBHA 1AVZC 1WX6A 3JB9F 3BFMA 1Z9QA 5KYYB 3OW2S 2JMAA 3MP1A 1PD0A 4BI8B 3MKDA 3A8MB 3JCMV 5GAN5 4MMLA 2EQKA 3X20B 1YHQQ 4OMMA 2R57A 1B34A 2DJZA 2XD0A 3QYHB 1YHQT 1VIEA 2J06A 2FPFA 4M7AG 1UJ0A 2QYZA 4Y91A 2LZ6B 1U1TA 3QKJA 2C06A 1AT1B 2DZCA 4MDWA 2AKKA 2JW4A 5IHKA 2RQUA 4KGZB 5KYYA 1Q7YC 2KROA 2P0PA 4RTVA 5FWCA 3RUXA 3CBPA 1LCKA 3EGDB 2EQIA 2HL3A 4NS5A 5GMKl 3HRUA 2BTTA 4Z8AA 3A98A 2M0OA 1GCQC 4PJOA 1S1NA 2RHYA 1OU8A 1PSFA 1K4US 5CO7A 3JSCA 5A0DA 2EJGA 5D6WA 1X01A 2H8HA 2RHUA 1JJ2S 5LJ5j 4DBQA 2ZZDA 2CZ1B 1G3YA 1FMWA 1X2KA 2W10A 1NPRA 1X75C 2JMCA 3R6OA 2K7AA 1VYTA 2KDSA 2CH4A 1JXMA 3HFOA 1S72Q 2QQSA 2JXBA 1Q86C 4HCBA 2E6NA 2XHCA 2I2LA 3FIFA 1Q82R 2A28A 1G2BA 2X4JA 4RKUE 3G6EQ 1SKUB 1FYNA 4C92D 2DVJA 4BDZA 8ATCB 2EJFA 3L2UA 2O4XB 3SFMA 2RNAA 2A7YA 2HBPA 3JB9G 5DM7R 5D7UA 3JCMg 1RAAB 2DL5A 3VU3C 2RH2A 4M77F 3KBGA 4J7FA 3EHRA 5J39A 2ZCFB 3FC3A 5ECAA 3M0RA 2QDYB 3CMAA 4OB3B 1N9SA 3OYKA 4M75B 5D6XA 3A8OB 2RJCA 2K5IA 4J9BA 1LPLA 2LCSA 2QG9B 5GMKe 1U3OA 2PNIA 3G6EA 1SEMA 1G5VA 2ABLA 1JXOA 4BY6B 5GMKm 1BI1A 4GY5A 4X1VA 1PCXA 2QXFA 8AT1B 2L3PA 2CUBA 1KC8C 4O6JA 2KR3A 1WHKA 3BY7A 2QAZA 3DLLA 4XTXA 4JS5A 4ZN3A 3NTKA 2O9SA 2YUOA 3M4GA 2DILA 4E47A 4C5GA 3U23A 1VQ6T 4Z89A 1GBRA 3PIPA 3TQ7P 1NYGA 4K11A 1U8RA 2GTOA 3P8BB 2IPOB 4OMNA 1G83A 4OF1A 3M58A 3UPUA 1LOJA 1AZGB 2B86A 4C0FA 1BCMA 3IQLA 5LJ5g 3V7SA 1VQNT 3CC4A 4PJOD 2CSIA 3JCMW 1O75A 2MIOA 3LWHA 3I55A 3CCQA 1VQMA 3SB2A 1V29B 5A0LA 2EPDA 2JOYA 4LUEA 2JN0A 3ZBDA 4C8QD 5CK9A 3OYFA 2F5KA 2ZPBB 1S72A 3CC4T 4AFQC 2QGFB 2WSFE 2L0AA 2RHXA 2RN8A 1MMDA 2LTOA 1YJWQ 2EVRA 2DYBA 4A4HA 4FM4B 4CC4B 1DJ7B 1H641 2A37A 2VXEA 2RQWA 4M77D 2QQAA 1K76A 1S72T 3CCVT 3QDRB 3QYGB 4M75D 2EQUA 2PUOB 4XK8E 1M1GA 2BUDA 1KQSA 1N5ZA 2CGHA 1NE8A 1K8AR 2FL7A 2VV5A 3GNGA 1U5SA 4WTOB 4PFPA 2FZGB 2RQTA 3EHQA 3PMIA 3OYHA 1PG5B 1BKBA 2ESWA 4C92G 4OVAA 4V2SA 4PK4A 1TG0A 1T0JA 4QVZA 4MDXA 4HT8A 3NPFA 1XQHA 3UA7A 3QO3A 1HSQA 1VQ4Q 1YJNT 1LJOA 3H0FA 1PM3A 2EWNA 1PKTA 3GIBA 1IO6A 1PNJA 4KH0B 3G4SA 2JTEA 2XG8D 3DKMA 3FEOA 4JRIA 2ZPIB 1AOJA 3H0IA 1B34B 1RABB 2EGCA 1TH7A 3E2UA 5DLOA 3L2ZA 4M7DF 2OTLT 4M7AB 2DO3A 3A8GB 4VUBA 4DA4A 1K0XA 2F2VA 2LRQA 3JAME 3CCUQ 4Z88A 3CXCS 4JPBW 3OYYA 5DY9A 4LXCA 2XDBA 1YP5A 3CCLT 4F7UB 2QA4Q 5KCHA 2BZXA 1SHFA 2QEXQ 2LT1A 5KE3A 3SWNB 1YCSB 4M75E 3CCMQ 1VQOT 4JLIA 5KYUB 2B8AA 4M78E 3GBQA 1OI1A 1M2OA 2NUPA 1E7OA 2GNCA 4J7IA 5CKDA 2VGNA 5GAOq 2FG0A 5LJ5f 1VQOQ 1C6VX 2MMPA 1CKAA 4ZGEB 1OOTA 3JCMP 1K9MU 1XNIA 2J6KA 4QT7A 1H3ZA 2J6OA 3QJYA 4L59A 1K1ZA 4TVRA 2RHIA 1UHFA 2ZPGB 2JUFA 4J6XA 1VQKT 3RBBB 5FU6C 1OYXA 2V8IA 2AHJB 1EZZB 4X34A 1Y07A 1WNLA 3GPLA 2LNVA 3RKWA 1ABOA 3OS2A 3C94A 4AFZC 1G8XA 2LMJA 1VQKA 5GAOl 1VQ8T 1PRLC 3MJXA 4ZN1A 2CH4W 2AK5A 1P92A 3QBYA 5GAMf 1OZ3A 1FMKA 3BDLA 4RTYA 2KXDA 3OB9A 4MZTA 5GANe 4PJOF 4XTYA 3LWIA 3O5ZA 1KJWA 4M7DC 2KT1A 5CCAA 1M8MA 3ZEHA 1D1BA 3CCJA 1QVFP 2JS2A 1NEGA 2EYWA 4OMQA 1SG5A 1CKBA 1Y96A 3OYLA 4BUGA 3HRSA 1KK7A 2HKQB 4M7DB 1VQPA 4F7UG 1Z9ZA 4M75C 5IHIA 4RTXA 1OPLA 1UFFA 1VOMA 4ELZC 1OX9A 1XOVA 4Y92A 3CCRT 1VYUA 2KVQG 4J9GA 5CQYA 3N5BB 2X4WA 1PSEA 1WLPB 4M75A 1M90C 3QIIA 2RJFA 1ZUKA 1W1FA 1BCOA 1YI2T 1M90U 2DD5A 5GJWB 2HCKA 2LQ8A 5IAYA 2RHZA 3LGFA 4OB2B 1I4K1 2CT3A 2HBWA 3C12A 3LLRA 5GANh 1QVFA 1VQ7A 4OB0B 1K73U 1X6GA 4RCCA 3SDZA 1KHCA 1Q95G 4F7UF 1YI2A 1SPKA 2JM8A 3G7ZA 5GAN3 9ATCB 2DL4A 4PJNA 2FZKB 3DLMA 5CQXA 3LW5E 4ATOA 2HSEB 1QVGP 3EAEA 2DNUA 1K9MC 1QWFA 5IH2A 2HKNA 2V1RA 3R6NA 3JCMQ 1QVGS 2FVUA 4XAXB 4N4HA 4ZNXA 4QQGA 3J81E 1MMGA 4DEYA 1I5LA 2DBMA 4AT1B 2EFIA 3I56Q 3URGA 4IUPA 2NUPB 3CCSQ 1Q7YU 1GRIA 2CZ0B 2DXUA 1BI0A 5D6YA 4NL2A 4F14A 3CMAQ 1LVKA 1PWTA 3REBB 1ZSGA 3X24B 4PFZA 1VQ8Q 2ZPHB 3VS6A 1QQJA 4J83A 2LQWA 1KD1U 2A36A 3OYIA 3DB4A 3MEUA 2EGEA 2RI3A 3A1PA 4XU1A 1ZUYA 3L2WA 5GAN2 1D0ZA 1YJWT 1WIEA 4KRTA 4CI0C 3KXTA 3EG9A 3RIRA 4JJBA 2OAUA 3FJPA 1BI3A 2CDTA 4E7HA 4WF2A 4IIOA 1KQSS 5KE2A 4HVUA 1NYFA 4LUDA 3HP9A 3M56A 4DQ2A 4JS4A 4XTVA 1X2QA 1RI0A 3JB9J 2X4XA 1QCOA 1I07A 4XTWA 2KK4A 3SHWA 1NJIR 2OTJA 4C92C 1VQNQ 2E12A 4ANJA 5GAN6 3OYBA 2M02A 1N8RR 2ATCB 3E19A 4XU2A 3HFNA 3QG1A 2DZ9A 2LX7A 3WXMB 4RTUA 2K57A 1QP3A 4RTTA 4F7UE 5EC7A 1O9SA 3CCLQ 1VYVA 2E41A 2OTJT 2SEMA 4EIKA 3CCST 3VUZA 3ME9A 4LD9K 3MEWA 1Y57A 2FEIA 1SRLA 4HCCA 3CMEA 2DERA 4ZGJB 5CAIA 1C0MA 2JJ9A 3EGXA 1MV3A 4CC3A 3EG2A 5DLQE 3ER0A 2C0IA 3DB3A 4LDXA 3ASKA 3CQTA 3CCUA 2KNBB 3I55T 2FZCB 3CMET 1UGPB 5CKFA 1K8AC 2XK0A 4RTZA 2DKGA 3RR6A 5L23A 4GLKA 2YRDA 2RO0A 3NFCA 4UC4A 4PJOB 4IUQA 3QXEB 1EX4A 2MI6A 2XICA 3HPWA 3UDCA 1YFNA 1B3QA 3F70A 2M16A 4O5VA 4X9CA 4BE0A 4FU6A 1JO8A 2Y90A 3EH1A 1OX8A 1Y96B 4B9WA 3CD6T 3A8LB 1VQ4A 3CBMA 2DA9A 2XU8A 2X3XD 5KH6A 4A4FA 1NJIC 1YBYA 3OQ5A 2FHDA 4HVVA 3OYDA 1VQ9Q 2XI9A 1WFWA 4E6RA 3PVLA 4LD6A 4KH1B 4A63B 4FSSA 4M7DE 1HXDA 1NBEB 7AT1B 1H92A 4A4KA 3M59A 1M2VB 1BIBA 2L5QA 2RI5A 2CUDA 4C8QC 4BI3A 1M3BA 1X6OA 2L89A 2BIVA 3RDVA 2E6ZA 5I11A 1WHJA 1JEGA 1UG1A 4J8OA 4EMGA 3CCEQ 5GMKj 2K3BA 2EIFA 3EG0A 2VUBA 1WJRA 4HT9A 1T0HA 1QVPA 3CXCA 2FYKA 3ULRB 5IT9E 2PUKB 1HK9A 2HDAA 3CEYA 2MK5A 5I21A 3JB9H 1M3AA 3RKYA 2K2VA 1RAIB 3PT9A 4XU3A 3UATA 3QZ5B 1OPKA 5I22A 5GAOp 5FWBA 2O2OA 1MNDA 4FYVB 1KD1C 3S3NA 2EW3A 2K5FA 1BBZA 2RA2A 1X43A 2ZGWA 3X25B 3CCLA 3I56T 3L2QA 1RI9A 2LCLA 1MMNA 1V76A 4C92B 3META 3THKA 2DJQA 3H0HA 2YUPA 1UEBA 3MHXA 4QQ6A 1N6AA 3VKIA 1VUBA 1Q7YR 1Q86R 2OTJQ 1VA7A 3CXCP 4PJMA 5IXFA 2WSEE 2D8HA 2O88A 2W0ZA 3JCMd 2JM9A 1K73C 2AZSA 1MV0B 4IKFA 3LYIA 1OZ2A 1U1SA 1VIFA 4RG8A 1UTIA 1IGUA 1QMCA 5KYNA 2IIMA 2DXTA 1JB0E 3C0CA 2QDLA 2RQRA 5CIUA 2ZAEA 3OYNA 1VQMQ 3JCMJ 1VQLA 3CCQQ 3EGUA 4PJOG 3CCET 2RD1A 2EQMA 2O31A 1E6HA 2E5KA 4JZ3A 2OJ2A 1M2VA 4NOYA 4JZ4A 1QWEA 5GAOm 4C0DC 2BE7D 2IG0A 5GAMe 2JTMA 1VQ8A 1H3HA 4J9HA 2K79A 4OMLA 2DL7A 5HKCA 2WACA 4RTWA 4PJOC 3UT1A 4M78D 1NZ9A 3VYGA 1QVGA 4JRKA 2RJEA 4LDYA 3PIOA 3EG3A 1Q86U 3OS1A 2NUTA 1R0BG 4JRPA 2EBPA 3MO8A 5GAOn 1WPYA 2DXCA 4N4IA 4FYYB 4E7JA 2AZVA 3PTAA 2BZYA 4PNOA 2DTHA 2E4HA 4OB1B 4J9CA 4KULA 4QW2A 1OV3A 3QDFA 3MP6A 