4X9HA

Crystal structure of dscam1 isoform 8.4, n-terminal four ig domains
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
395
structure length
391
Chain Sequence
b'QKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVSQFYITEAENEYVIKGNAAVVKCKIPSFVADFVQVEAWVDEEGMELWRNNYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVSPQLSGNGNQEHITLTRVPKMGSVTLMCPAQAYPVPFFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Down syndrome cell adhesion molecule, isoform AP
publication title Structural basis of Dscam1 homodimerization: Insights into context constraint for protein recognition
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
total genus 71
structure length 391
sequence length 395
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9hA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9hA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9hA03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x9hA04
3G08B 4LRNL 5DHVA 1F4XH 1UQSB 5E6YA 1QFWL 1A7NL 2VDNL 5DXWA 1MCPL 3GIVA 4P2RA 2BNQB 4XVJL 5D5MB 5ILTH 3OF6A 1T1ZA 3VFVA 4QTIL 3GHBL 4WDIB 2W91A 4L4JA 5EBWA 2ICCA 3LS4L 5L6YL 5DK2A 3KPRA 1JZ7A 4ZPTB 5C92A 4M5ZH 4RMUA 1IAIL 3HZKB 4I48B 1FNEB 4KZDH 2FLRT 1T1YA 4ORGB 3BDXA 5D2NC 2J6EL 3OKDA 4XT1C 1J1PH 3BWAA 3H7LA 5DGQA 2H45A 3TV3H 4GG8B 4HEME 2VAJA 2R8SH 3IFNH 1KTLA 1Q9OB 2YMXH 3QT2A 1Z5LB 2HN7A 2BSRB 1CICA 2CR6A 5FYJH 3V95A 1NCDL 1ZMYA 2A6IB 4JG0H 4LPXA 1AGBA 2Q1EA 5T1LA 1LEKB 5FF6A 2YA0A 2F54E 1KBGL 2A38A 3P73B 4QHLB 3CFDA 2X1QA 4ZS7H 3RGHA 4HKBB 1EFXB 3SJVA 4PJ7A 4X6EB 5EU6D 3FHAA 4D0DB 5MHSE 1MCOL 2NYYD 2IQAA 3VD5A 3UZVB 5FCSH 5FECA 3BUYA 3V0WH 4HGWA 2VDPH 3QDGA 3LOWA 1DVFD 5HGAA 4KAQL 4MA1C 1L9MA 4M7KL 4Z18A 4L8SB 2OR7A 2ZPKL 4GQPH 4XPHL 3EYOA 3U2SB 3KPNB 4PJ5E 2AS5M 1I9JH 2J88L 2ED9A 3NN8A 4IMLB 1VADB 4WI6A 5HHPA 1AO7D 3LVEA 4PJ8D 4LEXL 3CXDH 5EORH 1ZK9A 4TUJB 2Z8RA 4EVNA 4BZ2H 2FX8H 2ZUVA 1V7NH 4LASH 1HKLL 5LCVL 3MLTB 5IG7A 1X5IA 3L3DB 4MNGE 5D6CB 2IALB 4JFQB 4DKFL 4M7ZB 1UT9A 5IP4A 3PV6B 3EFFB 3V5HA 1KYOK 1RZGA 3R4DA 4WEMB 3PWPB 1RK0A 2XRAL 1AE6H 3IB4A 1LO2L 1BBDH 1DQQB 2VL5A 3BP6A 1VFAA 5HYSG 5GGVL 5F71A 2BERA 2XZQL 1K8IB 2YBRB 4KQ4L 4P3CH 1VEMA 2YR3A 4BFIA 4UDUA 3C60A 3ROLA 1CXHA 2PYEE 4XCCL 1H5BC 4NCC2 5BVJA 1N8ZB 3L7FB 4ODVH 4WUUB 3FN9A 4Z5RB 2QSCH 3FMGH 2VAAB 3IGAB 4TUOB 3SE9H 5ENWA 5GS0L 5KZCD 3PDDA 2NX5D 1RZJL 5F21B 3QEHB 3EHBC 4CU8A 3MV8D 4PRBA 3MRPA 4G6FD 3HRPA 2QR0B 4R0LA 3BPCB 1SJHB 4NQCB 1QSEB 3MUZ1 1D9KA 5GGSY 1IEHA 3O8XC 3W9DA 4FG6D 4NJAH 15C8L 4P23B 3QUYA 3O3DB 1X5LA 1A6AB 1BX2B 4UTAH 3GSVA 5E4IA 1H15B 2EDRA 3VFMB 1FNSL 2BSSB 5H35B 3EO9H 2NLJB 4JFEB 1U2HA 3BPLB 5DO2C 1WWAX 2YEZB 3RL2A 3ZDYF 4CL7A 1WISA 2FEEL 5GQBA 2E6PA 4EI5D 3NTCL 5KSAB 3MJ9A 3O3EB 3PDGA 1B4JH 3HC0B 3C08L 3BUTA 3RWDA 4RIRB 3MLXL 4ELMF 5BS0A 3IYLW 5DSCB 4J3TA 3AY4C 3TN0D 4KQ3H 2JCCA 2FR4B 5I0DA 5JPNB 2WMPA 3EJYD 1LDPL 2EDDA 1M6OA 5JDJA 4TQEL 2KL6A 2Y5TB 1S7WB 3QH3B 3V6OC 1X5YA 4IRJA 3MCKA 2FEDC 3B9EA 4RA0C 4XCNA 4AQ1B 1NBVL 4DN4L 5EA0L 5JHLH 1FORH 3MOAL 5FHBH 4UDTA 1M1SA 2YPVL 1EHLL 3BSZH 5IESH 4PRHE 4J8RA 4NUJA 1N5AB 4GRLB 1FL5A 1RIHL 1HZHL 5FYKU 4PJ9D 1LK3L 2HVKA 1NC4D 1H8OA 3TGXA 5ANMB 3LPWA 4HF5H 1I3RA 5T1KD 2C7UA 4ONOA 3DXAA 1AQDB 1CT8A 1FV1A 2GTZB 1ITBB 2ATPB 5MEQA 4UB0L 4XP5H 2ZUYA 5DJ8A 2EE9A 3RA7L 1Q0YL 3PWLB 4NZUL 3VG9C 3H9SB 2XWTA 2UWEF 1KJ3L 5JOPE 4PD4J 1QEWA 5I1LA 2YPLE 3HS0A 1EEYA 2EZ0D 3THMH 2XZAH 4NO0A 4KKCC 1EJOL 3P4OA 4HSQA 4P4KC 3C09B 1YEJH 2Q3ZA 3P9MB 1W72B 4LVOC 3KLHC 1CDGA 1KCSL 2F74A 3AUVA 3KPQB 2E9JA 4LDEB 3BQUD 5A2FA 3IT8D 5I1CH 1A47A 4WU5A 4POZD 3GRWH 5IFJA 3NPSB 5DFVC 3CZFA 4Z0BL 1AGCA 2PXYB 1F00I 1FNGA 4GOSA 3SKJL 4F80A 4JHWL 1MCBA 1VEPA 2D9CA 3AU1A 3UDWA 3JWOH 2HMID 1KN4H 1ZLVK 1YY8B 3E6HB 4KJWC 1A7RH 3IDIB 2CR3A 4L3EE 2LTQC 1X44A 3IDNB 5EWIL 1BQHA 3L9RA 1KCVL 1D5BA 1QBML 5JQ6H 5I1AA 5GRWA 4LLAA 4MS8C 5F96H 1FYTA 1FFNA 3QWOA 1W0VA 5DD0L 5C0AE 3MFFA 2YK1H 1WITA 2X89D 1N64L 2FBJH 1NSNL 4UV4L 3PGCA 3UTTB 3X3GL 4P57A 4NHUA 2YC1A 4M48L 4HHAA 1QKZH 2VR9A 5J6HA 4F7MB 5JIHA 1HWGB 2OI9B 4ZFZA 2C1PA 3MUHL 4PP1D 1F5WA 5DRWA 3LEVH 1I7ZA 3FO0L 3HC4L 3TYFB 4QT5B 4X6DA 1VFBB 5AZ2H 2IH3B 1T1WA 3OXRA 4JY5L 1KLGB 1C5BL 3ECBB 4NQED 4PJBE 3SGJA 1RK1B 5IB4A 3BIKA 3ZTNH 5KS9E 5C0EA 1L7IL 4AM0B 4YNYA 2FZ3A 5E9DB 4WNQA 1HI6B 2EDEA 3DNKA 1X5AA 1T6WA 1UKSA 3DI3B 4LVNB 4NBXB 1D5ZB 2BOBB 3IFOA 4PJAE 2IPTL 4KJPD 1F11A 3D48R 3BI9X 4GSDL 4NO5A 1QTYT 5M95B 4OGAC 4OCXL 1N7ML 4JJHA 4P48A 3VI4F 1YPZB 4XNQB 2KZ1B 1BVKA 1G9EA 4PRDA 3DX7B 5D7JC 1IEBB 4X6BA 5I8EA 1IEAA 4YEFA 5DZOA 4OM1H 4ACPA 2MCG1 3I02A 4NNXB 4GXVL 5SWSB 4XWGL 3SGEH 4C56A 1FLTX 2JJTC 3H9HB 4KKBC 3CLFH 3O11A 1G7MA 4PREB 5DLML 5TDPA 3MRDB 5GRUL 3DMMC 4ODTH 5IK3B 5FYJE 4JHBA 5EU5A 1UWXK 1XCQA 5F7KC 4R96A 3MRCA 2AAVA 3INUH 2CIIA 4HPYL 2GT9B 1YEDB 1JFQL 4NSKA 5GGTH 5E00B 5EZOH 1CLZH 2B1AL 2ICWI 4P46A 1IC7L 2MPAL 1TVDA 4O9HL 5DVKA 2QQQA 4KH2A 4Q6IA 5JQHC 2HT2D 5IW1A 1TJHH 2FL5A 4K3EL 1PG7L 3P30H 3TJEH 5IEKA 7FABL 2BC4A 4U6YA 2IAMC 1CG9A 4OZHA 1HSBA 5ACZA 2CKBH 2PW1B 3IRZA 3O6KL 2VLKD 2FIKA 1PGRB 2Y72A 3KPTA 