4X9HA

Crystal structure of dscam1 isoform 8.4, n-terminal four ig domains
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
395
structure length
391
Chain Sequence
QKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVSQFYITEAENEYVIKGNAAVVKCKIPSFVADFVQVEAWVDEEGMELWRNNYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVSPQLSGNGNQEHITLTRVPKMGSVTLMCPAQAYPVPFFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Dscam1 homodimerization: Insights into context constraint for protein recognition
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
molecule keywords Down syndrome cell adhesion molecule, isoform AP
total genus 71
structure length 391
sequence length 395
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9hA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9hA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9hA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9hA04
5DMGD 3RWHA 4O2CB 4Z7WB 3NTCH 2PO6A 2GKIA 3T0EA 1FAKT 5I8CA 3P4MB 4WVRA 4G9FD 1FLRL 4P59L 4RDQF 4HEPG 4QHMB 4CVZB 5DRZB 1A7BA 3B2UC 2QHRL 3KXFB 3VH8B 3D0VA 4M1GH 3VFSA 4OD3H 5ICZA 3EDJA 4FZ8L 3QJHB 3RVVD 5JW5B 1K8IB 4UV4H 1WBYB 4PJDF 5JXAH 3MRLA 3ULVL 3IS0X 1R3HA 4M1DH 5ADPH 3TIDB 3MV7E 3F62A 3RY6A 4QOKE 4O2FB 4QOKA 1P4LB 5I71C 4GRWB 3VRIA 5HI5D 4Y16D 5HD8C 3ARSA 1CU4L 1YDPA 4TSCL 1OARH 2HT4C 3D9AL 4K8RH 4UU9A 2EYTB 1QSEE 2W60A 2Z8RA 3RGVB 1RURL 1ERNA 3KHOA 1AI1L 1INEH 1C1EH 3AXLA 1E6JH 5TE4L 4MD5A 3EO0B 3OAYK 1DVFC 3E6HA 3KR3L 3V5HA 3C60C 4X4XB 4B41A 2OZ4L 3FFDA 4H0IA 4IIQA 4L9LA 1BFOB 3PNWA 2VIRB 2B0SL 3P4LA 4TQEH 5EOQH 4JKPL 2DBLL 4OGXH 1I8IA 2PXYB 3QIUB 4BQ8A 5IVXB 4P3CL 1FCGA 3PHSA 2D3VA 2H9GB 2VLLB 5BW7A 3SDAA 3KPPB 4JZNA 2FJFA 3AY4C 1Q72H 4N90D 4AIZB 5I1KH 1YNKL 4UZGA 5DWUL 4NQDA 4NCC1 2O93L 4Y0GA 3D3VE 1CI5A 2I5YL 5D7LB 1WQVT 1A6ZA 5C08D 4NQTA 4H0GA 3BZFA 4TUJA 4UQ2B 3RDTA 3NFPB 4X7DC 2ICEB 2X4TA 3B9EA 4RGMC 4XBEL 3FAWA 4YIQB 4HIJA 2NYYC 3QCVH 2Q8BL 2X4QA 3PHQA 3D6GA 1L7TL 4XNQB 5T3ZL 3KYOA 4D0CA 3TO4D 1HK6A 3D69A 4WO4B 1NL0L 4YDVB 4JN1H 4I13B 3GI9L 2H26B 2V2WA 4PP2A 2QADD 4H1LG 1QPXA 2J8HA 4EI6A 5EC2B 3TN0D 4OM1H 2R8SL 4QRPB 1OOAA 4F7PA 1A6WH 1FFRA 5ID0B 3KJ4B 4JFZL 1OAXL 3D5OF 1FP5A 1MJ8H 5JHLL 5F7WC 1RY7B 5C0ND 5IW1A 4RISH 4XP1L 5D7JB 4PJAB 1FFPA 2EH7H 4ETQB 5JQHC 4PGEA 3MRQB 4DKFH 1XF1A 1TVHB 4ODVL 4P3DB 1H5BC 4I4WA 3N06B 1BGXL 2J2ZA 3O6KL 4E42A 2VOTA 2QKIB 5HHNB 4DKEL 2YUZA 4OQTH 4MA7H 3OGOE 1HOCA 4P2OD 4H1LB 4WHTA 1B3JA 4QRTB 3AC0A 5DQJB 1TFHA 1OGAD 2I26N 3NPSC 4HJJL 2NLJA 4JGMA 4GMSH 4YDKH 5JDSA 1C8PA 2P4AB 2JB6A 5ICXB 5DEFB 3EFDH 3BW9A 1ZE3C 3GSNB 4K55A 1ULVA 2NX5D 3MC0A 3S36L 5I1GL 3CZFA 1CXEA 2CSPA 4P5KA 4LSSH 1F11A 3BT2L 4BSJA 5I8EB 1VFUA 2YPLB 5LG1A 2GSGA 4YBLC 4HWNA 2JCCB 4Z7VA 1QSFB 4LSUH 4R96A 3U0TA 4NZDA 3LQZB 3IDIA 5CHNA 4HIXH 4RMRA 1NGQH 5EU4B 1BWWA 1YMMD 1QRKA 2BOBA 2AV7A 1Z5LA 4WWKA 4BK4A 1ES0A 5CILH 4YE4L 4PJBF 2VSDA 4AZ8A 1PLGH 3KPRA 5FUOL 5JMRA 2FLBT 3HAEA 4H1LA 1M7IB 4WHTB 4PJEF 1SEBB 3ZDXF 3MRQA 1GOGA 2BHZA 5IHUH 4ZDHB 3RWFB 1LO2L 4IDJL 5E99H 3DXAE 4JJ5A 2LQRA 1KIUA 3BKJL 3VXRB 4Z95L 3MV9E 5K33A 4U7SA 1MQKL 2OZ4A 3U0TB 4QHNB 5TDOB 1XMWA 3MUJA 1FVCA 4KAQL 1BQUA 4MDIB 4RQQB 4JFOA 5IFJA 1A6VH 3UPRA 4XC3H 2N4IA 4XHQA 4OGYL 1FYTD 1SMOA 1YMHB 1JVKA 1HQ4A 2AABL 4TVPD 5ACZA 1S9VB 2X1XR 5CIPH 4G8IB 3S96B 1FH5H 4Z7UB 2OJZL 5HYSA 2WUBH 2V17H 3RPIA 1NGWA 3MTRA 5I66B 2JB6B 5ICXA 12E8L 2PTTA 2NXYC 1WAAF 4G8EA 3VRLE 3J8F7 1DQLL 3K2UH 3QEHA 3NFPA 1M71A 1F11B 4OCYH 4WHDA 1G0YR 4HV8B 3MRRB 1PQZB 2Y7QA 5HY9B 1X3DA 2C4XA 4FQHB 1JNLL 3HS0B 4NC0B 3OAZH 1ORQB 1ZOXA 4FA8A 3X3FL 3SKOB 2EDRA 4EUPH 4ZAKD 3ZKNC 3BD4A 5JTWA 2OL3L 4Y5YB 1J0YA 1BFVL 4P2OC 2DI9A 3MFFB 4R90H 2UZXB 2CQVA 4NQCA 3U0WL 3GKZA 3RX8A 4WW1B 2B5IC 2ENYA 2PUQT 1QKZL 3KNBB 1RUQL 3M45A 4XXCA 5C0AB 4Z7NE 2JJSA 3X3GH 1KGCE 1NMBH 2DIAA 2DQGL 1FFOA 4FQQB 4JZOB 5SWSD 1PY4A 4HS6A 4C55A 5HHXH 3PJSA 2ORBH 1FNSH 3FT2A 1FE8L 3BKYL 1TZHA 2ATKB 3EJJX 4FXLA 5JDJA 4G8GA 4JJHA 1NCWL 1IAOB 4OLZH 4RMTA 1UXWB 3ZTNH 1OPGL 3CUPB 3MREB 4KQ4L 1HH6B 4U6HA 2GTZB 5KVGL 1J5OH 1J1OH 4JKLA 4K2UH 4KHTL 3LKSA 4FFWC 5HBBA 1MCWM 5KG9B 1DQMH 1OQXA 3RWGA 1DQML 5C0RL 5J4MA 2YXMA 4WI6A 4PJ7E 1MCJA 3T2OA 5K9KA 3DI2B 1NGYA 2BVOA 4ALAH 4RFNB 3T0EB 4Z0BL 5EO0A 3K3QA 5EZLA 2A77L 4ZPVB 1J88A 1Z9OA 4Y5XC 1BJMA 3WSQL 1BJ1J 3NGBC 1KG0B 4L8BA 3VRJA 4PLKC 3MOQA 5IM7B 1DP0A 2GY5A 4NKDB 2A0LC 2DBJA 1KLGA 3ES6B 3TH4T 1BF2A 2J4WL 4D9LH 3EW3B 4HUXB 5IJVB 1P9MA 1C16A 3SDDD 2VDKL 3BKCL 1QRND 4PJGF 4Z7WA 1JPGA 1HWGB 1Q0YH 4ODTL 1X5KA 2FCBA 4Q9QH 4R0LC 4XWOD 4BZ1L 4JPIA 3CDYA 2ZCKL 3BJLA 5C92A 5FYKE 1CGUA 2NXYD 4BKLA 1U3HD 1JRHL 1MSPA 5I1IH 3L3DB 2DLIA 2HMID 4ZYKB 4DVRL 4O2FA 1AR2A 4XMLH 4AQ1B 4YHZH 3A6CL 4LF3B 3MJ7B 5DMKA 1UWXK 4X7SH 2VDLH 4TSBH 5F6IC 1KG0A 4L3CB 1GZPB 2CR6A 1NL0H 3QUXD 2APBA 1A4KA 2W65A 2IJ0C 5F72S 3UJIH 4H26B 1I3GH 1N0LA 4NHCL 2XICA 2X1WL 4KKBC 4QXWA 5BOPA 5HYJE 1IGFL 3IJSA 1C5CL 5DVKA 1K8IA 2ADIB 2IADA 3JUYA 3VFGL 5KS9F 4GAGL 4U1KA 4YDLB 1U8LA 4LP5A 5CD5D 1IFHL 4Y89A 5EPMB 3RI5K 3WV0A 3EJYC 4YEFA 3ZE1E 1MJJA 4O02L 1G84A 4MQXC 2DQDH 