1GCPA 2M9UA 3GF5A 3OMGA 4M77B 1D1CA 1WHHA 4JLGA 1WHGA 4ORZA 1UJYA 3X28B 1YIJQ 3OYMA 3RKXA 3TCJA 3JCMf 5M9OA 1YITT 4BACA 3RERA 2CZ6B 3PMTA 1V1CA 4BDYA 5GAOr 5LJ3d 1R0CB 4PL6A 4AFUC 4ME7A 4F16A 2D6FA 5GAMh 4M78B 1RLQC 3FDRA 1T3LA 1G3WA 2QGGA 1YITA 4C92E 2VVKA 2DETA 1YIJA 2VASA 3M0TA 2NLUA 1UHCA 4C5EA 2H3EB 2MAMA 5GMKh 1BYMA 1IHVA 4FYWB 4M7DD 2R5MA 1HYOA 3INZA 1YJ9A 2DTOA 4AG1C 2HQHA 3EFOB 1W2BA 5HK3A 4E7KA 1OULA 4FCYA 2OTLQ 2KXCA 4GBQA 1K9MR 3L42A 4R55A 1YJ9T 3OMCA 1KQ2A 1W70A 2HQXA 2DEUA 2YLBA 1I8FA 2F5TX 3VS2A 2BKDN 1UDLA 3G1JA 3GP8A 3LGLA 4HVWA 3M55A 3OYEA 3KUFA 1W4SA 3S6WA 4MMKA 2KRMA 1WI7A 1JBMA 4D8DA 2DPPB 1ZA1B 5GANj 4FSXA 3KFVA 3I9QA 1KQ1A 2NUZA 2QA4A 2DE0X 4L6V5 2YRVA 1K0SA 4Q5WA 1XTDA 1HJDA 1WDXA 4PFOA 1D3BB 4C5HA 4XTUA 3CC7A 1ZSZC 2HMAA 1E6GA 2DIQA 1SF9A 2LJ0A 2QK0A 5FU7B 2AT1B 2HEQA 1KSWA 2EKHA 2M1HA 1QW1A 2E5QA 2E65A 1PD1A 1QKWA 2CZ7B 1B07A 2WSCE 2MPXC 1TU0B 1N8RU 2FPDA 4C8QA 4ZGDB 3FRNA 2RK1A 2HSPA 2K3XA 2GF7A 1MGQA 4Y28E 3TVTA 1YN8A 2EAYA 3V8KA 4BI4A 3I5RA 4R56A 5CKHA 3EGXB 4OMFB 3V7RA 2VWFA 1YJNQ 5LL6S 1EIFA 2L2PA 2O9VA 3VS7A 1BB9A 4DOVA 1RLPC 2HD0A 2MWPA 3JCMe 2DBKA 2ROLA 2L3QA 4M7AF 3FB9A 4EMKA 2KSSA 2QI2A 1RUWA 3NGPA 1PKSA 4C8QB 2MCNA 3CMAT 1JQQA 2KEAA 1KD1R 3GLXA 2OAWA 4LDUA 3EFOA 4M7AE 2M51A 1WJQA 1QVFS 3CCUT 2LJ1A 1AWJA 3L2RA 1UE9A 4JJNK 1ZSZA 2M0YA 4LE9A 2DIGA 2A08A 4M7DA 1R8OB 1FWZA 2K6DA 1WA7A 1YWPA 5GAN8 2PQWA 1A0NB 2QTXA 1BI2A 1ZLMA 2V8KA 3QPHA 1FXXA 4A53A 1LNXA 2PU9B 3G71Q 3CCQT 1MHNA 2KGTA 3TSZA 2NYSA 1VQMT 4FL6A 3ZFJA 1VQ9A 5KCOA 1VQ6A 3CD6A 2DM1A 3VS1A 4PLLA 2JS0A 1AWXA 4F04B 5FRNA 2KRNA 3SWNA 4JJCA 2KY9A 2GCXA 4M78F 4QQDA 1TXQA 4IUTA 4X9DA 5C6SA 2Y4XA 2QQBA 5GANg 5LJ3e 1Q81U 2YLCA 2YRCA 1VQNA 1ZA2B 1NEBA 3QZ9B 2DRKA 2XMFA 3V7CA 3EG1A 2VGMA 3VS0A 5CKEA 1UGQB 2F1LA 4CC2A 1M1KR 2E64A 2RJDA 2PVGB 1M90R 4OMPA 1WGSA 2BZ8A 4PLIA 4EMKC 2KRSA 3QWYA 4JJDA 2DFUA 1IZ6A 1M1KU 3QUIA 1KHIA 2JTFA 3NTIA 1IB8A 1TTHB 1I5OB 4DEXA 4C0DB 3VV0A 2DL8A 5IXBA 1PC0A 3CC4Q 2NUTB 5LJ5e 1Q81R 2MYSA 5I2MA 1YJNA 4M7DG 3RMQA 2LP5A 5I2SA 2KAFA 1FX7A 4M78A 2VKNA 3CCVA 3PVQA 2G6FX 1WQ7A 4OMOA 3PE0A 2YXYA 1TS9A 4M7AC 1HD3A 4ELYC 2F69A 3CC2A 2SRCA 3M53A 2PZ1A 4ZTJA 2P84A 3I56A 2COWA 2JT4A 2CP7A 1WXTA 3BW1A 2OTLA 4MZPA 5FROA 3NMZC 3SWNC 1IXDA 2V26A 4OP0A 4C0ZA 2HNIA 2XIDA 2P0KA 4DOWA 3REAB 2DF6A 3VRYA 4AG2C 3OBYA 4J6YA 2EGAA 4J9DA 2DX1A 4FW1A 2V1QA 4PJOE 2LX9A 3EH2A 3EGDA 3MP8A 2QASA 5GANd 3VS3A 3X26B 2H3JA 1YNZA 3CC2Q 2RQVA 2ECZA 2GFUA 1XJWB 1C1AA 4KGXB 2MWOA 2KE9A 4FT4A 1D0XA 1GCQA 3EFSA 3MCAB 2GQIA 2LQKA 1RAEB 3E1SA 2AIRB 4RCBA 2ED0A 1WZOA 1VQLT 1Q82C 4C92A 1W6XA 4HCKA 2QTVA 1Y7XA 4XU0A 4MZMA 5KYXB 2HZYA 3PNWC 1ZUUA 5A2QE 3I35A 1VQLQ 1Q81C 4M77G 1SHGA 2Y4YA 2DMOA 4M77A 3M0QA 2KYMA 2YDLA 1R77A 2CP3A 3C4SA 1UUEA 2KYBA 3TREA 2GQVA 1YJ9Q 1RADB 2KBTA 2DK3A 2L8DA 4A4EA 4C8QF 4QVCA 1RAFB 1SRMA 3HHTB 4E2FB 3I5SA 1OQKA 2DL3A 1QP2A 2ZPFB 4B9XA 4OGEA 1KQSP 3JCMh 2PVDB 4NL3A 4J5YA 1YI2Q 4F17A 3E9FA 5IHNA 5LJ3j 2QQRA 4E7LA 1TWBA 2NWMA 3CD6Q 1W2BP 2E1HA 1SSFA 2FPEA 3CCJT 1UGSB 3PGGA 1RL2A 2ED1A 3HRTA 1W2BS 1AEYA 4M78C 3G71A 1ZX6A 2L3RA 1N8RC 4M75G 3H9NA 1G3TA 1VQPT 1KFZA 5GAMj 1VQ5Q 3VUBA 2KI7A 1U06A 4C0GA 4LNPA 5GAMg 2LC4A 2JZ2A 4YTLA 1M30A 1YIJT 1NLPC 1WYXA 2E3HA 2CKKA
chains in the Genus database with same CATH topology
3OBWA 4A54A 1K8AU 4M7AD 5AYFA 4M78B 3S3MA 4ELZC 1YHQA 3JB9F 3FDRA 3BFMA 1G3WA 5J3BA 1YITA 1XOVA 3OW2S 4C92E 5LJ3g 4N4GA 3MP1A 1KC8U 3CCRT 4BI8B 3A8MB 1YIJA 3JCMV 2KVQG 5CQYA 3N5BB 2X4WA 2NLUA 1PSEA 1I81A 2XDPA 4MMLA 2EQKA 5GAN5 1VQ7T 3X20B 4M75A 4HCZA 5LJ5h 1M90C 3QIIA 4C5EA 2MAMA 2R57A 1B34A 2DJZA 2RJFA 5GMKh 2XD0A 3H6ZA 5C0MA 4II1A 3QYHB 1YHQT 1VIEA 3S3OA 1YI2T 3M9QA 1M90U 4M7DD 2DD5A 2LQ8A 2R5MA 4N0AA 5IAYA 3INZA 2RHZA 4M7AG 1YJ9A 3CCRA 2DTOA 3LGFA 4Y91A 4HKEA 4OB2B 1I4K1 1U1TA 5FU6B 3C12A 3LLRA 3QKJA 5HK3A 5GANh 1W2BA 4E7KA 5FLXE 1VQ7A 1QVFA 4OB0B 1K73U 2C06A 4RCCA 2X4YA 4OGCA 4XTZA 5FU7C 3SDZA 3C95A 2DZCA 1KHCA 2QQ9A 4MDWA 4F7UF 3AHUA 3L42A 1YI2A 3G7ZA 5GAN3 4PKCC 3OW2A 4R55A 3OYJA 1YJ9T 3DLMA 3OMCA 1KQ2A 2HQXA 5CQXA 2YLBA 2P0QA 2QA4T 1I8FA 2F5TX 1Q7YC 2BKDN 3LW5E 3JCMb 4ATOA 2P0PA 3EAEA 4HA8A 1WJSA 1K9MC 3RUXA 3GP8A 3CBPA 3LGLA 3M55A 3OYEA 3KUFA 3JCMQ 3J7AF 1QVGS 2EKOA 2FVUA 1VQ5T 4XAXB 1W4SA 3S6WA 4MMKA 3TU4K 2VC8A 3CC7T 1JBMA 3CBOA 4N4HA 2DPPB 4QQGA 3OS5A 2HQEA 4NS5A 3J81E 5GANj 4FSXA 5GMKl 1I5LA 3HRUA 1KQ1A 4M77E 2QA4A 2EFIA 2M0OA 4PJOA 2RHYA 3URGA 1PSFA 4IUPA 4L6V5 3HSBA 2YRVA 5CO7A 1Q7YU 3JSCA 5A0DA 3PFSA 2EJGA 4Q5WA 2CZ0B 2DXUA 1BI0A 5D6YA 3A5ZB 4NL2A 2RK2A 1XTDA 5D6WA 2QEXT 1VQ5A 5GAN7 1X01A 2RHUA 1D3BB 1JJ2S 4C5HA 3WVEB 4CRIA 4XTUA 5LJ5j 3CC7A 2ZZDA 2CZ1B 1G3YA 4J6WA 4M75F 5LJ3h 1UGRB 3X24B 1NPRA 2DTIA 1X75C 3RMSA 2O01E 3R6OA 2DIQA 2ZPHB 4J83A 5FU7B 3M54A 5A0GA 1KD1U 2KDSA 2KMTA 3OYIA 3DB4A 3HFOA 3MEUA 2QQSA 1Q86C 5CR2A 2M1HA 1QW1A 4HCBA 2E5QA 2QEXA 2E65A 2RI3A 2CZ7B 2E6NA 1ZHIA 2XHCA 2I2LA 3FIFA 4XU1A 4LDVA 2X4JA 2WSCE 4RKUE 3L2WA 4C92D 1N8RU 4C8QA 4BDZA 5GAN2 4ZGDB 2EJFA 3FRNA 3RESA 1YJWT 3E9GA 3L2UA 2O4XB 2RK1A 3SFMA 4CI0C 2A7YA 2HBPA 2K3XA 3M4YA 4EPCA 3KXTA 2GF7A 1MGQA 3JB9G 3RIRA 4Y28E 5DM7R 2EAYA 3V8KA 2OAUA 3FJPA 1BI3A 3JCMg 3VU3C 4BI4A 4E7HA 2RH2A 4WF2A 4M77F 1GXIE 3KBGA 4J7FA 2XDDA 1KQSS 4IUVA 4R56A 3VJPA 5CKHA 3FLGA 2ZCFB 5KE2A 5J39A 4OMFB 3V7RA 3HP9A 3G6ET 3M56A 3FC3A 4DQ2A 4JS4A 4XTVA 5LL6S 3SD4A 1EIFA 3T9NA 2QDYB 1RI0A 2V8JA 3BDUA 3JB9J 3CMAA 1YJWA 2X4XA 4OB3B 3Q1JA 4XTWA 4DOVA 2KK4A 1N9SA 3OYKA 2HD0A 4M75B 2MWPA 5D6XA 3A8OB 3JCMe 2OTJA 2RJCA 4C92C 2E12A 2K5IA 5GAN6 3OYBA 4M7AF 3FB9A 3E19A 1W2BS 4XU2A 4EMKA 3HFNA 3MEVA 3QG1A 2KSSA 5GMKe 3G6EA 1G5VA 2RI2A 2DZ9A 2QI2A 3WXMB 2K57A 4C8QB 1QP3A 3OY9A 3CMAT 2K5LA 4BY6B 4F7UE 5GMKm 2GFAA 1BI1A 1O9SA 3GLXA 4GY5A 2E41A 2OTJT 2QXFA 5L8RE 4LDUA 1N27A 3CCST 3VUZA 4BE1A 2K4YA 3ME9A 4M7AE 4LD9K 1KC8C 1WJQA 3MEWA 1QVFS 4BE2A 4O6JA 3CCUT 1M1KC 3DLLA 3BY7A 3L2RA 4JS5A 4XTXA 4JJNK 4HCCA 4ZN3A 3NTKA 2D0QB 3CMEA 2DIGA 4M7DA 1R8OB 1FWZA 3M4GA 4ZGJB 5CAIA 