4X9SA

Crystal structure of hisap from streptomyces sp. mg1
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
241
Chain Sequence
VNKLELLPAVDVRDGQAVRLVHGVSGSETSYGSPLEAALAWQASGAEWLHLVDLDAAFGTGDNRALVAEITGAMDIKVELSGGIRDDASLAAALATGCTRVNLGTAALETPEWAAKAIAEHGDRIAVGLDVRGTTLKGRGWTSEGGDLYETLARLDSEGCARYVVTDIGKDGTLTGPNLELLKNVCAATDRPVVASGGISSLEDLRALAALVPQGVEGAIVGKALYAKAFTLEEALKVVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosyl isomerase A
publication title Co-occurrence of analogous enzymes determines evolution of a novel ( beta alpha )8-isomerase sub-family after non-conserved mutations in flexible loop.
pubmed doi rcsb
source organism Streptomyces sp. mg1
molecule tags Isomerase
total genus 90
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4x9sA00
3BG5A 4UTHA 1LP6A 2ZA1A 3GR8A 3TSBA 1XDMA 1FWNA 3HGOA 2H3DA 5H2ZA 5LNRA 2F84A 3C2FA 3FIGA 2I1OA 1H62A 5AHLA 3ABSA 5TIMA 4GC4A 5G1TA 1T8XA 4OE7A 5HR6A 1LRNA 1OX5A 1TPVA 3G1VA 4YLWA 5D2XA 3GDKA 3MYOA 3MP3A 1VLIA 3UPWA 4I7UA 2NUYA 4KKXA 1EPXA 2HS8A 3S5ZA 4NNAA 3STCA 2ISWA 3MI6A 4PFMA 4OHQA 2ISSA 3N19B 1K7EA 3P62A 1W0MA 2A4AA 2CZ5A 4D2JA 1VYSX 2Z6JA 5KZEA 3GAYA 2VEMA 4DELA 1OYBA 5KINA 1NF7A 4O12A 5CSSA 2ZTKA 1WDWA 5A5WA 3BW2A 4DF1A 1QWGA 2ZRZA 2WQPA 2C13A 4JX6A 2WSRA 4N6EA 4AWSA 4JR5A 4M7SA 5G1YA 1FCBA 4HIBA 3WK1A 4Y6GA 1PCWA 1OFDA 5AFDA 2ZZ4A 1TPFA 2QDGA 4I7VA 4TU1A 3O15A 1LOSA 2FQIA 3MHUA 1GTHA 3T4CA 3C0JA 4J9JA 3P8IA 4FHAA 3U2OA 1R2TA 2B4GA 3VE9A 2ZZ1A 4XTIA 2XFWA 3LGEA 1YDNA 1LBLA 4O57A 4L4LA 1ZY9A 4AVFA 3M5VA 3O63A 5AC8A 2ATSA 4K7YA 1Y0EA 3MHGA 3S5NA 3NQEA 3GYEA 3LHWA 1T96A 1YPFA 3FA5A 3TV8A 5I3GA 5LHEA 1W5OA 2YCEA 2Z2UA 3RU6A 1LYXA 4N9EA 1BTMA 1C29A 4YXGA 3PULA 3W7IA 4UNLA 1GYNA 1PE1A 4PL1A 4S2BA 4Z1AA 5LSMA 1H51A 1OX6A 3NG3A 3HPXA 5HUPA 1NAL1 4E2BA 4LC6A 1A50A 3DI1A 2A1YA 2A7NA 2BWGA 2X1SA 1XBZA 5HJLA 3EXRA 3V1PA 4E2DA 1PCKA 4GUIA 2X1RA 3UY8A 1OFPA 1TO3A 1VH7A 4XQ6A 2DZVA 3IGUA 5FEZA 4UXDA 3W72A 2C3ZA 3BW3A 3E96A 1OFOA 3BGJA 5K4ZA 1QFEA 3TC6A 3L2IA 4XKYA 1FUYA 4LVAA 4FIRA 3W1RA 2GVLA 2R94A 3PF3A 5FEWA 1H61A 4OV9A 2ZFAA 2TSYA 4N2YA 1SUXA 3SR7A 1XM3A 1WOAA 2VEKA 1DJNA 2A2IA 1LZOA 2ZQ0A 2QCGA 1QPRA 2WJZA 5K7JA 4TIMA 4NU7A 4E0CA 3SW6A 2Y62A 3BW4A 4JTFA 2TRSA 5LNUA 2AQWA 4IMGA 2Y7DA 4M6QA 5HWMA 3DFNA 3MBDA 3D0CA 3BV4A 5G2HA 4MY8A 1EEPA 3P74A 5F4SA 3M43A 3RLUA 4TMCA 2B7OA 3ATYA 4Q32A 2QDHA 4NJJA 2GVJA 2J88A 1LCOA 3FJLA 4HNUA 3W87A 5LKYA 3SY5A 1A5BA 2CZEA 1QAPA 5KZMA 3M44A 3QMSA 4N9DA 3NQGA 3UD6A 3LCWA 3O6DA 1VRDA 1VQTA 3W1LA 2YZRA 2NV1A 4R34A 3KVKA 4ORMA 1F2JA 2JK2A 5K4XA 3H55A 3UWVA 3CTLA 1XUZA 2BXVA 3L65A 4IX2A 1ME9A 3DGRA 2NXIA 3DFPA 3QH2A 2CLEA 5AYYA 4ORIA 1W8SA 4QAIA 3CM4A 4MVAA 1B4EA 1KA9F 1RQEA 3G18A 3W1XA 1VZWA 3R89A 2EPHA 3GNNA 1EWDA 3HOJA 2QEZA 4JY9A 3TQVA 5EBUA 1N8FA 1WOBA 3HPZA 1WBHA 5C2XA 3MBFA 3SECA 4KWVA 3SZ8A 3BVJA 1FCUA 2WV8A 2PURA 1W37A 1SFJA 1J2WA 5CPLA 1H7RA 1MXSA 3HGRA 4K8HA 5F2LA 4CCDA 3TFXA 5F1VA 2E77A 3EKZA 4K8EA 2GQ8A 2VFHA 3NAVA 1QPOA 4EVZA 3W85A 1FWWA 1XKYA 4X9SA 4MFDA 1MEIA 3NA8A 5HR7A 4JTHA 1ICSA 2IQTA 3P84A 5I3JA 1AK5A 4UTJA 3G1HA 1DOSA 5AHNA 5HWJA 1ME7A 2E6YA 2HSAA 4WX2A 3HG3A 3EXTA 3L0GA 2QCNA 1M5WA 3NDOA 2QAFA 2QCLA 3BARA 4DBDA 3M47A 3P60A 4R33A 2C0AA 5D2TA 4LC8A 3HG5A 1WX0A 3NQMA 1QNVA 1TQXA 1JUKA 3C2RA 2YDAA 3CWNA 2X1TA 3P67A 4Z1DA 2YX0A 4K38A 5AHEA 1D3GA 5EMUA 3FKRA 4UFKA 3QQ0A 3S6DA 3DU0A 2G95A 1IGSA 4GE8A 1TV5A 4JD4A 2A5HA 3W1TA 1JCNA 1KLZA 1K7XA 4FXSA 1ZENA 3S0CA 4JGDA 2E09A 5GVJA 4EF9A 2GJNA 3E0IA 3C61A 2Z0IA 1DHPA 1JUBA 1GVOA 3NL6A 3W7RA 1XXXA 4A29A 2HTMA 1JCLA 1GG0A 1IXNA 3N14A 1KM0A 2EGZA 3MWAA 4CQ9A 4O4VA 2QKFA 4DEFA 1OF8A 3KAOA 4LT9A 2QCCA 2DZPA 4UTKA 3CIWA 3EX6A 3TC7A 3LI1A 3NEVA 4XZ9A 1TPDA 4UNKA 2WNQA 4FNSA 4JEQA 3LV5A 5E0KA 4OBTA 4IUOA 3LBMA 2ZTJA 3EWYA 2WSYA 1JCXA 2WKJA 3G22A 3L9CA 2CLOA 2HMCA 5AYZA 1TTPA 3EWZA 3NL3A 5C55A 3F03K 3YPIA 3AO0A 3N34A 1ZFJA 1D9EA 4RX0A 1KM6A 1EB3A 3QEZA 5DY2A 3G3MA 3LCIA 1VC4A 1QPQA 3R2GA 7TIMA 3ZWTA 4O53A 2EF9A 4IPJA 3GDMA 1OK4A 1KFCA 5I3HA 3WFAA 4TO8A 1GYLA 1UUMA 1NFBA 3SJ3A 3W86A 2LLEA 1JQVA 3VCRA 3LERA 4UR7A 3LX9A 4KFNA 5KITA 1FWRA 1KFJA 3PY2A 3GDLA 2V2HA 2Y85A 5D2YA 4JDBA 4C1LA 5G4WA 3GDTA 3IIOA 3CT7A 2C1HA 2YYTA 3NZ1A 1L6YA 2B7NA 4GJ1A 1KM3A 4NX0A 3G1FA 1WQ5A 1K8XA 3SSJA 1UCWA 2WSQA 1TV8A 2VFGA 2C16A 4XBKA 3CWOX 4N6FA 3HMJG 2NXGA 4EOUA 4O0KA 1HFBA 1TTJA 5EYWA 4PCFA 3UZ5A 3K30A 4O18A 1J4EA 4BF9A 4PODA 3TW7A 1AW2A 1GVQA 3BO9A 2EKCA 3O6YX 1CW2A 1F05A 1H7NA 4M7TA 3UXDA 4BI7A 4WY0A 1JCYA 2BTMA 5LNWA 3NPUA 1GT8A 1YDOA 1FQ0A 3OHIA 1DQWA 