5SX4H 3IXAB 1FPTL 2V5RA 5I16B 1NGXB 1GIGH 1A7PL 4Z6AT 2P8PB 2PCPB 2K9UA 4XC3L 4Z7OE 3WUWG 2EZ0C 3VFUA 4JG1L 1QFHA 32C2B 4NM4H 1BFTA 2VWEE 3MJ9A 1IARB 3VE0A 3CU7A 4YPJA 2D9QB 3RIFK 3QI9B 1I1AB 4AG4H 2A9MH 1EEZB 1FAIH 2O5ZH 4PS4H 4JRYE 5DHVB 5B22A 5HDLA 1CN4A 3CC5A 3D69B 2QADC 4HIJB 1HH9B 1MJJB 3RJDA 1MVUB 1RZFH 4YUEH 3S5LB 1TIUA 1OTSC 2EDLA 3BP6B 4IOIB 1CF8H 1MHHA 1TVDA 5E8PA 1Z0NA 3U9UA 1IC4H 2NXZD 1V7ML 3TVMC 1KN4H 5B38G 2YA0A 2W65B 1TZGH 3OXSB 4XP6L 3MRLB 4OJFL 2C3WA 4E0RB 3ZYIA 5FA3A 2P8LB 3O2WL 1DCLA 1E27B 1RK1A 1F45A 4FFYL 1DSFH 2AXHA 1EAJA 1F6AA 2AKRA 3UTTE 3LEVL 3RRQA 2Z93A 3LRHA 3MRMA 3GSRA 5D7JA 5KSBE 1HHGB 4TYUA 4TPRL 4Q0XH 1JBJA 4NSKB 1RJZB 2A6KB 3RKPA 3UYPA 3QXAB 3RZWA 1RMFL 1LD9A 4IS6A 1AGDA 1NANI 3LV3B 3U2SA 2GSIB 3T2PA 5K59E 3CFDA 5HSFA 2BNQB 3VWKD 2CR3A 2WP3T 4O9HL 4N1EA 5CSZB 1GGYA 4Z7QF 32C2A 4PBVC 5DJCA 1FORL 4WENB 2Z92A 1QA9B 3GO1L 1QFWI 1CICC 3BFOA 4IIQC 4WCYH 1NLBH 4BELD 2BCKB 3QEUB 1T1YB 1ZT1A 4KDTA 3INUH 1SJHB 2ZSWA 1S7WB 4MCYA 5BJTA 1YEDA 2FO4A 4R26H 4WV1A 1QLFA 1FL3A 2FATL 2RCSH 4PJHF 1BOYA 1D5XB 1A6UH 1JCKA 4PJ7A 4W4NA 4LEXL 5AEAA 5HGDB 1K3IA 3SDAB 3V4UL 3SE9H 1F3DH 2ITCA 1FLTX 5JNYB 4E5XB 2VUOA 1S7SA 4XPFH 3OXSA 3BRFA 5IOPB 1ACZA 1TJIL 1XGYL 5IQ7L 1RVFH 2B4CL 4OZ4A 3CZFB 4CVZA 3UBXI 4PJCB 2I9TB 3D2UB 5EU7C 4LPVA 2QQNH 4ZG1A 43CAA 1BFSA 5FV1L 5E4EC 5T3ZD 5J3HC 2VYRE 3D2UD 1VERA 4Z0XA 4WFHE 4PRAA 4ZQKA 3QUYC 4G80B 2EEDA 3V7AE 1ZEAL 5FEBA 3VXUD 4HJGA 2W07A 2VJXA 3UTZA 5C07D 3C5ZB 4UNVA 3BGFC 4M6OL 2DLFH 3RI5F 4R4BB 5BVPL 5HVFB 1X7QB 5DJXB 1R5IA 3BZEB 1F8TL 3ULVE 2CRYA 1Y0LA 1SJEB 2E8ZA 1OQOA 4PRPA 3THML 1L7IL 4M48H 5DLML 2VDMH 3V0VA 3S34L 2IANB 4OIAA 5IBUG 3V0WH 4XRCA 2DMKA 2XZCL 5AWNH 4LPUA 1NC4A 2DQUH 4KRMB 5E8NA 3VD5A 5TQ0H 1AH1A 3T4AA 2BVQB 3CMOL 4LAJH 4XNMA 4DAGL 4YJZL 1KYOK 1CFTA 1PQZA 4XC1L 1FC2D 4ONFL 3ZDZE 2DD8L 4X6CE 4LOUC 5E8PB 1DQJA 3U9UB 4UQ3B 3WIHH 3HPLB 1EAPB 1RU9L 4XPHH 5FM4A 5E56A 4MJ4A 1A6VL 3VWKB 2JCCA 3W9DA 2OXGA 5I75B 1VKXB 2YXFA 1JZ7A 2ZCLL 2GJJA 1CLZL 5D1ZD 1BOGB 4X9IA 4C58B 3OJMB 1Q9WA 1H3TA 4R97B 2YUXA 1FYTE 2CXKA 1S9KC 3WUZA 4D9QE 5J9PB 4L8DA 5DK3A 1RHFA 1VB9A 1M7DB 5IESL 4WW2B 4GW4B 1ZEAH 1JI2A 4PJFB 5CP3A 5E8EA 3QHFL 4ZDHA 1MF2H 1NGQL 1AO7A 4KWUA 3OBAA 5EUOB 5FK9A 1YC7A 3HI6H 1HSAB 2AJVH 3OGCA 4DVBA 1C12A 1NMAH 2JF1A 4P4RA 2EICA 1YY8A 4HFWA 1NBYA 3JV6B 5DHYA 5DD6B 3G04A 3NBNA 1PDKA 4Z7VE 3B6SA 1J8HB 4MNQA 3SGJC 3HB3C 5I1KL 1TXKA 5I76B 2HKFH 4YDJA 5HVGB 3AAZA 2CPCA 4ERSL 3IDNB 1AHWA 3JBG7 5KJRL 3RUGE 1DLHA 2NR6C 4FRWA 2J8UB 4HHAB 2CMRH 3IDYC 4NYLB 1ZWIB 1NBZB 3RL2A 1N26A 4R4NC 4JFPB 3L7EA 3GB7B 2Y7QB 3WKNA 4HT1H 4HUMB 1WBYA 4P5MA 4XX1G 4GAJH 5D72H 5MENB 4PRBA 5EBGA 2Y07L 1Q8MA 3WMSA 1UADC 5DGQA 1OSZA 4GKNA 4XB8A 2XV6B 4NN6B 1BJ1H 5TPWH 1OM3H 4MAUH 4ONHB 4HIHB 2Q7NA 1KBGL 3MV8B 5T1LB 4OLWH 5A2JH 1NUNB 1ZT4A 3O6FC 3BESR 4RISL 1MI5E 4XVSH 2AEQL 1KB9J 4MNHA 3KR3H 1IEHA 4UI2A 4HUUB 3K80A 2ESVB 2YPKA 4DVBB 3NAAH 3GHBL 1EFXA 4EDXB 4PGCB 4KK9D 3KNBA 2OTUB 5LCVH 2JJSC 5E00A 1JTPA 4FQLH 2YEZA 3WFZA 2CH8A 2V5SA 2DQHH 3B9KC 3EJYD 1Z5LB 4UNUA 4P4KB 3STLB 3U46B 3BJ91 4WJ5B 3IYLW 1GH7A 3AFLA 3PHOB 1YN7B 4PREB 2WWKO 3L3IB 4XNQA 5LQBH 2DJ4A 3BP7A 3SKNB 4ONHA 3TT1H 3H3BC 1LO3L 3WCYA 1XGPB 1J87A 4BZ1H 1Q0YL 4ODTH 1KTDA 3K2MC 1HYSD 4FTVE 1YEJH 5FGBA 4ZSOE 3JWOL 5E5RB 1XF5B 1XGTA 1MLCB 1OSZB 1SBBA 1SVCP 3TO2B 3RNQA 1MCRA 1NBZA 5IJKA 1U8OB 1JPTL 3P9LA 5L88H 3A6BH 4URTB 1JWUB 4JRWA 3ULSB 2QR0A 4OLXL 3FO0H 4KKCD 3OXRA 3NCBB 1FNHA 4P5TD 1FNFA 4N0FA 5T1DL 5HYSB 5FDWA 1JF1A 2E9JA 5A1AA 1OP5K 1AGFA 3CVIH 1S9WB 2JIXA 3T0ED 3DYMA 3MRNA 3SQOL 4R7NB 4K9EH 2H2PC 2ZOLB 4OLWL 5HHMB 4V1DB 1FV1A 5KSBA 2RB8A 5IB3A 5CEZH 2HFEB 2R0WH 2EC8A 3G5XB 5GGTA 1DSFL 1TJGL 4KKLD 1K8DA 3HUJA 2APTA 3BMVA 3GEWB 3RVWD 2DQTH 3P77B 3RVVC 2GK0A 4Y4HC 4ONFH 5GS0L 5E2VH 1RJYA 5E2VL 4HK0B 2CRMA 3Q1SL 4DKEH 4JM4L 3FN3A 3E6FB 1GIGL 4G6KH 1WBXB 3DURA 3KLAA 5DJ6B 1FNSL 4UU9B 3HMWH 1G0XA 1LK2A 1RZKL 4MQSB 5E2TL 4OGYH 4GKNB 3NIDE 3P2TA 3SDXE 3UX9B 4F15C 5JHDB 3AREB 3QUMA 4POZD 3ARBA 3S88H 2ZJSH 5ITBL 3MRMB 3QPXL 5T3XD 1QVOA 3IJHB 3QXVA 2D4DA 4NJ9H 1VACA 1W2KT 3RWEB 3LMJL 2BXZA 3CFDB 3RFZC 5LXGL 3QXAA 3JZ7A 4N1CA 5IVOA 5C0AD 4PS4L 4N68A 2PETA 4C56A 3SCMD 1E6JL 5TE4H 1LNUB 1LVEA 4NZRH 3GHEL 4OZFH 5HHPB 4NZRL 3ZLQC 2WIMA 2VDLL 4TSBL 4JY4B 4R7DB 3P4MA 5F1NB 1P84K 2DKSA 2FDBP 3O2DL 3EYSL 4OLUH 4XP9L 4ZAKB 2UWEA 2CK0H 1BVZA 4O4YL 2C7UA 5IUSA 1G9MC 1X6NA 3VXSD 2DDQL 1KIPB 4LKCB 1NEUA 1A1OA 1LE9B 5J56B 3VI3F 1EXUB 1MWAB 4BFEA 1CFNA 3ARFC 5KAQF 4EXKA 3PDDA 4YHPB 5F3HB 3WUWA 5D2LA 4HULB 3BGFB 1TZIB 4OUOA 2VIRA 5INCB 4LLVB 1E0OB 2P5WE 4DZBB 3VFRA 1I1AA 2DTML 1MCFA 1T66C 4UTAL 3PWLA 3WIHL 1X5ZA 5DHVA 4ZFGL 4KAQH 3H9SB 2YD8A 3W11C 4LARH 1GGIH 2BY2A 4DWHA 3G5YA 4YDIL 4OQTA 4XVUC 4HW6A 4G9DA 5E4EB 3FMGL 3V79C 4ZO7A 2YD4A 3GMNA 4NWUL 1DLFL 5HDQL 5B3JE 1NLBL 1I8KB 2WUCH 5D1ZC 4MAUL 1QBAA 4PJCA 2I9TA 3T0XA 5FV2A 3ARGC 2X4TB 4RRPA 5JMOC 5F89A 3AU1B 4XP1H 3SOBH 3WJLC 4OV6F 2AGJH 4XAWH 4PB0L 5C0NC 4F9LC 1AQKH 5IB4A 3NH7H 2ED9A 3RA7H 1UJ3C 4LRNH 3CH1A 4PJGA 5KTEH 2V2XB 2ED8A 2WV3A 2GUOA 1GZPA 