1VQ9T 1NPPA 4E47A 4C5GA 1VQ6T 4JDSA 2DVEA 4RG2A 5GAN8 5DLQE 3PIPA 2PQWA 2QTXA 1BI2A 4C8QE 2V8KA 3CCSA 1U8RA 3QPHA 3ER0A 5GAMd 1FXXA 3DB3A 5CVIA 4LDXA 3ASKA 4A53A 1LNXA 2PU9B 3P8BB 3CCUA 2P4TA 3I55T 4OF1A 3CCQT 1MHNA 3M58A 3CMET 1UGPB 5CKFA 3UPUA 1LOJA 1K8AC 5J26A 1VQMT 4FL6A 3ZFJA 1VQ9A 2XK0A 4BD3A 2DKGA 4C0FA 3V8LA 5KCOA 4GLKA 1VQ6A 4FT2A 3CD6A 2RO0A 3NFCA 5LJ3f 4UC4A 5LJ5g 4PLLA 3V7SA 1VQNT 3OSSC 1VQ4T 3CC4A 4PJOB 4IUQA 3L2VA 3JB9I 3QXEB 4PJOD 3TEEA 2MI6A 5FRNA 2XICA 3HPWA 3UDCA 3SWNA 2MF2A 3JCMc 4E7IA 3JCMW 1O75A 3F70A 3L1AA 3LWHA 2M16A 4O5VA 4M77C 4X9CA 1M9SA 2KY9A 3I55A 3CCQA 4BE0A 4FU6A 2GCXA 4M78F 2Y90A 4C92F 1VQMA 3SB2A 4QQDA 1V29B 4IUTA 4X9DA 5A0LA 5C6SA 2JOYA 1Y96B 2Y4XA 2QQBA 4C5IA 5GANg 5LJ3e 3OYGA 4B9WA 2DAQA 4KT0E 2JN0A 3ZBDA 4C8QD 3A8LB 5CK9A 2F5KA 3OYFA 1Q81U 3CD6T 2YLCA 2ZPBB 1VQNA 1S72A 3CC4T 1VQ4A 3CBMA 3QZ9B 3V8JA 2XU8A 2WSFE 4Z02A 2LVMA 4RMOA 3V7CA 5KH6A 2VGMA 4A4FA 2RHXA 5CKEA 2LTOA 1UGQB 1YBYA 1NJIC 2HAXA 3OQ5A 2FHDA 2E64A 2RJDA 2PVGB 3OYDA 4A4HA 4FM4B 1WGSA 3OYCA 1ZQ1A 2XI9A 1DJ7B 1BIAA 4FIBA 4PLIA 4EMKC 4LD6A 1H641 2VXEA 4M77D 2QQAA 1IZ6A 1M1KU 1S72T 3CCVT 4M7DE 1HXDA 3QDRB 1KHIA 2JTFA 3M5AA 3QUIA 3QYGB 3NTIA 4A4KA 3M59A 4M75D 2EQUA 2PUOB 1BIBA 4XK8E 2L5QA 4KUDK 2RI5A 4C8QC 4BI3A 1M1GA 2BUDA 4C0DB 1X6OA 3VV0A 3HKSA 1KQSA 2CGHA 2BIVA 2L89A 5LJ5e 1YJNA 5I2MA 2E6ZA 3A8HB 1NE8A 4M7DG 2FL7A 2RB6A 2VV5A 2E70A 3RMQA 3GNGA 4J8OA 4EMGA 4BB7A 5I2SA 2KAFA 1FX7A 5GMKj 4M78A 3PMIA 3CCVA 3OYHA 1WQ7A 4IUUA 4M78G 1BKBA 2EIFA 4C92G 3G4ST 4OVAA 3OS0A 2VUBA 1WJRA 3JRZA 4HT9A 4V2SA 4M7AC 1QVPA 3CXCA 2FYKA 4QVZA 4MDXA 4HT8A 1M8VA 1IREB 1XQHA 4ELYC 3CPWS 5IT9E 2PUKB 3QO3A 1UB4A 1HK9A 2F69A 3CC2A 3M53A 1YJNT 2R58A 1LJOA 3CEYA 4ZTJA 3OSVA 4JUVA 3I56A 5I21A 2EWNA 3JB9H 3QJ6A 3GIBA 3P8DA 3RKYA 4QVDA 3CCMT 2K2VA 3BW1A 2OTLA 4MZPA 3PT9A 5FROA 1N9RA 2DD4A 3SWNC 2A3LA 4XU3A 3G4SA 2LT4A 4OP0A 4C0ZA 2HNIA 2XIDA 2P0KA 3QZ5B 4DOWA 5GAOp 2XG8D 1KD1C 3DKMA 3S3NA 3FEOA 2D9TA 2K5FA 1JRIA 4JRIA 2CS7A 2RA2A 2ZPIB 2ZGWA 1JJ2A 3X25B 3CC2T 1B34B 3CCLA 1BYMA 3I56T 3OBYA 5FRMA 1TH7A 2VYTA 4J6YA 5HY6A 3L2QA 5DLOA 1Q82U 3L2ZA 3CCMA 2LCLA 4M7AB 2OTLT 4M7DF 2DO3A 3A8GB 4C92B 2G3RA 3META 4VUBA 4DA4A 4PJOE 2LX9A 2E10A 2LRQA 3JAME 1UEBA 3MP8A 5GANd 3MHXA 4QQ6A 3X26B 3CXCS 2H3JA 1N6AA 3VKIA 1VUBA 3OYYA 5DY9A 2EJ9A 2XDBA 1KG1A 2GFUA 3CCLT 3HL8A 4F7UB 2JNGA 2MWOA 1WQWA 4IURA 4FT4A 5KCHA 3EFSA 3MCAB 2LQKA 5GANf 3E1SA 4N0AC 3QSUA 3JB9D 2WSEE 2LT1A 4RCBA 5KE3A 3JCMd 3SWNB 3LH0A 4M75E 1VQOT 4C92A 4JLIA 1Q82C 1VQLT 3CCEA 2KQWA 1D3BA 1K73C 5IN1A 4IKFA 2B8AA 4M78E 4P5NA 5LJ5d 1Y7XA 3LYIA 4XU0A 1OZ2A 4MZMA 4EMKB 4ZTFA 2DEQA 1NJIU 1U1SA 1VIFA 1OI1A 2LDMA 2X35A 3PNWC 4RG8A 4J7IA 2ZPEB 3QHSA 5CKDA 5A2QE 2VGNA 2DXTA 5GAOq 3J80E 1JB0E 4A4GA 5LJ5f 1Q81C 2DXBA 4M77G 5CIUA 3OYNA 2MMPA 2Y4YA 4ZGEB 3JCMJ 1VQOA 4M77A 1VQLA 3JCMP 2PVOB 4PJOG 1K9MU 1XNIA 3CCET 2EQMA 2RD1A 3NTHA 1AHJB 2YHTA 3QJYA 4L59A 1H3ZA 3C4SA 4TVRA 2EYQA 2RHIA 4KUIA 4NOYA 4L5GA 3TREA 2GQVA 5GAOm 2ZPGB 4C0DC 2JUFA 2DK3A 2L8DA 4J6XA 2IG0A 1VQKT 4EMHA 5GAMe 4A4EA 2JTMA 1VQ8A 4C8QF 4QVCA 3HHTB 1M1FA 5HKCA 4XQ3A 2WACA 5FU6C 1OYXA 3UT1A 2V8IA 4M78D 1NZ9A 3OYAA 4PJOC 3VYGA 2AHJB 3UWNA 1QVGA 4JRKA 2RJEA 1QP2A 4X34A 1Y07A 2ZPFB 4LDYA 3PIOA 1WNLA 4B9XA 4D6WA 1Q86U 3GPLA 2LNVA 3RKWA 3M57A 2LCCA 4OGEA 1G3SA 2O4XA 3OS1A 3C94A 3JCMh 3OS2A 4JRPA 3GOXA 2PVDB 1M5Q1 2CYZB 3CPWA 3MO8A 5GAOn 4NL3A 1VQKA 1WPYA 4J5YA 4KBMB 3CPFA 5GAOl 5GAN4 1VQ8T 2K3YA 4ZN1A 1M4ZA 3E9FA 2R5AA 2DXCA 4N4IA 3GNFB 3VYHB 5LJ3j 2QQRA 3H8ZA 4E7JA 1P92A 3QBYA 4E7LA 2RM4A 4LDWA 4EDUA 1YCYA 3PTAA 5GAMf 1OZ3A 2E1HA 1SSFA 3CCJT 1UGSB 3BDLA 4M7AA 3PGGA 1RL2A 4PNOA 2DTHA 3HRTA 3OB9A 4OB1B 4MZTA 4KULA 4QW2A 5EG2A 5GANe 4M78C 3MP6A 2M9UA 5CKBA 4PJOF 3GF5A 3G71A 3OMGA 4M77B 2IVWA 4XTYA 2L3RA 3OA6A 2XKOC 3LWIA 1N8RC 4M75G 5HK0A 1G3TA 3LX7A 4JLGA 4M7DC 1VQPT 3O8VA 5CCAA 2VXFA 5GAMj 3VUBA 3ZEHA 3MEAA 3X28B 4C8QG 4BY6C 4C0GA 3CCJA 3OYMA 2EQJA 3RKXA 5GAMg 3TCJA 2LC4A 5GMKi 2FB7A 3JCMf 5M9OA 1YITT 3JCMX 4BACA 1ZBXA 2JVVA 2JZ2A 3RERA 2CZ6B 3PMTA 3G71T 4YTLA 4BDYA 3P8HA 3EFRA 5GAOr 1YIJT 5LJ3d 1Y96A 3OYLA 3WVDB 4BUGA 3HRSA 4PL6A 4JRQA 4M7DB 4ME7A 1VQPA 1Y71A 4F7UG 2D6FA 2CKKA 4F7UA 4M75C 5GAMh
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A54 A;  5LJ3 e;  3JCM d;  4M7A D;  3SWN B;  4C92 D;  2JN0 A;  4M75 E;  4C8Q D;  4C92 A;  4JLI A;  4C8Q A;  4M78 B;  1D3B A;  2YLC A;  5GAN 2;  3JB9 F;  3BFM A;  2EJF A;  3RES A;  4C92 E;  5LJ3 g;  3V8J A;  4M78 E;  5LJ5 d;  4XU0 A;  4EMK B;  2DEQ A;  3V7C A;  1U1S A;  3JB9 G;  1MGQ A;  3JCM V;  3RIR A;  2E64 A;  2EAY A;  3QHS A;  1I81 A;  3V8K A;  3FJP A;  4MML A;  3JCM g;  5GAN 5;  3VU3 C;  2DXT A;  5GAO q;  4WF2 A;  4M77 F;  4M75 A;  5LJ5 h;  1BIA A;  5GMK h;  5LJ5 f;  4EMK C;  1B34 A;  2DJZ A;  4M77 G;  1H64 1;  3V7R A;  2VXE A;  3JCM J;  4M77 A;  3JCM P;  4M77 D;  4DQ2 A;  4XTV A;  4PJO G;  2RD1 A;  2YHT A;  3JB9 J;  4M7D D;  1HXD A;  3BDU A;  4M7D E;  3QUI A;  4N0A A;  4XTW A;  3INZ A;  4M7A G;  1N9S A;  4M75 D;  4NOY A;  2DTO A;  1BIB A;  4M75 B;  4Y91 A;  3JCM e;  1I4K 1;  4C92 C;  1U1T A;  4C8Q C;  5GAO m;  4J6X A;  5GAN 6;  4M7A F;  2CGH A;  4EMH A;  5GAM e;  5GAN h;  3FB9 A;  4C8Q F;  4QVC A;  5LJ5 e;  4XU2 A;  4M7D G;  4EMK A;  3HFN A;  2RB6 A;  5GMK e;  4RCC A;  4XTZ A;  4XQ3 A;  2DZ9 A;  2DZC A;  4EMG A;  4F7U F;  3AHU A;  4PJO C;  5GMK j;  4M78 D;  2K57 A;  4M78 A;  4C8Q B;  4JRK A;  5GAN 3;  1WQ7 A;  4M78 G;  4C92 G;  5GMK m;  4F7U E;  1WNL A;  3RKW A;  4HT9 A;  2E41 A;  1KQ2 A;  4V2S A;  4M7A C;  2YLB A;  3JCM h;  2FYK A;  1I8F A;  4HT8 A;  1M8V A;  1M5Q 1;  3JCM b;  4M7A E;  5GAO n;  4NL3 A;  1WPY A;  4J5Y A;  3QO3 A;  5GAO l;  1HK9 A;  5GAN 4;  4HA8 A;  1LJO A;  3BY7 A;  4XTX A;  3RUX A;  4JUV A;  5I21 A;  2EWN A;  5LJ3 j;  3JCM Q;  3JB9 H;  3GIB A;  3RKY A;  4M7D A;  4QVD A;  3M4G A;  4MMK A;  5CAI A;  2RM4 A;  3BW1 A;  2VC8 A;  1JBM A;  1N9R A;  1YCY A;  5GAM f;  3SWN C;  2E1H A;  4XU3 A;  5GAN