4X9DA

High-resolution structure of hfq from methanococcus jannaschii in complex with ump
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
NFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
molecule keywords Uncharacterized protein MJ1435
total genus 10
structure length 56
sequence length 56
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x9dA00
2FB7A 5GMKl 4M7DB 2DTHA 4PJOF 4A53A 4XTUA 3JCMb 1TH7A 2EJGA 4N0AC 5GAN6 3JCMg 3FB9A 4C92D 4QVCA 5GAOl 4HT8A 4F7UF 2E1HA 3JB9G 2RA2A 3PGGA 3QHSA 4JLIA 3SWNB 4C8QB 5GAMf 5GAMd 4C92A 5LJ3j 5I21A 5DY9A 4X9CA 4M7DF 5LJ3e 4M77C 4PJOB 4M7AF 4PJOE 3QO3A 3QUIA 2FYKA 4M75F 3JCMh 4M77D 2DZCA 4M78C 4NOYA 4F7UB 5LJ5g 1U1TA 4F7UE 3JCMe 1D3BB 4M75C 4XQ3A 4XU0A 3RESA 4C8QF 2HNIA 5GAOr 2DKGA 3L2ZA 4C92E 3HFOA 4C92B 2E10A 3RKYA 5GANh 4M75D 4PNOA 4M7AB 4PJOA 5GAN3 4M75B 4M7AD 1M8VA 4DQ2A 5GANf 1WNLA 2RB6A 4F7UA 1N9RA 2E41A 4M7AC 1D3BA 2E64A 4MMLA 1KQ2A 3V8JA 5LJ5j 3EFRA 4C92F 1JRIA 4JRIA 4HA8A 5GMKj 4M7DA 1WPYA 4M7AA 5GAN2 1BIBA 3JCMP 1YCYA 3INZA 5GAOq 3V7SA 4WF2A 2CGHA 1JBMA 3V8KA 5GAOp 2Y90A 4XU3A 1I8FA 3JB9D 3JCMJ 3SWNA 4C8QA 4NL3A 3RKXA 2YHTA 4M77G 3JB9H 2JN0A 3EFSA 4JRKA 1M5Q1 3M4GA 4RCCA 3SB2A 5GAN5 2VXEA 2YLCA 5GAN4 5GAOn 3SWNC 4J6WA 4M75G 3JCMc 4C8QC 5LJ5d 4EMHA 1LOJA 1U1SA 3JCMV 1LNXA 3V8LA 3JCMQ 5LJ3d 4C8QE 5GAOm 2DJZA 5GAMg 4OP0A 2YLBA 2I2LA 1BIAA 4M7DD 2QTXA 4M78F 4J5YA 5GMKm 5CAIA 1WQ7A 2EWNA 5GANd 4MMKA 3FIFA 4PJOG 2DTOA 5GAMh 4M77E 4RCBA 2ZGWA 3JCMf 4M7DC 2DEQA 4V2SA 4M7AE 3GIBA 4F7UG 1WQWA 2DTIA 4M78B 4M78E 2RD1A 3JCMd 2DXTA 2EJFA 3BY7A 3V7RA 4EMKC 5LJ5e 1KQ1A 3RIRA 4C92C 4Y91A 1B34A 4XTYA 1I4K1 3VU3C 4M77A 2DXUA 3JCMW 1MGQA 4J6XA 2EJ9A 3BDUA 4X9DA 5LJ5h 1Y96A 4NL2A 5LJ3h 4M78A 5GMKh 4JUVA 4A54A 5GANe 1I81A 3BW1A 5GANg 3JB9F 4M78D 5GAMe 5GAN8 3L1AA 1H641 4C92G 4QVDA 5GMKi 5LJ5f 1I5LA 4HT9A 4M7AG 1HXDA 4EMKB 4M78G 4J6YA 3FJPA 5GANj 3HSBA 4XTVA 3RKWA 4N0AA 5GAN7 4XTWA 4XU1A 3AHUA 4C8QD 4M7DG 2E65A 5GMKe 3V7CA 5LJ3g 4M75E 4M77F 2VXFA 4XTZA 3RUXA 3JB9I 2DZ9A 4EMKA 3JCMX 1X01A 4C8QG 4XU2A 3QSUA 3RERA 3JB9J 2K57A 1B34B 4M7DE 1N9SA 2DVEA 4M77B 4M75A 4PJOC 5LJ3f 2VC8A 2EAYA 5GAMj 3BFMA 4EMGA 1Y96B 4PJOD 2RM4A 1LJOA 4XTXA 3HFNA 1HK9A
chains in the Genus database with same CATH superfamily
2ROTA 1IB8A 2BIVA 1TH7A 3EGDA 4KULA 2A0FB 2DL5A 2FO0A 1M9SA 3CCJT 4C8QB 5I2SA 4JS4A 1UECA 1K8AU 4M7DF 4M77C 4J83A 5GJVB 2BE7D 3FLGA 3UA7A 5LJ5g 3A8OB 1RLQC 3OYJA 1V76A 3CCLA 3MEVA 4IIOA 1TXQA 1JXMA 1M8VA 2ZPGB 3CC7T 2AT1B 2RB6A 2LCLA 3CMEQ 2EQKA 3NGPA 2DIGA 1WPYA 4WF2A 1R77A 1JBMA 1RI0A 3ASKA 2QQSA 1X69A 2M9UA 2KROA 2K5FA 1AWJA 3UATA 2QG9B 2V26A 4R56A 5GAOm 5J26A 3G71T 3L2VA 4A4FA 4ESRA 2L3SA 5CVIA 1BU1A 2RHIA 1KFZA 5CQXA 1VQLA 2VASA 1Q95G 1ZUKA 1YHQA 4C0GA 3GIBA 3WVDB 3OYFA 4DA4A 1VQOA 3TREA 2DXUA 2RQVA 1XQHA 1SHGA 4JUVA 1C6VX 1I81A 3SD4A 2COWA 5CKHA 1BB9A 1ZSGA 2JJ9A 4EMKB 3HSBA 1NEBA 4C8QD 2CUDA 3GP8A 2QGGA 5FWCA 5CKEA 1W2BA 1UFFA 3HRSA 2FZCB 2SRCA 5HK0A 2VGNA 4J9CA 1WHGA 1D1BA 1HK9A 1H3HA 2FPDA 2PU9B 2CSQA 4X1VA 1XOVA 5I22A 2CYZB 4PKCC 3QZ9B 2RA2A 1QVGS 2YUOA 3OSVA 2W0ZA 1AOJA 4DOWA 4BACA 5KYNA 4RTWA 3JCMh 3OYDA 5FRMA 1D3BB 1N5ZA 4JS5A 4C92B 2HCKA 1YJNQ 2JW4A 4XK8E 1H8KA 4RTUA 4MZPA 4LE9A 4IUVA 4N4HA 2ZPBB 4E6RA 1PRMC 4FL6A 2XD0A 5DM7R 3V8KA 4K11A 3O5ZA 2QEXA 2A7YA 4JDSA 1BI0A 2X9HA 4OMQA 2WSEE 3V8LA 3DLLA 3JCMQ 2KT1A 4OP0A 2DBMA 3I55A 2EQIA 3X25B 1BK2A 1WQ7A 3VV0A 3L42A 1YIJT 1RAFB 3SEMA 1M1KC 4M7DC 1OPLA 2DTIA 3TQ7P 2QA4A 1KQ1A 2RK1A 5IHNA 2Y4XA 4C92C 2EKHA 2K4YA 1NJIC 2HMAA 1TWBA 4X9DA 1QW1A 5GMKh 4QW2A 1VQLQ 4ELYC 2PVOB 1N8RC 4IURA 2QQ9A 3OYHA 4KH0B 4XU1A 2EKOA 1YJWA 4XTZA 1W1FA 2AKLA 2DZ9A 1WXUA 5I2MA 3MKDA 4EPCA 5CKBA 1JJ2A 4J8OA 1VQ7Q 3M4YA 3I55T 2GTOA 1D1AA 3RNJA 2E5QA 2VGMA 3O8VA 5GAMj 4EMGA 2MIOA 4M7DD 1WHLA 1MMGA 3HFNA 4OMPA 2V8IA 3QIIA 2FB7A 5GMKl 3CXCA 3CPWA 4A63B 4C92D 2D6FA 1VQ9T 3PGGA 5GAMf 2CT4A 1VQ5T 5GAMd 2X35A 3QDFA 4FSSA 4C92A 4X9CA 4AMCA 2RI3A 2XKOC 1ZA2B 3A8HB 2XICA 4M77D 3UA6A 4F7UE 2E3IA 2G3RA 2D0NA 3ZFJA 2DKGA 3UF4A 3RKYA 2CP2A 4FM4B 1VQ6A 1A0NB 2LZ6B 3EFRA 2KYBA 4C5GA 4HA8A 1IO6A 1D0ZA 2PUOB 2DJQA 3CCQA 2NUTB 2X4JA 3M4GA 1SRLA 5IXBA 3SWNC 4J6WA 3OS1A 1NYFA 2O9VA 3JCMV 1RUWA 4JJCA 1XJWB 2OTJQ 2ED1A 1RAHB 3CCUA 1BIAA 3E19A 2XDPA 3M0QA 1M90R 4M78F 4PL6A 5HKCA 1V29B 3TVTA 2ZGWA 3C94A 4L59A 2KR3A 1SPKA 4M78B 3HP9A 3R6OA 1ZBXA 3E2UA 1Z9QA 1YWOA 4Y91A 4LDWA 2RJDA 1AWWA 1OULA 3PT9A 2KRMA 2IG0A 1RLPC 2EW3A 5A0LA 1KQSP 5GAMe 3CCVA 4C92G 5LJ5f 2RNAA 4M7AG 1SSFA 1W6XA 4HVVA 4HVWA 2RI2A 2VWFA 3CCSA 4N0AA 1UG1A 5GJWB 2ENMA 5LJ3g 4M75E 2RO0A 1YHQT 2YRVA 3EG1A 1YJWQ 1EX4A 2YUPA 2CT3A 2L2PA 1Y96B 1XTDA 3L2QA 2IIMA 1BCMA 5KE3A 1I1JA 3OYIA 1KIKA 3H0HA 3FB9A 1NJIU 4BUGA 1SF9A 2YDLA 2ATCB 2DETA 1H3ZA 3RESA 1YBYA 1K8AR 2BZYA 1YCSB 3GLXA 2RJEA 2MWOA 4HCKA 2EGAA 3CXCS 4AFSC 1I0CA 4C92F 1X2QA 5FU7B 1YJ9Q 1U5SA 3LWHA 3I56T 4NL3A 8ATCB 5FWBA 4DBHA 1E7OA 1Y07A 1WHHA 1LNXA 1NLPC 3QWYA 3ULRB 3G71A 4BDYA 3CCSQ 4OB3B 1M27C 4IUTA 3QPHA 2LX9A 1Y7XA 2OJ2A 1GL5A 3CC4T 1QCNA 2KRSA 4KGVB 3P8HA 1ACMB 1AZGB 2RN8A 3CCLQ 3RIRA 2R57A 4XTYA 4BI8B 1JB0E 1LPLA 1Q7YU 3E9FA 2NUTA 2LJ3A 2P0QA 1W4SA 4MDWA 4ZTFA 1SG5A 3MEAA 2F2VA 7AT1B 1AVZC 1K1ZA 1NEGA 4QVDA 2R5MA 3CC7Q 3MCAB 1VQKT 2O9SA 3C0CA 1WHKA 1KC8U 2E65A 3G6EQ 2VXFA 3PIOA 2NUPA 1VQNQ 3EG9B 2GTJA 5DLQE 1GBRA 4FYWB 3RERA 3JB9J 2K57A 3UDCA 2M16A 3VKIA 1WIEA 3M9QA 2HL5C 1VQNT 1PSFA 3DB4A 3BE3A 1NE8A 3EGXB 3FDRA 3L2RA 5DY9A 1S72Q 1MUZA 2J06A 3HHTB 1K9MC 1UGRB 3EG9A 4F7UB 1AEYA 4PJOA 5KYYB 4M75B 3OYMA 1VQKA 1IGUA 1WNLA 1YI2Q 2M51A 1QQJA 2JS0A 1JQQA 4FW2A 2C0OA 1WZOA 2ROLA 3EGXA 2KT8A 3OW2S 3SWNA 3T9NA 2K2MA 2YHTA 3PMIA 2JMCA 1VQ5A 4J9GA 2LTOA 1YITT 2BZ8A 3MP1A 3CMAA 3QKJA 3PMTA 2YLBA 5IN1A 5HK3A 1PM3A 1M90C 1HYOA 4P5NA 1MHNA 3FIFA 2EGCA 2KXDA 5ECAA 1FMWA 4O5VA 2XK0A 3META 2RPNA 4HCZA 1VYTA 3J7AF 4EMKC 3CMAQ 2K3BA 1I4K1 2RMOA 1I5OB 2E12A 4LUEA 1C0MA 4QQDA 2LRQA 2QYZA 1KC8C 2M02A 3N5BB 3HTRA 4Z88A 3LWIA 1PRLC 4JJBA 1WFWA 2OTLT 2KK4A 1X6GA 3GNFB 4PFOA 1QP2A 2XHCA 3M0PA 2G6FX 2VC8A 4RTYA 1AD5A 3VS3A 1Q81U 3X28B 2DBKA 2DTHA 2DNUA 3VYGA 2K2VA 1QVFA 1RAGB 3JB9G 3REAB 3NPFA 2IVWA 3CCST 3QUIA 4NOYA 4XU0A 3A8GB 4R0KA 2PNIA 4M7AB 2WSCE 3MHXA 5LL6S 2GQVA 5D7UA 1YJ9T 1KQ2A 3U23A 2OTLA 3H41A 1YP5A 4JRIA 4II1A 3AT1B 3VUZA 3EG2A 3QJYA 2JTMA 3H8ZA 2OTJT 4AFQC 2QASA 1X6OA 3CBOA 1K9AA 2CSIA 1BYMA 4C5EA 1HD3A 3H0IA 1M2VB 1ZHIA 3VS5A 2CZ0B 4DBRA 2FEIA 3VS2A 3IQLA 4KH1B 1P92A 3KUFA 3RBBB 3NHNA 1KQSS 4CC2A 2CP3A 1TU0B 1NM7A 3BY7A 4JRQA 1Q82R 3LYIA 1VQOQ 5IH2A 3M54A 2M0OA 3GPLA 1TG0A 1I5LA 1AWOA 4LDXA 1YIJQ 3CD6A 4J6YA 4F17A 1U8RA 3PTAA 2DVJA 4QQ6A 2XG8D 1GCQC 5GMKe 2VYTA 2DL4A 3MO8A 2E4HA 