1YMMB 3MRDA 4BFIA 3LSOA 2VQUA 5F1NA 1F4WL 4JDVA 4EN3A 5DS8A 2XTLA 1UACH 3WDIA 3MRCB 2IGFL 3DRTA 5LGJA 1KC5L 2G9HB 2Y36L 1MAMH 2YPLD 4C56B 2V7HB 3QFDA 2X4SB 3QZWB 5FGCE 1QA9A 3HC4H 2MCG1 3QO1A 2H26A 2Q3AA 2E7HA 4PP2B 4B50A 3MRPB 2FJGB 1NFDF 1RJYB 2E7BA 5C6TL 3O3BB 1U8HA 4RFOL 4LCUA 1CD0A 4BQBA 3SCMC 2XFXB 5F3BB 5J12C 5GISL 4S0TD 3VGHA 2Z31D 1OGAB 1XIWB 3ZKSD 5CEXB 3QJFA 5D5ME 1Q9KB 1ZLVH 3UJJL 4NQVB 3PIQB 3BQUC 2WWMD 4L8BB 4PRHD 5CJXA 1MFBH 1RZ8B 3S35X 4LU5H 1WTGT 4RWHA 4EIZC 2BFVL 2GUOB 1OW0A 2UUDK 1SBSL 2AV1A 3P4OA 4GW5B 2O5YH 1IC5H 3PDOA 4ZD3H 3MBED 3N85H 2APVA 2IALA 5IK3B 3GSXB 4KTDH 4JRXA 3RU8L 5I30H 3PP4H 5FFLA 4Z5RA 3IU4H 4QO1A 1U3HC 3HZMA 5GS0H 1YNLH 1SY6H 4N9GB 4U1IB 4X6BA 3DX8B 2XWBA 4HUVA 1RD6A 3W11D 1EHLL 1I8KA 3DMMD 1WK0A 3Q6GL 2JJVA 4MJ2A 3MLVL 4K94L 3PWPE 3NCJH 4ZNCD 1EO8L 4L29A 2F54B 1D5BA 3CH8A 3O41B 1EEYA 3QFJE 1Q9OA 1OM3L 4M03A 3GIVB 3EO1B 2JJWA 4O51B 2GTWB 4D9QD 5IHLB 5IFAH 5B39G 3ZKMC 3O6ML 1GGBH 3QNYA 5JHLH 3L3GA 1YC8A 5DMJB 5EIVA 3WFBL 1V5JA 4IOFC 4MHHG 5L88L 6FABL 4Y5YA 2PXYD 2H2SC 3F7PC 4PRNB 4JANB 8FABB 3O6FD 2P7TA 2OZ4H 4YO0A 1JTTA 1K2DA 2BK8A 3ARZA 2AEPL 4P5TC 3ZKND 2YPVH 2FX8L 3LEXA 3RNKB 1KIRA 5J1AA 1IKFH 1P5VA 1QPPA 5ESQB 2BOCB 1O0VA 2P49B 1IGTA 3RY6C 2FGWH 4CVXA 2FBJH 4M7ZC 2AK4A 3BWAA 5I8OL 2ADGA 1A14H 3QSKB 4RIRB 4G6AD 2XA8L 3OKLA 4XVUD 4I9WD 2ZWLT 4OGAD 3DNKA 35C8L 3W2DH 4U6VH 3OSKA 4JFFD 3JWNC 2ATPB 1VENA 4NNYA 5DK0A 4FQ2L 2DYPA 4Y16B 1MUJA 4EUPA 2E9IA 3MNZB 2DWDB 5EZJA 4LMQE 4P9HL 2J8UA 4PLJC 3KS0J 4YBQD 3TLRA 4OZIB 3MLUL 5E1HB 1FG2A 4LLYA 1NH6A 3DETD 3RKDC 1T1XB 1XR8B 12E8H 2AQ3A 4Z77A 3INUL 2HVKA 4QNPE 1N5YL 3TFKD 4AM0A 4JFZH 3ESVF 3D3VB 5CJ8A 1U8KB 3PL6C 3TGXA 2FIKA 1G0DA 4H20H 2Y5TA 1MH5B 1LO5B 3MBEC 3MJ8A 1EK3A 2NY6B 4RFNC 1JF1B 5DI8A 3F7RA 1CTNA 2CDFB 4X7TA 2OS7A 3MO1A 2R0ZH 5DFWH 5F1IA 5GSRB 2WQRA 4FZEH 4M93B 4MA7L 2SEBA 5DD5H 4PJ5E 3L5IA 4PLKD 4QT5B 3NZ8A 5CD3B 2Y36H 4HX1B 4Y2DA 3RJQB 1SQ2N 4YXHL 3WFCL 2NY1B 4WTZA 1JWUA 1CGWA 3MZGB 3VI4E 4XPBL 3GK8L 2XXCB 2EDQA 3GUTA 2AJYH 2IQ9H 3LKSB 4K3EL 2CLZB 4TSAH 3SKJH 1BPVA 4ELMA 4PJ7F 1CFVH 4POZC 3L3IA 3GSWA 3TIEA 1KJMB 5BRZA 1J0HA 2BY1A 4HS8L 4UDUA 3NFSH 4YUEL 4G8GB 1IM3B 1L6XA 3H0TA 4XNUH 2P5WB 3EO9L 3E8UH 1HHHB 4MJIE 1PKQB 4LFHD 2NW3A 3PV6A 2AS5M 2Z91A 5EDXA 3P77A 4QKXB 1UVQA 2NY7L 2PYFA 2B5IB 1LO5A 4OM1L 2R8SH 3ARGD 3GM0A 4BSVA 1UB5A 4ORGA 4DFHA 2OSLA 4LP4A 1DANU 2E6JA 3KPSB 4TULL 1JMXA 1WCBB 4R3SB 4MMZC 3RU8H 1RUAL 4KK5D 3EJZC 3TPUA 1I1CA 1B0WA 4J8RA 3IU4L 3R4DA 4Y5VA 3MV11 3WNKA 4JM4H 2P42B 4NN6C 2VDOH 5HDBE 5ADPL 1XF2B 3BGAA 1PX3A 5E8DH 3MCLH 3EYVB 1IGJB 1BREA 1RHHB 2D7PA 1QSED 4FHBD 3ZDZF 1KJMA 1HN1A 2XZZA 5A2KH 4HH9A 2ICEA 1PSKL 1YEFL 1QR4A 5I1CL 4KMTH 2VLLA 2G5BB 4G43A 4P9MH 3VFPB 5IG7B 2XZAL 4NCDA 2EEAA 2Y4SA 4OD2B 5GS2H 5IVXA 5IFHL 4TUOB 5DRNA 3Q48A 3OV6A 4K7FB 1U6AL 5JZ7C 4ZMAT 3BQUD 1MWAH 3BZ4B 2PW2B 1IAIL 1JZ6A 5JQ6L 1FFPB 5DFVD 4PG9A 2VISA 2BSED 1X7QA 1NDMB 5IROC 4V1DE 1IC7L 4HGMA 2AV7B 2X9XA 2D0HA 5FM8A 2MKLC 5DURD 4QHUA 2F19H 2WMPA 4JRYD 4PJEE 5EOCJ 4U1JB 5FUZL 3S5LG 1P7QD 1MRFL 5IBTH 1SHMA 2RHEA 5GZNC 2GQHA 3OKEA 1JV5B 3WKMH 4F7CA 1I85A 2MTPA 5IB5A 3TWCH 1WWWX 3VG9C 4S1RH 3RVXD 3IDMB 5EU6A 3TFKC 5C0EA 2GJ6D 2X4RB 3VWKC 1EERB 1D5ZA 1I1RA 3G6DH 4W4OA 1DLFH 2WM0A 5KSVB 2W38A 2CIIA 3GO1H 1UM4H 2VTFA 3SE8L 5D7IB 2NY7H 4OFYD 4RFEB 3R8QA 1IQDB 4XH2B 4NIKB 1T2JA 3UBXB 2NY6C 3FHAA 4WWID 3LKPB 3SPVB 4I48B 3L3JA 4ODUA 3MLRH 4Q9RL 1F90L 3UP1A 2X5PA 2WBJA 3ILQD 4DCQB 1PYWB 1JHLL 2BDNL 4P48A 1E4XL 1SEBA 2MPAL 3MJ9L 4XNYH 4MNQE 1PBYA 4FQIH 2GEEA 1T21A 1TCMA 1BQHB 2NW3B 4JPWH 4XXCC 4YHOH 1FPTH 4WUUE 5L2KD 1RIVL 3RWJB 5JQ6H 4CN1A 4NO5B 3PWJA 1A2YB 1QSEB 5I1AB 4JO4H 4CVUA 5IVNA 1MAJA 4XTRC 4YXHH 4Y16C 5KZCD 3QUYB 5DMIH 3W0WB 2XWTB 4D9RE 1FJ1B 2XKNB 3K8MA 1YQVL 2BSRA 4JR9H 2IQAB 5EOTB 5I1LB 4OIBA 5CFHA 4JFFE 5L8JB 3DX6A 4PRAB 4ZQKB 5C7XL 2QQLH 1W0YT 5L8LB 4U1SA 4NQSB 4L3EA 3U4EB 5GSVB 3M1BA 5I19L 3BEVA 3KPSD 3WIFA 3QUYD 4DVRH 1Y6NR 3C60D 2DLGA 1RZFL 2I25N 4JLRA 3VJ6B 3Q3GA 3BD5A 2FX9L 4NRZB 4GW5A 5DGRA 3CXHJ 3HRZB 4IOFD 2CDGA 4GQ9L 2JLLA 2V2XA 5CEZD 3ARXA 2AJZB 2IPTL 2XQYK 3O8XD 4GRMB 1ORSA 4PG2A 2IAMA 3L1OH 1W72A 2VLKA 3GI8L 5H94A 1WZMA 4JZNB 5EULV 2PXYC 1Q9KA 1QLFB 4HD9A 3TV3H 3MROB 4TOYL 2NY4C 4XBGB 1IC5L 4I5BA 2R9HC 1YEGH 1NC2A 1MCDA 4ETQA 1QBLL 1FGNH 2DQTL 5FO7A 4MB3A 1RUAH 3FFDB 3ZKXC 1NGZB 4QCIA 2G75A 2DLTA 4Z95H 1S7UA 2VXSL 4J3XA 4P2QE 4FMFA 1BM3L 1T7XA 2GTWA 4Z8FL 1MQKH 3L6FB 4RZCB 2GJ6B 1DE4A 5HYQA 1ADQA 2NY1D 1U2HA 4LMQI 1QR1B 3MRGA 4NRXB 2BSSA 1UWEH 3G6DL 5IBUB 3FN0L 4Y19A 4X6FA 5HDQH 1INDH 4HGWB 3FQRB 3QQ3A 4WI9A 2W91A 1NSNH 3FO1B 5ISZA 5C70A 4K2UL 2AI0L 4LCCB 3ZKXB 4JFDD 1KB5A 4YHML 4P9ML 1T21B 2G60H 3IFOB 3WHXB 4F33B 1ORSB 1AE6L 2VRAA 3LEXB 3RNKA 3SGKC 9CGTA 5EO1A 3PDOB 4M1CD 3HC0A 3HRZA 3V52L 1MCHA 3GIZH 3SDDC 3I9GH 5IEHA 3BQUB 1OGAE 1IM9B 3U0PA 4Z78B 3M07A 3UTSD 3Q0HA 4WI2A 3OHXB 1J05A 4KV5F 1HH6A 5AZ2H 3DV4B 3QDGE 2WK2A 1OB1B 3AU1A 3EZ8A 3HC3L 3U0WH 3MLTA 4ZOEA 4EQ2A 1RUML 2XIDA 4UDTA 5CS7A 3V5KB 1U8PB 3L6FA 4XAKE 3QCUH 1A14L 4LLQB 1A47A 2RFXB 1QVOB 