1NKOA 4I1NB 3BVNA 4YXKL 1GIGH 4HULB 2BNRE 5A2IH 2X40A 1Y0LB 5IWLC 4UV7L 3UTPE 5F9JB 1FLRH 5F7UA 3EJZC 3JWDC 4WW2C 5DMGC 3PF2A 1A6TA 2AJYH 3QNZB 1CFQA 2FECI 3D0VB 2P8PA 1UYWH 3EYVA 3MA9L 4O51B 5DUBB 5EU3A 3TCLB 5EO0A 1IGYA 3CXHJ 4XAWH 2EXYD 1MCSA 4KVNL 3HTLX 3TIDB 4ZAKC 4KV5F 2V2TB 1A5FH 2FRGP 4KWUA 2I27N 4HMDA 2LVCA 5HDQL 1SY6L 4GXUN 3S34H 8FABA 5MENE 1OAZH 3GSNH 4PTTB 1U8JA 1YY9C 4RFNC 3U0WL 3MRNB 3RUGB 4LKXB 2GY7B 3QXDB 2ORBH 4NT6B 4ZUSB 3RVXC 4XMKH 3AM8A 4NWUL 3NBNA 3MLZH 1J8HD 3OKKB 2FSEB 4D0CA 1JHKL 1NGYA 3PP3H 4N0UE 3WJLA 5I1GL 3SGKA 4OQ1A 3D69A 3PHOB 1E6OH 2X4NB 4Y16B 3U0TA 4S10A 1IFHH 4J2XA 2Q76A 5JXAL 4K23H 4OFYD 2R2BB 2VYRE 3CK0H 1KIQA 4PRPB 4DW2L 3RZCA 3VH8A 4QRRB 5IV2B 3L3KA 5ACLA 5E24E 2IPUG 4Y7MA 5DQ9B 4ZSOE 4KHTH 4FQXC 5C86A 5DJAB 3OJVC 4MXWH 1L7TH 3WKML 4X5WB 2H2PD 3F7QA 1BZQK 2N7BA 3SGDI 3BH8A 3QIUD 4QRSB 4EUPA 3K8LA 4DEPC 1E6JL 5FKAB 4Y89A 4DQOH 4PFEA 3VWKA 4TPRH 5FUZL 1CICC 3GSQB 3NCJL 3B4NA 2CMRL 3VGAB 5DHYA 3O3UN 4OUUA 2IG2L 3BW9A 4PJXA 3ZT5A 4PUBH 3LZFH 1MAKA 3QIWB 4NGHL 3WNOA 1NUNB 1CE6B 1EJ6A 3QFJD 3V6ZB 1BLNA 3GFUA 2P8MB 4NM4H 4PJEB 4BZ1L 4Y4HA 2A1WL 4E41A 4HS3A 3WIHA 3S35X 4NQDD 3OKNB 4ZUUA 3PWJB 5BRZA 4OIIL 5I1DA 4OI8A 3JTSA 4J4PA 1PEZA 4AT6A 5D7LA 1AR2A 3FFCE 1DCLA 1T0PB 2APXA 4XCEA 4WEUD 4IIQA 3KYOB 5IMLB 2ERJB 4O02H 3S3SA 3EYUL 3AS3A 5EU6E 3W82A 2VZ3A 1UM4L 3SDXB 5KTEH 2OJZL 5F97E 1KNOA 5IMOA 3K80A 1NAKH 1CGUA 1LQSR 5EC1B 3MNZA 4DVBA 4OI7A 3RRQA 4Y8AA 1L0YA 2BNQD 3RWFA 3JV4A 5TH2A 1JCKA 5CINL 4I5BA 4X4XA 1C12A 4LSQL 1T0MB 4HK3J 3ZE1E 4LEOA 3HZYA 4KMTH 5KAQG 1EMTH 5T1MA 4YPJA 1CYGA 4WW2F 3RY5A 4M62H 2IJ0C 1OB1A 1FSKC 1AO7E 1G7IB 2BHYA 2HJLB 4G8FA 3FFDB 4Y5VB 4LF3A 1R5IB 5DA4A 1ZLSL 5F7EL 3NMEA 4PJHA 3S36H 3CFCH 5IM7B 4G6JL 5ICZB 4JZOA 2IADA 1UZ6F 1FL6A 3HI6L 3U82B 1HHGA 2MCPH 3K4AA 3UBXB 1WTLA 3C60C 4PP2A 1G1YA 3H0TB 3VFGH 2P8LB 4OQTH 3KPPB 5KSUA 2EEAA 1IKNA 1P69B 4S2SA 1GGYA 1HSAB 2VOTA 4ZNCD 4X80H 1U8NB 3OPZL 4AIZB 5CFHA 2PTUA 4IOFC 4I8DA 1CDBA 3PL6A 3ZMRA 1EFXD 1EUUA 5C70A 1QD0A 1G6RA 4YK4C 1CFBA 1PYWA 4HS6B 1MY7A 3F65A 1BM3H 4XNZB 5B3NA 2YWYA 3ESUF 3F7VA 4NRYB 4RZCA 2R2HA 1CE1L 4R0LC 1CQYA 4YR6B 3O9WA 3U6RB 1TIUA 2EE3A 2G5BA 1J1XL 3QUYC 2E7BA 4PJFA 4Y19A 2BSTB 2DF3A 4W4OA 5E8DH 1EZVY 3SE4C 3I50L 3AROA 1WQVT 2BFVL 1EZVX 3MLUH 4U6HB 5FDWA 4NYLA 2F19L 3FJTA 5BZDB 1VPOL 2YUXA 5C0FA 5DQDL 3ULVL 3SDYH 3LKPA 4JJ5B 4LSRL 2ZKHL 4X7DC 5C9JB 2UV3A 4QRQA 3QPQD 5BVPL 5I1HL 4YQXL 3A6BH 4D0BA 5TGBA 5JMRA 1F4HA 1MHPL 3ARDB 3NGBB 4QXUL 3UAJD 4I2XB 4LSPL 3IDJA 3SKNB 2BVYA 1CGTA 5E08L 3L7EB 1IAKB 5HVHB 5I19L 3SBWA 4HQQH 1I8MA 2H3NB 2I60H 3KYMA 4IRJC 1U8HB 3UPRB 4FMFA 2R1XA 3QDJB 2P44B 4YHNB 4YBLB 4FXKB 1G7PA 4PJ7F 4TN9A 4Z7VA 1GPOH 2E27H 2WBJB 3P0GB 1ETZA 3QHZL 4M5YH 4GBXA 1U8PA 5F7DB 3I9GH 2ICEA 4NDMA 4KROC 3MRFB 2P48B 3FCTA 1JGDA 4QHKI 5HDBF 2BVOA 2DTSA 4JFDE 2XWBA 3S4SG 3GMLA 3GJFB 4BUGA 3DX6B 1FPTL 4HC1A 5IMMB 5GGSB 2CQVA 3CVIL 4NC1C 3WJJA 3HNSL 4NQCD 5F9OL 4M1GH 3TBWA 4P23D 4BYHA 3QIBD 4X5XB 4NO3B 1XGTB 3VXUE 2QQNH 4FP8L 3MRRB 4YDLC 3GM0A 1IE5A 1I1YA 1OLZA 3L3JB 3QQNA 1W8NA 1FO0H 1M71A 2DLHA 1IGTB 4QRPB 4JFED 1BVLB 1S9VB 4X83A 1VKXB 1A0QH 1EXUB 4HUWA 5KSAD 3DGCR 4L29A 1SM3H 1EGJA 4FQQA 1DBMH 3V4VL 3ARGA 5GS1A 4CGTA 5IJKA 1KFAH 5I74B 5L2JB 2J12B 4U1HA 1FHGA 1G9NH 1U3HA 3F7RA 3UDWC 5HGHB 4N1CA 5HYJE 1GYAA 3ILPB 3VU2A 5CP7A 2OJEB 5CGTA 3BYTA 3FTGB 2EH8H 4F8TA 3C5SB 3ZE0E 3S35L 4R7NB 4JREB 5I66B 2Y6SD 3L3GB 2FJFA 4UILL 1AGDB 1DLFH 1WZ1H 1SJVA 5DI8B 3CDGA 4Q9RL 1PD6A 4LLQA 4N8VG 2DIJA 4MX7B 4XVSH 3OJ2C 5MEPA 5K9KA 2ESVA 4HUMB 2FECL 4HV8A 3CUPB 1G9MC 2R4RH 3B2UD 3UYRL 5KOVC 4LLVA 2Z8SA 2BVQA 4NN5B 1R24A 3X11A 1ERNA 3NZHH 2OS7A 4ZG1A 2XTJC 5IBUG 3O4LB 5SWZA 5EPMB 3BX7C 3ALXA 4M03A 4APQB 4TOYH 4QOKA 4R90L 1JWMA 4HUUB 4TSBL 3LHPH 1G7JA 3PG2A 3H9SD 3OZ9H 3GJEB 5HPOA 3C6LA 3NH7H 4XXDB 3HNTH 1UVQA 2HJFA 2P5WB 4UINL 4DZBB 2AGJL 3KYKL 1GHFL 2DQFB 4HCRA 4HWEL 2VMFA 3GO1L 5AAWA 2EYTA 4FHBD 1Z2KA 4QKXB 4U1MB 5DWUL 4CMMB 1JZ4A 2HFGH 2D4DA 3OB8A 3QCUL 1YMHA 2CLVB 2JCCF 5GZND 1P2CB 5TDOB 2PXYD 4L8DB 2MTPA 4HIJA 5CJBA 1MH5A 4PGBA 4HMEA 4YXLL 4H88L 4Z76B 5JO5A 2ADFH 4ZPVB 4NNYB 4NZRH 5TE6L 4HIXH 3H6JA 1WCBA 1EPFA 2W65B 4JB9H 3VFOA 1DEDA 3QWRA 2D9QB 3UJJL 5AWNL 3S9DB 1FG2B 1YEEH 2V17H 2HT3C 1MREH 1ONQB 1I9IL 3WFCL 5AUMB 3OKEA 2XYCA 3HHRB 5CZXD 3BKJH 2JTDA 2AKRB 2Y5EA 1MJ7L 3UTTD 4AYFA 4MNHA 1KEMH 2VERN 3SDCB 5LWYL 3F12A 3VXMB 1NKRA 1RZ7H 2MQ3A 4YHYB 1ORSA 1XF1A 3QSKB 3MUGB 4DCQA 4HUVA 1QLEL 4Q97A 1QLFA 4I3SL 3X3FL 5FA4A 1DFBL 2NMSA 1L0XA 4K71B 4Q6IC 3WFEH 1QYGL 4DN3H 5LQBL 2VB5A 5GRYA 4OFKA 4ZO7A 1S7UA 4FNLH 1S9XB 1SQ2N 1AHWA 3J7HA 3S6CA 2OMNA 3C5ZA 1IKFH 4LLWA 4ENED 1A2YB 1I8IA 4PJ5A 1RZKH 1JIBA 3CVHA 1OAYH 5HHVH 1A1OB 2J2ZA 3T2NH 4LHUA 2V5MA 1D6VH 4HK0A 2QQLH 3IJSA 1OSPL 3WLWD 4O2EA 4CADB 5E2TH 1DQMH 4FTVB 3QCTL 1OF2B 3QR2A 5CLWA 3FB5B 3GSUB 4M1DH 4XP6H 4MNGA 3MOBL 1ACZA 4W68A 4JVWA 1RUML 4OT1H 1CGVA 3IDYC 2X4SB 4RAUB 1NLDH 1RIVL 4QXGL 3JXAA 1I1RA 4YGAB 1MIML 1FAIH 4LSSL 3TO4B 5EFIB 1KPRA 4MXQC 1T6VN 4J7RA 5DRXB 5KW9L 1FIGH 3JVGA 3FKUS 2VLLB 2A73A 3U7WL 3KS0H 