j;  4OP0 A;  5GMK l;  2HNI A;  1I5L A;  2DVE A;  4M7A A;  5GAN 8;  3PGG A;  1KQ1 A;  4PNO A;  2DTH A;  5GAO p;  2QTX A;  4M77 E;  4PJO A;  4C8Q E;  5GAN e;  4M78 C;  4PJO F;  3HSB A;  5GAM d;  4M77 B;  4XTY A;  1JRI A;  4JRI A;  2RA2 A;  4XU1 A;  1LNX A;  2ZGW A;  4A53 A;  1B34 B;  2EJG A;  2DXU A;  4M75 G;  1TH7 A;  4J6Y A;  4NL2 A;  4M7D C;  1LOJ A;  3L2Z A;  5GAN 7;  1X01 A;  1D3B B;  4M7D F;  2VXF A;  2DKG A;  4M7A B;  3V8L A;  4XTU A;  4C92 B;  5LJ5 j;  5GAM j;  5GAM h;  4J6W A;  4M75 F;  5LJ3 h;  4C8Q G;  4PJO E;  2E10 A;  5LJ5 g;  5LJ3 f;  3RKX A;  5GAM g;  2DTI A;  3V7S A;  5GMK i;  2FB7 A;  5GAN d;  3JCM f;  4PJO B;  3JCM X;  3JB9 I;  4PJO D;  3RER A;  5DY9 A;  2EJ9 A;  3JCM W;  3SWN A;  3JCM c;  3EFR A;  5GAO r;  5LJ3 d;  3L1A A;  1Y96 A;  3HFO A;  4F7U B;  4M77 C;  4X9C A;  1WQW A;  3EFS A;  4M7D B;  4M78 F;  2Y90 A;  4F7U G;  4C92 F;  5GAN f;  2E65 A;  3SB2 A;  4N0A C;  4X9D A;  4F7U A;  3QSU A;  3JB9 D;  4M75 C;  1Y96 B;  3FIF A;  2I2L A;  4RCB A;  5GAN g; 
#chains in the Genus database with same CATH topology
 4A54 A;  1K8A U;  5AYF A;  1IGQ A;  2AKL A;  3S3M A;  1YHQ A;  1GL5 A;  5J3B A;  5LJ3 g;  4N4G A;  1KC8 U;  3AT1 B;  2ENM A;  2I0N A;  1I81 A;  2XDP A;  5FW9 A;  1VQ7 T;  4HCZ A;  5LJ5 h;  3H6Z A;  5C0M A;  4II1 A;  3S3O A;  3M9Q A;  5HCK A;  1NG2 A;  4N0A A;  3CCR A;  4E7Z A;  4HKE A;  1WXU A;  2CP6 A;  5FU6 B;  5FLX E;  2X4Y A;  4OGC A;  1B7T A;  4XTZ A;  5FU7 C;  3C95 A;  2QQ9 A;  3AHU A;  3ZL7 C;  1J3T A;  4PKC C;  1CSK A;  2GGR A;  3FJ5 A;  2YUQ A;  3OYJ A;  3OW2 A;  2E3I A;  1MNE A;  2P0Q A;  2QA4 T;  3M0U A;  3JCM b;  4HA8 A;  1WJS A;  3J7A F;  2EKO A;  1VQ5 T;  3TU4 K;  2YWW A;  1TSF A;  2VC8 A;  3CC7 T;  3CBO A;  3OS5 A;  2HQE A;  2Z0W A;  4M77 E;  4E7S A;  2CP2 A;  3HSB A;  4CC7 A;  1AWO A;  3PFS A;  3A5Z B;  2RK2 A;  2QEX T;  3SEM A;  1VQ5 A;  5GAN 7;  3M0P A;  2HL5 C;  3WVE B;  4CRI A;  1RAC B;  4J6W A;  4KGV B;  4M75 F;  5LJ3 h;  1UGR B;  2DTI A;  3RMS A;  2O01 E;  3CCR Q;  3M54 A;  5A0G A;  2KMT A;  2F2W A;  5CR2 A;  2QEX A;  1D0Y A;  2DLP A;  1ZHI A;  4LDV A;  4B6M A;  1TUD A;  4J9F A;  2YUN A;  1X27 A;  3RES A;  3E9G A;  1I0C A;  2J05 A;  2FO0 A;  3M4Y A;  4EPC A;  2LQN A;  6AT1 B;  3H41 A;  2CT4 A;  3M0S A;  1GFD A;  2BE9 B;  1GXI E;  2XDD A;  4IUV A;  2VB6 A;  2COZ A;  3VJP A;  3FLG A;  3G6E T;  3SD4 A;  3T9N A;  1BU1 A;  2V8J A;  3BDU A;  1YJW A;  3Q1J A;  4LN2 A;  1ZBJ A;  4M4Z A;  3QWX X;  1F1B B;  1IHW A;  1QCF A;  2LJ3 A;  1TUG B;  4AFS C;  5KYX A;  3MEV A;  2RPN A;  2RI2 A;  3I55 Q;  3OY9 A;  2K5L A;  2J7I A;  2GFA A;  4DBF A;  1VQ7 Q;  1UEC A;  5L8R E;  4WCI A;  5AT1 B;  3OW2 P;  1N27 A;  4PJJ A;  4BE1 A;  2K4Y A;  4BE2 A;  1M1K C;  2D0Q B;  1QKX A;  4FW2 A;  1VQ9 T;  2C0O A;  1WXB A;  1NPP A;  1QCN A;  5KYW A;  4JDS A;  2DVE A;  4RG2 A;  2RMO A;  2GBQ A;  1KC8 R;  4C8Q E;  3VS5 A;  3CCS A;  3BE3 A;  5GAM d;  1AD5 A;  5CVI A;  2D8J A;  1UGV A;  2P4T A;  2EYZ A;  5J26 A;  3LH5 A;  4BD3 A;  3V8L A;  2RF0 A;  4RUG A;  3D7S B;  4FT2 A;  5LJ3 f;  1VQP Q;  3OSS C;  1VQ4 T;  2L3S A;  1GFC A;  3L2V A;  3NHN A;  3RNJ A;  3JB9 I;  3TEE A;  1MMA A;  4E7I A;  1H8K A;  2MF2 A;  3JCM c;  4HXJ A;  3L1A A;  3JV3 A;  4M77 C;  1M9S A;  2DYI A;  4C92 F;  3CCJ Q;  1ABQ A;  1NLO C;  4C5I A;  2DAQ A;  1TUC A;  4KT0 E;  2EYY A;  3V8J A;  1YIT Q;  4Z02 A;  4D8K A;  2LVM A;  1FMV A;  4RMO A;  1RAG B;  3UF4 A;  1T3S A;  2HAX A;  2D1X A;  3CCV Q;  3OYC A;  1ZQ1 A;  1BIA A;  4FIB A;  1JU5 C;  2K2M A;  4J9E A;  1PHT A;  3M5A A;  2LNH B;  1M27 C;  2CP5 A;  4KUD K;  4AMC A;  3HKS A;  2X3W D;  2ROT A;  3A8H B;  2RB6 A;  2E70 A;  4BB7 A;  2X9H A;  3HTR A;  1GBQ A;  3EG9 B;  4M78 G;  4IUU A;  1EFN A;  3OS0 A;  3G4S T;  3JRZ A;  1WHL A;  1M8V A;  1IRE B;  3CPW S;  4FYX B;  1D09 B;  1AZE A;  1UB4 A;  2R58 A;  3OSV A;  4JUV A;  3QJ6 A;  3P8D A;  4QVD A;  3CCM T;  2PTK A;  1MUZ A;  1N9R A;  2DD4 A;  2X51 A;  2A3L A;  2LT4 A;  2D9T A;  4PJL A;  2C0T A;  1JRI A;  2CS7 A;  3CC2 T;  1JJ2 A;  4R0K A;  5FRM A;  1Q82 U;  2VYT A;  5HY6 A;  3CCM A;  2F2X A;  2KT8 A;  2G3R A;  1IRX A;  2E10 A;  3UA6 A;  1VQK Q;  1ZSZ B;  2EJ9 A;  1KG1 A;  3HL8 A;  2K9G A;  2YSQ A;  4DBR A;  2JNG A;  4IUR A;  1WQW A;  2FRW A;  1X69 A;  5GAN f;  4N0A C;  3QSU A;  3JB9 D;  3LH0 A;  2J6F A;  2KQW A;  1D3B A;  3CCE A;  2COY A;  5IN1 A;  3CPW P;  2CP0 A;  2GTJ A;  2P4R A;  4P5N A;  5LJ5 d;  4ZTF A;  3MPU B;  4EMK B;  1NJI U;  2DEQ A;  2LDM A;  1QLY A;  2X35 A;  3VRZ A;  1KIK A;  2ZPE B;  3QHS A;  3J80 E;  4A4G A;  2DXB A;  4ESR A;  1VQO A;  1RAH B;  1JJ2 P;  2PVO B;  3NTH A;  1AHJ B;  2YHT A;  1BK2 A;  2CSQ A;  2A0F B;  1K9A A;  2EYQ A;  5KYW B;  4KUI A;  4L5G A;  2D0N A;  2YT6 A;  4EMH A;  1SSH A;  1VQ6 Q;  1M1F A;  1I1J A;  2OI3 A;  4XQ3 A;  5KYU A;  3OYA A;  3VS4 A;  3UWN A;  2OX7 A;  4D6W A;  3M57 A;  2LCC A;  1G3S A;  2O4X A;  3TSW A;  1ACM B;  4QKU A;  3GOX A;  1M5Q 1;  2CYZ B;  3CPW A;  4KBM B;  3CPF A;  5GAN 4;  2K3Y A;  1M4Z A;  2R5A A;  1WHM A;  1D1A A;  3GNF B;  3VYH B;  3H8Z A;  2RM4 A;  4LDW A;  4EDU A;  1YCY A;  1Y0M A;  4M7A A;  2DRM A;  5EG2 A;  3OYG A;  5CKB A;  1YWO A;  2IVW A;  3OA6 A;  4GLM A;  2XKO C;  1OU9 A;  1TOV A;  1OEB A;  5HK0 A;  3G4S Q;  3LX7 A;  1AWW A;  4IIM A;  1ARK A;  3CC7 Q;  3O8V A;  2VXF A;  2FRY A;  3MEA A;  2CRE A;  4C8Q G;  4BY6 C;  2EQJ A;  1X6B A;  3CME Q;  1NM7 A;  5GJV B;  2EYX A;  5GMK i;  2FB7 A;  3JCM X;  1ZBX A;  2JVV A;  3G71 T;  1PRM C;  1M3C A;  3EFR A;  3P8H A;  3WVD B;  2MOX A;  4JRQ A;  1Y71 A;  4J9I A;  4F7U A;  1K73 R;  3OBW A;  4M7A D;  4DBH A;  1AVZ C;  1WX6 A;  3JB9 F;  3BFM A;  1Z9Q A;  5KYY B;  3OW2 S;  2JMA A;  3MP1 A;  1PD0 A;  4BI8 B;  3MKD A;  3A8M B;  3JCM V;  5GAN 5;  4MML A;  2EQK A;  3X20 B;  1YHQ Q;  4OMM A;  2R57 A;  1B34 A;  2DJZ A;  2XD0 A;  3QYH B;  1YHQ T;  1VIE A;  2J06 A;  2FPF A;  4M7A G;  1UJ0 A;  2QYZ A;  4Y91 A;  2LZ6 B;  1U1T A;  3QKJ A;  2C06 A;  1AT1 