3IJHA 3EJZD 1U42A 3CLEL 4MDJB 2NR6D 3SDCA 1A21A 5ILTH 3PWNA 2OTWB 5FHAH 3QXDB 3GRWL 4M6MH 3QUXC 5JXAL 2HWZH 2V7NB 1T2QH 4RMVA 5EWIH 4AT6A 1I7UA 2X09A 5HYJA 1KXVC 1UM5L 3GSUB 3MRBA 1EVTC 4JPIB 3GJFB 2AW2A 4MS8C 1ACYL 3MGTB 3ZYOA 2B1AL 3VFWA 1WWBX 1D9KA 1G7PB 2NY4B 1OPGH 5DSCB 4NGHH 5DJ2A 3HZKB 1TNNA 1L6ZA 3MLSH 1WIOA 1C5DB 1CGYA 2VR4A 1NEZB 3IJSB 4DGVL 2GCYB 3A0OA 3ZDYF 2AQ2A 2JCCF 1KB5L 1P4BH 5BV7H 4XCFH 3FRUA 1NQBA 1TCRA 2F53D 4GG6F 3VW3H 5DUML 2R9HD 3ARGB 2HH0H 5JOFB 3EYFA 4I77H 4IDJH 1KYOJ 1QQDB 5E99L 3MBXL 2GW5A 1IRAY 5I18L 5BZWA 4CW1A 1W0WA 2PYED 4FZEL 1IAIH 4ZSOB 1ONQB 5SWSA 3RVTC 4R90L 4ZYKA 5EFIB 2EYRA 1L9MA 5IEKA 1MAML 2VKXA 2KDGA 3VG9B 2B4CH 5DUPL 2J12B 3SY0A 1V7NL 1FFQA 1UZ8B 1DR9A 1JK8A 2FO1A 1RZIA 3ET9F 3O45A 4LBEA 4H1LH 4J23A 4KMQA 2K7QA 5D96C 4R0LB 3MMEA 4OGZA 3BPLC 3VH8G 3WNLA 3PL6A 4ODWA 5F7KC 5BZDA 4Y1AD 1AGCA 4YHLL 5EH1A 2J8OA 3W82A 1GXEA 2DJUA 4MXQD 4C4KT 3HAEH 1FV1B 5KSBB 1JYWA 4PRHB 1IE5A 1SJXA 2X70A 2WUCL 2R0KL 2YD6A 3NGBB 3MV8E 4PJGE 4X8JA 2NY6D 3VGEA 2VITB 2X2YA 3QDMA 2B1HH 4HWBH 4QRUA 4MHHI 4YHYB 5GS0D 5IMKA 1A3RH 2Z31B 1NGPL 1J18A 4YQXH 1XGRA 1K9TA 4YAQB 2A0LD 1ZSDA 3K1KC 3D3VD 4HUKB 4AYFA 4L4TA 3I6GB 2AXJA 5JHDE 3S98A 5JUEH 3BP5A 4ALAL 2BVPA 1KSRA 1AP2B 4AL8L 3MCKB 1C5BL 4FZ8H 4U6TA 2UZYB 5E5MA 3ULVH 4FABL 1S3KH 3HUJF 5HVWA 1YN6A 2P5EE 4N8CH 4S1DC 4M7JH 3VWJA 2F5AH 3GSQA 3ULUC 2ERJB 1AD9A 3REVB 3QDJE 4X6CF 1A9EB 4JFFB 1J86A 4ODSH 2R23A 4Y88A 4Y4HB 3PG2A 1JGUH 3CFCH 3O3DB 2BY3A 5IFAL 4F2MA 4PJ9A 3OB8A 2QV2A 5HJ3B 3BIBX 1CG9B 2P48B 3H42L 4UNTA 4X7SL 4JFQA 1KELH 5CGYC 3TH2T 4G43B 4KK6C 2EE9A 4AMKL 5KSAB 2XPGA 4CNIB 4L3AA 3OKNA 5CD5C 4JFEE 4QRPA 1J7VR 3D39E 4PP1C 4DKAA 1U36A 2FYYA 4XPFL 4POYA 3O6FB 2O61A 4PJ8C 2CIIB 4HWBL 4AH2A 4JO2L 5CMAA 1S5IH 3HC3H 5DRXB 2QLVB 4P3CH 3SBWC 2DTSA 1G7QB 1UFUA 2NW2B 3KLSA 5E08H 4C54A 3HLAA 1HKFA 1UGNA 4JDTL 5F6HJ 2VDNL 2V2WB 5FUCE 1T20A 3MCKA 4EBQH 1I3VA 4MA3A 4XTRD 5C9JB 2F54D 4X6EB 3WD5L 3FQUA 1AGBB 4PRIE 1KCVH 3GMMB 2COQA 3OKOB 3V6FB 4GMTH 3KWWA 4PGDB 4GAJL 1FDLL 5EOCH 3QDAA 3B2VL 4NWUH 1EJOH 5H37H 2APFA 3KPMA 3UYRL 4JN1L 4M93C 3L3OA 4HZLB 2R2HA 1FL6B 1S5HA 4ELMF 5IVZB 2W59A 1XEDA 2R2CA 4DZ8B 3BZ4A 3CFCL 3HUJE 3L5JA 3B9VA 1ZVSB 3K74B 4GG8B 5KSAA 3MBEB 1N4XH 2BVEA 2DQIL 4LVNB 1BVKA 5IQ9A 4WI7A 3ZSTA 1HSBB 4HWEH 1FZOB 3BEWA 1UWGL 3VGDA 4OLVH 3MRHA 3PL6B 1Y0LB 1DUZA 1CYGA 2P5ED 5F7UA 1H3UA 2BXYA 2DQDL 5GJTL 4PJBE 2VXSH 3X14A 1WZKA 2BOBB 3TYFB 4JFXA 1G1CA 4H5SB 5CGTA 3U9PL 1A1MB 3ARED 4WDIA 5JHDD 2FWOB 2IH1A 4OCNC 1XIWD 4XCYA 4ONOA 2GJ6E 4R97C 5F1SA 1QSFA 3E0GA 3ZE0F 1XCQB 1YJDL 4WFHD 4YBLB 5L9DL 3LQZA 2GSGB 2R0LL 2F15A 5GGSY 3FQTB 4Z7VB 4RX4A 1AJ7L 2AVGA 5C6TH 4P9HC 2G5RA 1WC7A 3AAZB 2Z31C 4YHZL 1OWWA 2GIYA 1F3DJ 5E6ZA 3C8DA 1CICD 3BW9B 2NY5H 3D48R 4V1DD 1NC4B 1Z2KA 3T77A 3HPLA 3IF1B 5T1DH 2VXTL 3RWFA 1LO0L 4NO0D 1BBDL 3NFNA 5C07E 5HHNA 1M7IA 1A9BA 1KCSL 4P5TB 1CE6B 1R3JB 1U3ZA 1HOCB 4N9OB 2VR9A 2YSSB 4GRLA 1N6UA 4GFTB 3MGOA 3N85L 1XGUA 2X1QA 4ZD3L 3X17A 1XCTB 5T1KA 1SEQL 3HG1E 3KJ4C 4M1GL 3KPRE 4JEGB 1A02N 5F3BA 2C4FT 1HXYB 1JIBA 1S78C 3PGFH 4ZTOL 3DGGA 4ZS6C 3P0VL 2HVJB 5SWZD 1F02I 1ZHKB 4HGKC 2ZG1A 1D6VL 5I75C 4LLDB 1XF4B 1KXQE 5J3HD 3H9SD 4UT6L 4HFUL 1L0XA 4M5YH 3EKCA 2W0PA 1I1YA 2A83B 2OJEB 2HT2D 4M7ZB 3RY5A 1IBGH 5D7IF 1J1OL 1YEKH 5J89A 4KMTL 4JKWA 4Z78A 4MNQB 1XFPA 3B83A 4OF8A 4MS8D 4MXVE 4ZOAA 4X80L 3GBLA 4FQXA 4U1HB 5F6HI 4U7MA 4GW1A 3MUZ1 3WFBH 2ESVD 1E4KC 3ARVA 2H2SD 4JY6B 1I1FB 3KXFA 3JWDH 3SKUD 5CWSB 4M7LH 4J3UA 3FB7A 3MV8D 5T1LD 1FBIL 4IRJD 5SX5K 1HZHH 3GGWB 5D71H 5GJTH 1F4WH 4R4FL 1C5DA 1EIBA 4LIQH 1F6FB 1QBML 4PJDB 4DOHE 5JLZB 3UYOD 2NNAB 3H8NA 4GLRH 1ZKAA 2EIZA 3MRKB 4K9EC 3FT4A 4OGXL 4X6CA 2FEEI 4GS7C 1WWAX 4F7TA 3FQNB 5HHOA 1ND0A 3QXDA 5FDYA 2A2QT 2B8OT 5J12B 3TF7C 3SCMB 4XZUB 1OAUL 3VDAA 3C5SB 3SDYL 4J3WA 2VC2L 1H3WM 4TNVK 3MLTB 4Y4FD 2HN7A 1RIHH 4UUJB 1IGMH 5D7SH 3DX8A 1TETH 5DO2C 1WZ1L 2OMNA 1Y6MR 4S1DD 5SV3A 3FO0L 4X99B 4YBQC 3CFBA 1JRHI 3FKUS 4M6OH 3DETC 3A6OA 4QTHA 3NPZB 1YJDC 3RKDD 2BOCA 3MYZA 2HJLA 2BNUB 4NFDA 3RVWC 1HDMB 3WXVL 5TE7L 5E8NB 1ZA3B 1L0QA 1SM3L 3UMTA 1MCNA 1UJ3B 5I8CB 1A3QA 2YS4A 1KN2H 2WP3O 2D7TL 2QQKH 3U6RB 4L5FH 5J6HB 4EI5A 3H3PH 1IAMA 2DQCH 4OLYL 5HHMD 3DROB 3DJ9A 5FECA 2VAJA 4JFHD 1BECA 5D1ZB 1XF4A 3QXTA 1BM3H 5FYLD 3C5JA 1S78D 4QWWC 3SGDI 3HE7B 4PP1D 4XMPH 1KC5H 4AT6B 1R3KB 2C3VB 3QI9C 1MREL 1N0XL 3RGHA 1AKJA 1OAQL 3BUTA 4G9FE 4MB4A 2D0GA 1CGSL 3VDCA 1DN0B 1F4YH 2AJ3A 4C83A 2IPUG 4CMMA 1MHPH 5BRZE 2YRLA 1T1WA 1W0VB 5EO9A 3T0WA 2C3HA 1NAML 3QA3B 1BX2A 4I2XA 3ES6A 3QZWG 2OQJA 5FXCH 4UT7H 1KCVL 3BI9X 3QIBD 1JUFB 3EAKA 4K7PL 4M9OA 4XBPB 3UZEA 4P4KD 1AQDA 1BQSA 1UJ3A 5BW7C 2YC1A 3RWIB 3ZE2E 3GI9H 4YDLC 1QUNA 3QHZL 4QHLB 2MOVA 4ZAKC 3CFJB 3CVHL 2NMSA 3O9WA 5FIEA 1CXHA 4KK6D 5C07B 2BNRD 4HPYL 2ADJA 4LNVA 5KSVA 2CKBL 3BO8B 4UV7L 1G7IB 1P6FA 1A3RL 1TJGH 1XF3B 2DQEH 4S1QL 1W0VA 4ZS6D 4M5ZL 1LO2H 1R3KA 2C3VA 3MBXH 1BGXH 1QTYT 1H3XA 1RIVH 1NJ9A 4HS3A 2EDOA 1JGVL 1HIML 5D2LB 4FG6C 3I6KB 4F15B 3QDJD 5MEND 3BKML 3MLXH 1OB1A 3IJYB 3UTPE 5HHOB 2Y07H 4DZBA 3K4DA 3KPOA 1NLDH 