2PYEA 4PRIE 3NAAL 4POUB 4AEIL 3NIFE 5F70A 2OM5A 4IDLA 5DQJB 1CBVL 5GIRB 3AM8C 5EIIB 1FVEA 3MCG1 3VWJD 4E5XB 5T33L 2AK1L 4GUPA 2FH8A 3WJLC 3BGFC 3SGKC 4ZTPH 2I9LA 1LP9E 4HLZG 5JOEA 4X6DF 4HWZB 2VJXA 4J6RH 4NZTL 3OR6A 2VRAA 5ALCL 4C58B 3LPFA 1KCUL 1HOCB 4LGRB 4D9QE 2D7NA 3TH4T 3GSXA 1TCRB 4FQPA 1JJUA 1JHLL 4HWNA 4H1LB 3O2DA 4QHKJ 3KVQA 4NHCL 1JNNL 4MQ7B 3T4AA 3UO1H 1CGSL 2UYLA 3PQYE 4KGLA 1U91B 1WICA 4MJ5A 5FV2A 3RGVA 4P2OD 1N5YH 4K2UH 3FT3B 3RVWC 1KB5A 3IXTA 5KVMC 1PVHA 1CZ8H 2F5BH 1DBJH 2XG4A 1DUYA 5BMFL 3VWKC 2DYPA 1JPST 1FNHA 1AJ7L 5HYQA 2ARJQ 5BOZG 43CAB 3T08A 3CFJB 1A1NB 32C2A 5AG8A 1K5NA 3EDDA 43C9A 2VDKL 4XMLL 3VG0H 4GKNB 3HE7B 2Z92A 4JPIA 4PYGA 1OM3H 1RURH 3I6GA 2CDGA 5IW3A 1Q0XL 1KCRL 4L4VE 4Y4HC 4PBXA 3MYJB 4HG4K 1JWUA 4R8WL 1MJ8H 1DQJA 3ULVE 4EEEA 3ARFC 1YYML 5DS8A 3VFUB 1CLOH 5GGRA 5I75B 2R2EB 2GJJA 4XC3L 3GMOB 4XPTH 3B6SB 5JZ7D 1FG9C 3WNPA 2FWOB 2B1HL 3KXFD 3X13A 1XZ0B 4FQIL 1M7IB 3GMPB 4X8JB 3SCMB 5DT1L 4UT7H 3RPKA 3RBSA 3N1PC 4JO3L 1EDQA 2D7TL 2CUMA 5IEHB 2VWEC 2SEBB 3LQAH 2P45B 4A6YH 4G6AC 5CKAA 4IRZL 4HWBA 4JM2A 1R5WB 1Z9MA 1GC1C 5CZKA 2HWZH 3RVUD 4OZHF 4EDWL 3O6ML 3ZTJG 4GG6B 1DUZA 2CK0H 2V5YA 4YHLL 3LKNA 5FK9A 3PWVB 4Z0XA 4ZFFB 2OTWB 4XBEH 5I8OL 4QRRD 1A7QL 35C8L 3QUMB 4K94H 9CGTA 2YPLA 3TFKC 1I1AA 2EKSA 4Z7NF 2YZ8A 2JKXA 5DMYA 3DIFB 5DUML 4AG4L 2VKWA 1QRNE 5D93B 1BD2D 5HJ3A 1KJVA 1MCIA 4TULL 5F3BB 3MV7D 5D70H 1AXTH 2YSSA 4NWTH 4LU5L 2ICWB 4WJ5A 4GRWB 1RUPL 5ADOH 1A6WL 1YA5A 5FO8A 2HP4A 1EHAA 2XT1B 1JWSB 2AXJA 4JPVH 4MA8H 2VDRL 3WD5H 3TJHD 5D1XD 3QIWD 4NFDA 5JA9A 1IKNC 4WFFE 3IRPX 4XMPL 1CL7H 1GSMA 3UROR 2O5XH 2DQUL 3PL6C 1LHZA 1RQ5A 4L3EA 4PJIE 3PGDB 2VQTA 3Q2CA 1HIML 2NY6C 4OCNC 4RNRB 1I9EA 2DB8A 2WWMC 3PDOB 3RIFF 1AKJA 5I8KL 4LFHG 3B5TA 4FZ8H 4YHZH 4OZFA 1FN4A 3O9WC 4CVZB 5FOBA 2Z8VC 5C0AA 1UJ3C 2A0LD 2O5YH 4ONGH 4IS6A 1MAJA 4W4OC 4NRXA 1E28B 2HFFA 1J11A 1F42A 2X10A 4M4PA 1N26A 1A02N 5JPMA 1QO3A 1NH6A 1JRHL 4PGDA 3KPOB 1LDSA 2E7CA 1MCEA 3IF1B 3U4AA 4CVXB 4I77L 1ZEAL 5JW4N 1A9EB 1ROWA 1I7TB 2X4QA 5D1QB 5LKNA 4FS0A 4ALAH 4PJBA 1MY5A 2GSIA 2XG5A 1GGCH 4HJ0D 5I1KH 5KSBE 3HFMH 5KS9A 5C09E 3LQMA 5DRZB 2Q20A 1KLUA 3H8NA 3T65A 3RTQA 1S7SA 4WWKC 3UPCA 4PJXF 3SBWC 1D5XA 1T21A 4RWYL 1RU9L 3ZDXE 4XGZB 1YJDC 4OKVA 1FIEA 4HLZH 3VD9A 1HHKB 2LVEA 3O6LH 4LLUA 4PJAA 4Y1AB 4HKXA 3MODL 1TENA 1JP5A 1AGFA 1QVOA 3QJHB 2DWDB 2VXTH 3MBEB 4OFPA 1EH9A 1OTUC 3CU7A 3LAFA 4GBXC 3F58L 3NPZB 3QUXB 1FDLH 4K3HA 4N5ED 1QLRA 4QF1B 2XZCL 2ARWA 3HZMA 4LSUL 4XBPB 4G6MH 1J0KA 3WNKA 2NXZB 5E6IB 3WJJC 5FYKL 2V5SA 2IGFH 3JV0A 5E2JA 5AD0B 1BQUA 3MLYL 5ADPH 2B4CH 5TF0A 4RDQG 4HKJB 4LARH 1F4WH 1HILA 3MXWL 3QFDB 2RFXB 3U0PB 3G5VB 1WC7A 2C3GA 3BZ4A 3FO9B 3GHEH 5LGJA 1OGAB 3L3IA 1GZPB 1O5DT 3MA7B 1V3KA 4OLUH 1OAUH 2V2WB 4QEGA 2YHGA 2EYSA 5IBLC 5C1MB 3EO0A 4KTDL 5GS1C 1YYLH 4MYWB 3LKOA 3NTCH 5DJXA 5IJKC 1T5XA 1CK0L 4PB0H 5D72H 3ARDD 3QCVL 4GKSB 1U3HC 3UXFA 5EH1A 1OTTD 4PJHF 1UZ8B 4RGNB 3QRFM 2BNRA 3HUJE 3G6JA 3FB8B 3L6FA 5E2UL 4N0CC 2DQGH 1MVUB 1JGUH 4OLVH 1BJ8A 4M6OH 2R0KL 1N59A 3HZVA 4OCSH 3QDJD 3ZTJH 1YN7B 4KUZH 3FO2B 3V4PH 3L5IA 5DK0B 4C4KO 2UZXB 2Z31D 2DQTL 3QI9B 2YD4A 3MROA 4HIEB 4ODXA 2BNUB 1MHHA 2NY4B 3K1KC 1YNTA 2BY3A 4YZFE 5ALBL 4LAQH 4Z95H 1PZ5A 2WBWB 2OZ4H 3AMLA 5KVEL 4GW1A 2A6DA 4MMXC 1EEZB 3OAYK 2OYPA 5MENA 3EDKA 5K9JL 1JNHB 4WTZA 4P5TA 1KTDB 3FT2B 2KZWA 4JO2L 2F5AH 4NN7B 4RISL 5D71H 3PJSA 1A6PA 1JPFA 1XH3B 3P4LA 3WDHA 2I25N 5B39B 1A9BA 1NGXB 2AJXH 3HCVA 3C6LC 1E27B 3DHJA 3MRLB 4JY6A 2MJWA 4N0UA 4RMTA 3IAGC 3NIDF 1Y6MR 4ZYKB 3VW3L 3T09A 3CCHA 4YGVB 5GSVA 4IM8A 1U6AL 4QRUA 3O41A 2RCSL 3WYRA 5ICYB 5DR5L 4F33B 5HD8C 3DRTA 3RIFK 1KCSH 3LN4A 5D8JH 2CPCA 2GFBB 4H5SB 4ZSOA 5TDNA 3GMQA 1K4CA 1AC0A 4P5KA 1KT2B 2EDXA 3CFKB 5BO1H 5T3ZH 4JY4A 1AQKL 4EIZC 1DBBH 2JK5B 3RHWF 3QZWB 2EEBA 5E5MA 4QWWC 3V4UH 3FB7A 3QHFH 5E2WH 1T7VA 4ELMB 1INEH 3LSOA 4U1JB 4Z7VF 2J4WH 1FCCA 1ZANH 3OV6A 4Q0XL 4QHNA 3HAEG 3UC0L 4AENB 4TVSa 1NC2B 3QXAA 3FRUA 2DWEA 4X7TA 4HUKB 2COQA 3VD7A 3G9VA 3MRBB 5C0JA 1KJ2H 5IFHL 4F7PA 3EDEA 1FGVL 4QHMB 3W9EA 4JDZB 3GKWH 4OLWH 4U6VL 1Z9LA 1JYWA 2VXVH 3H42H 1IILE 5DEGB 3BKCL 4P9ML 1FZMA 5D2NE 2OTUB 3N85L 3FFCA 3O4LD 4LLYB 1JPTL 4HUNB 2P5EE 5CZVH 5A1AA 2IANB 5IF0A 1MRDL 4MA1B 1M7DA 3QPXL 4B7IA 5FM5O 1AHWC 3T1FA 1KENL 3C5ZC 1T66C 1F45A 1AD9A 2NY7L 1MFDH 5EU6A 4G9DB 2DQIL 2P5WD 1IGJB 3B5GA 4IRSB 5IHZB 1FZOA 3RWCA 1K85A 2UWEB 5CHNA 3P4NA 4NJ9L 5ESQA 1Z9SA 1G7QB 2CO7B 3CLEH 5IFAL 1PSKL 4BM7A 3JWDL 5INCA 5IB2A 1U95A 4PV9B 5IT2L 3BP7B 4MZ2A 4PJCE 1H3VA 3TPUA 3ZKND 1AO7A 2PKDA 4ZTOH 5C0IB 1RJLA 2JIXB 3V79C 4S1DC 2RQ8A 3WHXB 5F3HB 1BOGA 3JVGC 3LKRA 3BRDA 2ZCHL 2ED7A 1KGCD 4X98B 5C0DA 3V7AG 4NOFA 5JXEA 1ZWIA 1N4XH 1I7RB 2L4OA 1H5BB 4ERSH 2H26A 2BY1A 4RAHA 3B5HA 3GRWA 3M1BA 4L8CB 4KTEH 1BFOB 1YMMB 2AI0H 1YEFL 3U7YH 4OZ4A 4LCUB 1U8KA 2AK4B 3SDCD 2ADGA 4AZ8A 1JVKA 4PJDE 1ZHKB 3PNWB 1LO0L 1K4DA 1NUGA 4Z77B 3R1GL 1ORQB 2QHRL 4KKNA 4LCWE 1AIFB 1QSFE 2BRRL 4MA7L 3RKDC 4J1UA 3WFHA 3O8XB 2EYRB 1IC7H 3MUJA 1I4FB 3O6FD 4L8BA 1WVZA 3TO2B 4LKCA 1XGPA 3DVNB 4YUEL 5A16A 1P5UA 3RNKA 5EZLA 3RGVC 2XY1A 1KTKE 