3RUXA 2DXCA 4PJLA 5CK9A 2JUFA 2D1XA 1B34B 2DVEA 3I9QA 2CP6A 3OW2P 4F14A 1CKAA 2C0IA 3FEOA 1M8MA 2KNBB 3JAME 3VS1A 4E7HA 4LN2A 4DEYA 2E1HA 1ZA1B 4J9IA 2FG0A 1VQ6Q 4XAXB 1K9MR 2FVUA 2LCSA 3TSZA 3L2WA 2CH4A 4C92E 2M1HA 5KCHA 2A08A 1U3OA 3DKMA 4M7AC 2P84A 1PNJA 2ZPHB 1QVPA 2OX7A 2H8HA 2QEXT 5GAOq 4PFZA 2Y90A 3JB9D 2JXBA 3NTKA 4NS5A 5CQYA 3ME9A 1M5Q1 1LVKA 3WXMB 2GCXA 5KYUA 1NJIR 2CZ1B 2GFUA 4C8QE 1S72A 2DERA 3MPUB 2ZAEA 2E3HA 4D8DA 2ABLA 1G2BA 4KUIA 1WJSA 4E2FB 1JXOA 2EPDA 4J9BA 2GQIA 1AHJB 1FMKA 4OB2B 3EG3A 2QAZA 3CCUQ 2B8AA 3TEEA 2HQXA 3LW5E 4AFUC 2DFUA 2AZSA 4J6XA 3OYGA 2MF2A 2BZXA 1Y96A 4MZMA 2CKKA 4LNPA 4E47A 4E7SA 1KC8R 1M30A 4PK4A 4MDXA 1UJYA 2KXCA 4FYXB 1VYUA 1C1AA 4GLKA 3GF5A 4B9WA 4M7DG 4ZGEB 5CO7A 1WHJA 5IHKA 2HSPA 2V8JA 2LQ8A 1GFCA 4ZGDB 2FZKB 5KYWA 1Z9ZA 2RH2A 1WYXA 2HKNA 4M75A 1M1FA 2MK5A 2HBPA 4WCIA 2X4WA 1SRMA 2HZYA 3C12A 2YRDA 3OYKA 3CEYA 2K5IA 1UUEA 1K73R 2DE0X 1BCOA 2O01E 3S6WA 4JLIA 5I21A 2DYBA 3OS5A 4BY6C 4GBQA 3OY9A 1YJNA 3QO3A 1VQ5Q 1VQ9Q 4RUGA 5KCOA 5GAOr 1KHIA 2HQEA 3C4SA 2EYZA 1PKTA 4ANJA 3CCJQ 1E6GA 1ZLMA 5LJ5j 1G3TA 2ESWA 4M7AA 3NMZC 5GAN2 1QKXA 4LUDA 1PKSA 2COZA 5GAOp 3JCMJ 2CH4W 3RKXA 2Y4YA 4CC7A 2JN0A 2YUQA 4FT2A 2VXEA 4M75G 4EMHA 1WXTA 2K9GA 2RQWA 3SDZA 1M4ZA 2I0NA 1K0SA 5GAMg 1OPKA 3X24B 2NWMA 4VUBA 2I2LA 4C0DC 2LP5A 2FPFA 2QXFA 2DK3A 2W10A 2ZCFB 5AYFA 4RCBA 4B6MA 1K9MU 1M3AA 1OV3A 3I5RA 4EDUA 3VRZA 2LQNA 1UGQB 1OX8A 2NLUA 4BI4A 2RQTA 3URGA 4R55A 1LCKA 1OZ3A 4A4GA 2LJ0A 3CXCP 2SEMA 3OBWA 4HXJA 1G3WA 3LGFA 2MYSA 1VQ8T 3ZL7C 1UJ0A 4RKUE 5IT9E 3F70A 1YITA 2YSQA 1IHVA 2AKKA 1V1CA 2KBTA 2DIQA 3MJXA 1LJOA 2RHXA 4CC3A 5CR2A 3HKSA 1N8RU 2JS2A 3VS6A 1M1KU 4F16A 2VV5A 3SWNB 4E7KA 3G71Q 1ZSZB 4JLGA 1ABOA 1PD1A 2PZ1A 3I5SA 3CCQT 3LGLA 3CPWS 1U1TA 3OBYA 4C8QF 1D1CA 1PSEA 1IGQA 3HFOA 5C6SA 1ZQ1A 4PNOA 5GAN3 1PHTA 1YJ9A 1JO8A 3LH5A 2BUDA 1N9RA 1WX6A 3EH1A 4OMOA 1VYVA 2DMOA 2KGTA 4L6V5 3INZA 1QP3A 3V7SA 1VQPQ 2CGHA 3G7ZA 4PJNA 2YXYA 2V1RA 1ZSZA 3JB9H 1VQMT 1NLOC 1D0YA 1E6HA 3OYCA 2DYIA 1K8AC 4Y92A 4FSXA 1SSHA 2XU8A 3JRZA 2QTXA 3H6ZA 5GMKm 2LMJA 4ZNXA 2AK5A 4RTTA 2EWNA 2YT6A 2DTOA 2LJ1A 3VUBA 1PC0A 5IAYA 2CREA 4LXCA 4A4HA 3CC4Q 2RHYA 2HDAA 1AZEA 3JCMd 4J9DA 2EJFA 4Z02A 2MI6A 2LDMA 1B34A 3HL8A 1YJWT 1JJ2P 3X20B 6AT1B 4M4ZA 1XNIA 3R6NA 5GANe 1MNDA 2CDTA 2AIRB 2LT1A 5D6YA 2L0AA 2ZZDA 1KG1A 3FJPA 2F5KA 2ECZA 2DPPB 2MMPA 1BI1A 4IUPA 3CMEA 1VQ7A 5J39A 2CP5A 4AG1C 2EBPA 2JM8A 2OI3A 4PLIA 2F69A 3S3OA 5CKDA 3PE0A 4OGCA 4AG2C 5A2QE 2HQHA 2DRMA 2QA4Q 4PJOD 4XTXA 3P8DA 2K7AA 1VQ4Q 1VQ6T 3JCMb 3OQ5A 3TSWA 4HT8A 3ZEHA 5L23A 3I55Q 3PNWC 4BI3A 3RR6A 4PJOB 1G3YA 3OYYA 4OVAA 1WI7A 4GLMA 2DEUA 4ZN3A 1KHCA 2C0TA 3CCQQ 3L2ZA 2RHZA 1KQSA 2LC4A 1YHQQ 3G4SQ 1VQLT 1VQ4A 1UTIA 1TS9A 2LNVA 3UPUA 5IHIA 2L3RA 4B9XA 1QCOA 2KMTA 3TCJA 3EFSA 5J3BA 4RCCA 1Q81R 3CMAT 2WACA 2EYXA 1LOJA 2EQJA 3CC2Q 1H92A 3KFVA 4KRTA 4DBFA 4ZGJB 2RQRA 2KRNA 1MV3A 1FXXA 4BE1A 2DEQA 4QQGA 3C95A 4M7AE 2O2OA 4RMOA 3CC2A 2DAQA 3GBQA 2J05A 4LD6A 2EYQA 2MAMA 1GFDA 3JCMW 5CKFA 4CRIA 2EJ9A 4E7LA 4E7IA 4JPBW 4KBMB 3M0SA 2A37A 3ER0A 2QQBA 2K3YA 1IRXA 4Z89A 1H641 2NUPB 1TUCA 4QT7A 4HT9A 1W70A 3G4SA 4J9EA 3UT1A 5GANj 4XTVA 3M57A 1QLYA 1ARKA 4M77F 1AWXA 3EH2A 3JCMX 2GGRA 3P8BB 1Q86R 4OGEA 3EAEA 1JEGA 1GRIA 2KEAA 1YFNA 3EGDB 1OEBA 1QVGP 1PWTA 1UDLA 4BE0A 2ED0A 3MP8A 5CCAA 1JU5C 4OF1A 3LX7A 4JJNK 4IUQA 4RG2A 1M90U 4M7DB 2BTTA 2EJGA 4N0AC 1B3QA 4BY6B 2QDYB 5GAOl 4F7UF 1Q7YR 2EYYA 5D6WA 2EFIA 1GBQA 4PJOE 1UHFA 3OMCA 5KYUB 5CIUA 1Y71A 4M78C 3CBPA 1ZBJA 3A98A 3I35A 2QEXQ 4WTOB 3PVLA 3DB3A 3M5AA 1D0XA 4J9HA 2PVDB 5GANf 1BI2A 2E41A 2E64A 2J7IA 1X43A 3V8JA 4M7DA 3TU4K 1QVFP 3SFMA 3MEUA 4M77G 1Q82C 4EIKA 4C8QC 4ZN1A 2OAUA 5LJ3d 3OYLA 3HRUA 1IHWA 2L3PA 1W2BS 2GF7A 3KXTA 3HPWA 4Q5WA 5CAIA 4MMKA 3D7SB 4HCCA 5FRNA 4ELZC 3CCRQ 1M3BA 4F7UG 4M78E 5FU6B 2X3WD 2PUKB 3VU3C 5EC7A 3CCEA 2LVMA 5KYXA 1MNEA 2QGFB 2JM9A 1VQPA 4JZ3A 3UWNA 4UC4A 3OYBA 3G6ET 1BI3A 5GANg 3JB9F 1N6AA 1VOMA 3OYAA 1S72T 3QJ6A 2RJCA 2PVGB 5FU6C 1RAEB 2JMAA 1RL2A 5FROA 1NPRA 1I07A 2JNGA 4FCYA 1YJNT 2GFAA 4QKUA 2X51A 2EAYA 1PG5B 2ZPIB 4HCBA 1OX9A 2V8KA 2CP7A 2E5KA 3THKA 1K73U 4A53A 2J6FA 2KI7A 2EQMA 2YWWA 1Y0MA 5GAN6 4QVCA 4O6JA 3DLMA 3QHSA 3CD6T 5LJ3j 1X6BA 2JZ2A 3EGUA 1Q82U 2IPOB 3H0FA 4M75C 2DILA 3BDLA 4FU6A 4IIMA 1J3TA 4BDZA 4C0FA 5GANh 5KYWB 5C0MA 1QWFA 4D8KA 2C06A 3QBYA 1VQNA 2DD5A 3CCLT 5A0DA 1T0JA 1QWEA 3QDRB 3S3NA 2Z0WA 4MMLA 1B07A 3EFOB 1FYNA 1TTHB 5KE2A 1UGSB 3Q1JA 1BIBA 2EYWA 4C5IA 4JRPA 2DLPA 1EFNA 1PCXA 1OU8A 3OA6A 3M58A 4N4GA 4LDYA 2VB6A 5FU7C 2DD4A 4BE2A 1IXDA 4C0ZA 3M55A 4KGZB 2QK0A 1KD1U 1D09B 2H3JA 3A1PA 2D0QB 4M77E 2DXBA 3JCMf 3CCEQ 2QQRA 1NPPA 3CCRT 4JJDA 3BDUA 3CCRA 2DF6A 3OW2A 2HL3A 2QI2A 2HD0A 2GNCA 4OMFB 4OMNA 1OQKA 4M78D 3L1AA 3I56Q 2RK2A 2F1LA 1YIJA 4PFPA 1HXDA 2RQUA 3KBGA 2R58A 2XMFA 4M78G 4OMMA 3CCJA 1K73C 3RDVA 3VRYA 3M0TA 2L89A 2RI5A 1KK7A 1BKBA 3JB9I 3VS7A 1TUDA 1GCPA 4XU2A 2P0PA 1SHFA 1MMNA 4KUDK 1QCFA 4FYYB 1TUGB 3NTIA 4DOVA 2X4YA 3M56A 1ZUYA 2MOXA 4XTUA 3MEWA 1VA7A 3PIPA 1MMAA 2ZPFB 3JCMg 2WSFE 1FWZA 4Y28E 1UHCA 2EIFA 2FRYA 4C5HA 3RMSA 4A4KA 2FYKA 1TSFA 2RJFA 2HKQB 3CCMT 2EQUA 1FMVA 4PJJA 4BB7A 1QVGA 3PVQA 4M7AD 1SKUB 2J6OA 2R5AA 5FLXE 1VUBA 2H3EB 2JVVA 2LQKA 1DJ7B 5GMKj 3OYNA 5A0GA 1YCYA 3QZ5B 2FPEA 2JOYA 4C8QA 2KVQG 3CCMQ 5GAOn 1G3SA 2F2XA 1KSWA 4RTZA 2VKNA 3PFSA 2HEQA 3EG0A 1ZX6A 2CZ7B 2DO3A 1MV0B 4LD9K 2HBWA 1UGPB 5GAMh 1F1BB 2L3QA 4J7IA 2DL3A 2VVKA 2DL8A 2DA9A 1T3SA 1M2VA 1JJ2S 3V7RA 2OTJA 2LT4A 4OMLA 4HVUA 2CUBA 1WJRA 3VS4A 2FL7A 2X3XD 3QWXX 4E7JA 2LCCA 4M78A 2JTFA 3M0RA 3BW1A 2K79A 1OOTA 1R0BG 5GAN8 4TVRA 4A4EA 2QTVA 2VUBA 3OB9A 3CBMA 3CC7A 2NYSA 3FRNA 2XI9A 1T0HA 1YNZA 1M1GA 1VQMA 1RABB 1YITQ 3QSUA 4CC4B 2V1QA 1NBEB 3OS0A 1M2OA 1QKWA 4RTVA 4Z8AA 4PJOC 4ZTJA 5IXFA 2P4TA 5GAN5 1N8RR 4PJOF 1KD1C 1G5VA 1GXIE 3REBB 3LH0A 1GCQA 4M7AF 2KAFA 2HAXA 3FJ5A 2O31A 8AT1B 3EHQA 3QYHB 3OYEA 4XQ3A 3CCUT 2HNIA 4M75D 3RMQA 3EHRA 3VJPA 4FIBA 2FHDA 2X4XA 2B86A 3NTHA 3E9GA 3QG1A 1NG2A 2CP0A 4XU3A 1O75A 2QQAA 2RF0A 3SB2A 4JRKA 3L2UA 4RG8A 1NYGA 2OAWA 5L8RE 5LJ5d 2MWPA 3S3MA 4AT1B 4PJMA 4ME7A 2A36A 5D6XA 1QMCA 1CSKA 5KYYA 4FT4A 4J5YA 1HSQA 3VYHB 4FW1A 1NZ9A 3OMGA 4PJOG 1M1KR 2KE9A 2NUZA 2F5TX 1YI2T 1VQ9A 4OB1B 3CCET 3J80E 2XDDA 4OB0B 3HRTA 1MGQA 2BKDN 4RTXA 4NL2A 9ATCB 1WXBA 4A54A 4ATOA 3OS2A 3OSSC 1VQMQ 1M3CA 4DBQA 4AFZC 1VQ4T 5GMKi 2QA4T 4LDVA 3JSCA 3LLRA 5DLOA 3CCVQ 5KH6A 1BBZA 2BE9B 1Q86C 1X01A 3CC2T 3A8LB 2AZVA 1UE9A 5EG2A 1UB4A 2KSSA 5AT1B 4IUUA 3BFMA 1WDXA 2YRCA 1KJWA 1OI1A 5I11A 3CD6Q 4YTLA 1YI2A 2CS7A 2DM1A 3I56A 1Q7YC 1VQKQ 1EZZB 3G4ST 3MP6A 3NFCA 1UEBA 3CPWP 4M75F 2DZCA 3JCMe 4KGXB 3QXEB 2DRKA 1EIFA 2LQWA 2MCNA 