5C71A 5ID1A 1VDGA 3JTTA 3ARFB 4N0CC 4NKQB 3RAJH 2HLAB 3FOMA 4L4VE 5E4IA 3MLSL 4PJIB 2IMNA 2P24A 3DUHA 3JWOH 4PJXB 3EYUH 1DQLH 3VFTB 4R26L 5CBEB 2FEDD 3O3AA 4PJBB 4PGJA 1P1ZB 1NCCL 2VQTA 4OZGA 2AK4E 5FGRA 2DMCA 2BMKA 4OCSL 1KPVA 3MLWL 4LSDA 1J0JA 1A7OL 5GGVH 4N0FB 1NAKL 3PWPD 4NRZA 4HJ0C 5DFVC 2XA3A 2EKJA 5AG8A 1BFVH 1GYAA 1HH9A 4QF1B 3V9FA 1G6RH 2BNQD 2VZ3A 3KYMA 1YZZA 1SYSA 4HAGA 3AREC 5TQ0L 1ZGLP 3GMRA 4ZXBD 4KI5C 3QCTH 4DAGH 5FA4B 1JMZA 1JHKH 1T83A 3H9YA 5EU5A 4HWZA 2Q8AL 5ID1B 1FO0A 2H32B 3NIGF 1MCPH 4DW2H 5FYJL 4HKJB 3JUZA 3WD5H 5GZND 5D7SL 3EDEA 4QTIL 3TJEH 4LPWA 5IQ9B 3STZA 4GRWE 3MRHB 3JV4A 2YN5A 4HIXL 2G2RB 2CO7B 4TUOA 2EE3A 2WSKA 4P4KC 4PYHA 3H7BA 2ITDB 4NKOB 4Y5XB 3QEQA 1CVSC 3D9AH 4K23H 1CD1B 4WHYG 4LGSB 2AI0H 3G5XA 2A9NH 3HR5A 1IC1A 1KV3A 1DBBL 3LKRA 4D8PA 4P57A 1I9IH 1NDGB 4PJ8A 1VCAA 1N3NB 2ZSVA 2GI7A 1MIML 2Q20A 4KKLC 2QL1A 4RAVB 3H3PL 4I77L 4HV8A 4O5LL 4XNXH 5L2KA 1DBKH 4YHOL 4QNPF 1YECL 5C3LD 3MRJB 4RNRB 2XZQL 3WYRA 4CADB 1UACL 3C5ZD 3ARFD 5ALBH 2A6DB 3LKQA 2ZNWA 4K94C 3VXUB 3F5WB 5JIPA 1MHCB 1BLNB 4L8CA 1G9NL 2QSVA 4X7FC 5C6WH 4XP4L 5E2WL 4U1SB 3QDJB 2FHBA 3GMOB 5DR5H 1VGKB 4PRIA 1JGDA 2NY2D 4PJ8B 5GGTL 1JHKL 3QG6A 4PGBA 4JHAH 2V9RA 3GKWL 1KCRH 5DQ9B 1NAMH 4FXGA 2O5ZL 1JNHB 1UEMA 1CE6A 2DMBA 1FZMA 5IT2L 4XMKL 5KSAC 5IT2H 3VFOA 1UB6B 2FZ3B 5HGGS 4G8FA 2YK1L 2VR5A 1GCFA 3MLPA 3LKPA 5EN2A 4KRLB 3GMPA 4F8TA 2IANA 1FORH 4PGZA 4G5ZL 1LK3H 2R23B 4ETYA 4M7KL 2YOCA 1J5OL 2E7LC 3MOBH 5IMOB 5IHZB 3FAXA 3LKOA 2CRIA 3IS1X 1T0MA 4OZIA 1CL7L 3P11L 1XR9A 1SBSH 2E9WA 4WUKL 3TV3L 3QIBB 3FB5A 3RZCA 1J8KA 1HNFA 4N8PA 4YHNA 3CU1A 1SEQH 1IAKB 2NXYB 1RIUL 4JPWL 1LHZA 1B4JL 1NKOA 3IDYB 4RCAA 4N0CD 1YPZB 3I75A 2I24N 2A6DA 1QRNB 3IFNH 5C2BL 1ZLSL 3LS5H 4X7TB 1F58H 4G3YH 5FB8A 1LE5B 2FSEA 2AP2A 4IMLB 4M4RA 3NZ8B 1PKOA 3CXDL 4YX2L 4EXPX 2R0LH 3MQIA 3X12A 4YHYC 4JFDA 2VZ1A 2GFBB 3N1PC 4Q58C 4OFIA 3F58L 1X4YA 4LHUG 4WTZG 5EN2B 3V4VL 2HYMA 3BMWA 4LSPH 5CKGA 1C1EL 1M6OA 3D18A 3UEZA 4OCYL 5IIEB 5JXEC 1U8KA 3FT4B 3OKDA 4NT6B 1JNLH 1HHJA 3H9HB 4MXWL 5LAXB 3VFOB 4GO6B 4WEBH 2F5BH 2HRPL 5HHOE 5K59F 2F74B 3UTSA 3BPLB 1QSFE 1Q9WB 5D96B 1P7KB 2FNBA 3F12A 1I1FA 1QBMH 4KI5D 2UV3A 3C5ZC 2ATPA 3NIFE 4IMLA 1CXIA 3MRRA 2V5MA 2DN7A 1AIFB 4JCLA 3GM8A 2VDPL 2FBJL 5B38B 3MRIA 5FYLH 4ZPTB 3HE7A 1I1AD 1MJUL 4EKXA 5CEYA 3BKJH 1KCRL 4IJ3B 5DTFA 5ACZB 4K3DL 1MJ7H 4MX7A 5E2UL 3AMKA 5MEQA 5IFJB 1FL5B 3NPSB 2EDNA 2Y23A 2MNUA 1ZT7A 2RBLA 5F1IB 4XNUL 5CGYD 2X4OB 3HZVB 1CDBA 3WFHA 3UYRH 3I84A 4KQ4H 3ZKMD 2R1YA 1EGJH 2OCFD 4KI1A 3UO1H 5C0FA 2V5TA 1CDGA 4KK5C 2R2EB 2A74B 3QIUC 5ETUB 4J7RA 3FT3A 1I7RB 2P5WA 4JGUA 3WJJC 2H45A 3L3GB 3MJGX 4XCNB 1YUHB 2VWEC 3S7GA 2FZ3A 3KAAA 1MIMH 3W9EA 3JWDL 3G6AA 1G7JA 3OQ3B 1EHXA 5JUEL 2R15A 1I7UB 2I07A 4JM2A 4P23A 3QUXB 1WT5A 4QRRA 4NO2A 4UMGA 4WO4C 1ED3A 3AGVA 1P6AB 1XGYH 5IQ7H 4UTBL 1BQLH 1FYTB 1S7TA 5SWZE 2DYPD 3T2NH 2XT1B 2R4SH 5L6YH 5SWZB 4H88L 1CL7I 2V2TA 1U3HB 4G6ML 2ADGB 3TIDA 3PV7A 4U3CA 2X4UB 4MNGA 4GG6E 1W0WB 1TTGA 1RK1B 4HIEB 3CDGB 1P2CA 1F3JB 2MKWA 4I18A 3U7YH 2FR4A 1F5WA 4I0PA 3V7MA 4LSVH 2MFNA 4FTVA 3OPZH 3SDDB 2ARWA 3TWCL 3CFJA 1UEYA 4MD0A 3SDAC 1FGVH 3AM8C 1HI6B 1R3HB 2YD1A 3QO0A 1WIUA 4PJXA 5TF1L 4HF5H 3R8BB 4BZ2H 5IMLA 3LRGA 5GHWL 5CBEA 2EECA 4NO0B 1CE1H 1JL8A 4CJ0A 3F8UB 3HZKA 3CCHB 4DEPC 1KCSH 4LCCC 4MA8L 1XIWC 2ADFH 1P1ZA 4QXUH 1I9EA 4OZGE 1CICB 2WIIA 3SJVB 5CEYB 2P24B 2HFFA 4NBZB 5EBLA 3CMOH 4U0RC 1RUQH 1FCCA 3TCLA 3V5HB 2PF6A 3CFEB 4LPTA 3LN4B 4NHUB 1HHIB 2HT3C 2AQ1A 3MNZA 1WGOA 5JO5B 3WXWL 3DUUB 4YIQA 4I3GA 1ZLSH 1IGTB 5TH2B 4OZHB 4NC1E 5L8KB 1UZ6F 3RAJL 5DC9B 3ULUD 5EBMB 4EIGB 4GAFB 1I7RA 3QPXH 4RIRA 1RFDH 2AXGA 5ANMA 1G6RB 4F3FB 1I7ZB 5IMLB 2L7UA 4R7DA 3BHBA 4YC2C 1I8IB 2PXYA 4HMCA 4R8WH 2IFFL 4AEHH 4K3JH 5GSVA 2C9AA 3PABB 3QWRA 5IB2A 2NY5C 4XCCL 4QRPD 1MHEA 4G5ZH 5FYKL 3IAPA 4HPOL 1D7FA 2QADB 3DX9B 3KS0H 5C3TA 3VFNB 1WFOA 4U6XB 2DB8A 3B3IA 5AZ2L 5HGHB 2P47B 3V6OA 3CFEA 1JPFB 4MMXC 1M4KA 4NC1C 4YBHA 4G9DB 5J57B 3Q5TA 1JN6B 4HMDA 3DUUA 1PEZA 1Q72L 3TCLB 4U1MA 5C08B 5D7LD 1N6VA 3OZ9L 4DTGL 3MX0A 2ZUVA 5TDPB 3MFGB 3WKML 4HS8H 3T09A 5GIRA 5LGJB 3LKNA 3NFSL 3IDXH 3IDXL 1NCWH 1PD6A 3FRPG 4HT1L 4PUBL 1BAFH 3TNMA 3S36X 3QIUD 4KC3B 5T3ZH 1PJ9A 1NLDL 5DJ8B 3F7QA 1IEAB 3DX7B 3UDWA 1QO3B 5C0CA 3KYKL 3TYGH 3TZVD 2AXGB 3VGFA 5GS2D 4CVWA 5C0BA 5KSAD 4NNXB 2AJUL 3TVMA 1FAIL 2H2PD 1MHHB 4PGBB 1FZKB 1CCZA 3IFLH 43C9A 4X0KB 5KOVC 2HJFA 5DUMH 1JYXA 2DQCL 4OLYH 3BAEL 4JKMA 4Y4HD 5JPNB 1YNLL 5C0JA 1UH3A 4MCZA 2P46B 1RUPL 4JO1H 3MODL 1FVDA 3V8CA 4UINH 4GOSA 1QSFD 3OTTA 3DVNA 1EHAA 1J8HE 3GSNL 1KCKA 1HQ4B 3LKOB 5FYJD 2YD5A 1T3FB 4JPVL 4FFZH 4FFZL 4WNQB 4JPKL 4R3SA 4X6CB 2Y72A 4KUCF 3BPNB 5JPMA 1CLZH 4RZCA 1J0IA 3N0PB 5DEGB 4L8SA 1PG7W 4JDVB 1J10A 2Q8AH 1XGQB 3JTSA 2E9BA 3Q6FA 1QLRB 1W72B 2VLKB 4ZO9A 2ICWB 2ARJQ 5I19H 1S5HB 2GFBA 4LRIA 4KQ3L 4NPYA 4DZ8A 5CCKL 1QFUL 3VFNA 3FMGH 4X4YA 3Q5YA 2AJSL 4N1HB 4P2OB 4RMUA 4ZOBA 3B43A 3CLFL 5GRYA 1OCWL 5EORH 4LIQL 4OBSA 2R56H 3ARRA 1D5MA 1T03L 1AHWC 2AXFA 4M62L 1WC7B 1HHKB 1A6AA 1ZHBA 1KACB 3FOLA 1CT8A 4KJWC 1MHCA 2VERN 1IC7H 