B;  2DZC A;  4MDW A;  2AKK A;  2JW4 A;  5IHK A;  2RQU A;  4KGZ B;  5KYY A;  1Q7Y C;  2KRO A;  2P0P A;  4RTV A;  5FWC A;  3RUX A;  3CBP A;  1LCK A;  3EGD B;  2EQI A;  2HL3 A;  4NS5 A;  5GMK l;  3HRU A;  2BTT A;  4Z8A A;  3A98 A;  2M0O A;  1GCQ C;  4PJO A;  1S1N A;  2RHY A;  1OU8 A;  1PSF A;  1K4U S;  5CO7 A;  3JSC A;  5A0D A;  2EJG A;  5D6W A;  1X01 A;  2H8H A;  2RHU A;  1JJ2 S;  5LJ5 j;  4DBQ A;  2ZZD A;  2CZ1 B;  1G3Y A;  1FMW A;  1X2K A;  2W10 A;  1NPR A;  1X75 C;  2JMC A;  3R6O A;  2K7A A;  1VYT A;  2KDS A;  2CH4 A;  1JXM A;  3HFO A;  1S72 Q;  2QQS A;  2JXB A;  1Q86 C;  4HCB A;  2E6N A;  2XHC A;  2I2L A;  3FIF A;  1Q82 R;  2A28 A;  1G2B A;  2X4J A;  4RKU E;  3G6E Q;  1SKU B;  1FYN A;  4C92 D;  2DVJ A;  4BDZ A;  8ATC B;  2EJF A;  3L2U A;  2O4X B;  3SFM A;  2RNA A;  2A7Y A;  2HBP A;  3JB9 G;  5DM7 R;  5D7U A;  3JCM g;  1RAA B;  2DL5 A;  3VU3 C;  2RH2 A;  4M77 F;  3KBG A;  4J7F A;  3EHR A;  5J39 A;  2ZCF B;  3FC3 A;  5ECA A;  3M0R A;  2QDY B;  3CMA A;  4OB3 B;  1N9S A;  3OYK A;  4M75 B;  5D6X A;  3A8O B;  2RJC A;  2K5I A;  4J9B A;  1LPL A;  2LCS A;  2QG9 B;  5GMK e;  1U3O A;  2PNI A;  3G6E A;  1SEM A;  1G5V A;  2ABL A;  1JXO A;  4BY6 B;  5GMK m;  1BI1 A;  4GY5 A;  4X1V A;  1PCX A;  2QXF A;  8AT1 B;  2L3P A;  2CUB A;  1KC8 C;  4O6J A;  2KR3 A;  1WHK A;  3BY7 A;  2QAZ A;  3DLL A;  4XTX A;  4JS5 A;  4ZN3 A;  3NTK A;  2O9S A;  2YUO A;  3M4G A;  2DIL A;  4E47 A;  4C5G A;  3U23 A;  1VQ6 T;  4Z89 A;  1GBR A;  3PIP A;  3TQ7 P;  1NYG A;  4K11 A;  1U8R A;  2GTO A;  3P8B B;  2IPO B;  4OMN A;  1G83 A;  4OF1 A;  3M58 A;  3UPU A;  1LOJ A;  1AZG B;  2B86 A;  4C0F A;  1BCM A;  3IQL A;  5LJ5 g;  3V7S A;  1VQN T;  3CC4 A;  4PJO D;  2CSI A;  3JCM W;  1O75 A;  2MIO A;  3LWH A;  3I55 A;  3CCQ A;  1VQM A;  3SB2 A;  1V29 B;  5A0L A;  2EPD A;  2JOY A;  4LUE A;  2JN0 A;  3ZBD A;  4C8Q D;  5CK9 A;  3OYF A;  2F5K A;  2ZPB B;  1S72 A;  3CC4 T;  4AFQ C;  2QGF B;  2WSF E;  2L0A A;  2RHX A;  2RN8 A;  1MMD A;  2LTO A;  1YJW Q;  2EVR A;  2DYB A;  4A4H A;  4FM4 B;  4CC4 B;  1DJ7 B;  1H64 1;  2A37 A;  2VXE A;  2RQW A;  4M77 D;  2QQA A;  1K76 A;  1S72 T;  3CCV T;  3QDR B;  3QYG B;  4M75 D;  2EQU A;  2PUO B;  4XK8 E;  1M1G A;  2BUD A;  1KQS A;  1N5Z A;  2CGH A;  1NE8 A;  1K8A R;  2FL7 A;  2VV5 A;  3GNG A;  1U5S A;  4WTO B;  4PFP A;  2FZG B;  2RQT A;  3EHQ A;  3PMI A;  3OYH A;  1PG5 B;  1BKB A;  2ESW A;  4C92 G;  4OVA A;  4V2S A;  4PK4 A;  1TG0 A;  1T0J A;  4QVZ A;  4MDX A;  4HT8 A;  3NPF A;  1XQH A;  3UA7 A;  3QO3 A;  1HSQ A;  1VQ4 Q;  1YJN T;  1LJO A;  3H0F A;  1PM3 A;  2EWN A;  1PKT A;  3GIB A;  1IO6 A;  1PNJ A;  4KH0 B;  3G4S A;  2JTE A;  2XG8 D;  3DKM A;  3FEO A;  4JRI A;  2ZPI B;  1AOJ A;  3H0I A;  1B34 B;  1RAB B;  2EGC A;  1TH7 A;  3E2U A;  5DLO A;  3L2Z A;  4M7D F;  2OTL T;  4M7A B;  2DO3 A;  3A8G B;  4VUB A;  4DA4 A;  1K0X A;  2F2V A;  2LRQ A;  3JAM E;  3CCU Q;  4Z88 A;  3CXC S;  4JPB W;  3OYY A;  5DY9 A;  4LXC A;  2XDB A;  1YP5 A;  3CCL T;  4F7U B;  2QA4 Q;  5KCH A;  2BZX A;  1SHF A;  2QEX Q;  2LT1 A;  5KE3 A;  3SWN B;  1YCS B;  4M75 E;  3CCM Q;  1VQO T;  4JLI A;  5KYU B;  2B8A A;  4M78 E;  3GBQ A;  1OI1 A;  1M2O A;  2NUP A;  1E7O A;  2GNC A;  4J7I A;  5CKD A;  2VGN A;  5GAO q;  2FG0 A;  5LJ5 f;  1VQO Q;  1C6V X;  2MMP A;  1CKA A;  4ZGE B;  1OOT A;  3JCM P;  1K9M U;  1XNI A;  2J6K A;  4QT7 A;  1H3Z A;  2J6O A;  3QJY A;  4L59 A;  1K1Z A;  4TVR A;  2RHI A;  1UHF A;  2ZPG B;  2JUF A;  4J6X A;  1VQK T;  3RBB B;  5FU6 C;  1OYX A;  2V8I A;  2AHJ B;  1EZZ B;  4X34 A;  1Y07 A;  1WNL A;  3GPL A;  2LNV A;  3RKW A;  1ABO A;  3OS2 A;  3C94 A;  4AFZ C;  1G8X A;  2LMJ A;  1VQK A;  5GAO l;  1VQ8 T;  1PRL C;  3MJX A;  4ZN1 A;  2CH4 W;  2AK5 A;  1P92 A;  3QBY A;  5GAM f;  1OZ3 A;  1FMK A;  3BDL A;  4RTY A;  2KXD A;  3OB9 A;  4MZT A;  5GAN e;  4PJO F;  4XTY A;  3LWI A;  3O5Z A;  1KJW A;  4M7D C;  2KT1 A;  5CCA A;  1M8M A;  3ZEH A;  1D1B A;  3CCJ A;  1QVF P;  2JS2 A;  1NEG A;  2EYW A;  4OMQ A;  1SG5 A;  1CKB A;  1Y96 A;  3OYL A;  4BUG A;  3HRS A;  1KK7 A;  2HKQ B;  4M7D B;  1VQP A;  4F7U G;  1Z9Z A;  4M75 C;  5IHI A;  4RTX A;  1OPL A;  1UFF A;  1VOM A;  4ELZ C;  1OX9 A;  1XOV A;  4Y92 A;  3CCR T;  1VYU A;  2KVQ G;  4J9G A;  5CQY A;  3N5B B;  2X4W A;  1PSE A;  1WLP B;  4M75 A;  1M90 C;  3QII A;  2RJF A;  1ZUK A;  1W1F A;  1BCO A;  1YI2 T;  1M90 U;  2DD5 A;  5GJW B;  2HCK A;  2LQ8 A;  5IAY A;  2RHZ A;  3LGF A;  4OB2 B;  1I4K 1;  2CT3 A;  2HBW A;  3C12 A;  3LLR A;  5GAN h;  1QVF A;  1VQ7 A;  4OB0 B;  1K73 U;  1X6G A;  4RCC A;  3SDZ A;  1KHC A;  1Q95 G;  4F7U F;  1YI2 A;  1SPK A;  2JM8 A;  3G7Z A;  5GAN 3;  9ATC B;  2DL4 A;  4PJN A;  2FZK B;  3DLM A;  5CQX A;  3LW5 E;  4ATO A;  2HSE B;  1QVG P;  3EAE A;  2DNU A;  1K9M C;  1QWF A;  5IH2 A;  2HKN A;  2V1R A;  3R6N A;  3JCM Q;  1QVG S;  2FVU A;  4XAX B;  4N4H A;  4ZNX A;  4QQG A;  3J81 E;  1MMG A;  4DEY A;  1I5L A;  2DBM A;  4AT1 B;  2EFI A;  3I56 Q;  3URG A;  4IUP A;  2NUP B;  3CCS Q;  1Q7Y U;  1GRI A;  2CZ0 B;  2DXU A;  1BI0 A;  5D6Y A;  4NL2 A;  4F14 A;  3CMA Q;  1LVK A;  1PWT A;  3REB B;  1ZSG A;  3X24 B;  4PFZ A;  1VQ8 Q;  2ZPH B;  3VS6 A;  1QQJ A;  4J83 A;  2LQW A;  1KD1 U;  2A36 A;  3OYI A;  3DB4 A;  3MEU A;  2EGE A;  2RI3 A;  3A1P A;  4XU1 A;  1ZUY A;  3L2W A;  5GAN 2;  1D0Z A;  1YJW T;  1WIE A;  4KRT A;  4CI0 C;  3KXT A;  3EG9 A;  3RIR A;  4JJB A;  2OAU A;  3FJP A;  1BI3 A;  2CDT A;  4E7H A;  4WF2 A;  4IIO A;  1KQS S;  5KE2 A;  4HVU A;  1NYF A;  4LUD A;  3HP9 A;  3M56 A;  4DQ2 A;  4JS4 A;  4XTV A;  1X2Q A;  1RI0 A;  3JB9 J;  2X4X A;  1QCO A;  1I07 A;  4XTW A;  2KK4 A;  3SHW A;  1NJI R;  2OTJ A;  4C92 C;  1VQN Q;  2E12 A;  4ANJ A;  5GAN 6;  3OYB A;  2M02 A;  1N8R R;  2ATC B;  3E19 A;  4XU2 A;  3HFN A;  3QG1 A;  2DZ9 A;  2LX7 A;  3WXM B;  4RTU A;  2K57 A;  1QP3 A;  4RTT A;  4F7U E;  5EC7 A;  1O9S A;  3CCL Q;  1VYV A;  2E41 A;  2OTJ T;  2SEM A;  4EIK A;  3CCS T;  3VUZ A;  3ME9 A;  4LD9 K;  3MEW A;  1Y57 A;  