5C0RL 1WIUA 1D6EB 3O3BA 2A9ML 2EDYA 2XNAA 3F6LA 2MQ0A 5INDA 2CDFA 4FTVD 3VXQB 4BQ9A 3I75A 3U9PL 3I2CL 4LIQL 1F6FB 5HYSA 1DN2A 1YEHH 2D0GA 1R3JB 4MCZA 1HHJB 5FXCH 4TSAL 1AP2B 4FQHA 4MDJA 2B39A 1U8QB 1GZQA 3EDFA 5BXFB 4PRAA 4WI3A 2GTWB 5ESAA 2J7LA 4XHJC 5C6TH 1N0XH 3TO4D 5IIEB 4EI5A 3IFPA 1AH1A 4KUCF 4H1LG 4F3FA 2AQ3A 2W0PA 5KJRL 4H26B 2EO1A 2Z9TA 2AXFA 3KJ6H 1JNJA 3DETC 1WAAE 4RMSA 5IB3A 3WS6A 2JJUA 1HINH 2ZCLH 5BJTA 3BIBX 5E5UB 3TN0A 3LY6A 1IVLA 5I18H 3MV11 4S1RH 3OWEA 4XCFH 5IUSA 3D2UB 4ODWB 2HKFL 2AJZB 5CIPB 1JMXA 4Y2DA 2PO6A 4DAGL 4NKOA 4JFDA 3RHWK 1IT9L 1OD9A 3QO0A 3RWGB 1MFAL 2ZSVA 4G7VH 5KVFH 3WHE1 2YD6A 1QG3A 2FGWL 3VFWB 3KXFE 5C6WH 3K46A 3QQ4A 4HXAH 3VE0A 3V6OE 3HAEH 3BPOC 5IVZB 2R1YA 3VG9B 1RFDL 4KJYB 1F8TH 3ISWA 4H8WH 1RZIA 3FO1B 3MR9A 1SJEB 4M8VA 5DUPL 4HG4J 1PBYA 3FRPA 4UIMA 5T1KA 1XF5A 4KK6C 1GGIL 2PCPB 5CJQL 2R39A 6CGTA 4LVOB 1MCRA 4EN3A 5JLZB 2YPKA 4KI5E 5HPMB 2AJ3B 5FYKE 3G6DL 3WIIH 1U8OB 5GGTA 4E0RA 4UBDD 3LB6C 5ERWB 4HGKC 3WN5A 5HVFB 1CFSA 1V8HA 4M3KB 1NGWB 3D25B 4U7SA 3GGWA 3S37X 1IC4H 2KH2B 4G9FB 1BJ1J 4IJ3C 4OI9A 1MFEL 4EQ2A 4Y5XB 3S88L 3HE7D 1R3IH 5GGQL 5HYJA 3TPKA 2EDQA 1HWHB 2DKMA 4XPBH 1S78D 3ALWA 3STLA 5J11B 3BD3A 1BD2E 3P0YL 2CKBA 4XPGL 3IXAA 1A3RL 1P53A 3KPSD 3MV7E 4JM4H 3CAFA 2LTQB 1KB9K 2MSPA 3BQUA 1B0RB 4TNWF 3IDXL 3SDAB 1A6ZA 1XF3B 1S7RB 1Z0NA 1N6QH 2DLFL 5J1AB 5M7QA 5HHXL 3RWIA 1G0XA 2C3VB 1C5CH 1JPGB 1TCMA 3RNQB 4FFYH 4L9DA 4M3JA 5LAXB 5CCKH 1T20A 1FBIL 5JDSA 1RMFH 1XCTB 3RWEB 4OZGB 5MERA 1D5MB 3QUZA 1QFUL 5T5FH 1P9MA 4WI2A 4XX1G 1MI5B 2DD8L 3EYUH 3C5JA 4QNPE 1KG0A 1H3UA 3O0RH 5LG1A 1AR1C 1MJUL 3IDMA 5BV7C 5C7XL 1ZGLM 4N9GA 3ZKMD 4KV5E 3MGTA 2X89A 1I85A 3LEYH 2QQKH 4G80A 4GQ9L 4I18A 4WWID 3ALPA 4HBCL 3VXSB 3MJ9L 1J05A 4MQSB 5TPWH 5IHLB 2GAZA 4FFVD 5GSRA 4QHUB 1CFVL 3RTQC 2O61B 4XC1L 5F1KC 1RHHB 3U83A 3O45B 3VRJA 3Q5TA 3UTSE 4OLYL 2J8UE 3IU4L 1NBYB 3DX9B 4HXBH 4KK5C 3O2VH 4NFCA 4UQ3A 5FYLH 2HVJA 1KN2H 4GS7C 1ZT1B 3KJ4C 1CU4H 4NQEA 4DOHB 4BSVB 1I3GH 4H25B 3VXNA 3T3ME 5HHMB 3UYPA 5T3ZE 5CWSA 5JHDB 4M93C 3FONB 4MA3B 4QLRA 2EDTA 5D7JB 1ZHBA 4ZFGH 1WGOA 1GCFA 3GBML 5DRNA 2A9NH 2PTTA 3M8OL 1J12A 2Q7NA 4LQFL 2AW2A 1T2XA 1NAMH 1FE8H 5FYJU 4Z78A 3OGCA 3AC0A 3DMMB 3TH3T 4JM2F 3HI1B 3VFNA 4X6FB 3HA0A 5IVXE 4YHML 4IOIA 4O2CA 4HAFA 1NFIA 1WSST 1BZ9B 2F19H 5J12C 3RP1A 4H1LH 4U6XB 5D1QD 5DJZA 2DLTA 1EAPA 1DEEB 1OL0A 4OZIE 3MX0A 4EBQL 1V3MA 4M7JH 1YC7A 5T1DH 1U92B 3IAPA 4U1SB 2DAVA 1IC5H 3DSFL 3TBTA 4G43A 4L1DA 4MJ2A 4U1IB 3WNLA 3F5WA 4GRMB 4WW2B 2C4FU 4ETQA 1P1ZB 5J6GA 1KIRB 3GI8H 1IM9D 4Y1AD 3V52H 2Q8BL 2Q86A 2AABH 2VDOL 2W9DH 5B4MC 4XNUH 1NGZA 3KPLB 3MBED 5ISZB 5E1HB 1EVTC 4D9LL 4PG2A 1F3JA 2VXQH 3DLQR 5EOQL 3DV6B 4YLQT 1T3FB 1T2QL 1KPVA 3MJGX 3BN9D 4P5TC 1MOEA 2FATH 2NXZD 4MHHI 2R4SL 4PRIA 5E6ID 2IPKA 5IQ7H 4RFNB 3OXSA 1G9ML 4M6MH 5I17B 2X4TA 1IAOB 3HI5H 4WENB 4BH8A 5EO1A 1CFTB 3H7BA 4CMHC 1A7BA 4XP4L 2W38A 2OL3B 4OQTA 3C8KA 1RJZB 1PX3A 3D9AL 4JZNA 2IMMA 1TTGA 4G8GE 5HGBA 5KN5A 2EKJA 1CD0A 3BKYH 1LP9A 1DDHB 1LO3L 5DHVB 3GIVB 4P2RB 4JO1H 3QUMH 5FM4A 1HEZA 1T1ZB 4XNXL 4PJBF 3KYAA 1U58A 3WUWG 4W6WB 1LD9A 5KS9F 1CR9L 4PPTA 1KIPA 5EBWB 5DK2B 3KPRB 4O5LL 1LE5A 4MD0A 5AYUL 3S37L 1J8HA 1QBLL 4FABL 1B2WH 1DBAH 1H8SA 3PQYA 5GZOD 4RGND 5KVDH 1MUJA 4PJAF 1T1YB 3QDHA 1P4IL 3JTTA 2DKSA 3OKDB 4DEPB 3BWAB 5B39G 4M8QA 5GXBB 4OFYA 4HS8H 4MXVF 4ZXBA 1KTLB 2CXGA 3SQOH 2HN7B 4M02A 4NRZA 5H37G 1CICB 2EEDA 4RAVA 2E9WA 2WUBH 3QI9D 5FF6B 5T1LB 1AGBB 4MNQE 4FQ2H 1H3TA 2NY4D 4Q9RH 5J3HC 1ZA3A 3CFDB 4L4VA 3RVTD 4Z7UE 3QIUA 5CEYA 5DURB 3N1FC 3SJVB 4PJ7B 5HVGB 4YBQD 2GJ6D 1RUQL 2B0SL 2IQAB 3HKFA 2GCYA 1NCBL 1X4ZA 5TE4L 5FECB 3BUYB 4HGWB 4Z8FH 3QDGB 4PS4L 2IWGA 2JB6A 3ARPA 3FT4A 4O4YL 5HGAB 1U3ZA 4EOWH 1DQDL 3P9LB 3QFJA 4G5ZL 5SV4A 4F7EA 2D7OA 4JRYD 2Z35A 3MJ7A 5L88L 4DKEL 2APBA 2F8VA 1ND0A 4DKDC 3EYOB 2Z0BA 3U30C 3ARWA 4YHPA 3NN8B 5HHPB 4MB5A 4TVPD 3V8OA 3LRSA 3RIAF 3IFLL 3DYOA 3B9VA 5JW5A 2VH5L 4TTDD 5CUSL 2JB5H 4EVNB 2P7TA 2CGRH 2D03L 2O5ZH 4IHOB 2XKNB 1BHGA 3G6JF 2WWKO 5IG7B 3UEZA 3B2VH 1QNZL 4LOUC 3EO1A 1CWVA 5ITBL 3HG1D 1QRNA 5C2UB 4DGIH 3IKKA 3ZYJA 3W2DH 1ADQH 2XQYK 3V5HB 1FSKB 4PJ8C 1LE9A 2XZZA 1RZGB 3FZUC 3RU8L 1FO0A 1N6VA 1UC6A 1RK0B 5TJWK 2VL5B 3BP6B 3K7UA 1VFAB 4BFGA 3BO8A 3SKMA 4WDIA 4BFIB 4UDUB 4ONFH 3C60B 5JXEC 3ROLB 1NC2D 4L3CA 4OBRA 5BVJB 4K9EH 4NFBA 4I0PA 4PLJD 2EDBA 3SGDH 4CNIA 5L0QC 5J1TC 2DQHL 3OG4B 4OM0L 5IGXH 1E4XI 5ENWB 4PJIA 3CH8A 1HQRA 3HRZA 3JWOC 2Y06H 4YK4B 5EUKA 1G7LA 3WSQL 2MWCA 3BE1H 4PRBB 3MRPB 4XAKE 2XY2A 3DSNA 3RQ3A 3PIQA 1WZMA 4R0LB 4OJFL 1D9KB 5DTFA 3W9DB 1NMCB 3QUYB 5IBTL 4F15C 3D18A 3UZQA 3WEXA 3LQZA 3HMXA 3GSVB 2YWZA 2DI7A 1BF8A 4X6EA 5K93A 4I9WD 4DJMA 2DICA 1EK3A 4IRSD 5B8CA 4XRCA 1NDGA 2X4RA 1JF1A 4XTRC 3QEGL 2BVPA 3FAXA 3RL2B 3VCLA 6FABL 1FRGL 1TQCB 3PP4H 4OB5H 4YXHL 1TTUA 3U46A 3RY6A 5I15L 3HR5A 3RWDB 5C0GA 5KSBA 1PKQE 5BS0B 1OAXL 3V7AE 4XPFH 1PY9A 4XWOC 5C09A 2EDKA 3MOBH 3B9DA 5E1AA 3UTZA 2JIXD 4JDVA 1KV3A 5I16B 1M6OB 4I3RH 2FD6H 4TRPL 1KJMA 4EI5C 4U0RC 1LO5A 1BZ7A 3N0PB 4IRJB 3MCKB 1BEYL 4XCNB 2EC9U 3GK8L 3S8WA 3BPNB 4KPHH 