4F7UA 1SEMA 1IZ6A 3CCVT 4MZTA 3JCMP 1RACB 1WA7A 1WLPB 2E6NA 3ZBDA 1I8FA 1QVFS 4N4IA 4DEXA 1ABQA 1VQ8Q 5GAN4 4M7DE 2YLCA 1YN8A 3QYGB 4FYVB 1U1SA 3J81E 1W2BP 4CI0C 2KQWA 5HY6A 1RAIB 3M59A 5GANd 4J9FA 3WVEB 1K76A 2PTKA 2EVRA 4V2SA 1K0XA 1ZUUA 2EGEA 2E6ZA 3CMET 4JZ4A 2DXTA 2COYA 2JTEA 1Q81C 1VQ8A 2DX1A 1G8XA 1VQOT 4J7FA 2KYMA 5LJ3h 2O88A 4E7ZA 1X27A 2A28A 1CKBA 4X34A 2A3LA 2K5LA 1G83A 3FC3A 2K6DA 5GAN7 4XTWA 3AHUA 2D8HA 1WJQA 3GOXA 3M0UA 3GNGA 4EMKA 4C8QG 1RAAB 2XIDA 2LNHB 1VIEA 1Q86U 2FRWA 1N9SA 2HSEB 5LJ3f 1OZ2A 3G1JA 2LX7A 5KYXB 2XDBA 2F2WA 2PQWA 2RM4A 1VQPT 1OYXA 3CQTA 1YWPA 4ORZA 2L8DA 3A5ZB 1KD1R 2ZPEB 2YUNA 1X2KA 3E1SA 2M0YA 5LJ3e 3CCMA 4L5GA 2K3XA 5FW9A 3G6EA 2GBQA 2E10A 1RADB 2AHJB 4HKEA 3SHWA 4DQ2A 4IKFA 1R8OB 2MPXC 1D3BA 4KT0E 1JRIA 1FX7A 1PD0A 3VS0A 1VIFA 4QVZA 2DL7A 2O4XB 4PLLA 1O9SA 1OU9A 2L5QA 3M53A 3JCMc 2JT4A 2DJZA 2OTLQ 2E70A 2P0KA 1IREB 1S1NA 1Y57A 1U06A 1N27A 1MMDA 2FZGB 3EFOA 3JV3A 5HCKA 1WQWA 2P4RA 2RD1A 4GY5A 5LJ5e 2O4XA 1B7TA 5M9OA 4BD3A 1VQ7T 1ZSZC 4M77A 1K4US 2J6KA 2KDSA 5LJ5h 3CC4A 2QDLA 2D9TA 4F04B 1AT1B 2D8JA 1T3LA 3X26B 1UGVA 3RKWA 1RI9A 4D6WA 2CZ6B 3V7CA 1TOVA 3H9NA 1R0CB 1X75C 3A8MB 1WHMA 2KY9A 2RHUA 1HJDA 4C0DB 4M77B 4LDUA 1WGSA 3CPFA
chains in the Genus database with same CATH topology
5CR2A 2X4YA 3M56A 1VQNT 1PSFA 3DB4A 3HKSA 2BIVA 3MEWA 4XTUA 1N8RU 1TH7A 1NE8A 3PIPA 2ZPFB 4KULA 3JCMg 1M1KU 2WSFE 1FWZA 3FDRA 2VV5A 1M9SA 4Y28E 3CCJT 3SWNB 4C8QB 4E7KA 5I2SA 4JS4A 4JLGA 1K8AU 3L2RA 2EIFA 5DY9A 4M7DF 4M77C 3HHTB 1K9MC 4C5HA 4J83A 3RMSA 4A4KA 2FYKA 3CCQT 1JJ2A 3FLGA 1UGRB 3LGLA 2RJFA 3A8OB 4F7UB 5LJ5g 3CPWS 1U1TA 3OBYA 3OYJA 3CCMT 4C8QF 1PSEA 3CCLA 2EQUA 3MEVA 3HFOA 5C6SA 1ZQ1A 4BB7A 4PNOA 4PJOA 1QVGA 5GAN3 4M75B 4M7AD 1YJ9A 1M8VA 3OYMA 2R5AA 1VQKA 2ZPGB 3CC7T 5FLXE 1VUBA 1WNLA 2RB6A 2BUDA 2JVVA 1N9RA 2LCLA 2LQKA 2EQKA 1DJ7B 5GMKj 2DIGA 5A0GA 1WPYA 3OYNA 1YCYA 4L6V5 3INZA 1QP3A 3QZ5B 3V7SA 4WF2A 2CGHA 1JBMA 3G7ZA 1RI0A 3OW2S 3ASKA 2JOYA 2QQSA 3SWNA 3T9NA 4C8QA 2KVQG 2YHTA 1VQMT 3JB9H 3PMIA 2M9UA 3OYCA 1VQ5A 2K5FA 5GAOn 1G3SA 2LTOA 1YITT 1K8AC 3MP1A 3PFSA 4FSXA 4R56A 3CMAA 3QKJA 2XU8A 5GAOm 3JRZA 5J26A 2CZ7B 3PMTA 2DO3A 2YLBA 5IN1A 5HK3A 2QTXA 3H6ZA 4A4FA 3L2VA 5GMKm 1M90C 4LD9K 5CVIA 2EWNA 2RHIA 4P5NA 1MHNA 3FIFA 5CQXA 1UGPB 2DTOA 5GAMh 1VQLA 4O5VA 2XK0A 4J7IA 3VUBA 5IAYA 3META 1YHQA 4HCZA 4C0GA 4A4HA 3GIBA 2RHYA 3WVDB 3JCMd 3OYFA 1JJ2S 4Z02A 2EJFA 4EMKC 3V7RA 2MI6A 3J7AF 4DA4A 1VQOA 2OTJA 3TREA 2LDMA 1B34A 2LT4A 3HL8A 1YJWT 1I4K1 2DXUA 1WJRA 3X20B 2E12A 1XNIA 2FL7A 1LJOA 4E7JA 2LCCA 1XQHA 4QQDA 4M78A 2LRQA 4JUVA 5GANe 1I81A 3SD4A 1KC8C 2JTFA 3BW1A 5GAN8 5CKHA 2LT1A 4TVRA 5D6YA 4A4EA 3N5BB 2VUBA 3OB9A 4EMKB 2ZZDA 1KG1A 3FJPA 2F5KA 3CBMA 3LWIA 2DPPB 3CC7A 2MMPA 1BI1A 4IUPA 3FRNA 2XI9A 3HSBA 3CMEA 4C8QD 2OTLT 2KK4A 1M1GA 1VQ7A 5J39A 1VQMA 3GNFB 3QSUA 4PLIA 3GP8A 1QP2A 2XHCA 2F69A 5CKEA 3OS0A 3S3OA 5CKDA 4OGCA 3HRSA 1W2BA 4PJOC 2VC8A 5A2QE 5HK0A 4ZTJA 2VGNA 4PJOD 4XTXA 2P4TA 3P8DA 1Q81U 1HK9A 5GAN5 3X28B 2DTHA 4PJOF 1KD1C 1VQ6T 3VYGA 3JCMb 2PU9B 1G5VA 3OQ5A 1GXIE 4HT8A 3ZEHA 1XOVA 2K2VA 1QVFA 2CYZB 4PKCC 3QZ9B 2RA2A 3JB9G 1QVGS 3LH0A 3OSVA 3PNWC 4BI3A 4BACA 2IVWA 4DOWA 3CCST 4M7AF 4PJOB 1G3YA 2KAFA 3QUIA 3OYYA 4OVAA 3JCMh 2HAXA 3OYDA 5FRMA 4NOYA 3QYHB 3OYEA 1D3BB 4XQ3A 4XU0A 3CCUT 3A8GB 2HNIA 1KHCA 4ZN3A 3L2ZA 4JS5A 4C92B 2RHZA 4M75D 4XK8E 2WSCE 4M7AB 3RMQA 1KQSA 2LC4A 4MZPA 3MHXA 4IUVA 5LL6S 3VJPA 2GQVA 4FIBA 4N4HA 2ZPBB 1YJ9T 1KQ2A 2OTLA 2FHDA 1VQLT 4FL6A 2X4XA 4JRIA 3NTHA 1VQ4A 3E9GA 3QG1A 4II1A 2XD0A 5DM7R 3V8KA 2LNVA 3UPUA 4XU3A 3VUZA 2L3RA 4B9XA 3QJYA 1O75A 2QEXA 2KMTA 2A7YA 2QQAA 3TCJA 2JTMA 4JDSA 3EFSA 3SB2A 4JRKA 5J3BA 3H8ZA 4RCCA 4RG8A 3L2UA 3CMAT 2OTJT 5L8RE 5LJ5d 1BI0A 2WACA 2MWPA 1LOJA 2EQJA 3S3MA 2WSEE 3V8LA 3DLLA 1X6OA 3JCMQ 3CBOA 4ME7A 1BYMA 4OP0A 4C5EA 4ZGJB 3I55A 5D6XA 3X25B 1ZHIA 4FT4A 4J5YA 3VYHB 2CZ0B 1NZ9A 1WQ7A 3VV0A 3L42A 3OMGA 1YIJT 4PJOG 1FXXA 4BE1A 1M1KC 1P92A 4M7DC 2DEQA 3KUFA 4QQGA 3C95A 4M7AE 2F5TX 2DTIA 1KQSS 4RMOA 1YI2T 1VQ9A 3CC2A 2QA4A 3BY7A 2DAQA 4JRQA 1KQ1A 4OB1B 3LYIA 2RK1A 3CCET 2Y4XA 4C92C 4LD6A 2EYQA 2MAMA 3J80E 3JCMW 2K4YA 4OB0B 3HRTA 3M54A 2M0OA 1MGQA 5CKFA 2EJ9A 4CRIA 2XDDA 4E7LA 4X9DA 2BKDN 1QW1A 4NL2A 4E7IA 3GPLA 4KBMB 5GMKh 4A54A 4QW2A 4ATOA 3OS2A 3ER0A 2QQBA 2K3YA 3OSSC 4ELYC 1VQ4T 1H641 5GMKi 1I5LA 4LDXA 2PVOB 3CD6A 4HT9A 1N8RC 4IURA 4J6YA 2QQ9A 3UT1A 3OYHA 4XTVA 3G4SA 2QA4T 3PTAA 5GANj 4LDVA 3M57A 3JSCA 3LLRA 4XU1A 4QQ6A 1U8RA 5DLOA 2XG8D 5GMKe 2EKOA 2VYTA 5KH6A 3MO8A 1YJWA 4M77F 3RUXA 4XTZA 2DXCA 2DZ9A 3JCMX 1Q86C 1X01A 3CC2T 3P8BB 5I2MA 5CK9A 4EPCA 3A8LB 4OGEA 5CKBA 2JUFA 4J8OA 5EG2A 3M4YA 1UB4A 1B34B 3EAEA 3I55T 2DVEA 2KSSA 2E5QA 2VGMA 4IUUA 3O8VA 5GAMj 4BE0A 3BFMA 3MP8A 4EMGA 5CCAA 4M7DD 3HFNA 2V8IA 3QIIA 3FEOA 3LX7A 1OI1A 2FB7A 4IUQA 4OF1A 4RG2A 5GMKl 4JJNK 1M90U 4M7DB 3CXCA 3JAME 3CPWA 2EJGA 4N0AC 4YTLA 4BY6B 2CS7A 2QDYB 4C92D 5GAOl 3I56A 4E7HA 4F7UF 1YI2A 1Q7YC 2D6FA 1VQ9T 2E1HA 3G4ST 3PGGA 5GAMf 1VQ5T 5GAMd 2X35A 4C92A 5D6WA 4X9CA 3MP6A 3NFCA 2EFIA 1UEBA 4XAXB 4PJOE 3OMCA 2FVUA 2RI3A 2XKOC 4M75F 4M77D 3A8HB 1Y71A 2DZCA 2XICA 3CBPA 4M78C 5CIUA 4F7UE 3JCMe 3L2WA 2G3RA 3QXEB 3ZFJA 2DKGA 4C92E 2M1HA 3RKYA 3DB3A 3M5AA 4FM4B 1VQ6A 1EIFA 5KCHA 2PVDB 3DKMA 5GANf 4F7UA 1BI2A 2E41A 2E64A 4M7AC 3V8JA 1IZ6A 3EFRA 2ZPHB 3CCVT 4C5GA 4HA8A 4M7DA 1QVPA 2QEXT 4MZTA 3TU4K 3JCMP 3SFMA 3MEUA 2E6NA 5GAOq 2PUOB 3CCQA 2Y90A 3ZBDA 1I8FA 3JB9D 1QVFS 3NTKA 4N4IA 4NS5A 4M77G 5CQYA 1Q82C 3ME9A 1M5Q1 2X4JA 3M4GA 5GAN4 4M7DE 2YLCA 3SWNC 4J6WA 3QYGB 3WXMB 2GCXA 4C8QC 3OS1A 2CZ1B 1U1SA 2GFUA 3JCMV 4ZN1A 3J81E 2OAUA 5LJ3d 3OYLA 3HRUA 4C8QE 1S72A 4CI0C 3CCUA 1BIAA 3E19A 2XDPA 1W2BS 2GF7A 3KXTA 3HPWA 4M78F 4PL6A 4Q5WA 5CAIA 2KQWA 3M59A 4KUIA 1V29B 1WJSA 4MMKA 5HY6A 5HKCA 5GANd 3WVEB 1AHJB 2ZGWA 3C94A 4OB2B 4L59A 4V2SA 4HCCA 5FRNA 4ELZC 2E6ZA 4F7UG 4M78B 3CMET 2B8AA 3HP9A 4M78E 3TEEA 2DXTA 5FU6B 2HQXA 1ZBXA 3R6OA 3LW5E 1Q81C 4Y91A 2PUKB 1VQ8A 3VU3C 4J6XA 3OYGA 3CCEA 4LDWA 2RJDA 2MF2A 1VQOT 2LVMA 4J7FA 1Y96A 4MZMA 5LJ3h 1VQPA 2CKKA 3PT9A 2IG0A 4E47A 3UWNA 4UC4A 3OYBA 3G6ET 1BI3A 5A0LA 5GANg 3JB9F 4X34A 2A3LA 5GAMe 1N6AA 3CCVA 4C92G 3OYAA 1S72T 5LJ5f 4M7AG 3QJ6A 1SSFA 2K5LA 2PVGB 2RI2A 2RJCA 5FU6C 3FC3A 4MDXA 3CCSA 4N0AA 4GLKA 4XTWA 3GF5A 4B9WA 5GAN7 3AHUA 4M7DG 1WJQA 1RL2A 5FROA 5LJ3g 4ZGEB 1NPRA 4M75E 5CO7A 3GOXA 2XDBA 2V8JA 2JNGA 2LQ8A 2RO0A 3GNGA 4EMKA 4ZGDB 1YHQT 4C8QG 2XIDA 2YRVA 1VIEA 1YJNT 1Q86U 2RH2A 1N9SA 4M75A 2GFAA 5LJ3f 1OZ2A 1M1FA 2EAYA 2ZPIB 1Y96B 1XTDA 2HBPA 2RM4A 2PQWA 2X4WA 1OYXA 2V8KA 3L2QA 1VQPT 4HCBA 5KE3A 3C12A 1K73U 3OYKA 4A53A 2L8DA 2K5IA 3CEYA 3A5ZB 3OYIA 2EQMA 