2MQ0A 3RUGA 2KZWA 2EDXA 1U8JB 1D6EB 3MR9B 5CLWA 4BA8A 4OAWA 1YNKH 5TDPA 2FRGP 4MB5A 2A6JA 4Z18A 5B39B 1YA5A 3TBVB 4U33A 5E0QA 2WBKA 4NNPL 1ZTXL 2VSCA 4WO4D 4N0YL 4LGPB 1E4XI 1TENA 1CK0H 3MRBB 2F5AL 5DJYB 2PKDA 4UT6H 1XGUB 2EDYA 3QUYA 4FQQA 3FN0H 1RULL 3HNSH 1HHJB 4QRSB 3CPLB 3QULB 1KBGH 1HYRC 1INEL 1WEJL 3S36H 5LWYH 5C09D 2Q76B 2A9ML 1K4DA 3FB7B 1DTUA 1JJUA 3WFEL 5K9OB 3MFFA 3RIAK 4M3JA 2F53B 4NQXA 3MUGB 2XYCA 2JB5H 4LAQL 4K8RD 5F7FA 2DRUA 1OD7A 5F93C 5CBAA 4R0LA 2BJML 1GGCL 1T5XB 2EKSA 3TPKA 4DN3H 3BD3A 3U82B 4KK8D 5GRVK 3ULSA 1WWCA 4G7VL 2NY4D 1MCSA 5E7FA 3P73B 2OR7A 1G7LB 4U6HB 4PTUA 4JO2H 4MJIA 1T89A 3WBDA 2WINA 4PLOB 1CT8B 2C26A 3V5DA 4HQQH 2DQFB 3RPKA 1QKZH 1UWXH 1V8HA 2NY1C 4XNZB 3ZMRA 1HILB 3IKCB 3GNML 2OYPA 1ROWA 4ZFOA 5D8JL 4ZUVA 3GJEA 2EE2A 5EA0L 4K7PX 2DI7A 4FQ1H 4QYOB 4LLUA 4X4YB 4Y4FC 3H3KA 2GJ6A 4YDIH 1JPTH 1DVFA 4PRHE 3LS5L 5LAXA 4NO2B 1J8HA 4O9HH 1GGTA 1OTSD 2YRPA 5IBLC 2EH8H 1HSAA 1UWEL 4P46D 1EJOL 2VLJA 1OF2A 1R24A 5KSBF 1YEHH 4PRHA 2P7TB 5ADOL 1IZJA 3B2UD 2F74A 3UTSB 4HJ0D 4GJTB 1LGVA 1DBAH 2D4FA 4GW4A 5DVMA 4ODWB 2VE6B 5BZDB 5LXGH 4M1CC 1GZQB 1OAKH 2WZPD 1A9EA 3QO0B 2JK5B 1R6VA 5IGXH 4HKXA 4XCFL 5CP7B 1F97A 5KANI 2XY2A 1E4XH 3JSSA 3G5ZB 3GMQA 1J0ZA 1U93A 2Y6SC 4JQXC 3QDME 5EU3A 3Q1SH 2DQHL 2ZUYA 4OUUA 3CSYA 4OIIH 1BVLA 1HILA 2HT4D 1FN4A 5A43C 1F6LL 1FIGL 3UTTD 1QFOA 3SJVA 4F7EB 2GITB 4MJ5B 3NCYS 1C7SA 4NZTH 4H8WL 2VLRB 4H8WH 3DROA 3ARTA 4UOW1 3CFKB 1AR1C 4YK4C 3LVEA 1U8IA 2HKHL 2I9LA 3CLEH 3U6RA 4ZODA 2VABA 2ZCHH 4NKMB 1T04A 1P7HL 2LABA 3K2UL 3SO3C 3DV6A 1T5XA 2PYFB 3LH2H 4XWGH 3MACL 5EZOL 1N2RB 5D7JC 3WS3B 3W5NA 1F00I 2Q86A 4QRSA 4KK8C 2XTJB 4NQED 5TH2A 4ZO6A 3STZB 3L1OL 3O11A 3UTOA 4KKAC 1MFEL 3ARWA 5D5MF 1QZ1A 1HHIA 2I9LB 3VFGH 3C60B 5C0DB 5EIIA 2MHAA 1JHLH 2BDNH 3GMOA 2P43B 3MPCA 5D1XA 4PV8A 3ZTJH 5GPRA 4JFFA 5GJSL 4LQFH 4X9GA 1KEML 3WSQH 2W9DL 5D1ZA 5MENA 3QFJA 1Y18A 1RJCA 4KZEH 3CIQA 1WFNA 2EE6A 1M05A 3FZUD 3ZDYE 1N7ML 4I9WE 4M61B 5KZCB 3DX9A 5MP6H 4YHKH 1FDLH 1CQKA 3TT3L 1EFQA 1AXSA 3VFVB 4F9LA 2X1OA 4XBPA 2W9EL 3D0VB 4PLJD 4JPKH 3IDJB 2C5DC 1LILA 3G6JA 3WE6B 4MQTB 1S8DB 5DZOA 3LB6D 5DRZA 1S7WA 2HFGH 4MCYB 5BJTB 2YC1B 4TVPL 3EFFA 2QBWA 5T5NG 1KENH 1TQBC 2PO6B 3DARA 3OX8B 5T3XL 2FEDC 4APQC 1T7YA 1JUFA 3C2AL 3S35H 4ODBD 4LCUB 1IGYB 5DJCB 1CDIA 3HNVH 3TNNB 2IBZX 3DX7A 1Y18B 2HTKD 3W81A 2FO4B 2DM2A 4U1MB 3TNMB 1T4KA 4HPOH 5BS0E 2DM4A 3M17B 2EDHA 5GGQL 3CVHH 4PJAE 3NCCB 3L3OB 4PJHA 2FGWL 1WICA 4KTEH 1ZVYA 1FSKC 2DQUL 3MV01 3RGVA 4G6JH 3DXAA 2XRAH 5JW3L 3I6KA 4Q6IC 3NACH 1A64A 1G7JB 5KN5B 5I71B 2CK2A 2KZ1B 5F7DA 4JB9L 3CD4A 4HH9B 1P7QB 1MFDH 2CGRL 3MA7A 5BZWB 4CW1B 4U05A 1NUGA 4EJ1C 2XACC 5DURB 1IGYA 1MCQA 4YPGB 5J7CC 1ONQA 3BKYH 3HG1B 5BVJA 3MLXL 1FNEB 4D0BB 2H9GA 3KLHD 3KGRA 1AGEA 4X0KA 1KNOA 3FONA 3BOVA 3EFFB 3VFVA 3ARYA 3HE6B 2KL6A 4PRPD 4K7PY 1DUYB 7FABH 3G6JB 3WE6A 3KJ6H 4EOWL 2K1MA 3FO2B 4Z9KB 4KKAD 4L9LB 2APWA 2UY6A 1J1PH 4NWTL 1Q9OB 4AIXA 5F1KC 4WEUD 4XPGL 3TJHD 4OLVL 4MA1C 5K9JH 2DQEL 4S1QH 3NIGE 1OP9A 3MRIB 5DMKB 1K4CA 5E7BA 5CIPB 5C09E 3C6LB 4LCWE 2C3GA 4KH2A 3HNVL 2P8MB 4HZAA 3BP4A 4MJ6A 2VO5A 4XCCH 2BSRB 4YFEA 2DD8H 2PYEA 3L3HA 3MZTA 4KJYA 1H8SA 1CDCA 3PQYA 1A7PH 1PG7X 2H3NA 1VGKA 4GKSB 1IKFL 1BQHA 3CAFA 3KG5A 1P7KA 1A7NH 1C08A 5CUSH 4HUWA 4OAWB 4GBXA 4HWBA 2XRAL 4CDGC 1MIEH 3LPWA 1KPUB 3HCVA 1PW3A 2HKHH 1YNTB 4LPYA 3N50A 5GS3A 2M26A 3B5TA 3MR9A 3E2HB 1EFXD 5HHQA 2YR3A 1VPOH 4PD4J 4WWKD 2ARJB 3SPVA 1R5WB 4NO3A 1FE8H 4YWGL 1DUYA 4UIMA 2MWCA 5BVJB 4PBWD 2R2BB 3QCVL 4XPAH 3FONB 5I1JH 4P46C 1OWRM 4IRZL 5KS9E 4XGZA 4M7LT 3L95B 1S8DA 3RDTC 1KB5B 4EOWH 1BD2A 1B90A 4OD1L 2OTPA 1S9XB 5DJ0B 5L0QB 1BEYL 1CZ8H 1S9YB 4QXUL 2R1WA 3JWDC 1I8LA 4G8GD 2XKSA 2D7TH 2RQ8A 3BE1H 4JRYA 5FUOH 1QBLH 2D9CA 4WU5A 1DQQB 1HYSC 1K6QH 5GS1C 3L3KB 1WBZB 1FJ1A 2XKNA 3PP4L 5HYQB 1N5AB 3KPLB 1C08B 3BN9C 4LASL 4IM8A 4KUCD 1JF6A 3TC9A 4PTTA 2YKLL 4L1DA 4KZEL 5SWQA 3BVNB 4DGIL 5FO7B 3S3SA 5K9OA 3WNOA 3MNVB 5D2NB 3BGMB 2P8LA 3MUGA 4PJDA 5JLZA 1UJTA 4ESKA 4M5YL 4HG4K 1EO8H 4G8FB 7CGTA 1INDL 2DIBA 3BDBA 1OT2A 4Z7UF 1UM4L 3SE8H 4PY7B 2Z93B 3CSBA 1X6LA 2BERA 1V05A 4ZFFA 3T0VA 1TTUA 4GRMA 5DQ9A 1EX0A 4JFEB 4EVNA 4OZFG 5GRJL 2VDQL 4ZFOB 3U30C 2ZUQB 5JXED 5TE6H 5I8KH 5K9JL 4EQ3A 4LDEB 5ENWB 4OSUH 2OP4L 1JF5A 3DWTA 4AEHL 4OFVA 3O2VH 1YPZA 1RZGA 1BZQK 2WINB 4DN3L 4OFPA 4R2GC 3ETBF 4U31A 5J1TC 1EUUA 3DRQA 3VXNB 3IKCA 4GQPH 3FFCA 3GI8H 1IL1A 1WSST 1CZ8L 1CTOA 1KTKE 2BFVH 2VB5A 5D5MA 2FHFA 4LVEA 4D3CL 1YEEL 1NCBL 3MV9A 2YN3A 5L2KE 3WDHA 4OZHA 4UIKL 5HHVL 1CFQA 4J4PC 3BSZL 3QBTB 5B8CB 3ABZA 4JFOB 1FN4B 4X7CC 2FB4L 4PJEA 3GSUA 4LIQE 5E00B 3FTGA 4NQCB 3KPSA 2H8PA 3B8YA 2AEIT 3B9KB 1IJ9A 1KLGB 5GISH 4HH8A 5C2BH 1WZ1H 4HUVB 4MWFA 3MYJB 3A6CH 4UB0L 3B2VH 4PUBH 3NFNB 4Y5YC 3PABA 1KULA 3LIZH 3HKFA 3PV6B 1MHEB 4OCLC 1U58B 2H1PL 2FD6H 1GHFL 4Z7VF 4QRPE 2E7CA 1MFCL 4XX1E 3F65A 3VA2C 2BZDA 1ORQA 4AG4L 1UA6L 4IMKC 5DD1H 3JTTB 1CFQB 4HC1L 1OAYL 2ZG2A 5KVDL 4UILL 1BIHA 4HBCL 1WBZA 5HHME 4BUGA 4PB9L 4FG6D 4J1UA 2XNAA 5IKCB 5A3IC 1VFMA 2X4NA 2XN9D 3KDMB 1HZHL 4LGRB 1EBPA 4FQLL 1TMCB 1MLBA 