2R0LL 4UDTB 3WS6C 3ZZ1A 2IALA 4DUWA 4J8RB 3TNMA 3VGEA 3TN0C 4WI7A 4NUJB 1TJGH 1FL5B 5FYLE 2AK4D 1OCWL 4RMVA 2PO6C 4KROB 2HVKB 5GJTL 1TTFA 3EHBD 2JCCE 1I3RB 2C7UB 1YNLL 4FQJH 5ECJE 3DXAB 4C4KT 1CT8B 3GSWA 5MEQB 1XIWD 3ULSA 4BQCA 5DJ8B 5JORA 1N6UA 4YWGH 1GC1L 1BWWA 5F9WC 2XWTB 1FH5L 3T2QA 4YDLB 4TVPH 1QEWB 5I1LB 1JZ8A 3HS0B 2BDNL 3E8UH 1EEYB 1DR9A 4NO0B 5J89A 3P4OB 4I4WB 3QEHA 2RGSA 4HMCA 4LPTA 4OFDA 4C54A 3ZE1F 1IGIL 4EN3C 4Q6YA 1VFOA 1WV7T 4CBPA 5TE7H 2F74B 2GUOA 4GLRH 3OR7A 5E03A 1SBSL 3QIBA 1T5WA 4WU5B 3WN5C 1H3GA 2XN9E 5IFJB 1F6LL 1AGCB 2YXFA 3WDIA 1FNGB 3P11L 4XP1L 3FN0L 4IDJL 4NC1E 5BMFH 3AB0C 2EZ0C 5SV3A 5CILH 1UJTA 3AU1B 5TFSL 2E8ZA 4AL8H 2VXSL 4PGCA 4RMWA 5D96C 25C8H 1BQHB 3BQUC 2KBGA 3C2SA 3L9RB 2CLRA 5CJOH 1D5BB 2FEDD 4POZC 2X05A 5I1AB 4KKLD 3QJFA 4WI8A 4NM8H 5L2KE 3RIAK 1G6RL 5C07E 1FYTB 1FFNB 3S4SA 3ARVA 1W0VB 3MFFB 4LK4A 4M61A 2HMIC 3E6FA 3MXVL 2EDHA 4XPAH 1JYNA 4YIQA 1UWGH 3PGCB 1OY3B 3QRGL 5GRJL 1KXTB 1JF6A 4PTUA 4P57B 1EAJA 4NHUB 2YC1B 3QUZC 5JPNA 4HHAB 3KPSE 5J6HB 1P7QD 1MHEA 1MF2L 2H1PL 4JHAH 4UOJA 5C71A 2AJUL 5BW7C 5ICXA 4QCIA 1F4YH 3WCYA 3EYSH 5DRWB 3CU1A 4RBPK 3GBNH 4ONHA 1I7ZB 1I85C 2QSTA 1BF2A 1A3LH 4X6DB 1T1WB 2YA1A 3OXRB 3LS5H 4PB9L 4NQXA 4MLIA 4JCMA 1CGYA 2OK0L 5IB4B 3BIKB 5B3JE 4KKCD 5C0EB 1MRFH 1KB9J 3CFIC 1UXWA 4PP1C 4R4FH 2FZ3B 4WHTA 3P0VL 4YNYB 4ZUWA 4WNQB 3ARBD 5E56A 4NN6C 3KLHD 1QR1A 1I8KA 4OFVA 2UVFA 3C2AH 3UCRA 2Q8AH 1F11B 5DFVD 5FGRA 4PJGE 3WE6A 4GAJH 4G9FD 4NO5B 1YJDL 5D7KD 4YC2C 3MLVH 3BGMA 3DYPA 5LJYH 4N8VA 2RR3A 4RX4A 1MPAL 3DVFA 4MJID 1ZS8A 1BVKB 1Q1JH 2R1WA 4KJWD 1DL7L 4PRDB 1JTOA 5E2VL 1BFTA 3JWNC 4N90E 3KPQA 2XPGA 4X6BB 5I8EB 3SOBL 4UU9A 1IEAB 3T0DA 3SDAD 3MV9B 4M1CC 1OPGH 3I02B 4XX1E 4C56B 4JKLA 3WFBL 3SO3C 3O11B 4JR9L 4JFXA 5TDPB 1DE4B 4HC1L 1RULH 5SWQA 5EU5B 3E6HA 4L9LA 1XCQB 1SEQL 3QA3A 4R96B 5SX4I 4BJLA 3GMMA 2CIIB 4R3SA 4CJ0A 1U9KA 1MEXH 3GI9H 3K3QA 4GJTB 2HYMA 3LIZH 1MI5D 4NSKB 2Y07H 4KK8D 3NA4A 4P46B 5GRVK 2P5EA 4Q6IB 3KR3L 5IW1B 1IGML 1C5DA 2FL5B 4XI5D 5IEKB 1U41A 5E99L 2BC4B 4U6YB 1CG9B 3GBLA 3KLAB 4JFFE 4OZHB 1HSBB 1NMBL 3VXSD 3WUZA 4HUXA 5ACZB 3QG6A 4YDJA 2FIKB 4F58H 1EGJL 3BVNB 2VTFA 2K1MA 4KHXH 4UNUA 1UCBL 3G9AB 1FFRA 1YECH 2EIZA 2VO5A 1JPSH 4YFEA 4A6YA 4DKAA 2HT2C 3MACL 1A6TB 1CFQB 4K3GA 1G84A 5FUOL 2P8PB 3RX5A 3TYFA 5C2BL 3EYVB 4PGEB 3LN5A 2E5EA 5EU3B 3T0BA 1NCTA 4O2FA 5EO0B 1IGYB 1UCTA 1A6UH 1C1EL 3AREA 4OD3L 3R06A 3RX7A 5EOTB 5IW6A 3ZE0F 4PJCA 3Q1SL 3G04B 3MODH 3IDYB 3G6AA 5HHMD 3EYFA 4WY7L 5JHDD 5L7XH 3F7YA 3HMWH 1E4KA 1NCNA 4H0IA 1TFHA 8FABB 1QSVA 4XVTL 3RX8A 1IQDB 2BOBA 1U8JB 5I30H 1IGFH 1EVUA 5GGRY 1ZV5A 4KKBD 1TZHA 4HEPG 2Z93A 4NQVA 1I1FA 5IQ9A 4HKZA 1Y18A 2EIBA 2MMXA 4RWHA 3ZL4L 4PJDA 5C0CE 3ARQA 3DX7A 1BFVL 2DBLL 4D0CB 2X4OA 1NGYB 4KZEL 3BGFB 1F6AA 3PABA 3D69B 4LCWA 1QSFA 5CBEA 3U0TB 1EUTA 4JKMA 2EC8A 1QACA 3BEVA 2Q76B 2R23A 1MCCA 2ADJA 3CH1A 5I0ZA 5CJXA 4HW6A 2H8PA 1KIQB 3RZCB 1NL0L 5DVNA 2EDNA 4JFYA 3VH8B 5LXGL 3L3KB 2XKUA 4ZOAA 1MHCA 3VWJA 5HHQA 2WINA 1M05A 2H6PA 1ZVYA 5E00A 3W81A 1CFNA 2R29H 3BH8B 4UIKH 4EUPB 4L3AA 3VMNA 1LEIA 2BY0A 3I6LD 1RD6A 4Q74A 3DROA 4GMTL 4ZXBC 4K3DL 5E2UH 5GJSL 3VWKB 4HPOL 4NP4L 4LCYA 4DK3A 5DHYB 4OUUB 4EI6A 1L0QA 3BW9B 4PJXB 2VE6A 5I1IH 2V9QA 1CGXA 1QBAA 2WUCL 5C08E 5ISZD 1BLNB 4P2OA 4FZEH 3VA2C 1MNUH 1UWEL 1Y0LA 3QIUC 4Y4HB 3BHBA 4E41B 4HS3B 4NKIH 3GZKA 3ZDZE 4ZUUB 1R0AH 1MQKL 3QULA 5BRZB 1HYSD 5I1DB 2KKQA 2XA3A 3JTSB 4AT6B 3CDCA 5D7LB 4XCEB 3TT3L 2BRQA 1WAAA 3KG5A 4IIQB 1ZXQA 2EDLA 3HC3H 1YZZA 2VR5A 3RAJH 4LMQE 4JN1L 1JN6A 2ARJA 1Q9KA 1YEIH 2PUQT 4LDOB 1KPUA 3OJMB 4FXGA 5I8CA 1KNOB 2GJ6E 5IMOB 1VERA 4N9OB 2R69L 3WFDH 1A7PH 3MNZB 3QP3A 4I0CC 5TF1H 4DVBB 4P2RD 2BVTA 3RWFB 3JV4B 5C0BE 1UH4A 5TH2B 3KXFA 3OF6D 3CVHL 3MC0A 1WIPA 2JJVA 3VGDA 3FOLA 4I5BB 4X4XB 3V6OA 1IZKA 1C12B 4M4RA 1OSZB 3EOTH 4JRYE 1MVFA 4LEOB 3HZYB 3KPRD 1TETH 4PG9A 4YHOH 3DUHA 3ULUH 5T1MB 3EZ8A 1K6QL 1OB1B 2PR4L 4TVPE 1XGQA 4LF3B 4DGVH 2VWEE 3D85A 5DJ6A 5SX5K 1NMAH 4PJHB 4P3DB 2BJMH 3QEQE 4JZOB 1FL6B 2ITCA 4DTGH 2PF6A 5CJ5A 2VUOA 1A4JA 1HHGB 5GS2H 5L9DH 1CICD 1JNLL 5A2KH 1UFUA 2W0FA 5EOCL 4I0PC 4ODHH 5KSUB 2AJSL 3HG1E 1OGTA 4S2SB 2AQ2A 1BD2A 4FFZL 3GM8A 1G9NC 1UACH 1OP5K 3MV7A 3PL6B 4P2QE 3TWCH 1TITA 3SJVD 4PLOB 1MLCA 4QY8A 1G6RB 3NIFF 1PYWB 2BCKA 4H0GA 2V7NA 2NY6B 3TVMA 2DQJL 4P4KA 3GJFK 4MAYD 3QDME 3F7VB 3BD5A 4AIOA 2R2HB 2Y36L 5DA0B 1PLGH 5CMAA 3O9WB 5D1XA 1W8OA 4YHIA 1BGXL 2G5BB 3MRHA 4Y19B 4YDVB 4KDTA 4NO2A 1LP9F 3G5XA 4U1LA 3KLSA 3UJIL 4DGYL 4WU7A 4RA3A 2GI7A 5AZEH 5FDWB 1A7OL 1F58H 5CP3H 4PLNC 4NYLB 5B8CC 2NCMA 3VRIA 3DURA 3U36A 4TTGA 5D1ZB 1L4IA 2VIRA 3KPMA 3ARXA 2OLDA 5D7SL 5C0FB 1ACYL 4MQTB 3C87A 3LKPB 2HH0L 1TZGH 2RHEA 4F9LA 1KB5L 4QRQB 3BT2H 3RY6C 2MFNA 4D0BB 5TGBB 1T89A 4JGUA 4I9WE 4PJFE 4X0KA 1E4WH 3REVA 3NFNA 3IDJB 1RJYA 3ARRA 3MLRH 2FEEI 4R7DA 2DL9A 3CNKA 3M17A 3KYMB 3UTSA 1Q94A 4U7MA 2J8UA 4GKOA 2GW5A 2R1XB 3C8HA 3C60D 5DFWH 1G7PB 2WZPD 3ULVF 2Y25A 4Z7VB 3UAJC 1NDMA 3VFRA 4GBXB 1U8PB 2ICEB 4NDMB 1K2DA 4LQ1A 3PP3K 4MMZC 3FCTB 5DF0A 2BVOB 2XWBB 3BH9A 3GMLB 2ZUSA 4GO6B 1JGVH 2P4AB 5EIVA 