2ZPEB 5GAN6 3FB9A 4QVCA 1NJIU 4O6JA 2O01E 3DLMA 3S6WA 3E1SA 4BUGA 3QHSA 4JLIA 3CD6T 5LJ3j 5I21A 4BY6C 3OS5A 3OY9A 5LJ3e 1YJNA 2JZ2A 3QO3A 3CCMA 1Q82U 1H3ZA 4L5GA 2K3XA 4M75C 3BDLA 3RESA 4FU6A 1YBYA 1KHIA 5KCOA 5GAOr 2HQEA 4BDZA 3C4SA 3G6EA 4C0FA 2E10A 5GANh 5C0MA 3GLXA 2C06A 3QBYA 1VQNA 2AHJB 4HKEA 2DD5A 3CCLT 2RJEA 5A0DA 2MWOA 3QDRB 4DQ2A 3S3NA 4IKFA 1R8OB 4KT0E 1D3BA 4MMLA 3CXCS 5LJ5j 1G3TA 4C92F 1JRIA 1FX7A 5FU7B 5KE2A 1UGSB 3Q1JA 4M7AA 5GAN2 1BIBA 1VIFA 4QVZA 4C5IA 2O4XB 5GAOp 4PLLA 4JRPA 1NJIC 1O9SA 3LWHA 2L5QA 3I56T 3JCMJ 4NL3A 3RKXA 2Y4YA 2JN0A 3M53A 4FT2A 2VXEA 4M75G 3JCMc 1Y07A 4EMHA 3OA6A 3M58A 1LNXA 3SDZA 4N4GA 3G71A 4BDYA 1M4ZA 4LDYA 4OB3B 5FU7C 2DJZA 5GAMg 3X24B 4IUTA 3QPHA 2DD4A 2E70A 2I2LA 2LX9A 4VUBA 4C0DC 1Y7XA 4C0ZA 2P0KA 3M55A 4BE2A 1KD1U 3CC4T 2H3JA 1IREB 2QXFA 2DK3A 2ZCFB 2D0QB 3P8HA 5AYFA 4M77E 2DXBA 4RCBA 1N27A 3JCMf 1WQWA 1K9MU 2QQRA 2RD1A 4GY5A 5LJ5e 1NPPA 2O4XA 3RIRA 2R57A 4EDUA 5M9OA 3CCRT 4XTYA 4BD3A 4BI8B 1VQ7T 4M77A 1JB0E 1Q7YU 3E9FA 3BDUA 1UGQB 3CCRA 2NLUA 3OW2A 2KDSA 4BI4A 5LJ5h 3URGA 2P0QA 2QI2A 4R55A 1W4SA 2HD0A 3CC4A 4MDWA 4OMFB 4ZTFA 1OZ3A 3MEAA 4A4GA 4M78D 3L1AA 2RK2A 4QVDA 1YIJA 2D9TA 3OBWA 2R5MA 1HXDA 3KBGA 2R58A 3MCAB 4M78G 3X26B 1G3WA 3CCJA 1VQKT 1K73C 3RKWA 1KC8U 2E65A 4D6WA 2CZ6B 3LGFA 3V7CA 1VQ8T 2VXFA 3PIOA 2L89A 2RI5A 4RKUE 3A8MB 1X75C 1BKBA 3F70A 5DLQE 3JB9I 2KY9A 2RHUA 5IT9E 1YITA 4XU2A 2P0PA 3JB9J 3RERA 2K57A 3UDCA 3G71T 4C0DB 2M16A 4KUDK 4M77B 2DIQA 3VKIA 4LDUA 1WGSA 3CPFA 3M9QA 2RHXA 3NTIA 4DOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FB7 A;  5GMK l;  4M7D B;  2DTH A;  4PJO F;  4A53 A;  4XTU A;  3JCM b;  1TH7 A;  2EJG A;  4N0A C;  5GAN 6;  3JCM g;  3FB9 A;  4C92 D;  4QVC A;  5GAO l;  4HT8 A;  4F7U F;  2E1H A;  3JB9 G;  2RA2 A;  3PGG A;  3QHS A;  4JLI A;  3SWN B;  4C8Q B;  5GAM f;  5GAM d;  4C92 A;  5LJ3 j;  5I21 A;  5DY9 A;  4X9C A;  4M7D F;  5LJ3 e;  4M77 C;  4PJO B;  4M7A F;  4PJO E;  3QO3 A;  3QUI A;  2FYK A;  4M75 F;  3JCM h;  4M77 D;  2DZC A;  4M78 C;  4NOY A;  4F7U B;  5LJ5 g;  1U1T A;  4F7U E;  3JCM e;  1D3B B;  4M75 C;  4XQ3 A;  4XU0 A;  3RES A;  4C8Q F;  2HNI A;  5GAO r;  2DKG A;  3L2Z A;  4C92 E;  3HFO A;  4C92 B;  2E10 A;  3RKY A;  5GAN h;  4M75 D;  4PNO A;  4M7A B;  4PJO A;  5GAN 3;  4M75 B;  4M7A D;  1M8V A;  4DQ2 A;  5GAN f;  1WNL A;  2RB6 A;  4F7U A;  1N9R A;  2E41 A;  4M7A C;  1D3B A;  2E64 A;  4MML A;  1KQ2 A;  3V8J A;  5LJ5 j;  3EFR A;  4C92 F;  1JRI A;  4JRI A;  4HA8 A;  5GMK j;  4M7D A;  1WPY A;  4M7A A;  5GAN 2;  1BIB A;  3JCM P;  1YCY A;  3INZ A;  5GAO q;  3V7S A;  4WF2 A;  2CGH A;  1JBM A;  3V8K A;  5GAO p;  2Y90 A;  4XU3 A;  1I8F A;  3JB9 D;  3JCM J;  3SWN A;  4C8Q A;  4NL3 A;  3RKX A;  2YHT A;  4M77 G;  3JB9 H;  2JN0 A;  3EFS A;  4JRK A;  1M5Q 1;  3M4G A;  4RCC A;  3SB2 A;  5GAN 5;  2VXE A;  2YLC A;  5GAN 4;  5GAO n;  3SWN C;  4J6W A;  4M75 G;  3JCM c;  4C8Q C;  5LJ5 d;  4EMH A;  1LOJ A;  1U1S A;  3JCM V;  1LNX A;  3V8L A;  3JCM Q;  5LJ3 d;  4C8Q E;  5GAO m;  2DJZ A;  5GAM g;  4OP0 A;  2YLB A;  2I2L A;  1BIA A;  4M7D D;  2QTX A;  4M78 F;  4J5Y A;  5GMK m;  5CAI A;  1WQ7 A;  2EWN A;  5GAN d;  4MMK A;  3FIF A;  4PJO G;  2DTO A;  5GAM h;  4M77 E;  4RCB A;  2ZGW A;  3JCM f;  4M7D C;  2DEQ A;  4V2S A;  4M7A E;  3GIB A;  4F7U G;  1WQW A;  2DTI A;  4M78 B;  4M78 E;  2RD1 A;  3JCM d;  2DXT A;  2EJF A;  3BY7 A;  3V7R A;  4EMK C;  5LJ5 e;  1KQ1 A;  3RIR A;  4C92 C;  4Y91 A;  1B34 A;  4XTY A;  1I4K 1;  3VU3 C;  4M77 A;  2DXU A;  3JCM W;  1MGQ A;  4J6X A;  2EJ9 A;  3BDU A;  4X9D A;  5LJ5 h;  1Y96 A;  4NL2 A;  5LJ3 h;  4M78 A;  5GMK h;  4JUV A;  4A54 A;  5GAN e;  1I81 A;  3BW1 A;  5GAN g;  3JB9 F;  4M78 D;  5GAM e;  5GAN 8;  3L1A A;  1H64 1;  4C92 G;  4QVD A;  5GMK i;  5LJ5 f;  1I5L A;  4HT9 A;  4M7A G;  1HXD A;  4EMK B;  4M78 G;  4J6Y A;  3FJP A;  5GAN j;  3HSB A;  4XTV A;  3RKW A;  4N0A A;  5GAN 7;  4XTW A;  4XU1 A;  3AHU A;  4C8Q D;  4M7D G;  2E65 A;  5GMK e;  3V7C A;  5LJ3 g;  4M75 E;  4M77 F;  2VXF A;  4XTZ A;  3RUX A;  3JB9 I;  2DZ9 A;  4EMK A;  3JCM X;  1X01 A;  4C8Q G;  4XU2 A;  3QSU A;  3RER A;  3JB9 J;  2K57 A;  1B34 B;  4M7D E;  1N9S A;  2DVE A;  4M77 B;  4M75 A;  4PJO C;  5LJ3 f;  2VC8 A;  2EAY A;  5GAM j;  3BFM A;  4EMG A;  1Y96 B;  4PJO D;  2RM4 A;  1LJO A;  4XTX A;  3HFN A;  1HK9 A; 
#chains in the Genus database with same CATH topology
 2ROT A;  1IB8 A;  2BIV A;  1TH7 A;  3EGD A;  4KUL A;  2A0F B;  2DL5 A;  2FO0 A;  1M9S A;  3CCJ T;  4C8Q B;  5I2S A;  4JS4 A;  1UEC A;  1K8A U;  4M7D F;  4M77 C;  4J83 A;  5GJV B;  2BE7 D;  3FLG A;  3UA7 A;  5LJ5 g;  3A8O B;  1RLQ C;  3OYJ A;  1V76 A;  3CCL A;  3MEV A;  4IIO A;  1TXQ A;  1JXM A;  1M8V A;  2ZPG B;  3CC7 T;  2AT1 B;  2RB6 A;  2LCL A;  3CME Q;  2EQK A;  3NGP A;  2DIG A;  1WPY A;  4WF2 A;  1R77 A;  1JBM A;  1RI0 A;  3ASK A;  2QQS A;  1X69 A;  2M9U A;  2KRO A;  2K5F A;  1AWJ A;  3UAT A;  2QG9 B;  2V26 A;  4R56 A;  5GAO m;  5J26 A;  3G71 T;  3L2V A;  4A4F A;  4ESR A;  2L3S A;  5CVI A;  1BU1 A;  2RHI A;  1KFZ A;  5CQX A;  1VQL A;  2VAS A;  1Q95 G;  1ZUK A;  1YHQ A;  4C0G A;  3GIB A;  3WVD B;  3OYF A;  4DA4 A;  1VQO A;  3TRE A;  2DXU A;  2RQV A;  1XQH A;  1SHG A;  4JUV A;  1C6V X;  1I81 A;  3SD4 A;  2COW A;  5CKH A;  1BB9 A;  1ZSG A;  2JJ9 A;  4EMK B;  3HSB A;  1NEB A;  4C8Q D;  2CUD A;  3GP8 A;  2QGG A;  5FWC A;  5CKE A;  1W2B A;  1UFF A;  3HRS A;  2FZC B;  2SRC A;  5HK0 A;  2VGN A;  4J9C A;  1WHG A;  1D1B A;  1HK9 A;  1H3H A;  2FPD A;  2PU9 B;  2CSQ A;  4X1V A;  1XOV A;  5I22 A;  2CYZ B;  4PKC C;  3QZ9 B;  2RA2 A;  1QVG S;  2YUO A;  3OSV A;  2W0Z A;  1AOJ A;  4DOW A;  4BAC A;  5KYN A;  4RTW A;  3JCM h;  3OYD A;  5FRM A;  1D3B B;  1N5Z A;  4JS5 A;  4C92 B;  2HCK A;  1YJN Q;  2JW4 A;  4XK8 E;  1H8K A;  4RTU A;  4MZP A;  4LE9 A;  4IUV A;  4N4H A;  2ZPB B;  4E6R A;  1PRM C;  4FL6 A;  2XD0 A;  5DM7 R;  3V8K A;  4K11 A;  3O5Z A;  2QEX A;  2A7Y A;  4JDS A;  1BI0 A;  2X9H A;  4OMQ A;  2WSE E;  3V8L A;  3DLL A;  3JCM Q;  2KT1 A;  4OP0 A;  2DBM A;  3I55 A;  2EQI A;  3X25 B;  1BK2 A;  1WQ7 A;  3VV0 A;  3L42 A;  1YIJ T;  1RAF B;  3SEM A;  1M1K C;  4M7D C;  1OPL A;  2DTI A;  3TQ7 P;  2QA4 A;  1KQ1 A;  2RK1 A;  5IHN A;  2Y4X A;  4C92 C;  2EKH A;  2K4Y A;  1NJI C;  2HMA A;  1TWB A;  4X9D A;  1QW1 A;  5GMK h;  4QW2 A;  1VQL Q;  4ELY C;  2PVO B;  1N8R C;  4IUR A;  2QQ9 A;  3OYH A;  4KH0 B;  4XU1 A;  2EKO A;  1YJW A;  4XTZ A;  1W1F A;  2AKL A;  2DZ9 A;  1WXU A;  5I2M A;  3MKD A;  4EPC A;  5CKB A;  1JJ2 A;  4J8O A;  1VQ7 Q;  3M4Y A;  3I55 T;  2GTO A;  1D1A A;  3RNJ A;  2E5Q A;  2VGM A;  3O8V A;  5GAM j;  4EMG A;  2MIO