2FEI A;  1SRL A;  4HCC A;  3CME A;  2DER A;  4ZGJ B;  5CAI A;  1C0M A;  2JJ9 A;  3EGX A;  1MV3 A;  4CC3 A;  3EG2 A;  5DLQ E;  3ER0 A;  2C0I A;  3DB3 A;  4LDX A;  3ASK A;  3CQT A;  3CCU A;  2KNB B;  3I55 T;  2FZC B;  3CME T;  1UGP B;  5CKF A;  1K8A C;  2XK0 A;  4RTZ A;  2DKG A;  3RR6 A;  5L23 A;  4GLK A;  2YRD A;  2RO0 A;  3NFC A;  4UC4 A;  4PJO B;  4IUQ A;  3QXE B;  1EX4 A;  2MI6 A;  2XIC A;  3HPW A;  3UDC A;  1YFN A;  1B3Q A;  3F70 A;  2M16 A;  4O5V A;  4X9C A;  4BE0 A;  4FU6 A;  1JO8 A;  2Y90 A;  3EH1 A;  1OX8 A;  1Y96 B;  4B9W A;  3CD6 T;  3A8L B;  1VQ4 A;  3CBM A;  2DA9 A;  2XU8 A;  2X3X D;  5KH6 A;  4A4F A;  1NJI C;  1YBY A;  3OQ5 A;  2FHD A;  4HVV A;  3OYD A;  1VQ9 Q;  2XI9 A;  1WFW A;  4E6R A;  3PVL A;  4LD6 A;  4KH1 B;  4A63 B;  4FSS A;  4M7D E;  1HXD A;  1NBE B;  7AT1 B;  1H92 A;  4A4K A;  3M59 A;  1M2V B;  1BIB A;  2L5Q A;  2RI5 A;  2CUD A;  4C8Q C;  4BI3 A;  1M3B A;  1X6O A;  2L89 A;  2BIV A;  3RDV A;  2E6Z A;  5I11 A;  1WHJ A;  1JEG A;  1UG1 A;  4J8O A;  4EMG A;  3CCE Q;  5GMK j;  2K3B A;  2EIF A;  3EG0 A;  2VUB A;  1WJR A;  4HT9 A;  1T0H A;  1QVP A;  3CXC A;  2FYK A;  3ULR B;  5IT9 E;  2PUK B;  1HK9 A;  2HDA A;  3CEY A;  2MK5 A;  5I21 A;  3JB9 H;  1M3A A;  3RKY A;  2K2V A;  1RAI B;  3PT9 A;  4XU3 A;  3UAT A;  3QZ5 B;  1OPK A;  5I22 A;  5GAO p;  5FWB A;  2O2O A;  1MND A;  4FYV B;  1KD1 C;  3S3N A;  2EW3 A;  2K5F A;  1BBZ A;  2RA2 A;  1X43 A;  2ZGW A;  3X25 B;  3CCL A;  3I56 T;  3L2Q A;  1RI9 A;  2LCL A;  1MMN A;  1V76 A;  4C92 B;  3MET A;  3THK A;  2DJQ A;  3H0H A;  2YUP A;  1UEB A;  3MHX A;  4QQ6 A;  1N6A A;  3VKI A;  1VUB A;  1Q7Y R;  1Q86 R;  2OTJ Q;  1VA7 A;  3CXC P;  4PJM A;  5IXF A;  2WSE E;  2D8H A;  2O88 A;  2W0Z A;  3JCM d;  2JM9 A;  1K73 C;  2AZS A;  1MV0 B;  4IKF A;  3LYI A;  1OZ2 A;  1U1S A;  1VIF A;  4RG8 A;  1UTI A;  1IGU A;  1QMC A;  5KYN A;  2IIM A;  2DXT A;  1JB0 E;  3C0C A;  2QDL A;  2RQR A;  5CIU A;  2ZAE A;  3OYN A;  1VQM Q;  3JCM J;  1VQL A;  3CCQ Q;  3EGU A;  4PJO G;  3CCE T;  2RD1 A;  2EQM A;  2O31 A;  1E6H A;  2E5K A;  4JZ3 A;  2OJ2 A;  1M2V A;  4NOY A;  4JZ4 A;  1QWE A;  5GAO m;  4C0D C;  2BE7 D;  2IG0 A;  5GAM e;  2JTM A;  1VQ8 A;  1H3H A;  4J9H A;  2K79 A;  4OML A;  2DL7 A;  5HKC A;  2WAC A;  4RTW A;  4PJO C;  3UT1 A;  4M78 D;  1NZ9 A;  3VYG A;  1QVG A;  4JRK A;  2RJE A;  4LDY A;  3PIO A;  3EG3 A;  1Q86 U;  3OS1 A;  2NUT A;  1R0B G;  4JRP A;  2EBP A;  3MO8 A;  5GAO n;  1WPY A;  2DXC A;  4N4I A;  4FYY B;  4E7J A;  2AZV A;  3PTA A;  2BZY A;  4PNO A;  2DTH A;  2E4H A;  4OB1 B;  4J9C A;  4KUL A;  4QW2 A;  1OV3 A;  3QDF A;  3MP6 A;  1GCP A;  2M9U A;  3GF5 A;  3OMG A;  4M77 B;  1D1C A;  1WHH A;  4JLG A;  1WHG A;  4ORZ A;  1UJY A;  3X28 B;  1YIJ Q;  3OYM A;  3RKX A;  3TCJ A;  3JCM f;  5M9O A;  1YIT T;  4BAC A;  3RER A;  2CZ6 B;  3PMT A;  1V1C A;  4BDY A;  5GAO r;  5LJ3 d;  1R0C B;  4PL6 A;  4AFU C;  4ME7 A;  4F16 A;  2D6F A;  5GAM h;  4M78 B;  1RLQ C;  3FDR A;  1T3L A;  1G3W A;  2QGG A;  1YIT A;  4C92 E;  2VVK A;  2DET A;  1YIJ A;  2VAS A;  3M0T A;  2NLU A;  1UHC A;  4C5E A;  2H3E B;  2MAM A;  5GMK h;  1BYM A;  1IHV A;  4FYW B;  4M7D D;  2R5M A;  1HYO A;  3INZ A;  1YJ9 A;  2DTO A;  4AG1 C;  2HQH A;  3EFO B;  1W2B A;  5HK3 A;  4E7K A;  1OUL A;  4FCY A;  2OTL Q;  2KXC A;  4GBQ A;  1K9M R;  3L42 A;  4R55 A;  1YJ9 T;  3OMC A;  1KQ2 A;  1W70 A;  2HQX A;  2DEU A;  2YLB A;  1I8F A;  2F5T X;  3VS2 A;  2BKD N;  1UDL A;  3G1J A;  3GP8 A;  3LGL A;  4HVW A;  3M55 A;  3OYE A;  3KUF A;  1W4S A;  3S6W A;  4MMK A;  2KRM A;  1WI7 A;  1JBM A;  4D8D A;  2DPP B;  1ZA1 B;  5GAN j;  4FSX A;  3KFV A;  3I9Q A;  1KQ1 A;  2NUZ A;  2QA4 A;  2DE0 X;  4L6V 5;  2YRV A;  1K0S A;  4Q5W A;  1XTD A;  1HJD A;  1WDX A;  4PFO A;  1D3B B;  4C5H A;  4XTU A;  3CC7 A;  1ZSZ C;  2HMA A;  1E6G A;  2DIQ A;  1SF9 A;  2LJ0 A;  2QK0 A;  5FU7 B;  2AT1 B;  2HEQ A;  1KSW A;  2EKH A;  2M1H A;  1QW1 A;  2E5Q A;  2E65 A;  1PD1 A;  1QKW A;  2CZ7 B;  1B07 A;  2WSC E;  2MPX C;  1TU0 B;  1N8R U;  2FPD A;  4C8Q A;  4ZGD B;  3FRN A;  2RK1 A;  2HSP A;  2K3X A;  2GF7 A;  1MGQ A;  4Y28 E;  3TVT A;  1YN8 A;  2EAY A;  3V8K A;  4BI4 A;  3I5R A;  4R56 A;  5CKH A;  3EGX B;  4OMF B;  3V7R A;  2VWF A;  1YJN Q;  5LL6 S;  1EIF A;  2L2P A;  2O9V A;  3VS7 A;  1BB9 A;  4DOV A;  1RLP C;  2HD0 A;  2MWP A;  3JCM e;  2DBK A;  2ROL A;  2L3Q A;  4M7A F;  3FB9 A;  4EMK A;  2KSS A;  2QI2 A;  1RUW A;  3NGP A;  1PKS A;  4C8Q B;  2MCN A;  3CMA T;  1JQQ A;  2KEA A;  1KD1 R;  3GLX A;  2OAW A;  4LDU A;  3EFO A;  4M7A E;  2M51 A;  1WJQ A;  1QVF S;  3CCU T;  2LJ1 A;  1AWJ A;  3L2R A;  1UE9 A;  4JJN K;  1ZSZ A;  2M0Y A;  4LE9 A;  2DIG A;  2A08 A;  4M7D A;  1R8O B;  1FWZ A;  2K6D A;  1WA7 A;  1YWP A;  5GAN 8;  2PQW A;  1A0N B;  2QTX A;  1BI2 A;  1ZLM A;  2V8K A;  3QPH A;  1FXX A;  4A53 A;  1LNX A;  2PU9 B;  3G71 Q;  3CCQ T;  1MHN A;  2KGT A;  3TSZ A;  2NYS A;  1VQM T;  4FL6 A;  3ZFJ A;  1VQ9 A;  5KCO A;  1VQ6 A;  3CD6 A;  2DM1 A;  3VS1 A;  4PLL A;  2JS0 A;  1AWX A;  4F04 B;  5FRN A;  2KRN A;  3SWN A;  4JJC A;  2KY9 A;  2GCX A;  4M78 F;  4QQD A;  1TXQ A;  4IUT A;  4X9D A;  5C6S A;  2Y4X A;  2QQB A;  5GAN g;  5LJ3 e;  1Q81 U;  2YLC A;  2YRC A;  1VQN A;  1ZA2 B;  1NEB A;  3QZ9 B;  2DRK A;  2XMF A;  3V7C A;  3EG1 A;  2VGM A;  3VS0 A;  5CKE A;  1UGQ B;  2F1L A;  4CC2 A;  1M1K R;  2E64 A;  2RJD A;  2PVG B;  1M90 R;  4OMP A;  1WGS A;  2BZ8 A;  4PLI A;  4EMK C;  2KRS A;  3QWY A;  4JJD A;  2DFU A;  1IZ6 A;  1M1K U;  3QUI A;  1KHI A;  2JTF A;  3NTI A;  1IB8 A;  1TTH B;  1I5O B;  4DEX A;  4C0D B;  3VV0 A;  2DL8 A;  5IXB A;  1PC0 A;  3CC4 Q;  2NUT B;  5LJ5 e;  1Q81 R;  2MYS A;  5I2M A;  1YJN A;  4M7D G;  3RMQ A;  2LP5 A;  5I2S A;  2KAF A;  1FX7 A;  4M78 A;  2VKN A;  3CCV A;  3PVQ A;  2G6F X;  1WQ7 A;  4OMO A;  3PE0 A;  2YXY A;  1TS9 A;  4M7A C;  1HD3 A;  4ELY C;  2F69 A;  3CC2 A;  2SRC A;  3M53 A;  2PZ1 A;  4ZTJ A;  2P84 A;  3I56 A;  2COW A;  2JT4 A;  2CP7 A;  1WXT A;  3BW1 A;  2OTL