4AMKL 2GKIA 4OLZH 1LO0H 1UH2A 4GH7B 2QADC 5IJVA 1D9KD 2OL3H 4HWBL 2XQBL 3NOIA 3TBWB 3D39E 3OAUH 1J1OH 4JPKL 2R0WL 3F62A 5DGRA 3KLDA 2XA8H 1EBAA 3OKYA 1I1YB 3TLRA 2LV4A 3VXRE 2PNDA 5IVXA 3TP4A 5D6DA 1M71B 1KJ2A 3WIFA 3KWWA 3A6CL 2DBJA 3QYCA 4RFOH 4MAUL 1A4KA 1JHTA 3PHQA 2JE8A 1NEZG 4WVRA 4HUWB 4L29B 3QIBC 5I71C 4OZIA 3ARGB 3BDYH 4WRLA 5GS1B 5DMIH 1U3HB 5BS0D 4N5UA 3L3HA 3VMOA 5CP7B 1CGWA 5DD3L 4DWHA 1WBYA 1RZKC 2BY2A 5DD5H 3K2UL 2PW2A 1FFPA 2OP4H 2FJFB 2C4FT 2BP3A 4OF0A 3CDGB 1LK2A 4PJIF 2B2XL 1RZFH 4LLQB 3MLSL 3UBXI 1QP1A 3TBVA 5MEPB 3BZEA 3JV5A 1L6ZA 4LSTL 5K9KB 1YQVH 3L95A 2ESVB 2FIRT 2Z8WC 1PFCA 1WWWX 4WFHE 4FQ1H 4HV8B 3L7EA 4HIIA 1IAKA 4LHJB 4JPWL 4HJJH 4LLVB 2BVQB 1R24B 3DXAD 4X9GA 4YX2L 3X11B 4J3VA 4URTB 5HGDA 1A6VL 5HHOE 5C9KA 5SWZB 2ZCKL 4HFWA 4KK9D 4HFUH 2Z31A 1RHFA 2EH7L 3ARUA 4X9IA 1DQLL 2EXWC 1JWMB 5KAQF 4WW1A 2I5YL 3MRIA 2X09A 1G7JB 3WXWH 3C6LB 5BV7L 3TCXA 3WXVH 1WZLA 2YA2A 1UVQB 4NUGH 4G8GA 2HJFB 4U3HA 3B2UC 4NO0D 4ZAKA 4DUXA 1A14L 5ID1B 2FBOJ 1MCWM 4JQIH 1AFVL 2EYTB 2NNAA 5FCUL 1OAKL 4Y5YA 1O7VA 2R0ZL 2AEPL 5I2IA 5KSBF 3GIZH 5EIQA 1YMHB 1R3KA 1J10A 1XR9A 4GAGH 2G75A 1CLYH 3AMKA 3D87B 1FL3A 3DX8A 4HIJB 1F4XL 3ZDXF 1MH5B 4PGBB 4QOKE 4JO4H 1MJJA 4EXPX 1OOAA 5ILTL 5JO5B 1PKOA 4S0TD 4XXCA 4BUHA 2LE9A 1S7XB 1WCBB 3VFOB 1WFNA 4XP9H 4U2ZA 4JG1L 5GZNC 2WWKT 1MQ8A 5HI4D 2PXYC 4M5ZL 1FYTD 4KZDL 4MNQA 3OKEB 2G60H 4O58H 5D7KE 3BAEH 2F54B 1J1PL 4CUCA 5HGGS 4L9LC 3TV3L 4MNHB 4Z7UA 3ZSTA 2R8SL 4MJIE 3IFNL 2YMXL 3B3IA 3F12B 4FQXA 1SMAA 2GIYA 1ORSB 5FYJL 4DCQB 4LPVA 4HUVB 1OT2A 3MNWA 1KELH 4JG0L 1QLFB 1QFWM 5FA4B 1ZTXH 2BK8A 2HJKA 3BN3B 1A8JH 3IVKA 4ZS7L 3GKZA 5C7XH 1S7UB 2CDEA 2WM0A 1AHWB 5HSFA 3C5ZB 4LLWB 1DBKH 3CUPA 3NABH 3Q48A 4PJ5B 2GY5A 3V0WL 3CVHB 5JNYA 1Q9WA 3D3VE 1IAIM 2EO9A 5J9PA 3LQAC 4M43H 1C08A 4LHUB 4HK0B 2AEQH 2DJSA 3IJSB 1Q72H 3OKLA 2GITA 4O2EB 3LRHA 1Q9LA 4H0HB 1ZGLP 5HDLA 3UP1A 1S9WA 2BSED 3H9YA 3HUJF 3M07A 2CH8A 1BJ1H 3AREC 4MNGB 2VDQH 5A40E 5H94A 3HAEA 4W81A 3QQ3A 3CSBA 4K94C 3CXDL 5EORL 2G2RA 2W92A 1R5VA 1AXIB 3ULUE 4H20H 4BZ2L 2FX8L 2VLME 1V7NL 1E4KC 4LASL 3IKCA 1VCAA 1KPRB 5DJDA 3AAZB 3WLWC 3D0LA 3QEUA 1BPVA 3MV9D 4K8RD 4YZFF 1DLHA 2A73B 3CMOH 4NKMA 4P4RA 4Q9QH 4C56D 2PYEB 2HT3D 1S5HA 1FGNH 3ZSSA 2D31A 4OGYH 2H32B 1FVEB 4Z76A 1AE6L 3OB0K 1BBDL 3LMJH 3CX2A 1MCNA 4GUPB 4AQOA 5IB5B 4P3CL 2CUIA 3QAZC 4OTXH 5CSGA 1OARH 3N1GC 2UZIH 2I9LB 3AS0A 4ODVL 4P46D 3OR6B 3RJQB 1U8MA 4QTHA 3FMGL 5CJXC 1JUFA 1S5IH 1JI1A 3TA3A 3GSXB 4OCMC 3VWJC 4XH2A 3MNVA 5A2JH 3T4AB 1GJIA 2UYLB 1FVDA 4MJ5B 5EZJA 4XB7A 3RGVB 5LGHL 5F72S 1KB5B 3IXTB 1AC6A 3IJHA 4NJAL 1IQWH 5HDOA 4G7YH 3MV01 4UTAL 1MWAH 1KF9B 1DUYB 1FNFA 3H3PH 4IMKA 1AD0A 1OQXA 1ZLUH 3P77A 2DYPB 5TQ2L 4OGXH 5HYQB 5JOFA 5HY9A 3EO9L 32C2B 3O6FA 1MFNA 4UUJA 2DM3A 1K5NB 43C9B 4JN2A 1PKQA 3VXPA 3V9FA 3UYOD 2Z92B 1D5IH 4JPIB 1WT5A 1F97A 3I6GB 4P2OC 5GRVL 2OCFD 2CDGB 4MQXD 1REIA 2YOCA 1A1OA 3SE4A 2X9WA 4Y4KD 2CIKA 4N0FA 2LU3A 4HBQA 1FZJA 1JWUB 1MRCH 1DQJB 2CRIA 4CRPA 4MXQD 4JVUA 4W6YB 5DS8B 2KUTA 3MREA 1B4JL 5GGRB 5JW3H 2KQMA 4ZO8A 4KKAC 1L6XA 4YEEA 4NPYA 2VDLH 2EC9T 4KMLB 4KQ3L 3X13B 2X4PA 1VFMA 1FP5A 4PRHB 4EUPG 5DMKA 5FOJA 1GAFH 5T3XE 3HNVH 5DVLA 1HCFX 5KG9A 4X7EC 8CGTA 1QBBA 3RI5K 4P3WA 2HRPH 5JHLL 1FORL 1KCKA 4WIQA 4JM2B 5F6IC 5FHBL 3T77A 2DTMH 2NY5H 3BSZL 5IESL 4OV5A 2IH1A 1TJIH 2W9EH 1DUZB 1P4BH 5J0BA 3LKNB 5FK9B 4Z0XB 2IFGA 3RZCD 2HLAA 3WS3A 3BPOB 4S1SH 1NAMA 4PRNA 4WO4B 3RL1A 2YPLB 4HF5L 1I1AB 2BVEA 2EKSB 2H9GA 2B4CC 4MB4A 3DVGA 5HJ3B 1KJVB 3RVWD 4XP5L 2X7LA 1OAQH 3RVUC 3PGFH 4KI5C 2YSSB 4WJ5B 2APFA 3S98A 4QO1A 2FGZA 4PJCF 5FO8B 4UT9H 2XN9A 1IL1A 3THML 2XZAL 4GAYA 5HI5C 3MBXH 4IJ3B 1YEJL 4NC0B 4WI4A 5CKGA 5CEXA 3MMEA 2X1OA 1DN0A 5FHAH 4OCYH 3BOVA 4L3EB 4Y4HD 4K8RH 2F8XC 4WFED 4E41D 5I1CL 4QGTA 4YDIH 3GRWL 3TVMC 2A74A 5EUOE 3CD4A 4XBGA 5BRZD 5IROA 3I84A 3EOBB 1AKJB 4J4PD 3VGAC 4K3JH 5L2KA 4WI5A 5C07A 3JWOL 1FN4B 4OZFB 4PJDF 5D1XC 5ACMA 5C0AB 1KN4L 5FOBB 3QIWC 4GXUM 1P7HL 4NKDA 2VC2H 1CF8H 5ETUA 1A7RL 1INQA 3EDJA 4KDTC 4IS6B 4GMSH 4G8EA 5IHUH 4NRXB 3KPSA 4V1DE 5JQ6L 2HFFB 1R3HA 3OAZK 4G6AD 5F96L 4HZLA 5DEZA 2UY6A 5JPMB 2FX9H 1CLCA 1QO3B 3MJ8A 2YK1L 4PGDB 3GB7A 1NCCH 4KY1H 2FWOA 5BV7B 2FBJL 4KVCH 4P99A 2QLVB 2X4QB 3VFSA 4F9LC 1QKZL 1ZVHA 2VLJD 5ITFA 4OCWH 3L5XH 2OBGA 1MFCH 1T89C 3S5LG 4PJBB 2GSIB 3HPJA 3GNMH 5KS9B 2Z91A 3OAYH 3LEVL 3G5ZA 3NCBB 1KLUB 5EDXA 3T65B 3RTQB 1S7SB 1D5XB 1T21B 2QBWA 2XXCB 5AZ2L 1FVCA 4OKVB 1OLLA 2DQCH 2OTWA 4PJAB 4LLUB 1C8PA 4L5FH 4WUKH 4HKXB 4PJGA 3ZTNL 1AGFB 1HHHA 1QVOB 1WF5A 4GS7B 3KJ4B 1X7QA 1SMOA 5E94B 4LRIA 4MHHG 3X12A 3PL6D 2NXYC 4YHKH 4M93B 1QLRB 1WAAF 1J5OH 4L4TD 2NY6D 3HZMB 5DC9B 2WWMD 3OX8A 2VXUH 3DTXA 1FYHB 4RGOH 1UM5H 1TMCB 4QYOA 1GGBH 1VESA 5EC2A 3NA9H 3O9WD 1U93A 4GW5A 4Y19D 4AEHH 3S36X 5E7BA 2VDMH 4PY8I 1HILB 4N5EC 4OM1L 1P7KA 3PGDA 1ZA6A 1FC1A 5D6DC 4MXVE 3F6IA 1HXMA 1WC7B 2CSPA 5IMKA 3BZ4B 5LGJB 4X4ZA 3L3IB 3CLFL 2VLRE 2YD2A 5D1ZD 4CAGA 2IQ9H 2OXGA 1J7VR 4K7PX 2UUDK 4ODTL 5J12B 2EYSB 1RI8A 1ZOXA 5I1EH 5DJYA 3EO0B 3HB3C 1X9QA 3INUL 3LKOB 4JFFA 5DJXB 4D3CH 1E28A 1T5XB 