A;  4M7D D;  1WHL A;  1MMG A;  3HFN A;  4OMP A;  2V8I A;  3QII A;  2FB7 A;  5GMK l;  3CXC A;  3CPW A;  4A63 B;  4C92 D;  2D6F A;  1VQ9 T;  3PGG A;  5GAM f;  2CT4 A;  1VQ5 T;  5GAM d;  2X35 A;  3QDF A;  4FSS A;  4C92 A;  4X9C A;  4AMC A;  2RI3 A;  2XKO C;  1ZA2 B;  3A8H B;  2XIC A;  4M77 D;  3UA6 A;  4F7U E;  2E3I A;  2G3R A;  2D0N A;  3ZFJ A;  2DKG A;  3UF4 A;  3RKY A;  2CP2 A;  4FM4 B;  1VQ6 A;  1A0N B;  2LZ6 B;  3EFR A;  2KYB A;  4C5G A;  4HA8 A;  1IO6 A;  1D0Z A;  2PUO B;  2DJQ A;  3CCQ A;  2NUT B;  2X4J A;  3M4G A;  1SRL A;  5IXB A;  3SWN C;  4J6W A;  3OS1 A;  1NYF A;  2O9V A;  3JCM V;  1RUW A;  4JJC A;  1XJW B;  2OTJ Q;  2ED1 A;  1RAH B;  3CCU A;  1BIA A;  3E19 A;  2XDP A;  3M0Q A;  1M90 R;  4M78 F;  4PL6 A;  5HKC A;  1V29 B;  3TVT A;  2ZGW A;  3C94 A;  4L59 A;  2KR3 A;  1SPK A;  4M78 B;  3HP9 A;  3R6O A;  1ZBX A;  3E2U A;  1Z9Q A;  1YWO A;  4Y91 A;  4LDW A;  2RJD A;  1AWW A;  1OUL A;  3PT9 A;  2KRM A;  2IG0 A;  1RLP C;  2EW3 A;  5A0L A;  1KQS P;  5GAM e;  3CCV A;  4C92 G;  5LJ5 f;  2RNA A;  4M7A G;  1SSF A;  1W6X A;  4HVV A;  4HVW A;  2RI2 A;  2VWF A;  3CCS A;  4N0A A;  1UG1 A;  5GJW B;  2ENM A;  5LJ3 g;  4M75 E;  2RO0 A;  1YHQ T;  2YRV A;  3EG1 A;  1YJW Q;  1EX4 A;  2YUP A;  2CT3 A;  2L2P A;  1Y96 B;  1XTD A;  3L2Q A;  2IIM A;  1BCM A;  5KE3 A;  1I1J A;  3OYI A;  1KIK A;  3H0H A;  3FB9 A;  1NJI U;  4BUG A;  1SF9 A;  2YDL A;  2ATC B;  2DET A;  1H3Z A;  3RES A;  1YBY A;  1K8A R;  2BZY A;  1YCS B;  3GLX A;  2RJE A;  2MWO A;  4HCK A;  2EGA A;  3CXC S;  4AFS C;  1I0C A;  4C92 F;  1X2Q A;  5FU7 B;  1YJ9 Q;  1U5S A;  3LWH A;  3I56 T;  4NL3 A;  8ATC B;  5FWB A;  4DBH A;  1E7O A;  1Y07 A;  1WHH A;  1LNX A;  1NLP C;  3QWY A;  3ULR B;  3G71 A;  4BDY A;  3CCS Q;  4OB3 B;  1M27 C;  4IUT A;  3QPH A;  2LX9 A;  1Y7X A;  2OJ2 A;  1GL5 A;  3CC4 T;  1QCN A;  2KRS A;  4KGV B;  3P8H A;  1ACM B;  1AZG B;  2RN8 A;  3CCL Q;  3RIR A;  2R57 A;  4XTY A;  4BI8 B;  1JB0 E;  1LPL A;  1Q7Y U;  3E9F A;  2NUT A;  2LJ3 A;  2P0Q A;  1W4S A;  4MDW A;  4ZTF A;  1SG5 A;  3MEA A;  2F2V A;  7AT1 B;  1AVZ C;  1K1Z A;  1NEG A;  4QVD A;  2R5M A;  3CC7 Q;  3MCA B;  1VQK T;  2O9S A;  3C0C A;  1WHK A;  1KC8 U;  2E65 A;  3G6E Q;  2VXF A;  3PIO A;  2NUP A;  1VQN Q;  3EG9 B;  2GTJ A;  5DLQ E;  1GBR A;  4FYW B;  3RER A;  3JB9 J;  2K57 A;  3UDC A;  2M16 A;  3VKI A;  1WIE A;  3M9Q A;  2HL5 C;  1VQN T;  1PSF A;  3DB4 A;  3BE3 A;  1NE8 A;  3EGX B;  3FDR A;  3L2R A;  5DY9 A;  1S72 Q;  1MUZ A;  2J06 A;  3HHT B;  1K9M C;  1UGR B;  3EG9 A;  4F7U B;  1AEY A;  4PJO A;  5KYY B;  4M75 B;  3OYM A;  1VQK A;  1IGU A;  1WNL A;  1YI2 Q;  2M51 A;  1QQJ A;  2JS0 A;  1JQQ A;  4FW2 A;  2C0O A;  1WZO A;  2ROL A;  3EGX A;  2KT8 A;  3OW2 S;  3SWN A;  3T9N A;  2K2M A;  2YHT A;  3PMI A;  2JMC A;  1VQ5 A;  4J9G A;  2LTO A;  1YIT T;  2BZ8 A;  3MP1 A;  3CMA A;  3QKJ A;  3PMT A;  2YLB A;  5IN1 A;  5HK3 A;  1PM3 A;  1M90 C;  1HYO A;  4P5N A;  1MHN A;  3FIF A;  2EGC A;  2KXD A;  5ECA A;  1FMW A;  4O5V A;  2XK0 A;  3MET A;  2RPN A;  4HCZ A;  1VYT A;  3J7A F;  4EMK C;  3CMA Q;  2K3B A;  1I4K 1;  2RMO A;  1I5O B;  2E12 A;  4LUE A;  1C0M A;  4QQD A;  2LRQ A;  2QYZ A;  1KC8 C;  2M02 A;  3N5B B;  3HTR A;  4Z88 A;  3LWI A;  1PRL C;  4JJB A;  1WFW A;  2OTL T;  2KK4 A;  1X6G A;  3GNF B;  4PFO A;  1QP2 A;  2XHC A;  3M0P A;  2G6F X;  2VC8 A;  4RTY A;  1AD5 A;  3VS3 A;  1Q81 U;  3X28 B;  2DBK A;  2DTH A;  2DNU A;  3VYG A;  2K2V A;  1QVF A;  1RAG B;  3JB9 G;  3REA B;  3NPF A;  2IVW A;  3CCS T;  3QUI A;  4NOY A;  4XU0 A;  3A8G B;  4R0K A;  2PNI A;  4M7A B;  2WSC E;  3MHX A;  5LL6 S;  2GQV A;  5D7U A;  1YJ9 T;  1KQ2 A;  3U23 A;  2OTL A;  3H41 A;  1YP5 A;  4JRI A;  4II1 A;  3AT1 B;  3VUZ A;  3EG2 A;  3QJY A;  2JTM A;  3H8Z A;  2OTJ T;  4AFQ C;  2QAS A;  1X6O A;  3CBO A;  1K9A A;  2CSI A;  1BYM A;  4C5E A;  1HD3 A;  3H0I A;  1M2V B;  1ZHI A;  3VS5 A;  2CZ0 B;  4DBR A;  2FEI A;  3VS2 A;  3IQL A;  4KH1 B;  1P92 A;  3KUF A;  3RBB B;  3NHN A;  1KQS S;  4CC2 A;  2CP3 A;  1TU0 B;  1NM7 A;  3BY7 A;  4JRQ A;  1Q82 R;  3LYI A;  1VQO Q;  5IH2 A;  3M54 A;  2M0O A;  3GPL A;  1TG0 A;  1I5L A;  1AWO A;  4LDX A;  1YIJ Q;  3CD6 A;  4J6Y A;  4F17 A;  1U8R A;  3PTA A;  2DVJ A;  4QQ6 A;  2XG8 D;  1GCQ C;  5GMK e;  2VYT A;  2DL4 A;  3MO8 A;  2E4H A;  3RUX A;  2DXC A;  4PJL A;  5CK9 A;  2JUF A;  2D1X A;  1B34 B;  2DVE A;  3I9Q A;  2CP6 A;  3OW2 P;  4F14 A;  1CKA A;  2C0I A;  3FEO A;  1M8M A;  2KNB B;  3JAM E;  3VS1 A;  4E7H A;  4LN2 A;  4DEY A;  2E1H A;  1ZA1 B;  4J9I A;  2FG0 A;  1VQ6 Q;  4XAX B;  1K9M R;  2FVU A;  2LCS A;  3TSZ A;  3L2W A;  2CH4 A;  4C92 E;  2M1H A;  5KCH A;  2A08 A;  1U3O A;  3DKM A;  4M7A C;  2P84 A;  1PNJ A;  2ZPH B;  1QVP A;  2OX7 A;  2H8H A;  2QEX T;  5GAO q;  4PFZ A;  2Y90 A;  3JB9 D;  2JXB A;  3NTK A;  4NS5 A;  5CQY A;  3ME9 A;  1M5Q 1;  1LVK A;  3WXM B;  2GCX A;  5KYU A;  1NJI R;  2CZ1 B;  2GFU A;  4C8Q E;  1S72 A;  2DER A;  3MPU B;  2ZAE A;  2E3H A;  4D8D A;  2ABL A;  1G2B A;  4KUI A;  1WJS A;  4E2F B;  1JXO A;  2EPD A;  4J9B A;  2GQI A;  1AHJ B;  1FMK A;  4OB2 B;  3EG3 A;  2QAZ A;  3CCU Q;  2B8A A;  3TEE A;  2HQX A;  3LW5 E;  4AFU C;  2DFU A;  2AZS A;  4J6X A;  3OYG A;  2MF2 A;  2BZX A;  1Y96 A;  4MZM A;  2CKK A;  4LNP A;  4E47 A;  4E7S A;  1KC8 R;  1M30 A;  4PK4 A;  4MDX A;  1UJY A;  2KXC A;  4FYX B;  1VYU A;  1C1A A;  4GLK A;  3GF5 A;  4B9W A;  4M7D G;  4ZGE B;  5CO7 A;  1WHJ A;  5IHK A;  2HSP A;  2V8J A;  2LQ8 A;  1GFC A;  4ZGD B;  2FZK B;  5KYW A;  1Z9Z A;  2RH2 A;  1WYX A;  2HKN A;  4M75 A;  1M1F A;  2MK5 A;  2HBP A;  4WCI A;  2X4W A;  1SRM A;  2HZY A;  3C12 A;  2YRD A;  3OYK A;  3CEY A;  2K5I A;  1UUE A;  1K73 R;  2DE0 X;  1BCO A;  2O01 E;  3S6W A;  4JLI A;  5I21 A;  2DYB A;  3OS5 A;  4BY6 C;  4GBQ A;  3OY9 A;  1YJN A;  3QO3 A;  1VQ5 Q;  1VQ9 Q;  4RUG A;  5KCO A;  5GAO r;  1KHI A;  2HQE A;  3C4S A;  2EYZ A;  1PKT A;  4ANJ A;  3CCJ Q;  1E6G A;  1ZLM A;  5LJ5 j;  1G3T A;  2ESW A;  4M7A A;  3NMZ C;  5GAN 2;  1QKX A;  4LUD A;  1PKS A;  2COZ A;  5GAO p;  3JCM J;  2CH4 W;  3RKX A;  2Y4Y A;  4CC7 A;  2JN0 A;  2YUQ A;  4FT2 A;  2VXE A;  4M75 G;  4EMH A;  1WXT A;  2K9G A;  2RQW A;  3SDZ A;  1M4Z A;  2I0N A;  1K0S A;  5GAM g;  1OPK A;  3X24 B;  2NWM A;  4VUB A;  2I2L A;  4C0D C;  2LP5 A;  2FPF A;  2QXF A;  2DK3 A;  2W10 A;  2ZCF B;  5AYF A;  4RCB A;  4B6M A;  1K9M U;  1M3A A;  1OV3 A;  3I5R A;  4EDU A;  3VRZ A;  2LQN A;  1UGQ B;  1OX8 A;  2NLU A;  4BI4 A;  2RQT A;  3URG A;  4R55 A;  1LCK A;  1OZ3 A;  4A4G A;  2LJ0 A;  3CXC P;  2SEM A;  3OBW A;  4HXJ A;  1G3W A;  3LGF A;  2MYS A;  1VQ8 T;  3ZL7 C;  1UJ0 A;  4RKU E;  