A;  4MZP A;  5FRO A;  3NMZ C;  3SWN C;  1IXD A;  2V26 A;  4OP0 A;  4C0Z A;  2HNI A;  2XID A;  2P0K A;  4DOW A;  3REA B;  2DF6 A;  3VRY A;  4AG2 C;  3OBY A;  4J6Y A;  2EGA A;  4J9D A;  2DX1 A;  4FW1 A;  2V1Q A;  4PJO E;  2LX9 A;  3EH2 A;  3EGD A;  3MP8 A;  2QAS A;  5GAN d;  3VS3 A;  3X26 B;  2H3J A;  1YNZ A;  3CC2 Q;  2RQV A;  2ECZ A;  2GFU A;  1XJW B;  1C1A A;  4KGX B;  2MWO A;  2KE9 A;  4FT4 A;  1D0X A;  1GCQ A;  3EFS A;  3MCA B;  2GQI A;  2LQK A;  1RAE B;  3E1S A;  2AIR B;  4RCB A;  2ED0 A;  1WZO A;  1VQL T;  1Q82 C;  4C92 A;  1W6X A;  4HCK A;  2QTV A;  1Y7X A;  4XU0 A;  4MZM A;  5KYX B;  2HZY A;  3PNW C;  1ZUU A;  5A2Q E;  3I35 A;  1VQL Q;  1Q81 C;  4M77 G;  1SHG A;  2Y4Y A;  2DMO A;  4M77 A;  3M0Q A;  2KYM A;  2YDL A;  1R77 A;  2CP3 A;  3C4S A;  1UUE A;  2KYB A;  3TRE A;  2GQV A;  1YJ9 Q;  1RAD B;  2KBT A;  2DK3 A;  2L8D A;  4A4E A;  4C8Q F;  4QVC A;  1RAF B;  1SRM A;  3HHT B;  4E2F B;  3I5S A;  1OQK A;  2DL3 A;  1QP2 A;  2ZPF B;  4B9X A;  4OGE A;  1KQS P;  3JCM h;  2PVD B;  4NL3 A;  4J5Y A;  1YI2 Q;  4F17 A;  3E9F A;  5IHN A;  5LJ3 j;  2QQR A;  4E7L A;  1TWB A;  2NWM A;  3CD6 Q;  1W2B P;  2E1H A;  1SSF A;  2FPE A;  3CCJ T;  1UGS B;  3PGG A;  1RL2 A;  2ED1 A;  3HRT A;  1W2B S;  1AEY A;  4M78 C;  3G71 A;  1ZX6 A;  2L3R A;  1N8R C;  4M75 G;  3H9N A;  1G3T A;  1VQP T;  1KFZ A;  5GAM j;  1VQ5 Q;  3VUB A;  2KI7 A;  1U06 A;  4C0G A;  4LNP A;  5GAM g;  2LC4 A;  2JZ2 A;  4YTL A;  1M30 A;  1YIJ T;  1NLP C;  1WYX A;  2E3H A;  2CKK A; 
#chains in the Genus database with same CATH homology
 3OBW A;  4A54 A;  1K8A U;  4M7A D;  5AYF A;  4M78 B;  3S3M A;  4ELZ C;  1YHQ A;  3JB9 F;  3FDR A;  3BFM A;  1G3W A;  5J3B A;  1YIT A;  1XOV A;  3OW2 S;  4C92 E;  5LJ3 g;  4N4G A;  3MP1 A;  1KC8 U;  3CCR T;  4BI8 B;  3A8M B;  1YIJ A;  3JCM V;  2KVQ G;  5CQY A;  3N5B B;  2X4W A;  2NLU A;  1PSE A;  1I81 A;  2XDP A;  4MML A;  2EQK A;  5GAN 5;  1VQ7 T;  3X20 B;  4M75 A;  4HCZ A;  5LJ5 h;  1M90 C;  3QII A;  4C5E A;  2MAM A;  2R57 A;  1B34 A;  2DJZ A;  2RJF A;  5GMK h;  2XD0 A;  3H6Z A;  5C0M A;  4II1 A;  3QYH B;  1YHQ T;  1VIE A;  3S3O A;  1YI2 T;  3M9Q A;  1M90 U;  4M7D D;  2DD5 A;  2LQ8 A;  2R5M A;  4N0A A;  5IAY A;  3INZ A;  2RHZ A;  4M7A G;  1YJ9 A;  3CCR A;  2DTO A;  3LGF A;  4Y91 A;  4HKE A;  4OB2 B;  1I4K 1;  1U1T A;  5FU6 B;  3C12 A;  3LLR A;  3QKJ A;  5HK3 A;  5GAN h;  1W2B A;  4E7K A;  5FLX E;  1VQ7 A;  1QVF A;  4OB0 B;  1K73 U;  2C06 A;  4RCC A;  2X4Y A;  4OGC A;  4XTZ A;  5FU7 C;  3SDZ A;  3C95 A;  2DZC A;  1KHC A;  2QQ9 A;  4MDW A;  4F7U F;  3AHU A;  3L42 A;  1YI2 A;  3G7Z A;  5GAN 3;  4PKC C;  3OW2 A;  4R55 A;  3OYJ A;  1YJ9 T;  3DLM A;  3OMC A;  1KQ2 A;  2HQX A;  5CQX A;  2YLB A;  2P0Q A;  2QA4 T;  1I8F A;  2F5T X;  1Q7Y C;  2BKD N;  3LW5 E;  3JCM b;  4ATO A;  2P0P A;  3EAE A;  4HA8 A;  1WJS A;  1K9M C;  3RUX A;  3GP8 A;  3CBP A;  3LGL A;  3M55 A;  3OYE A;  3KUF A;  3JCM Q;  3J7A F;  1QVG S;  2EKO A;  2FVU A;  1VQ5 T;  4XAX B;  1W4S A;  3S6W A;  4MMK A;  3TU4 K;  2VC8 A;  3CC7 T;  1JBM A;  3CBO A;  4N4H A;  2DPP B;  4QQG A;  3OS5 A;  2HQE A;  4NS5 A;  3J81 E;  5GAN j;  4FSX A;  5GMK l;  1I5L A;  3HRU A;  1KQ1 A;  4M77 E;  2QA4 A;  2EFI A;  2M0O A;  4PJO A;  2RHY A;  3URG A;  1PSF A;  4IUP A;  4L6V 5;  3HSB A;  2YRV A;  5CO7 A;  1Q7Y U;  3JSC A;  5A0D A;  3PFS A;  2EJG A;  4Q5W A;  2CZ0 B;  2DXU A;  1BI0 A;  5D6Y A;  3A5Z B;  4NL2 A;  2RK2 A;  1XTD A;  5D6W A;  2QEX T;  1VQ5 A;  5GAN 7;  1X01 A;  2RHU A;  1D3B B;  1JJ2 S;  4C5H A;  3WVE B;  4CRI A;  4XTU A;  5LJ5 j;  3CC7 A;  2ZZD A;  2CZ1 B;  1G3Y A;  4J6W A;  4M75 F;  5LJ3 h;  1UGR B;  3X24 B;  1NPR A;  2DTI A;  1X75 C;  3RMS A;  2O01 E;  3R6O A;  2DIQ A;  2ZPH B;  4J83 A;  5FU7 B;  3M54 A;  5A0G A;  1KD1 U;  2KDS A;  2KMT A;  3OYI A;  3DB4 A;  3HFO A;  3MEU A;  2QQS A;  1Q86 C;  5CR2 A;  2M1H A;  1QW1 A;  4HCB A;  2E5Q A;  2QEX A;  2E65 A;  2RI3 A;  2CZ7 B;  2E6N A;  1ZHI A;  2XHC A;  2I2L A;  3FIF A;  4XU1 A;  4LDV A;  2X4J A;  2WSC E;  4RKU E;  3L2W A;  4C92 D;  1N8R U;  4C8Q A;  4BDZ A;  5GAN 2;  4ZGD B;  2EJF A;  3FRN A;  3RES A;  1YJW T;  3E9G A;  3L2U A;  2O4X B;  2RK1 A;  3SFM A;  4CI0 C;  2A7Y A;  2HBP A;  2K3X A;  3M4Y A;  4EPC A;  3KXT A;  2GF7 A;  1MGQ A;  3JB9 G;  3RIR A;  4Y28 E;  5DM7 R;  2EAY A;  3V8K A;  2OAU A;  3FJP A;  1BI3 A;  3JCM g;  3VU3 C;  4BI4 A;  4E7H A;  2RH2 A;  4WF2 A;  4M77 F;  1GXI E;  3KBG A;  4J7F A;  2XDD A;  1KQS S;  4IUV A;  4R56 A;  3VJP A;  5CKH A;  3FLG A;  2ZCF B;  5KE2 A;  5J39 A;  4OMF B;  3V7R A;  3HP9 A;  3G6E T;  3M56 A;  3FC3 A;  4DQ2 A;  4JS4 A;  4XTV A;  5LL6 S;  3SD4 A;  1EIF A;  3T9N A;  2QDY B;  1RI0 A;  2V8J A;  3BDU A;  3JB9 J;  3CMA A;  1YJW A;  2X4X A;  4OB3 B;  3Q1J A;  4XTW A;  4DOV A;  2KK4 A;  1N9S A;  3OYK A;  2HD0 A;  4M75 B;  2MWP A;  5D6X A;  3A8O B;  3JCM e;  2OTJ A;  2RJC A;  4C92 C;  2E12 A;  2K5I A;  5GAN 6;  3OYB A;  4M7A F;  3FB9 A;  3E19 A;  1W2B S;  4XU2 A;  4EMK A;  3HFN A;  3MEV A;  3QG1 A;  2KSS A;  5GMK e;  3G6E A;  1G5V A;  2RI2 A;  2DZ9 A;  2QI2 A;  3WXM B;  2K57 A;  4C8Q B;  1QP3 A;  3OY9 A;  3CMA T;  2K5L A;  4BY6 B;  4F7U E;  5GMK m;  2GFA A;  1BI1 A;  1O9S A;  3GLX A;  4GY5 A;  2E41 A;  2OTJ T;  2QXF A;  5L8R E;  4LDU A;  1N27 A;  3CCS T;  3VUZ A;  4BE1 A;  2K4Y A;  3ME9 A;  4M7A E;  4LD9 K;  1KC8 C;  1WJQ A;  3MEW A;  1QVF S;  4BE2 A;  4O6J A;  3CCU T;  1M1K C;  3DLL A;  3BY7 A;  3L2R A;  4JS5 A;  4XTX A;  4JJN K;  4HCC A;  4ZN3 A;  3NTK A;  2D0Q B;  3CME A;  2DIG A;  4M7D A;  1R8O B;  1FWZ A;  3M4G A;  4ZGJ B;  5CAI A;  1VQ9 T;  1NPP A;  4E47 A;  4C5G A;  1VQ6 T;  4JDS A;  2DVE A;  4RG2 A;  5GAN 8;  5DLQ E;  3PIP A;  2PQW A;  2QTX A;  1BI2 A;  4C8Q E;  2V8K A;  3CCS A;  1U8R A;  3QPH A;  3ER0 A;  5GAM d;  1FXX A;  3DB3 A;  5CVI A;  4LDX A;  3ASK A;  4A53 A;  1LNX A;  2PU9 B;  3P8B B;  3CCU A;  2P4T A;  3I55 T;  4OF1 A;  3CCQ T;  1MHN A;  3M58 A;  3CME T;  1UGP B;  5CKF A;  3UPU A;  1LOJ A;  1K8A C;  5J26 A;  1VQM T;  4FL6 A;  3ZFJ A;  1VQ9 A;  2XK0 A;  4BD3 A;  2DKG A;  4C0F A;  3V8L A;  5KCO A;  4GLK A;  1VQ6 A;  4FT2 A;  3CD6 A;  2RO0 A;  3NFC A;  5LJ3 f;  4UC4 A;  5LJ5 g;  4PLL A;  3V7S A;  1VQN T;  3OSS C;  1VQ4 T;  3CC4 A;  4PJO B;  4IUQ A;  3L2V A;  3JB9 I;  3QXE B;  4PJO D;  3TEE A;  2MI6 A;  5FRN A;  2XIC A;  3HPW A;  3UDC A;  3SWN A;  2MF2 A;  3JCM c;  4E7I A;  3JCM W;  1O75 A;  3F70 A;  3L1A A;  3LWH A;  2M16 A;  4O5V A;  4M77 C;  4X9C A;  1M9S A;  2KY9 A;  3I55 A;  3CCQ A;  4BE0 A;  4FU6 A;  2GCX A;  4M78 F;  2Y90 A;  4C92 F;  1VQM A;  3SB2 A;  4QQD A;  1V29 B;  4IUT A;  4X9D A;  5A0L A;  5C6S A;  2JOY A;  1Y96 B;  2Y4X A;  2QQB A;  4C5I A;  5GAN g;  5LJ3 e;  3OYG A;  4B9W A;  2DAQ A;  4KT0 E;  2JN0 A;  3ZBD A;  4C8Q D;  3A8L B;  5CK9 A;  2F5K A;  3OYF A;  1Q81 U;  3CD6 T;  2YLC A;  2ZPB B;  1VQN A;  1S72 A;  3CC4 T;  1VQ4 A;  3CBM A;  3QZ9 B;  3V8J A;  2XU8 A;  2WSF E;  4Z02 A;  2LVM A;  4RMO A;  3V7C A;  5KH6 A;  2VGM A;  4A4F A;  2RHX A;  5CKE A;  2LTO A;  1UGQ B;  1YBY A;  1NJI C;  2HAX A;  3OQ5 A;  2FHD A;  2E64 A;  2RJD A;  2PVG B;  3OYD A;  4A4H A;  4FM4 B;  1WGS A;  3OYC A;  1ZQ1 A;  2XI9 A;  1DJ7 B;  1BIA A;  4FIB A;  4PLI A;  4EMK C;  4LD6 A;  1H64 1;  2VXE A;  4M77 D;  2QQA A;  1IZ6 A;  1M1K U;  1S72 T;  3CCV T;  4M7D E;  1HXD A;  3QDR B;  1KHI A;  2JTF A;  3M5A A;  3QUI A;  3QYG B;  3NTI A;  4A4K A;  3M59 A;  4M75 D;  2EQU A;  2PUO B;  1BIB A;  4XK8 E;  2L5Q A;  4KUD K;  2RI5 A;  4C8Q C;  4BI3 A;  1M1G A;  2BUD A;  4C0D B;  1X6O A;  3VV0 A;  3HKS A;  1KQS A;  2CGH A;  2BIV A;  2L89 A;  5LJ5 e;  1YJN A;  5I2M A;  2E6Z A;  3A8H B;  1NE8 A;  4M7D G;  2FL7 A;  2RB6 A;  2VV5 A;  2E70 A;  3RMQ A;  3GNG A;  4J8O A;  4EMG A;  4BB7 A;  5I2S A;  2KAF A;  1FX7 A;  5GMK j;  4M78 A;  3PMI A;  3CCV A;  3OYH A;  1WQ7 A;  4IUU A;  4M78 G;  1BKB A;  2EIF A;  4C92 G;  3G4S T;  4OVA A;  3OS0 A;  2VUB A;  1WJR A;  3JRZ A;  4HT9 A;  4V2S A;  4M7A C;  1QVP A;  3CXC A;  2FYK A;  4QVZ A;  4MDX A;  4HT8 A;  1M8V A;  1IRE B;  1XQH A;  4ELY C;  3CPW S;  5IT9 E;  2PUK B;  3QO3 A;  1UB4 A;  1HK9 A;  2F69 A;  3CC2 A;  3M53 A;  1YJN T;  2R58 A;  1LJO A;  3CEY A;  4ZTJ A;  3OSV A;  4JUV A;  3I56 A;  5I21 A;  2EWN A;  3JB9 H;  3QJ6 A;  3GIB A;  3P8D A;  3RKY A;  4QVD A;  3CCM T;  2K2V A;  3BW1 A;  2OTL A;  4MZP A;  3PT9 A;  5FRO A;  1N9R A;  2DD4 A;  3SWN C;  2A3L A;  4XU3 A;  3G4S A;  2LT4 A;  4OP0 A;  4C0Z A;  2HNI A;  2XID A;  2P0K A;  3QZ5 B;  4DOW A;  5GAO p;  2XG8 D;  1KD1 C;  3DKM A;  3S3N A;  3FEO A;  2D9T A;  2K5F A;  1JRI A;  4JRI A;  2CS7 A;  2RA2 A;  2ZPI B;  2ZGW A;  1JJ2 A;  3X25 B;  3CC2 T;  1B34 B;  3CCL A;  1BYM A;  3I56 T;  3OBY A;  5FRM A;  1TH7 A;  2VYT A;  4J6Y A;  5HY6 A;  3L2Q A;  5DLO A;  1Q82 U;  3L2Z A;  3CCM A;  2LCL A;  4M7A B;  2OTL T;  4M7D F;  2DO3 A;  3A8G B;  4C92 B;  2G3R A;  3MET A;  4VUB A;  4DA4 A;  4PJO E;  2LX9 A;  2E10 A;  2LRQ A;  3JAM E;  1UEB A;  3MP8 A;  5GAN d;  3MHX A;  4QQ6 A;  3X26 B;  3CXC S;  2H3J A;  1N6A A;  3VKI A;  1VUB A;  3OYY A;  5DY9 A;  2EJ9 A;  2XDB A;  1KG1 A;  2GFU A;  3CCL T;  3HL8 A;  4F7U B;  2JNG A;  2MWO A;  1WQW A;  4IUR A;  4FT4 A;  5KCH A;  3EFS A;  3MCA B;  2LQK A;  5GAN f;  3E1S A;  4N0A C;  3QSU A;  3JB9 D;  2WSE E;  2LT1 A;  4RCB A;  5KE3 A;  3JCM d;  3SWN B;  3LH0 A;  4M75 E;  1VQO T;  4C92 A;  4JLI A;  1Q82 C;  1VQL T;  3CCE A;  2KQW A;  1D3B A;  1K73 C;  5IN1 A;  4IKF A;  2B8A A;  4M78 E;  4P5N A;  5LJ5 d;  1Y7X A;  3LYI A;  4XU0 A;  1OZ2 A;  4MZM A;  4EMK B;  4ZTF A;  2DEQ A;  1NJI U;  1U1S A;  1VIF A;  1OI1 A;  2LDM A;  2X35 A;  3PNW C;  4RG8 A;  4J7I A;  2ZPE B;  3QHS A;  5CKD A;  5A2Q E;  2VGN A;  2DXT A;  5GAO q;  3J80 E;  1JB0 E;  4A4G A;  5LJ5 f;  1Q81 C;  2DXB A;  4M77 G;  5CIU A;  3OYN A;  2MMP A;  2Y4Y A;  4ZGE B;  3JCM J;  1VQO A;  4M77 A;  1VQL A;  3JCM P;  2PVO B;  4PJO G;  1K9M U;  1XNI A;  3CCE T;  2EQM A;  2RD1 A;  3NTH A;  1AHJ B;  2YHT A;  3QJY A;  4L59 A;  1H3Z A;  3C4S A;  4TVR A;  2EYQ A;  2RHI A;  4KUI A;  4NOY A;  4L5G A;  3TRE A;  2GQV A;  5GAO m;  2ZPG B;  4C0D C;  2JUF A;  2DK3 A;  2L8D A;  4J6X A;  2IG0 A;  1VQK T;  4EMH A;  5GAM e;  4A4E A;  2JTM A;  1VQ8 A;  4C8Q F;  4QVC A;  3HHT B;  1M1F A;  5HKC A;  4XQ3 A;  2WAC A;  5FU6 C;  1OYX A;  3UT1 A;  2V8I A;  4M78 D;  1NZ9 A;  3OYA A;  4PJO C;  3VYG A;  2AHJ B;  3UWN A;  1QVG A;  4JRK A;  2RJE A;  1QP2 A;  4X34 A;  1Y07 A;  2ZPF B;  4LDY A;  3PIO A;  1WNL A;  4B9X A;  4D6W A;  1Q86 U;  3GPL A;  2LNV A;  3RKW A;  3M57 A;  2LCC A;  4OGE A;  1G3S A;  2O4X A;  3OS1 A;  3C94 A;  3JCM h;  3OS2 A;  4JRP A;  3GOX A;  2PVD B;  1M5Q 1;  2CYZ B;  3CPW A;  3MO8 A;  5GAO n;  4NL3 A;  1VQK A;  1WPY A;  4J5Y A;  4KBM B;  3CPF A;  5GAO l;  5GAN 4;  1VQ8 T;  2K3Y A;  4ZN1 A;  1M4Z A;  3E9F A;  2R5A A;  2DXC A;  4N4I A;  3GNF B;  3VYH B;  5LJ3 j;  2QQR A;  3H8Z A;  4E7J A;  1P92 A;  3QBY A;  4E7L A;  2RM4 A;  4LDW A;  4EDU A;  1YCY A;  3PTA A;  5GAM f;  1OZ3 A;  2E1H A;  1SSF A;  3CCJ T;  1UGS B;  3BDL A;  4M7A A;  3PGG A;  1RL2 A;  4PNO A;  2DTH A;  3HRT A;  3OB9 A;  4OB1 B;  4MZT A;  4KUL A;  4QW2 A;  5EG2 A;  5GAN e;  4M78 C;  3MP6 A;  2M9U A;  5CKB A;  4PJO F;  3GF5 A;  3G71 A;  3OMG A;  4M77 B;  2IVW A;  4XTY A;  2L3R A;  3OA6 A;  2XKO C;  3LWI A;  1N8R C;  4M75 G;  5HK0 A;  1G3T A;  3LX7 A;  4JLG A;  4M7D C;  1VQP T;  3O8V A;  5CCA A;  2VXF A;  5GAM j;  3VUB A;  3ZEH A;  3MEA A;  3X28 B;  4C8Q G;  4BY6 C;  4C0G A;  3CCJ A;  3OYM A;  2EQJ A;  3RKX A;  5GAM g;  3TCJ A;  2LC4 A;  5GMK i;  2FB7 A;  3JCM f;  5M9O A;  1YIT T;  3JCM X;  4BAC A;  1ZBX A;  2JVV A;  2JZ2 A;  3RER A;  2CZ6 B;  3PMT A;  3G71 T;  4YTL A;  4BDY A;  3P8H A;  3EFR A;  5GAO r;  1YIJ T;  5LJ3 d;  1Y96 A;  3OYL A;  3WVD B;  4BUG A;  3HRS A;  4PL6 A;  4JRQ A;  4M7D B;  4ME7 A;  1VQP A;  1Y71 A;  4F7U G;  2D6F A;  2CKK A;  4F7U A;  4M75 C;  5GAM h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...