3IKKA 2VLME 5D2LF 1F4XH 1S9XA 5DJ0A 3NMEA 5A2FA 4M8QA 3VXRE 3MNWB 3DMMB 1EGJA 3I2CL 2BC4B 2ADJB 3ULVC 3BRGC 3HNSL 1UQSA 4K71B 5J0BA 1YMME 1NDMA 5GRUH 4XVJH 4S1SL 1H15B 4HCRH 5EIIB 1F4AA 5GGTH 2Q86B 2Y5TB 3WS6A 3RHWF 1QFPA 5TFSL 1IMHC 2JK5A 1GAFH 4V1DA 1Z3GH 3A6BL 1O5DT 4OZIE 4JREB 2HLFC 4P2QD 2A38A 4Q2ZA 3EOAA 4WW2C 4LSUL 4HKJA 4ODHL 1QYGL 4IRJC 4JY5L 3O6LL 3OAUL 3K81A 1YYML 5BV7C 1VFOA 3IJYA 4R2GD 4OD1H 4MCZB 1LP9F 2HTKC 3U4BH 4M48L 5DLMH 1OAKL 1I8MA 5B8CA 3P11H 2ICCA 2P45B 3BN9D 3OKLB 1C5CH 1B6UA 4WUKH 3FTGB 3C09C 1BJ8A 3IVKB 1F3JA 3NH7L 2N7BA 4GG6A 3GMRB 2R4RL 3ZT6A 4M8QB 4JHWL 4ORZC 4YXKH 1ODAA 4NYLA 5DEFA 1FZKA 1EH9A 3WEXB 1BWMA 5HYJD 3OJ2C 3U1SL 4OQTL 1A5FH 2VITA 4E41A 3ZO0A 4C56D 4LPCA 3I6LE 4N0YH 5HDBF 4B7IA 5TDNA 3IFNL 4RNRA 1T1ZB 3SDXA 3FQWA 1T22B 3SJVE 1S7QA 3VFRB 2ZG3A 4JFQB 1RULH 1MI5D 3BHBB 5J1SC 5DQJA 2W9EH 2WWMC 2ZJSL 5ITBH 1PAMA 3MLUH 2VL4A 4Y5XA 5KVGH 4ZUTB 1QEWB 4JQVC 4KHTH 5C0IB 5DD3H 5EO9B 1MELA 3B9KA 4P57B 1P84J 1W8OA 1BX2B 4I2XB 2EDTA 3P0YH 3QG6B 4UDUB 4Q6YA 3H0TB 4OSUL 2BJMH 4PV9B 5GGRA 4RMSA 1B88A 3QYCA 1OF2B 1R24B 5FCUL 2AK4D 5TF0A 1HHHA 4P2RB 5ELIA 1YECH 5D1QA 3SDXF 3DMMA 1MWAL 3O3DA 4NN5B 5HGBB 1PG7L 3BDXA 1K4CB 3LKQB 4YDVA 5F88B 3RVTD 1IGFH 2EC9T 2BP3A 1G7IA 1J0KA 5IJKC 1VKXA 4OTXH 1I9JH 5C9JA 2IEPA 3NA9L 3RTQB 2EDDA 1CDJA 1K3ZA 1XF2A 3SKMA 3IETA 1TPXB 2PNDA 3F5WA 4IRSD 2HJKB 3S8WA 4XBGA 4EN3B 4PJIF 3ZHKA 3F7VA 3NIFF 4CMHB 5JW5A 4HXAL 4OF7A 1G7QA 3V6ZB 4PG2C 4W6XB 1OW0C 1WF5A 2W1NA 3JV0A 2W0LA 4F3FA 1WJ3A 1JYNA 4QTIH 3TJEL 2PTVA 1VGEH 4AEFA 1PVHA 4JVPA 3WNMA 1SJHA 3VG0H 4I0CC 2P44B 4JZJC 3ZE1F 3AVEA 3BDYL 3VXSB 3BP6A 4KGLA 5AYQA 2IPKB 1QEWA 3BPOC 2C4FU 5A2IH 2BVUA 1KJ3L 2FIRT 3LKNB 3RTQA 4IIQB 1XZ0A 1I9IL 3MLRL 4TTGA 3MXWH 1KGCD 3EO0A 4X9FA 1NGPH 4PJHB 4NN7B 2AGJL 4XAWL 3SGEH 3GMLA 4G80A 5DZLA 3T1FA 2FJGA 1CWVA 3NAAL 3RGVC 5F97E 1N59A 2X4SA 3QZWA 1NGZA 4QCIB 1BZ9B 3U2SB 4ZUVB 3HZMB 4ZTPL 4QOKB 1HINH 1ETZB 4UV4L 2J7LA 3PP3K 2A6KA 4WFGD 5F21B 4X5XB 3T04D 3GSXA 2H32H 1U2CA 1F13A 2VH5L 2IC2A 3B5GA 5IBLD 2YSSA 4GRLB 4KROD 3IRPX 5GRXG 5CJOL 4QRQA 5EC1A 4J4PD 4PJCF 2GHWB 5D7KD 1JYVA 3C9NB 4HKBA 1F4YL 4I0KA 3FB5B 3RZCB 1U9KA 4OZGB 2VXQL 1CFVL 4U6VL 43C9B 3TVMB 4RFOH 3FO2A 3OKMB 2W0FA 1UG9A 2UVEA 1YNTA 3BEWB 4LSRL 4PRNA 2CO6B 3EOBB 3QWOA 3VRLF 4MQ7B 2YD3A 2XQBL 1MPAL 1NAKH 1IEAA 3ARDD 3QUZD 5F88A 4F9PA 3OR6A 2OK0L 2FD6L 2R56L 4A2MA 3VGBA 4OUUB 4Y8AA 3U4BL 3W0WA 1I1AC 1HEZB 2H3NB 1PFCA 4XPTL 3BRDA 1MFEH 3P40A 4Z7WF 5MEOB 2CUIA 5FHBH 3QIWD 3T0AA 2X7LB 1PZUB 1L0YA 4A2LA 3O2WH 3DVNB 3MNVA 5D2NA 2EIDA 3RWJA 1U8PA 5I30L 3SY0B 1KEGL 5SWQB 1JWMB 2NX5E 4LRNL 1A2YA 1QSEA 2LVCA 1IILE 4AEIL 1D5BB 2BRQA 2E6PA 4IRSC 4S0SD 1FZJA 3VXPB 4DW2L 2EIZB 3EYFB 4FFVC 2XN9E 1DQQA 4NUJA 3BKMH 3VXOB 3QQ4A 4IHOB 5HGAB 4M7JL 3V95A 5CZXC 3MV7D 2NY2C 3GSNH 2B1AH 5ESVA 3TT3H 5BOZG 4P9HH 3HMXA 2AXFB 2V17L 4Y1AA 1EBAA 4NQDB 1AGFB 4K8RL 4S2SB 3C08L 3DPBA 4X4ZA 5HVHB 1AI1H 3EOTH 4JHAL 3F7VB 2VLRA 2QQLL 2EXYD 2X4OA 1YEIH 3HZVA 3QNXA 5I17B 1PZ5B 2GJZB 3CDGA 4HIEA 5T3XH 3G5YB 3VJ6A 4OI8A 4HBQA 3PGDB 1G7MB 3C6SA 3GHBH 5F6IB 3QDGD 3L9RB 5GS1A 2PW1A 1FBIH 3U36B 4LCWD 3I50L 5H2BA 5CJBA 4R4FH 5I1HL 5DYOB 1WBXA 1HXMA 1E28A 1J9CT 2DDQH 2VMFA 3OL2A 4WI8A 1HQRB 1S7TB 5C8JB 1G9NC 3O11B 4GUPB 1KT2A 3I85A 4OFKA 5E8OA 5D70H 3SQBA 1ED3B 1N59B 3MRKA 5E6IA 1VADB 2CGRH 2R1XA 4JFDE 1YMMA 5GXBB 4JDZA 4YLQT 5D6DA 2CDEB 4L4VD 5DS8B 1FNGB 4FQ1L 4LSVL 1G7MA 3RQ3A 4L4TB 4LVOB 3FT3B 5EO0B 1J8HD 1IGML 4FXKA 1SYVA 3CNKA 3T0EC 25C8L 1NKRA 3OR6B 4GMTL 4JY6A 1X44A 5J6HA 1IQWH 4LCYA 4IOIA 2FR4B 4JY4A 1UH2A 3MNWA 4KTYA 2NY0B 1WAAA 4F33A 1V3LA 1FG9C 4X4ME 5JR1L 5ISZB 5BQ7B 5I6XB 1XGTB 4J6RH 1GC1H 4EDWH 2B7DT 4KPHL 4UV7H 3W39B 3L7FB 4TOYH 4MJIB 3V6OC 4Y2DD 1FYTA 4NUGH 4R8WL 5BS0D 2MPAH 4XNYL 2X1PA 4KTDL 5IESH 2J1KA 4KU1A 4O02H 1F3RB 3I02B 4Y5VB 3FT2B 3CJJA 3O6KH 3D1MC 2BHUA 3UXFA 5ANME 5I74C 2E8YA 2P8PA 1I8MB 5IHZA 3QQNA 1E28B 1NAMA 2CLVB 3H9SA 3LQMA 2OSLB 2VH5H 1VFAA 1LDSA 5MP6L 1T4KB 3S6CA 4PY8J 2IH3A 4WW1A 2F8VA 5I16A 3T08A 3GMQB 2WUBL 4OCWH 5DK2B 2AK1H 4ZFZA 1NSNL 2ADIA 1JGUL 2HFFB 2GJZA 4F57H 4QHKI 1AJ7H 3OAYH 1U8LB 2YPKB 4G6FD 1RMFH 2EXYC 1VEOA 5DA0B 1FL5A 4BK5A 4HIHA 3ZL4H 2BX5A 1S7QB 2IAND 3NABH 5ALCH 3NZHH 3CSGA 1N6QH 1TTFA 1MLCA 3NZHL 1LEKB 1N6QL 2LVEA 1EO5A 3AY4A 3O6LH 3OAUH 1RHHA 5KBNC 1WITA 2ZP0T 1MLBB 2N56A 1TZGL 5TE7H 1Q0XL 1QNZL 4KMLB 1LNUA 3S37X 3CFIC 3W39A 1F90H 1CGTA 1M7XA 3RWCA 4PB0H 3B4NA 4DFIA 4MAYC 5I15L 3QUML 1LK2B 2X6MA 3EUUA 5IJVA 5EA0H 3CK0H 3O4LD 2X10A 2Z35A 3HN3A 4KRPB 2I60H 2HT2C 2WWKT 4GAYA 5CP3H 2P8MA 4NJAH 3V8OA 5JW4N 5GRWA 3T3ME 2WBJC 3O3AB 1N64H 1MWAA 1T6VN 5DO2D 3SGEI 3TYFA 4KROC 4OLEA 4Q2ZB 4Z77B 2DS4A 3SE3C 5DVOA 3UAJD 4R7NA 1JWSA 4PV9A 2R2HB 1H5BA 4NFCA 4QY8B 3X11B 2UYLB 1A9BB 1GPOH 5FKPA 2H8PB 1S9WA 2JIXB 3SDAD 4BUHA 3C2SA 3C8HA 3VXSA 4ODUB 3VMNA 3TBWB 4Y16A 5C08A 3IDMA 3MRNB 3QQ9C 5EC2A 3DBXA 5I8KL 4WEBL 4MD0B 1G6VK 2V5YA 4BYHA 1NANH 5F7HA 3BAEH 4LNRB 4U1GC 1UH4A 1KCLA 4K3HA 1A22B 4Z0BH 1UC6A 1KCUL 3ECBA 3W0WE 5I18H 2WNGA 3DHJA 1D5ZB 3CVIL 2GT9A 5H37G 1RSFA 2F58L 4N9GA 