4KI5F 5GGTL 4PR5A 4EUPH 3H2WA 5EZOL 1ES0A 1CLZL 1U3JA 2BNRB 4DVRH 3L6FB 1TJHL 3P30L 3Q6GH 3TJEL 4ZD3H 1T03H 4JANA 4UOW0 2A2QT 2CKBL 3HZVB 1N59B 3L3OA 3Q5YA 1DSFH 1J0HA 5DJ2A 1GIGL 5J06A 1QR4A 3MROB 4Q58C 1MHHB 1YNTB 1OTUD 3WIHH 1FLRL 2IFFH 3NACH 3T0ED 1PZ5B 1QSZA 3ARYA 2AJYL 1MIEH 1UYWL 1CCZA 2A6DB 5IR1A 4LPCA 5MENB 1ADQA 4F7CA 4U1NA 2EICA 4P5TB 4XAWL 3G6JE 1IM9A 2AP2A 4R2GC 1B0GA 3PJSB 4I3GA 1A5FL 1JPFB 2DWDA 2Z31C 3DV4A 1U36A 5FB8A 3T2OA 4F37F 4OLXH 4WFGE 2F53D 4QNPF 1A9BB 3HCVB 3S34L 4CMHB 3FOMA 2NW2A 5C0CA 1OAZL 3GSNL 4JY6B 3HE6A 3BEWA 2B5IC 1RUKH 4YDKH 4LHQB 4N0UB 2A83A 3ROOA 4QRTB 1FC2D 4Y5YC 2ORBL 1MFBH 1TVBA 3CCHB 4XMKL 2XKSA 5ESVA 5GSVB 2X1WL 1KEGH 3O41B 3MLZL 4WV1A 2YD7A 1NGPH 3W0WE 3DRTB 1H3PH 1V3JA 2AV7A 3LN4B 3Q3GA 3ARGD 3EFDH 4JRXE 4ZSOB 5TDNB 3GMQB 1K4CB 4P5KB 1KC5H 4JY4B 1U3HD 1E6OL 1QHPA 1IFHL 4XP1H 2J8UF 4K23L 4OIBA 4CU6A 1AGEA 4JAMA 5E5MB 3CK0L 2ZUQB 4S0SD 5DZNA 1AI1H 1S8DB 3FB7B 5DFTA 4XXCC 5JR1H 3LSOB 1Z3GH 4ZQKA 3V6FA 3T3MF 4KHTL 5HI3C 4QHNB 4YPGB 3QXAB 3FRUB 4MXWL 2DWEB 1L7TL 3L1OH 4X7TB 2ITDA 2A77H 3P9WB 3NVQA 5C08A 2ESVD 3QNYA 1IAMA 3JZ7A 4F7PB 4DQOL 3BRFA 1UGNA 3MYZA 4Z7WE 3BYYA 4KRPC 4OAWA 4PUBL 3LZFL 3FQTA 3ZT7A 1FZMB 1YN7A 3N9GH 2D7MA 2H1PH 3FFCB 4YAQA 3CJJA 1F90H 4R26H 3CFEA 5CEZD 4NM4L 5IVXF 5IF0B 3VXOA 1M7DB 3T1FB 3WUWA 4X7SH 1AD9B 5EU6B 2KDGA 3K81A 4XNYH 2ZUUA 2GJ6A 4M6AA 1CDHA 1VGKA 2HKHH 4OF7A 1FZOB 3RWCB 4OZIF 2DI9A 5CHNB 3P4NB 4MJ6A 3FQXB 5C0BA 5ESQB 1UM6H 4X9HA 4O02L 3IU3A 3ARFA 5C3LD 1H9VA 3MO1A 4WEBH 4LDLB 1Q8MA 5HD8D 3TYGH 4X6CE 4JRYA 3CGTA 5KTEL 5FIEA 3O2WH 1YN6A 5INCB 5IB2B 1U95B 1NAKL 1YNKH 3IDGA 3CSGA 3VGGA 3TBSA 1AO7B 2GEEA 1RJLB 1XEDA 2EE6A 3DUSA 4H8WC 4ZDHA 1X4XA 3QEQA 1B0WA 3R0MA 1BOGB 4KMTL 4LNRA 3LKRB 3QWRD 3I3DA 5C0DB 5F1IA 1EX0A 4M62L 1ZWIB 4G6KH 3RWHA 5FDYA 2H26B 4X7FC 1SHMA 4KUCD 3HG1A 3M1BB 2F54D 3LD8C 4J3SA 4FA8A 3ZKNC 4NCC1 1NFDE 4OZ4B 5L0QB 5LBSH 3S36L 1U8KB 4P2QA 3CFCL 2AEWA 2ADGB 5MEOA 5DDHA 2H2SC 2FB4H 1QPXA 2MCPL 4F9PA 3REWA 4X99A 1K4DB 1IM3A 3QDMA 5FGCE 3VFGL 2HTKC 4OQTL 3NCMA 4J1UB 4PV8A 4X80L 3T8XA 3TA3C 3QNXA 2JJSC 1INDH 4EXKA 2CRYA 4JDTH 3V5KA 1RIUH 4L8BB 4MDIB 3C5ZD 5KZCB 4ORZC 1BM3L 4JEGB 1XGPB 4LSVH 4G3YH 4PJ5D 5A16B 4N1EA 3RNKB 4K7PH 5EZLB 1ITCA 4NQSA 2ZNXA 3X14B 5MP6H 4LHUD 3O3BB 4K71C 4G6FB 2Q87A 4M9OA 2XNAB 2AJVH 4IMKC 4EDXA 4HDIA 3P40A 5E8DL 1NCWH 2QHLA 3UTOA 3MLUL 5INDB 2CDFB 3I75B 2V2XA 3STZA 3O6FC 2LAAA 5HYSB 2Q3AA 4MCZB 5B22A 3MRJA 1UJ3A 4F37K 1HK6A 4MDJB 1LO4H 4IRSA 4TSCH 1HH9A 1WT5C 12E8H 1GZQB 4PRAB 5L8KB 3SDYL 5BQ7A 4LCIH 5F93C 1KYOJ 2NX5E 3AS2A 3QDAA 3IFPB 4EI5B 3A6BL 4U0RB 7CGTA 3MV8E 4F3FB 3V0VA 3BWUC 4E42A 4JGJA 3KDMA 4Z7UF 2PYED 2AXFB 4J12A 2ADIA 1AY1H 5IB3B 4P9HH 5BJTB 3TN0B 4Q7DA 4HQQL 2I60L 3QUKA 3A67H 3C9NA 4N0YH 4Y2DB 2PO6B 4NKOB 2CLZA 4JFDB 5CEZH 2ICWJ 3QO0B 4BFEA 1XGYH 1EV2E 4NKQB 2ZSVB 5E4EC 1GPOL 2E27L 4WWKA 1KXVC 3PWPD 2VSCA 4U05A 4M5YL 1H3WM 3QQ4B 3VE0B 3LH2H 4UZGA 3D39A 1E4XH 3VXUB 2R1YB 1G7HA 4PBVC 5F9WB 1U8LA 1T83A 1LILA 4HCRH 3CZJA 3VXRA 4WUUD 5E8EA 2F9BT 1RZIB 3MR9B 1ZSDA 3TZVA 4UIMB 5T1KB 1XF5B 3RGVD 2XWJA 1MAMH 3SO5A 1AIFA 1OP9A 2X1XR 2YD9A 2C3WA 2VN4A 4M1GL 1J0JA 4EN3B 2YPKB 5GISH 3VFPA 1XIWA 2QQNL 4UT6H 4E0RB 3QG7H 2DYPD 3WN5B 1RVFH 1XF4A 1FO0L 1J0ZA 3GGWB 3MLPA 1QSED 1UXSA 3NFSH 4N8CH 3AB0B 2XQYG 5HYJB 3QISA 3FQWA 1F02I 2FO1A 3STLB 2I9TA 1A0QL 2CKBB 3IXAB 1CL7I 4OSUH 3F7PC 1SM3L 5DYOA 1NGQH 2YRZA 5D96B 1DBML 2J8HA 2GK0A 3BQUB 4UBDC 5IROC 4JFOA 1A6ZB 5EBMA 1G9NL 1YEKH 1X5XA 3B83A 4CN6A 3RWIB 2CJUH 4NCDA 3DETD 1HHJA 1HDMA 5CD5C 2EH8L 4PRHD 4R97C 5K9OA 5JDSB 1ULVA 4LBEA 4GAFB 2VZVA 5MERB 3QUZB 1FFOA 1DLFL 1WZ1L 4JFHD 4XCYA 2NY2B 1NANI 4LLMA 3RPIB 4JM2D 3C5JB 3HMXL 1KG0B 3EJJX 3DOSA 4XVSL 2PYFA 5HHOA 3IDMB 4N9GB 5GPRA 4TUKH 3MGTB 2K7QA 4KI1A 3CC5A 5K59E 2W1NA 4G80B 3P2TA 4I18B 1F3RB 2R4RL 5JOPD 4WO4D 1I1AD 1XF2A 1J05B 1P7QA 3NZHL 3QWQB 2GAZB 1JRHI 5GSRB 4GRLD 4OZFG 5CS7A 2HAZA 1DJSA 3LHPL 4NN6B 3OZ9L 4OCRH 1QFPA 3NH7L 3LB6D 3VRJB 1NEUA 3HNTL 1UA6H 1NCAH 2VLJE 5GHWH 5C3TA 3WKNA 3OKMA 4UQ3B 4KDVA 2HVJB 4KJYA 1ZT4A 2BVUA 4HT1H 1FJ1A 2VITA 4YC2B 3MCLH 1PX4A 3VXNB 4ETYA 2JELH 1LNUA 4LRIC 2HFGL 5CWSB 5JUEH 5EG6C 5HHNA 3ILQC 3ARBA 1RAMA 1G0DA 1ZHBB 2OR9H 1TZIA 2FH6A 3GMNA 5DRNB 2XACC 2PTTB 1AKJD 2J5LC 1KIUA 2DQJH 2H32H 2QTEA 2F58H 2DLGA 5C0AD 3SO3B 5I6XC 4Y5XA 1A22B 4Z78B 2ADFL 3OGCB 1B4RA 5T5NF 5F89A 4NZRL 3VFNB 4HIXL 4QXTA 4KTYA 1BGXH 4NNPH 3MLWH 4MJIA 1NLBH 1IBGL 1VGEH 4JB9L 5DD1H 1KUMA 3F8UB 4NQEE 4IOIB 4O2CB 1YEEL 4L4TE 2FJGA 2V17L 5J7CC 1MREL 2ZOLA 2VR4A 3KS0J 1YUHA 2WSKA 3BKJL 2IMNA 3O2DH 1KEML 4LL9A 2CUHA 5DJZB 1EAPB 1RZ7L 4S1QH 1V7MH 3SEPA 3T0AA 1XCTA 4OZGA 4U4BA 3U9UA 5TQ0H 2OQJA 4XZUA 3TBTB 3UPAA 4NOBA 3UTQA 4G43B 1V5JA 5CGYD 4ZNEE 3D3VA 3WFEL 4DN3L 1IGCH 3RDTB 3RTQD 2YKLH 5F8RC 3F5WB 4FNLL 3DVIA 1VEOA 2FNBA 4ETQB 1IKFL 2WQ8A 3BGAA 4KRLB 1RZKL 4I0KA 2Q86B 3BKMH 1OAYL 3ZHLA 1T0NA 1NGZB 5HHVL 3DO7A 3OHXA 4R6UA 3T2NL 2QQLL 1MCWW 4QHUA 1F3JB 4LPWA 4UQ2A 5E2TL 2O61A 1X5HA 1DQML 3Q6FA 2UZYB 1MCDA 1KPVB 3KYNA 4GKZA 3UJTH 2FYYA 4M1DL 4XP6L 5E9DD 4BFBD 4RGMB 