5IT9 E;  3F70 A;  1YIT A;  2YSQ A;  1IHV A;  2AKK A;  1V1C A;  2KBT A;  2DIQ A;  3MJX A;  1LJO A;  2RHX A;  4CC3 A;  5CR2 A;  3HKS A;  1N8R U;  2JS2 A;  3VS6 A;  1M1K U;  4F16 A;  2VV5 A;  3SWN B;  4E7K A;  3G71 Q;  1ZSZ B;  4JLG A;  1ABO A;  1PD1 A;  2PZ1 A;  3I5S A;  3CCQ T;  3LGL A;  3CPW S;  1U1T A;  3OBY A;  4C8Q F;  1D1C A;  1PSE A;  1IGQ A;  3HFO A;  5C6S A;  1ZQ1 A;  4PNO A;  5GAN 3;  1PHT A;  1YJ9 A;  1JO8 A;  3LH5 A;  2BUD A;  1N9R A;  1WX6 A;  3EH1 A;  4OMO A;  1VYV A;  2DMO A;  2KGT A;  4L6V 5;  3INZ A;  1QP3 A;  3V7S A;  1VQP Q;  2CGH A;  3G7Z A;  4PJN A;  2YXY A;  2V1R A;  1ZSZ A;  3JB9 H;  1VQM T;  1NLO C;  1D0Y A;  1E6H A;  3OYC A;  2DYI A;  1K8A C;  4Y92 A;  4FSX A;  1SSH A;  2XU8 A;  3JRZ A;  2QTX A;  3H6Z A;  5GMK m;  2LMJ A;  4ZNX A;  2AK5 A;  4RTT A;  2EWN A;  2YT6 A;  2DTO A;  2LJ1 A;  3VUB A;  1PC0 A;  5IAY A;  2CRE A;  4LXC A;  4A4H A;  3CC4 Q;  2RHY A;  2HDA A;  1AZE A;  3JCM d;  4J9D A;  2EJF A;  4Z02 A;  2MI6 A;  2LDM A;  1B34 A;  3HL8 A;  1YJW T;  1JJ2 P;  3X20 B;  6AT1 B;  4M4Z A;  1XNI A;  3R6N A;  5GAN e;  1MND A;  2CDT A;  2AIR B;  2LT1 A;  5D6Y A;  2L0A A;  2ZZD A;  1KG1 A;  3FJP A;  2F5K A;  2ECZ A;  2DPP B;  2MMP A;  1BI1 A;  4IUP A;  3CME A;  1VQ7 A;  5J39 A;  2CP5 A;  4AG1 C;  2EBP A;  2JM8 A;  2OI3 A;  4PLI A;  2F69 A;  3S3O A;  5CKD A;  3PE0 A;  4OGC A;  4AG2 C;  5A2Q E;  2HQH A;  2DRM A;  2QA4 Q;  4PJO D;  4XTX A;  3P8D A;  2K7A A;  1VQ4 Q;  1VQ6 T;  3JCM b;  3OQ5 A;  3TSW A;  4HT8 A;  3ZEH A;  5L23 A;  3I55 Q;  3PNW C;  4BI3 A;  3RR6 A;  4PJO B;  1G3Y A;  3OYY A;  4OVA A;  1WI7 A;  4GLM A;  2DEU A;  4ZN3 A;  1KHC A;  2C0T A;  3CCQ Q;  3L2Z A;  2RHZ A;  1KQS A;  2LC4 A;  1YHQ Q;  3G4S Q;  1VQL T;  1VQ4 A;  1UTI A;  1TS9 A;  2LNV A;  3UPU A;  5IHI A;  2L3R A;  4B9X A;  1QCO A;  2KMT A;  3TCJ A;  3EFS A;  5J3B A;  4RCC A;  1Q81 R;  3CMA T;  2WAC A;  2EYX A;  1LOJ A;  2EQJ A;  3CC2 Q;  1H92 A;  3KFV A;  4KRT A;  4DBF A;  4ZGJ B;  2RQR A;  2KRN A;  1MV3 A;  1FXX A;  4BE1 A;  2DEQ A;  4QQG A;  3C95 A;  4M7A E;  2O2O A;  4RMO A;  3CC2 A;  2DAQ A;  3GBQ A;  2J05 A;  4LD6 A;  2EYQ A;  2MAM A;  1GFD A;  3JCM W;  5CKF A;  4CRI A;  2EJ9 A;  4E7L A;  4E7I A;  4JPB W;  4KBM B;  3M0S A;  2A37 A;  3ER0 A;  2QQB A;  2K3Y A;  1IRX A;  4Z89 A;  1H64 1;  2NUP B;  1TUC A;  4QT7 A;  4HT9 A;  1W70 A;  3G4S A;  4J9E A;  3UT1 A;  5GAN j;  4XTV A;  3M57 A;  1QLY A;  1ARK A;  4M77 F;  1AWX A;  3EH2 A;  3JCM X;  2GGR A;  3P8B B;  1Q86 R;  4OGE A;  3EAE A;  1JEG A;  1GRI A;  2KEA A;  1YFN A;  3EGD B;  1OEB A;  1QVG P;  1PWT A;  1UDL A;  4BE0 A;  2ED0 A;  3MP8 A;  5CCA A;  1JU5 C;  4OF1 A;  3LX7 A;  4JJN K;  4IUQ A;  4RG2 A;  1M90 U;  4M7D B;  2BTT A;  2EJG A;  4N0A C;  1B3Q A;  4BY6 B;  2QDY B;  5GAO l;  4F7U F;  1Q7Y R;  2EYY A;  5D6W A;  2EFI A;  1GBQ A;  4PJO E;  1UHF A;  3OMC A;  5KYU B;  5CIU A;  1Y71 A;  4M78 C;  3CBP A;  1ZBJ A;  3A98 A;  3I35 A;  2QEX Q;  4WTO B;  3PVL A;  3DB3 A;  3M5A A;  1D0X A;  4J9H A;  2PVD B;  5GAN f;  1BI2 A;  2E41 A;  2E64 A;  2J7I A;  1X43 A;  3V8J A;  4M7D A;  3TU4 K;  1QVF P;  3SFM A;  3MEU A;  4M77 G;  1Q82 C;  4EIK A;  4C8Q C;  4ZN1 A;  2OAU A;  5LJ3 d;  3OYL A;  3HRU A;  1IHW A;  2L3P A;  1W2B S;  2GF7 A;  3KXT A;  3HPW A;  4Q5W A;  5CAI A;  4MMK A;  3D7S B;  4HCC A;  5FRN A;  4ELZ C;  3CCR Q;  1M3B A;  4F7U G;  4M78 E;  5FU6 B;  2X3W D;  2PUK B;  3VU3 C;  5EC7 A;  3CCE A;  2LVM A;  5KYX A;  1MNE A;  2QGF B;  2JM9 A;  1VQP A;  4JZ3 A;  3UWN A;  4UC4 A;  3OYB A;  3G6E T;  1BI3 A;  5GAN g;  3JB9 F;  1N6A A;  1VOM A;  3OYA A;  1S72 T;  3QJ6 A;  2RJC A;  2PVG B;  5FU6 C;  1RAE B;  2JMA A;  1RL2 A;  5FRO A;  1NPR A;  1I07 A;  2JNG A;  4FCY A;  1YJN T;  2GFA A;  4QKU A;  2X51 A;  2EAY A;  1PG5 B;  2ZPI B;  4HCB A;  1OX9 A;  2V8K A;  2CP7 A;  2E5K A;  3THK A;  1K73 U;  4A53 A;  2J6F A;  2KI7 A;  2EQM A;  2YWW A;  1Y0M A;  5GAN 6;  4QVC A;  4O6J A;  3DLM A;  3QHS A;  3CD6 T;  5LJ3 j;  1X6B A;  2JZ2 A;  3EGU A;  1Q82 U;  2IPO B;  3H0F A;  4M75 C;  2DIL A;  3BDL A;  4FU6 A;  4IIM A;  1J3T A;  4BDZ A;  4C0F A;  5GAN h;  5KYW B;  5C0M A;  1QWF A;  4D8K A;  2C06 A;  3QBY A;  1VQN A;  2DD5 A;  3CCL T;  5A0D A;  1T0J A;  1QWE A;  3QDR B;  3S3N A;  2Z0W A;  4MML A;  1B07 A;  3EFO B;  1FYN A;  1TTH B;  5KE2 A;  1UGS B;  3Q1J A;  1BIB A;  2EYW A;  4C5I A;  4JRP A;  2DLP A;  1EFN A;  1PCX A;  1OU8 A;  3OA6 A;  3M58 A;  4N4G A;  4LDY A;  2VB6 A;  5FU7 C;  2DD4 A;  4BE2 A;  1IXD A;  4C0Z A;  3M55 A;  4KGZ B;  2QK0 A;  1KD1 U;  1D09 B;  2H3J A;  3A1P A;  2D0Q B;  4M77 E;  2DXB A;  3JCM f;  3CCE Q;  2QQR A;  1NPP A;  3CCR T;  4JJD A;  3BDU A;  3CCR A;  2DF6 A;  3OW2 A;  2HL3 A;  2QI2 A;  2HD0 A;  2GNC A;  4OMF B;  4OMN A;  1OQK A;  4M78 D;  3L1A A;  3I56 Q;  2RK2 A;  2F1L A;  1YIJ A;  4PFP A;  1HXD A;  2RQU A;  3KBG A;  2R58 A;  2XMF A;  4M78 G;  4OMM A;  3CCJ A;  1K73 C;  3RDV A;  3VRY A;  3M0T A;  2L89 A;  2RI5 A;  1KK7 A;  1BKB A;  3JB9 I;  3VS7 A;  1TUD A;  1GCP A;  4XU2 A;  2P0P A;  1SHF A;  1MMN A;  4KUD K;  1QCF A;  4FYY B;  1TUG B;  3NTI A;  4DOV A;  2X4Y A;  3M56 A;  1ZUY A;  2MOX A;  4XTU A;  3MEW A;  1VA7 A;  3PIP A;  1MMA A;  2ZPF B;  3JCM g;  2WSF E;  1FWZ A;  4Y28 E;  1UHC A;  2EIF A;  2FRY A;  4C5H A;  3RMS A;  4A4K A;  2FYK A;  1TSF A;  2RJF A;  2HKQ B;  3CCM T;  2EQU A;  1FMV A;  4PJJ A;  4BB7 A;  1QVG A;  3PVQ A;  4M7A D;  1SKU B;  2J6O A;  2R5A A;  5FLX E;  1VUB A;  2H3E B;  2JVV A;  2LQK A;  1DJ7 B;  5GMK j;  3OYN A;  5A0G A;  1YCY A;  3QZ5 B;  2FPE A;  2JOY A;  4C8Q A;  2KVQ G;  3CCM Q;  5GAO n;  1G3S A;  2F2X A;  1KSW A;  4RTZ A;  2VKN A;  3PFS A;  2HEQ A;  3EG0 A;  1ZX6 A;  2CZ7 B;  2DO3 A;  1MV0 B;  4LD9 K;  2HBW A;  1UGP B;  5GAM h;  1F1B B;  2L3Q A;  4J7I A;  2DL3 A;  2VVK A;  2DL8 A;  2DA9 A;  1T3S A;  1M2V A;  1JJ2 S;  3V7R A;  2OTJ A;  2LT4 A;  4OML A;  4HVU A;  2CUB A;  1WJR A;  3VS4 A;  2FL7 A;  2X3X D;  3QWX X;  4E7J A;  2LCC A;  4M78 A;  2JTF A;  3M0R A;  3BW1 A;  2K79 A;  1OOT A;  1R0B G;  5GAN 8;  4TVR A;  4A4E A;  2QTV A;  2VUB A;  3OB9 A;  3CBM A;  3CC7 A;  2NYS A;  3FRN A;  2XI9 A;  1T0H A;  1YNZ A;  1M1G A;  1VQM A;  1RAB B;  1YIT Q;  3QSU A;  4CC4 B;  2V1Q A;  1NBE B;  3OS0 A;  1M2O A;  1QKW A;  4RTV A;  4Z8A A;  4PJO C;  4ZTJ A;  5IXF A;  2P4T A;  5GAN 5;  1N8R R;  4PJO F;  1KD1 C;  1G5V A;  1GXI E;  3REB B;  3LH0 A;  1GCQ A;  4M7A F;  2KAF A;  2HAX A;  3FJ5 A;  2O31 A;  8AT1 B;  3EHQ A;  3QYH B;  3OYE A;  4XQ3 A;  3CCU T;  2HNI A;  4M75 D;  3RMQ A;  3EHR A;  3VJP A;  4FIB A;  2FHD A;  2X4X A;  2B86 A;  3NTH A;  3E9G A;  3QG1 A;  1NG2 A;  2CP0 A;  4XU3 A;  1O75 