4U1IA 4DGYH 2O5XH 3F6IA 4QWWD 2IWGA 3IETB 3ARBB 2B20A 4E41B 5JW4M 2ADFL 3QNZB 4OZFA 2V2TB 3M8OH 1IGIH 3P30H 5FO9B 4LDOB 2Z31A 3TN0A 1PLGL 4OCWL 1CLOH 1I75A 1OTTD 5EOTA 4XVJL 5I1LA 1U8MB 4X6DB 3VXSE 5D8JH 5C0CB 3GMLB 5CINH 4JQVA 1LDPL 4DTGH 3HE6A 4KFZC 4EVNB 4MGXA 4RGOL 1H5BB 2IPKA 2Z91B 4NPYB 1ACYH 2WW8A 5SX5H 2OI9B 4X4MA 4DJMA 3KYNA 4X5WA 1P4IL 3LKRB 1WISA 4WEMB 2KQNA 3Q6FB 1R3IH 2KPNA 5IW1B 1X9QA 4YHIB 5DK2A 1INQA 2ZCLH 5DJDA 3MA7B 5DC4B 5F7EL 1OCWH 2NXZB 3MOBL 5D1QC 4JG0H 4DK6A 4U1KB 1QRNE 4X5LA 4WNQA 5JIKA 5JPMB 3VXMD 5C86A 5HD8D 1NC2D 1X5YA 3MXWL 1A6UL 4TVPE 5T3ZE 1BLNA 4L8CB 4QEGA 3ARDC 4TULH 3VD4A 4RFEA 3BWUC 3SE4C 5E5MB 3M1BB 4ACPA 4PJEB 2YPLA 1A6TB 3QI9D 2G75B 1DBJH 5DRXA 5SX4I 4RGMB 5AZEH 1NCDH 3AB0C 3QDJA 3U4AA 1DLHB 3VWJB 1YYLL 2XY1A 4MSWA 3DGGB 5ITFA 4L3ED 3T8XA 4LHUD 5I73C 3UBXG 1HNGA 4PD4K 4F37F 5I0DA 4JJ5B 3SGKA 1DQJB 5E2WH 4NM4L 1AGEB 1C12B 3WO4C 3QAZC 1D3CA 1WCBA 4WIQA 1HHKA 1R5WA 2HFTA 4ODSL 2FB4H 3HG1A 4RQQA 3KPRB 1AO7D 2ITDA 2AJZA 4X8XA 5CINL 3KPRD 3QUKA 5DJAA 4Q9CA 2MQCA 4AM0B 1BQHG 1IAIM 3VCLA 3FQXB 4HEME 4M4PA 4D8PB 1NPUA 4KXZH 2EEBA 4KXZI 3KPQA 4MD4A 1ZT1B 4PJAA 4L3EB 3QQ3B 5ALCL 3MBEA 4M02A 1K4DB 1JWSB 4ZO8A 5HXMA 4EI5D 1DVFB 3TA3D 2ZZUT 3TYGL 1PG7H 4JN2B 4HLZH 1T03H 1GOFA 2OM5A 2AJUH 1JWMA 1NMAL 4YGAB 1FZMB 2O26U 3QFDB 1TQCC 2PW1B 1KN2L 3PQYB 3GSRB 4YQXL 1KB5H 4U4BA 43CAB 3ISWA 1A0QL 3I75B 4GKSA 5ACLA 1OLLA 4X6BB 4WU7A 3DRTB 3OKEB 3ZDXE 3U36A 4WTXA 2FL5A 1MJUH 3WNNA 3SE9L 3IDNA 3L3HB 4KJYB 4OZ4B 3C6SB 1XCQA 2CKBA 2R1WB 3ULUF 3ARQA 5I1DB 1UM5H 4G42A 4Y19E 5I17A 4NO3B 3EDFA 1N64L 5D72L 4YHKL 2DLEA 3NCJL 5HHQB 5IW6A 5E1AA 4ELKA 4P4RB 3RWIA 5CEXA 3SKMB 3QQ4B 4IHOA 5HGAA 3HCVB 3QQ9D 4TSAL 3WN5C 1E4WL 2R2BA 1HSBA 1IVLA 4F9PC 2J6EA 3VFWB 1FHGA 4LKXA 4LCYB 1CFBA 2VDQH 4R4BA 3GJFA 5GRJH 4D0DA 1S7RA 3C2AH 2BNQA 3MLWH 4TN9A 1HXYA 3H6JA 4PTTB 1A7OH 1D9KB 4LL9A 4D0CB 3DO7A 1Q94A 1JGLL 1J12A 3KPLA 1VADA 3MGTA 3HFML 3UPCA 3C5JB 1AR1D 5F71A 5E8OB 5GRVL 2YWZA 3D2UA 1L7IH 4N8VG 5F70A 3MOAH 2V7NA 2F54A 1A7QL 1DQDH 3I02A 1LQSR 1GVIA 1RZJL 5IEKB 3O4LE 5I2IA 1FLRH 3O3EA 1A0QH 3BSZH 3LEYH 4MAYD 5JA9A 4WU5B 2XWBB 4GLRI 4OB5H 1J05B 1QP1A 5SWSB 1NGWB 1CDUA 2DM7A 1XF3A 3PGCA 1KEMH 3U7YL 3OR7A 1NGYB 2BVOB 5D7IE 4OCMC 5E2UH 1TETL 4FQXC 2DICA 4OD2A 1PZ5A 5BQ7A 1AC6A 1IEBA 5EOCL 3QEQE 4JFEA 1II4E 4M3KB 3IU3A 4KRPD 3O4LB 1LK3L 1YY8B 3C9NA 1A6PA 1H8NA 4FXKB 4HKBB 5T5FH 1U8OA 2UWEE 4ZFFB 4JANA 8FABA 4ONGL 2E6QA 2LAGB 1SM3H 2CIKA 4WFED 1QLEL 2AEQH 4KJWD 4PB9H 4H20L 4NUGL 1IKNC 4PJIA 5C0RH 1AGCB 2YZ1A 4BKLB 5DJZB 4F37K 1ZLUH 4ZOCA 3LD8C 4PV8B 2VXVL 4O5LH 3E6HB 3UTQB 5HTSA 5EU5B 3LD8B 5E6IC 4XCEA 3OMZA 4JN2A 3W9EB 2YKLH 4F58H 4GKOA 2HTLC 1N7MH 2CUMA 3IGAA 3V4PH 5EZLB 1RZJH 3M17A 1AP2A 3MA9H 4JM2B 4P23B 4WRLA 5EBLB 1TVBA 1MREH 3X13B 4GH7B 5JOPD 2R4SL 5L6YL 2OR9L 3A67L 2OR9H 3A67H 1CGSH 2SEBB 4TSCH 2R1YB 3VXRD 2FHCA 3LAFA 3MO1B 1NMBL 2QSQA 1F2QA 2D03L 3ZT7A 4Q97A 3TA3C 4XMLL 2HLFD 4QRUB 2FIKB 2J5LB 1EA9C 4LSRH 3QFJB 2X05A 1KELL 5ESVB 4I18B 2ESVE 4X99A 4JY5H 2IBZY 2RIKA 3V52H 4H25A 5EZOH 4PTUB 2YPVL 4ELMB 1WTLA 1YYMH 2X9YA 3CX2A 3LDBC 3ZHDA 1KN4L 3BX7C 2Y6SD 3HHRB 3O3EB 4X5XA 3P3YA 3BP7B 3SKNA 4XP6H 1NBVL 1CL7H 4AH2B 5BS0B 3IDGB 3HI5L 1JFQL 4Y2DB 4NZUL 3UTTA 4F7PB 5HI4C 1IFHH 3SGDH 1TZIA 2NX5B 1Q94B 1D9KC 1UB5B 4ORGB 5T5NF 5EU3B 1CICA 2WIIB 3UJTH 1JHTA 1LDPH 3L5XL 4M6ML 1FC1A 1RIHL 1TNMA 4ZUTA 2DF3A 1PKQE 3E1F1 4G9FA 2YD7A 3OX8A 1TDQA 4O2EB 4HSQA 1UVQB 1KUMA 3QWOB 1L7TH 1R5VA 4G8GE 4HMEA 3TNNA 1A1OB 1LE9A 2ZOLA 1EEUA 3TJHC 4LVHC 4L4VB 5IVZA 3U79A 3GMMA 1GJIA 1H15A 1IM3A 5C7XH 3G9VA 1QFWL 4IOSD 4NKMA 1AQDB 5CJQH 3VD3A 1ZAGA 3O9WC 1JRHH 2Z4QB 5T1KD 4Z76B 1NCCH 2VZTA 4IDLA 4PGDA 5D7JD 5EU6B 4Z7UE 3O4OC 5DFTA 3CSYB 4OF3A 5FGCB 4M7LL 4ODHH 3QNZA 4OZFB 5MI0C 4WV1B 1U3YA 1G7PA 2DLFL 1FZJB 5BVPH 5F7DB 3TN0B 2OK0H 4LCWB 5ESAB 4MJ5A 5JORA 4H5SA 2BY0A 5GQBA 2X4PB 4TQEL 3TO4B 2IH1B 3LN5A 3UJIL 1CLYH 1KJ2L 2AJXL 3P30L 2LTQC 5IMOA 2Q7YA 1I9JL 5D93C 4G6JL 5GGRB 4FQXD 1BVKB 2CKNA 3EBAA 4S1SH 3T0DA 3CVHA 2VC2H 4K3DH 2UYLA 3QXWA 5DJ8A 5DRWA 5C0IA 4RDQG 3FOMB 4NKDA 3O8XC 4NT6A 1GGIL 3CMGA 5E2TH 4S10A 4MQXD 2G5BA 1T22A 4U3XA 5J13C 1CE1L 4L9DA 4M7KH 3H2WA 4N0UE 2YPLE 5F7EH 1H3VA 2QQQA 4ODXB 3KWWB 3VGAB 2NZIA 1U92A 4LPXA 5C0JB 1SYSB 3RPIB 5FHBL 4KPHH 3WHE1 4HK3N 4HBCH 2FATH 4QGTA 3SOBL 2ICWJ 1JPFA 4G8EB 3IFLL 2XG5A 3VWJC 3QIWB 3TO4A 3ARPA 2XFXA 1QOKA 2QSTA 4CN4A 5GGVL 4HUNB 2LU7A 3RGVD 2JTDA 4AMKH 3E3QC 5J11C 3BISA 4HLZG 4CN6A 4HKZB 1D5MB 3PF2A 4JFYB 3QUZB 3ARDB 2I60L 3HI6L 1ZHKA 3T1WA 1NDGA 2J8UE 1E4KA 2FJHA 3RUGB 3QG7L 1BQLL 3M8OL 4Y4KC 1G9NH 3UTSE 4A6YA 3C60A 5C0DA 2Z9TA 1T0NB 3V0VB 4LK4A 3O2DA 3N1MC 4NJ9L 2EIBA 5I1CH 1A3LL 1RZJC 2ICWI 5F9WC 3G9AB 3LB6C 4TUKL 4P0DA 3VXME 4HJGB 5F9WB 5I1IL 4P2OA 3STBA 3NA4A 3LS4H 4IMKA 3O9WD 1F2XK 3KXFD 5HDOA 1RPQA 3MXVH 4G9FB 1BOGA 4GRLD 4DCQA 5T33L 3NABL 4Y4KB 4XWGL 3ARDA 2EDJA 3SBWA 4WW2F 5T3XE 4GW1B 3OF6D 4PYGA 1MY5A 4QOKD 1MAKA 3GSNA 5GGQH 3VXNA 2AJVL 1DEEB 2JELL 2JKXA 1I1YB 3AS0A 4MA8H 1NAMB 2CLVA 3HMXL 1I85C 5I8EA 2CKBH 5JOEA 4QRRD 1T0PB 4OCRL 4OV5B