4PRIB 2IPKB 4OT1L 1T7XA 1S7QA 2X4TB 1NLDL 1BAFH 2WANA 3E2HC 1FAIL 5EO1B 3H7BB 4PLKC 3T0EE 3C8KB 2J8OA 4JZNB 4K9EC 3HE6C 1FIGL 2VLKE 3RWJA 5HGBB 5KN5B 5B38A 4P5MA 3VXTA 1LP9B 2OR8A 4C59B 4WCYH 1RUAH 1HEZB 3E3QE 4CU7A 4F57H 1U58B 4FN0A 4WV1C 5B3JF 3EOAA 2DDQH 2F53E 1KIPB 2NY0C 5SWSD 5HBBA 5SX4H 5EU4A 1LE5B 4ZTPL 1S7TB 4DZ8A 5JW4M 1PQZA 3PQYB 4J6RL 2YD8A 1QPPA 3L5HA 3I6KA 3Q5OA 1MUJB 5D2LE 4LVHC 4OD1H 5DD6A 2DQDH 3CX5K 4ODSH 3JTTB 4PJGF 5CP3A 3UTPD 2AXGA 3U1SH 4M6NH 4M8QB 3TT1H 4HIHA 2Z4QA 1EHNA 1URLA 4ZXBB 1S3KH 2P49B 4CN4A 4NRZB 2NW3A 3K8KA 1EO8H 4YO0A 4RAVB 3UO1L 5B4MD 1N5YL 4K2UL 4NZDA 1CZ8L 4RGNC 2F5BL 1DBJL 4YE4H 3OG6B 4L4VB 3MSPA 3QIUB 5CEYB 5DJ0B 4CVWA 1J8HE 1W72H 4M7LH 4GRMA 4BK5A 1JGLH 2LFGA 4OZFH 5MEND 2GCYB 4RMRA 3VG0L 4UTBH 2R56L 1N2RA 3VDCA 1M7XA 4CW1A 2BX5A 2V7HA 2JB6B 1OM3L 3FT4B 1RURL 4KC3B 3TEUA 5EZIH 2IC2A 4FMKA 4F7EB 2L7UA 3OQ3B 2LU4A 1MJ8L 2Z35B 4FQLH 3MJ7B 4JFZH 3RVTC 5CSBA 3G5YA 1ND0B 2P47B 4RRPA 1CLOL 4XPTL 4YBQC 4YHPB 2VABA 2DQEH 1YEGH 2WLZA 2NY3C 2QSQA 1WEJH 1KLFA 3LRSB 4NN7C 4UT7L 5CEZE 5D7IE 1I9RH 2P7TB 4G8IA 3LQAL 4FQCH 1CFTA 4JKPH 4A6YL 2OL3A 5GS0D 4P59H 3DWTA 4LCCA 3EO1B 3U4BH 1ZHNA 3ORJA 1QRNB 1P6FA 2K9UA 2HWZL 3QFJE 1DDHA 1ZHLA 2CK0L 3BP4B 3ARTA 1LE9B 3SY0A 1ZVSA 4XBEL 5DJCA 1E0OB 1FO0B 2LABA 5CLTA 2G9HA 3A0OA 4F2MA 3SE8H 1VSCA 3K2MC 5E8OA 4NQDE 4TTDC 3BO8B 4K94L 3SKMB 4Y16D 1IJ9A 5J13C 4LRNH 3BZFA 3TH2T 4AJ0A 4BELD 4L3CB 5JW4R 1QFWH 1A7NH 2VDNH 4JG1H 1MCPH 4I0PB 2IBBA 4PRPD 5D70L 1AXTL 4XVJH 3NCFB 4CNIB 5J3HD 4NWTL 4MVBC 4PJIB 4MLSA 4QTIH 1HQRB 3GHBH 5ADOL 3HRZB 4CKVX 5EUKB 4F9PC 3LS4H 4AK1A 5L6YH 5EUOA 3GSOB 4JPVL 4MA8L 4MJ4A 1G7LB 1K9TA 3WD5L 1TQBB 4Y8DC 1IAIH 3PIQB 4ODBD 3FFCD 2BNQE 1CL7L 5D5ME 2L0DA 2W60A 2HLFD 2O5XL 5DTFB 4PLJC 2J6EH 3ZE2E 3D18B 3WEXB 2UVEA 3LQZB 2O93L 5JIIA 4V1DA 4ZUVA 1PJ9A 1QA9A 3DBXA 3P3YA 5B8CB 4XRCB 4B0MM 1NDGB 2X4RB 4FZ8L 1JF1B 1QQDA 1NCDH 2GQHA 3DGGA 4MAYA 1BBJA 4UNVA 4YHZL 2BVPB 1KBGH 3VCLB 4LP5A 2O5YL 4ONGL 3PWUB 3P9LA 3U46B 1MCOH 2NZ9D 4JZJA 3OGOE 3HR5B 4LOUD 5C0GB 4JFPA 5KSBB 3K1DA 2ZP0T 4IRSC 4FOMA 5C09B 2VZ1A 5E1AB 2ZG2A 4KAQH 3UTZB 4M7KH 4JDVB 1LEGA 1NJ9A 3FZUD 3UBXG 1KJMB 2ZPKH 2VZSA 1LO5B 1BZ7B 1J86A 5KBNC 4XPHH 4RBPH 4ALAL 2Q7YA 4IHOA 2XKNA 5I1KL 4EIGB 1GGCL 2J88H 4MD5A 5JXED 3HFML 4ZFOA 5GGUA 3ZDZF 3TNMB 4LEXH 4X4YA 2XV6B 1F2QA 5F88A 1HKLH 1X5GA 5LCVH 3O6LL 1BQLL 4OGZA 4JLRA 1JK8A 1WUNT 5FA3A 5I9QB 1CD8A 2VXTL 1XR8B 4DKFH 3OMZA 5BZWA 3GSWB 2E7MA 1SVZA 2QADB 3ULSB 1UKTA 3B9KA 5JORB 1FDLL 5CSZA 5CBAA 2HT4C 2XRAH 1BJMA 1LO2H 1T83C 5GGVH 2NR6C 2XZQH 1CDJA 1HH6A 3N1MC 1ZGLA 1DTUA 4G6ML 4KQ4H 2DI8A 3TZVC 4XCCH 4C83A 5FO9A 4RMQA 4EQ3A 1HHIA 3SE3A 2V5RA 4NBYB 2IGFL 2VLRA 4ZOEA 4WI9A 1LMKA 4UNTA 2VSDA 4XTRD 5H8DA 4RFEA 3CDYA 3PWPE 1XIWC 2B4CL 3FQRA 5ADPL 2CRMA 1FZKA 2GUOB 5GS0H 4LARL 3OR7B 1F4WL 5EN2A 3QIBB 1T5WB 1RZJH 3FQNA 5I71B 3BRGC 1BOYA 2EIDA 3S3JA 2NPLX 3M45A 3GHEL 5TQ2H 1R3LA 2QKIA 4WUUE 1J0YA 4OLUL 3BP5A 1OAUL 2RJMA 4Z6AT 2YUVA 4XWOD 3GUTA 1H0DA 3HUJB 2FJHA 15C8H 2MOVA 4PGCB 2X2YA 1YYLL 1PG7X 2CLRB 4RQQA 4DFHA 4PB0L 1SYVB 5D72L 1FNSH 3GSRA 4W4NA 2APTA 3FB6A 3QJFB 2I26N 3S4SB 3FRPG 4NQCE 1QSEE 1WBZA 4XVUC 5JIKA 4M61B 3E6FB 2DQGL 2E9IA 4FFWD 4YIQB 4GW4A 3O4OC 4PTUB 1JGUL 4OLVL 3IJYA 2FDBP 5E6ZA 5FGBA 4XHQA 5I16A 4M6OL 4Y2DD 2PO6D 4OCSL 5A3ID 1MHEB 4JFDD 3C08H 4JFEE 4KUZL 3SPVB 3V4PL 3MLXH 5ICXB 4KKLC 3MRQA 4QCIB 5K9QI 4LAQL 4UAOB 4ONHB 4Z95L 5E7FA 5E95B 1LDPH 2OZ4L 4TQEH 3VXUD 1D3CA 1U2CA 1NEZA 1RZ8A 3K0WA 2DKUA 5EU7E 4NQXB 2WBJD 3WLBA 1NBVH 4DN4H 5EA0H 2F5AL 1CVRA 3MOAH 3GMRA 4JFHE 5D71L 2YPVH 3DRQA 1UXWB 1EHLH 4WHTB 4ZUWB 2WW8A 1W0WA 2MNUA 4EN3D 1QR1B 5F1NA 1RIHH 1HZHH 2AJXL 4PJFF 1I8KB 3AXLA 2ZJSL 1TXKA 1WBXA 3W0WA 1LK3H 4JRXA 3OTTA 2V5TA 4Y4FA 3WE6B 3EZJB 2VZTA 4U31A 4Y0GA 2A6JA 3IS0X 1HXYA 3LKSA 5HYJD 3W11D 1CD1A 4P2CG 4I4WA 4UB0H 1T04A 3AFLA 3BGMB 2DRUA 4N8VB 1NFKA 1ZS8B 3RA7H 1Q0YH 2R1WB 3ARBC 1SYSB 4WTWA 4NZUH 2XPGB 1KJ3H 4QRPD 5D8JL 4UU9B 3ZHKA 3QXVA 5ANME 1OVZA 4NBZB 1MCLA 5BO1L 1XGRA 5AEAA 5T3ZL 2EDJA 2R9HD 1DBBL 1EJOH 3SDDA 4WGVB 1MWAA 2XFXA 4Y5XC 4JFXB 2BOCA 1GOGA 1FQ9C 3V4UL 5IBUB 3QHFL 5E2WL 5J11C 5SWQB 1INEL 3H9SE 2X6MA 4L9LB 3QA3B 2J4WL 3QUZD 1U42A 1ZANL 4Z7WA 4Z0BH 3GMMB 2Y4SA 1KULA 4R3SB 2OSLA 4K7FA 2I07A 1UEYA 3SKJH 1JI2A 2NY2D 3SDAC 4JHWH 5D2NB 5FO7A 2MQCA 3PWNA 4D2NA 2P5EB 1KJ2L 3UX9B 1C5DB 2HRLA 3MUY1 4W70A 3GKWL 4PY7A 4OLWL 5EWIH 3KAAA 4LLDB 1KCVH 3B9AA 2VXVL 3W39A 1QBMH 4HUXB 3TBYA 3H42L 3QG6B 4YDJB 1WWCA 3LDBC 3NFPA 5DD0H 1UB6A 5F7HA 1DANU 5CZVL 4KK8C 2EIZB 5DC0A 1N64H 1NSNH 4UV4H 4A6YB 2FLBT 2BXZA 3X3GH 4MCYA 4M48H 4XI5C 3T3PF 4X6CA 1PG7W 2FHBA 1MFDL 3LN5B 4O2FB 2JLLA 3AREB 3R06B 4APQD 2EDWA 2CRZA 5IW6B 4PJCB 2DN7A 4XNMA 4BKLA 1S9YA 1SJXA 1MLBA 2VQ1A 5K33A 3FO0H 3G6AB 3HC4H 3UTTE 3ULUC 3EYFB 2X4UA 3CLEL 3F7YB 4MD4B 4JY5H 1C5BH 4U3CA 1ZT7A 1ED3A 4M1CD 4U3XA 1DVFA 1L7IH 2ZG1A 3EBAA 1TZHB 4ZTOL 2HFEA 2XI9A 2Z93B 4NQVB 1I1FB 5IQ9B 1NFDA 1H3XA 4HKZB 1Y18B 2XICA 2VKXA 1N3NA 4PJDB 2IPTH 2DJ4A 2X4OB 5EO9A 3ETBF 3QAZB 4GSDH 2H41A 1F6AB 3PABB 5SX5H 1N4XL 1C7SA 3MV9A 1QSFB 4LCWB