A;  2QQA A;  2RF0 A;  3SB2 A;  4JRK A;  3L2U A;  4RG8 A;  1NYG A;  2OAW A;  5L8R E;  5LJ5 d;  2MWP A;  3S3M A;  4AT1 B;  4PJM A;  4ME7 A;  2A36 A;  5D6X A;  1QMC A;  1CSK A;  5KYY A;  4FT4 A;  4J5Y A;  1HSQ A;  3VYH B;  4FW1 A;  1NZ9 A;  3OMG A;  4PJO G;  1M1K R;  2KE9 A;  2NUZ A;  2F5T X;  1YI2 T;  1VQ9 A;  4OB1 B;  3CCE T;  3J80 E;  2XDD A;  4OB0 B;  3HRT A;  1MGQ A;  2BKD N;  4RTX A;  4NL2 A;  9ATC B;  1WXB A;  4A54 A;  4ATO A;  3OS2 A;  3OSS C;  1VQM Q;  1M3C A;  4DBQ A;  4AFZ C;  1VQ4 T;  5GMK i;  2QA4 T;  4LDV A;  3JSC A;  3LLR A;  5DLO A;  3CCV Q;  5KH6 A;  1BBZ A;  2BE9 B;  1Q86 C;  1X01 A;  3CC2 T;  3A8L B;  2AZV A;  1UE9 A;  5EG2 A;  1UB4 A;  2KSS A;  5AT1 B;  4IUU A;  3BFM A;  1WDX A;  2YRC A;  1KJW A;  1OI1 A;  5I11 A;  3CD6 Q;  4YTL A;  1YI2 A;  2CS7 A;  2DM1 A;  3I56 A;  1Q7Y C;  1VQK Q;  1EZZ B;  3G4S T;  3MP6 A;  3NFC A;  1UEB A;  3CPW P;  4M75 F;  2DZC A;  3JCM e;  4KGX B;  3QXE B;  2DRK A;  1EIF A;  2LQW A;  2MCN A;  4F7U A;  1SEM A;  1IZ6 A;  3CCV T;  4MZT A;  3JCM P;  1RAC B;  1WA7 A;  1WLP B;  2E6N A;  3ZBD A;  1I8F A;  1QVF S;  4N4I A;  4DEX A;  1ABQ A;  1VQ8 Q;  5GAN 4;  4M7D E;  2YLC A;  1YN8 A;  3QYG B;  4FYV B;  1U1S A;  3J81 E;  1W2B P;  4CI0 C;  2KQW A;  5HY6 A;  1RAI B;  3M59 A;  5GAN d;  4J9F A;  3WVE B;  1K76 A;  2PTK A;  2EVR A;  4V2S A;  1K0X A;  1ZUU A;  2EGE A;  2E6Z A;  3CME T;  4JZ4 A;  2DXT A;  2COY A;  2JTE A;  1Q81 C;  1VQ8 A;  2DX1 A;  1G8X A;  1VQO T;  4J7F A;  2KYM A;  5LJ3 h;  2O88 A;  4E7Z A;  1X27 A;  2A28 A;  1CKB A;  4X34 A;  2A3L A;  2K5L A;  1G83 A;  3FC3 A;  2K6D A;  5GAN 7;  4XTW A;  3AHU A;  2D8H A;  1WJQ A;  3GOX A;  3M0U A;  3GNG A;  4EMK A;  4C8Q G;  1RAA B;  2XID A;  2LNH B;  1VIE A;  1Q86 U;  2FRW A;  1N9S A;  2HSE B;  5LJ3 f;  1OZ2 A;  3G1J A;  2LX7 A;  5KYX B;  2XDB A;  2F2W A;  2PQW A;  2RM4 A;  1VQP T;  1OYX A;  3CQT A;  1YWP A;  4ORZ A;  2L8D A;  3A5Z B;  1KD1 R;  2ZPE B;  2YUN A;  1X2K A;  3E1S A;  2M0Y A;  5LJ3 e;  3CCM A;  4L5G A;  2K3X A;  5FW9 A;  3G6E A;  2GBQ A;  2E10 A;  1RAD B;  2AHJ B;  4HKE A;  3SHW A;  4DQ2 A;  4IKF A;  1R8O B;  2MPX C;  1D3B A;  4KT0 E;  1JRI A;  1FX7 A;  1PD0 A;  3VS0 A;  1VIF A;  4QVZ A;  2DL7 A;  2O4X B;  4PLL A;  1O9S A;  1OU9 A;  2L5Q A;  3M53 A;  3JCM c;  2JT4 A;  2DJZ A;  2OTL Q;  2E70 A;  2P0K A;  1IRE B;  1S1N A;  1Y57 A;  1U06 A;  1N27 A;  1MMD A;  2FZG B;  3EFO A;  3JV3 A;  5HCK A;  1WQW A;  2P4R A;  2RD1 A;  4GY5 A;  5LJ5 e;  2O4X A;  1B7T A;  5M9O A;  4BD3 A;  1VQ7 T;  1ZSZ C;  4M77 A;  1K4U S;  2J6K A;  2KDS A;  5LJ5 h;  3CC4 A;  2QDL A;  2D9T A;  4F04 B;  1AT1 B;  2D8J A;  1T3L A;  3X26 B;  1UGV A;  3RKW A;  1RI9 A;  4D6W A;  2CZ6 B;  3V7C A;  1TOV A;  3H9N A;  1R0C B;  1X75 C;  3A8M B;  1WHM A;  2KY9 A;  2RHU A;  1HJD A;  4C0D B;  4M77 B;  4LDU A;  1WGS A;  3CPF A; 
#chains in the Genus database with same CATH homology
 5CR2 A;  2X4Y A;  3M56 A;  1VQN T;  1PSF A;  3DB4 A;  3HKS A;  2BIV A;  3MEW A;  4XTU A;  1N8R U;  1TH7 A;  1NE8 A;  3PIP A;  2ZPF B;  4KUL A;  3JCM g;  1M1K U;  2WSF E;  1FWZ A;  3FDR A;  2VV5 A;  1M9S A;  4Y28 E;  3CCJ T;  3SWN B;  4C8Q B;  4E7K A;  5I2S A;  4JS4 A;  4JLG A;  1K8A U;  3L2R A;  2EIF A;  5DY9 A;  4M7D F;  4M77 C;  3HHT B;  1K9M C;  4C5H A;  4J83 A;  3RMS A;  4A4K A;  2FYK A;  3CCQ T;  1JJ2 A;  3FLG A;  1UGR B;  3LGL A;  2RJF A;  3A8O B;  4F7U B;  5LJ5 g;  3CPW S;  1U1T A;  3OBY A;  3OYJ A;  3CCM T;  4C8Q F;  1PSE A;  3CCL A;  2EQU A;  3MEV A;  3HFO A;  5C6S A;  1ZQ1 A;  4BB7 A;  4PNO A;  4PJO A;  1QVG A;  5GAN 3;  4M75 B;  4M7A D;  1YJ9 A;  1M8V A;  3OYM A;  2R5A A;  1VQK A;  2ZPG B;  3CC7 T;  5FLX E;  1VUB A;  1WNL A;  2RB6 A;  2BUD A;  2JVV A;  1N9R A;  2LCL A;  2LQK A;  2EQK A;  1DJ7 B;  5GMK j;  2DIG A;  5A0G A;  1WPY A;  3OYN A;  1YCY A;  4L6V 5;  3INZ A;  1QP3 A;  3QZ5 B;  3V7S A;  4WF2 A;  2CGH A;  1JBM A;  3G7Z A;  1RI0 A;  3OW2 S;  3ASK A;  2JOY A;  2QQS A;  3SWN A;  3T9N A;  4C8Q A;  2KVQ G;  2YHT A;  1VQM T;  3JB9 H;  3PMI A;  2M9U A;  3OYC A;  1VQ5 A;  2K5F A;  5GAO n;  1G3S A;  2LTO A;  1YIT T;  1K8A C;  3MP1 A;  3PFS A;  4FSX A;  4R56 A;  3CMA A;  3QKJ A;  2XU8 A;  5GAO m;  3JRZ A;  5J26 A;  2CZ7 B;  3PMT A;  2DO3 A;  2YLB A;  5IN1 A;  5HK3 A;  2QTX A;  3H6Z A;  4A4F A;  3L2V A;  5GMK m;  1M90 C;  4LD9 K;  5CVI A;  2EWN A;  2RHI A;  4P5N A;  1MHN A;  3FIF A;  5CQX A;  1UGP B;  2DTO A;  5GAM h;  1VQL A;  4O5V A;  2XK0 A;  4J7I A;  3VUB A;  5IAY A;  3MET A;  1YHQ A;  4HCZ A;  4C0G A;  4A4H A;  3GIB A;  2RHY A;  3WVD B;  3JCM d;  3OYF A;  1JJ2 S;  4Z02 A;  2EJF A;  4EMK C;  3V7R A;  2MI6 A;  3J7A F;  4DA4 A;  1VQO A;  2OTJ A;  3TRE A;  2LDM A;  1B34 A;  2LT4 A;  3HL8 A;  1YJW T;  1I4K 1;  2DXU A;  1WJR A;  3X20 B;  2E12 A;  1XNI A;  2FL7 A;  1LJO A;  4E7J A;  2LCC A;  1XQH A;  4QQD A;  4M78 A;  2LRQ A;  4JUV A;  5GAN e;  1I81 A;  3SD4 A;  1KC8 C;  2JTF A;  3BW1 A;  5GAN 8;  5CKH A;  2LT1 A;  4TVR A;  5D6Y A;  4A4E A;  3N5B B;  2VUB A;  3OB9 A;  4EMK B;  2ZZD A;  1KG1 A;  3FJP A;  2F5K A;  3CBM A;  3LWI A;  2DPP B;  3CC7 A;  2MMP A;  1BI1 A;  4IUP A;  3FRN A;  2XI9 A;  3HSB A;  3CME A;  4C8Q D;  2OTL T;  2KK4 A;  1M1G A;  1VQ7 A;  5J39 A;  1VQM A;  3GNF B;  3QSU A;  4PLI A;  3GP8 A;  1QP2 A;  2XHC A;  2F69 A;  5CKE A;  3OS0 A;  3S3O A;  5CKD A;  4OGC A;  3HRS A;  1W2B A;  4PJO C;  2VC8 A;  5A2Q E;  5HK0 A;  4ZTJ A;  2VGN A;  4PJO D;  4XTX A;  2P4T A;  3P8D A;  1Q81 U;  1HK9 A;  5GAN 5;  3X28 B;  2DTH A;  4PJO F;  1KD1 C;  1VQ6 T;  3VYG A;  3JCM b;  2PU9 B;  1G5V A;  3OQ5 A;  1GXI E;  4HT8 A;  3ZEH A;  1XOV A;  2K2V A;  1QVF A;  2CYZ B;  4PKC C;  3QZ9 B;  2RA2 A;  3JB9 G;  1QVG S;  3LH0 A;  3OSV A;  3PNW C;  4BI3 A;  4BAC A;  2IVW A;  4DOW A;  3CCS T;  4M7A F;  4PJO B;  1G3Y A;  2KAF A;  3QUI A;  3OYY A;  4OVA A;  3JCM h;  2HAX A;  3OYD A;  5FRM A;  4NOY A;  3QYH B;  3OYE A;  1D3B B;  4XQ3 A;  4XU0 A;  3CCU T;  3A8G B;  2HNI A;  1KHC A;  4ZN3 A;  3L2Z A;  4JS5 A;  4C92 B;  2RHZ A;  4M75 D;  4XK8 E;  2WSC E;  4M7A B;  3RMQ A;  1KQS A;  2LC4 A;  4MZP A;  3MHX A;  4IUV A;  5LL6 S;  3VJP A;  2GQV A;  4FIB A;  4N4H A;  2ZPB B;  1YJ9 T;  1KQ2 A;  2OTL A;  2FHD A;  1VQL T;  4FL6 A;  2X4X A;  4JRI A;  3NTH A;  1VQ4 A;  3E9G A;  3QG1 A;  4II1 A;  2XD0 A;  5DM7 R;  3V8K A;  2LNV A;  3UPU A;  4XU3 A;  3VUZ A;  2L3R A;  4B9X A;  3QJY A;  1O75 A;  2QEX A;  2KMT A;  2A7Y A;  2QQA A;  3TCJ A;  2JTM A;  4JDS A;  3EFS A;  3SB2 A;  4JRK A;  5J3B A;  3H8Z A;  4RCC A;  4RG8 A;  3L2U A;  3CMA T;  2OTJ T;  5L8R E;  5LJ5 d;  1BI0 A;  2WAC A;  2MWP A;  1LOJ A;  2EQJ A;  3S3M A;  2WSE E;  3V8L A;  3DLL A;  1X6O A;  3JCM Q;  3CBO A;  4ME7 A;  1BYM A;  4OP0 A;  4C5E A;  4ZGJ B;  3I55 A;  5D6X A;  3X25 B;  1ZHI A;  4FT4 A;  4J5Y A;  3VYH B;  2CZ0 B;  1NZ9 A;  1WQ7 A;  3VV0 A;  3L42 A;  3OMG A;  1YIJ T;  4PJO G;  1FXX A;  4BE1 A;  1M1K C;  1P92 A;  4M7D C;  2DEQ A;  3KUF A;  4QQG A;  3C95 A;  4M7A E;  2F5T X;  2DTI A;  1KQS S;  4RMO A;  1YI2 T;  1VQ9 A;  3CC2 A;  2QA4 A;  3BY7 A;  2DAQ A;  4JRQ A;  1KQ1 A;  4OB1 B;  3LYI A;  2RK1 A;  3CCE T;  2Y4X A;  4C92 C;  4LD6 A;  2EYQ A;  2MAM A;  3J80 E;  3JCM W;  2K4Y A;  4OB0 B;  3HRT A;  3M54 A;  2M0O A;  1MGQ A;  5CKF A;  2EJ9 A;  4CRI A;  2XDD A;  4E7L A;  4X9D A;  2BKD N;  1QW1 A;  4NL2 A;  4E7I A;  3GPL A;  4KBM B;  5GMK h;  4A54 A;  4QW2 A;  4ATO A;  3OS2 A;  3ER0 A;  2QQB A;  2K3Y A;  3OSS C;  4ELY C;  1VQ4 T;  1H64 1;  5GMK i;  1I5L A;  4LDX A;  2PVO B;  3CD6 A;  4HT9 A;  1N8R C;  4IUR A;  4J6Y A;  2QQ9 A;  3UT1 A;  3OYH A;  4XTV A;  3G4S A;  2QA4 T;  3PTA A;  5GAN j;  4LDV A;  3M57 A;  3JSC A;  3LLR A;  4XU1 A;  4QQ6 A;  1U8R A;  5DLO A;  2XG8 D;  5GMK e;  2EKO A;  2VYT A;  5KH6 A;  3MO8 A;  1YJW A;  4M77 F;  3RUX A;  4XTZ A;  2DXC A;  2DZ9 A;  3JCM X;  1Q86 C;  1X01 A;  3CC2 T;  3P8B B;  5I2M A;  5CK9 A;  4EPC A;  3A8L B;  4OGE A;  5CKB A;  2JUF A;  4J8O A;  5EG2 A;  3M4Y A;  1UB4 A;  1B34 B;  3EAE A;  3I55 T;  2DVE A;  2KSS A;  2E5Q A;  2VGM A;  4IUU A;  3O8V A;  5GAM j;  4BE0 A;  3BFM A;  3MP8 A;  4EMG A;  5CCA A;  4M7D D;  3HFN A;  2V8I A;  3QII A;  3FEO A;  3LX7 A;  1OI1 A;  2FB7 A;  4IUQ A;  4OF1 A;  4RG2 A;  5GMK l;  4JJN K;  1M90 U;  4M7D B;  3CXC A;  3JAM E;  3CPW A;  2EJG A;  4N0A C;  4YTL A;  4BY6 B;  2CS7 A;  2QDY B;  4C92 D;  5GAO l;  3I56 A;  4E7H A;  4F7U F;  1YI2 A;  1Q7Y C;  2D6F A;  1VQ9 T;  2E1H A;  3G4S T;  3PGG A;  5GAM f;  1VQ5 T;  5GAM d;  2X35 A;  4C92 A;  5D6W A;  4X9C A;  3MP6 A;  3NFC A;  2EFI A;  1UEB A;  4XAX B;  4PJO E;  3OMC A;  2FVU A;  2RI3 A;  2XKO C;  4M75 F;  4M77 D;  3A8H B;  1Y71 A;  2DZC A;  2XIC A;  3CBP A;  4M78 C;  5CIU A;  4F7U E;  3JCM e;  3L2W A;  2G3R A;  3QXE B;  3ZFJ A;  2DKG A;  4C92 E;  2M1H A;  3RKY A;  3DB3 A;  3M5A A;  4FM4 B;  1VQ6 A;  1EIF A;  5KCH A;  2PVD B;  3DKM A;  5GAN f;  4F7U A;  1BI2 A;  2E41 A;  2E64 A;  4M7A C;  3V8J A;  1IZ6 A;  3EFR A;  2ZPH B;  3CCV T;  4C5G A;  4HA8 A;  4M7D A;  1QVP A;  2QEX T;  4MZT A;  3TU4 K;  3JCM P;  3SFM A;  3MEU A;  2E6N A;  5GAO q;  2PUO B;  3CCQ A;  2Y90 A;  3ZBD A;  1I8F A;  3JB9 D;  1QVF S;  3NTK A;  4N4I A;  4NS5 A;  4M77 G;  5CQY A;  1Q82 C;  3ME9 A;  1M5Q 1;  2X4J A;  3M4G A;  5GAN 4;  4M7D E;  2YLC A;  3SWN C;  4J6W A;  3QYG B;  3WXM B;  2GCX A;  4C8Q C;  3OS1 A;  2CZ1 B;  1U1S A;  2GFU A;  3JCM V;  4ZN1 A;  3J81 E;  2OAU A;  5LJ3 d;  3OYL A;  3HRU A;  4C8Q E;  1S72 A;  4CI0 C;  3CCU A;  1BIA A;  3E19 A;  2XDP A;  1W2B S;  2GF7 A;  3KXT A;  3HPW A;  4M78 F;  4PL6 A;  4Q5W A;  5CAI A;  2KQW A;  3M59 A;  4KUI A;  1V29 B;  1WJS A;  4MMK A;  5HY6 A;  5HKC A;  5GAN d;  3WVE B;  1AHJ B;  2ZGW A;  3C94 A;  4OB2 B;  4L59 A;  4V2S A;  4HCC A;  5FRN A;  4ELZ C;  2E6Z A;  4F7U G;  4M78 B;  3CME T;  2B8A A;  3HP9 A;  4M78 E;  3TEE A;  2DXT A;  5FU6 B;  2HQX A;  1ZBX A;  3R6O A;  3LW5 E;  1Q81 C;  4Y91 A;  2PUK B;  1VQ8 A;  3VU3 C;  4J6X A;  3OYG A;  3CCE A;  4LDW A;  2RJD A;  2MF2 A;  1VQO T;  2LVM A;  4J7F A;  1Y96 A;  4MZM A;  5LJ3 h;  1VQP A;  2CKK A;  3PT9 A;  2IG0 A;  4E47 A;  3UWN A;  4UC4 A;  3OYB A;  3G6E T;  1BI3 A;  5A0L A;  5GAN g;  3JB9 F;  4X34 A;  2A3L A;  5GAM e;  1N6A A;  3CCV A;  4C92 G;  3OYA A;  1S72 T;  5LJ5 f;  4M7A G;  3QJ6 A;  1SSF A;  2K5L A;  2PVG B;  2RI2 A;  2RJC A;  5FU6 C;  3FC3 A;  4MDX A;  3CCS A;  4N0A A;  4GLK A;  4XTW A;  3GF5 A;  4B9W A;  5GAN 7;  3AHU A;  4M7D G;  1WJQ A;  1RL2 A;  5FRO A;  5LJ3 g;  4ZGE B;  1NPR A;  4M75 E;  5CO7 A;  3GOX A;  2XDB A;  2V8J A;  2JNG A;  2LQ8 A;  2RO0 A;  3GNG A;  4EMK A;  4ZGD B;  1YHQ T;  4C8Q G;  2XID A;  2YRV A;  1VIE A;  1YJN T;  1Q86 U;  2RH2 A;  1N9S A;  4M75 A;  2GFA A;  5LJ3 f;  1OZ2 A;  1M1F A;  2EAY A;  2ZPI B;  1Y96 B;  1XTD A;  2HBP A;  2RM4 A;  2PQW A;  2X4W A;  1OYX A;  2V8K A;  3L2Q A;  1VQP T;  4HCB A;  5KE3 A;  3C12 A;  1K73 U;  3OYK A;  4A53 A;  2L8D A;  2K5I A;  3CEY A;  3A5Z B;  3OYI A;  2EQM A;  2ZPE B;  5GAN 6;  3FB9 A;  4QVC A;  1NJI U;  4O6J A;  2O01 E;  3DLM A;  3S6W A;  3E1S A;  4BUG A;  3QHS A;  4JLI A;  3CD6 T;  5LJ3 j;  5I21 A;  4BY6 C;  3OS5 A;  3OY9 A;  5LJ3 e;  1YJN A;  2JZ2 A;  3QO3 A;  3CCM A;  1Q82 U;  1H3Z A;  4L5G A;  2K3X A;  4M75 C;  3BDL A;  3RES A;  4FU6 A;  1YBY A;  1KHI A;  5KCO A;  5GAO r;  2HQE A;  4BDZ A;  3C4S A;  3G6E A;  4C0F A;  2E10 A;  5GAN h;  5C0M A;  3GLX A;  2C06 A;  3QBY A;  1VQN A;  2AHJ B;  4HKE A;  2DD5 A;  3CCL T;  2RJE A;  5A0D A;  2MWO A;  3QDR B;  4DQ2 A;  3S3N A;  4IKF A;  1R8O B;  4KT0 E;  1D3B A;  4MML A;  3CXC S;  5LJ5 j;  1G3T A;  4C92 F;  1JRI A;  1FX7 A;  5FU7 B;  5KE2 A;  1UGS B;  3Q1J A;  4M7A A;  5GAN 2;  1BIB A;  1VIF A;  4QVZ A;  4C5I A;  2O4X B;  5GAO p;  4PLL A;  4JRP A;  1NJI C;  1O9S A;  3LWH A;  2L5Q A;  3I56 T;  3JCM J;  4NL3 A;  3RKX A;  2Y4Y A;  2JN0 A;  3M53 A;  4FT2 A;  2VXE A;  4M75 G;  3JCM c;  1Y07 A;  4EMH A;  3OA6 A;  3M58 A;  1LNX A;  3SDZ A;  4N4G A;  3G71 A;  4BDY A;  1M4Z A;  4LDY A;  4OB3 B;  5FU7 C;  2DJZ A;  5GAM g;  3X24 B;  4IUT A;  3QPH A;  2DD4 A;  2E70 A;  2I2L A;  2LX9 A;  4VUB A;  4C0D C;  1Y7X A;  4C0Z A;  2P0K A;  3M55 A;  4BE2 A;  1KD1 U;  3CC4 T;  2H3J A;  1IRE B;  2QXF A;  2DK3 A;  2ZCF B;  2D0Q B;  3P8H A;  5AYF A;  4M77 E;  2DXB A;  4RCB A;  1N27 A;  3JCM f;  1WQW A;  1K9M U;  2QQR A;  2RD1 A;  4GY5 A;  5LJ5 e;  1NPP A;  2O4X A;  3RIR A;  2R57 A;  4EDU A;  5M9O A;  3CCR T;  4XTY A;  4BD3 A;  4BI8 B;  1VQ7 T;  4M77 A;  1JB0 E;  1Q7Y U;  3E9F A;  3BDU A;  1UGQ B;  3CCR A;  2NLU A;  3OW2 A;  2KDS A;  4BI4 A;  5LJ5 h;  3URG A;  2P0Q A;  2QI2 A;  4R55 A;  1W4S A;  2HD0 A;  3CC4 A;  4MDW A;  4OMF B;  4ZTF A;  1OZ3 A;  3MEA A;  4A4G A;  4M78 D;  3L1A A;  2RK2 A;  4QVD A;  1YIJ A;  2D9T A;  3OBW A;  2R5M A;  1HXD A;  3KBG A;  2R58 A;  3MCA B;  4M78 G;  3X26 B;  1G3W A;  3CCJ A;  1VQK T;  1K73 C;  3RKW A;  1KC8 U;  2E65 A;  4D6W A;  2CZ6 B;  3LGF A;  3V7C A;  1VQ8 T;  2VXF A;  3PIO A;  2L89 A;  2RI5 A;  4RKU E;  3A8M B;  1X75 C;  1BKB A;  3F70 A;  5DLQ E;  3JB9 I;  2KY9 A;  2RHU A;  5IT9 E;  1YIT A;  4XU2 A;  2P0P A;  3JB9 J;  3RER A;  2K57 A;  3UDC A;  3G71 T;  4C0D B;  2M16 A;  4KUD K;  4M77 B;  2DIQ A;  3VKI A;  4LDU A;  1WGS A;  3CPF A;  3M9Q A;  2RHX A;  3NTI A;  4DOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...