5FF3A 3A24A 3IV3A 4IPIA 4HKPA 1M7PA 1DORA 3ZFHA 3IVSA 4IOTA 2Y63A 2C14A 1OK6A 3B05A 1TJPA 3TJXA 5D09A 5AHFA 2A6LA 3EXSA 4M19A 3TH6A 1EP1A 4CQ8A 3LRKA 3W7JA 4HNNA 3EWUA 1A5CA 4JDYA 3UWYA 3ATZA 4Z08A 4LVBA 2ABAA 1NEYA 3KHJA 5BMXA 1TTQA 5CPOA 1W5NA 1I2RA 3TJLA 3B0VC 3L0NA 3NQDA 3TMQA 4ALDA 1OYCA 5G2IA 3EWXA 2VC6A 5F2MA 4UMAA 3A9IA 5LGXA 2A21A 2WNNA 3A22A 3DHDA 5CKSA 1E51A 1H63A 4HSOA 4CNOA 1HTIA 3VKJA 5L9FA 5BW6A 3GKAA 1BWLA 3CPRA 3HG2A 3ZWSA 1FCVA 3TAOA 2FB2A 3QPYA 2EAWA 3LOTA 3C6CA 1R46A 3GKFA 1XC4A 1JRBA 1YXCA 2X2GA 4UFMA 1BEUA 3L5MA 4YL2A 3FOKA 3DFSA 4O19A 1VYPX 2ZZ2A 2JGYA 4I7WA 3TFCA 3W07A 3UPBA 2H90A 1ZALA 4UMCA 2A0NA 4UFJA 3W74A 1VYRA 3KXQA 4X3ZA 4JTJA 3NPVA 1SO3A 4ZQCA 3TCEA 3M5ZA 2HS6A 3PUEA 1ADOA 4NXSA 4UTMA 1VCVA 5D37A 4OGZA 2WOQA 2I9EA 3G3DA 2YW3A 3G1AA 4FNTA 4FX8A 1H7XA 3HIJA 3MUXA 3GXPA 2QJIA 1G4TA 2E1DA 3BLFA 4N4QA 4FB7A 1SW3A 3ZS4A 3U8GA 2B0MA 4TMBA 3W70A 4O16A 4GUFA 1JULA 3KOFA 1O5KA 3CIXA 1L6SA 4C1KA 3TUUA 1MEWA 2Y61A 3IEBA 4ZL1A 2CFFA 2QCDB 3LTYA 3TKFA 4YCOA 3QFEA 8TIMA 1H7PA 2VKZG 3NVTA 5C5YA 3GR7A 1DVJA 5KTLA 4WY0B 1LM1A 3LTSA 3MHFA 3OVQA 4AHPA 1IXPA 3GB6A 2XN2A 3TA6A 4ZMGA 2V0TA 1L6WA 2EHHA 3DFOA 3JS3A 3QSTA 3TQKA 1MZHA 4N4PA 1VCFA 4BWLC 4LRTA 5LNSA 4CLMA 1VLWA 4FX6M 1RZMA 2J9XA 1I4NA 1V5XA 1YXDA 2ZA2A 3EWBX 5DBTA 3PWAA 2E5DA 1OABA 4X2RA 1F76A 2ZZ3A 2V2DA 5F1UA 1TPC1 3W1AA 2R91A 4U4MA 1O95A 1H7OA 3NYZA 1VHCA 3FS2A 4HN4A 1H5YA 4GUJA 2Y7EA 1C8VA 1I2NA 3LXBA 3W2JA 1KV5A 2XN1A 3STGA 3QYQA 3I7QA 3LCHA 1XBYA 4HSNA 4AF0B 1SO6A 3PBYA 2V2CA 3C3NA 2TYSA 5G2WA 5J5DA 3FFSA 3I65A 1YDVA 4K37A 1SO4A 3ZR4A 2CWNA 4O50A 5FESA 3UWUA 1CX9A 1GOXA 4ADTA 1JRCA 4PH6A 4OQVA 5LGZA 4O14A 3NQ2A 1TRIA 4LRSA 1U5JA 4UC5A 3CEPA 1DQXA 3TW6A 3QQ1A 4JX4A 1H7WA 2J9YA 3G8RA 1KFEA 1WV2A 4IMEA 4KFPA 3W7PA 4IMDA 2QCHA 5DCDA 2OT0A 1ZJIA 5EY5A 5C6MA 1RR2A 1SSGA 1EUNA 4UTWC 1VHNA 5TBOA 3PSWA 2GQ9A 4AHQA 2H6RA 4NJKA 1LTDA 4OV4A 3RMJA 4FNUA 3UY7A 1K03A 1MSSA 2VOMA 1YPIA 3G24A 4ZQRA 3W2NA 1KTCA 4O17A 4LW7A 3HJZA 1JJKA 2OCZA 3VE7A 1IIHA 1JVNA 1OVDA 1G6CA 3PSVA 3NOEA 1EP2A 4B5NA 1RV8A 1RVGA 2ISVA 2E6DA 1X6UA 3C2VA 1TB3A 4Y90A 2C18A 2E68A 2KZHA 4RXFA 3KRZA 4K6AA 2WPBA 3O6CA 4JY8A 3FEMA 2UV8G 3M9YA 3NL2A 2RH9A 3W2LA 2NX3A 3LCXA 4GBUA 2YFOA 1I45A 2CU0A 5BMWA 3S5YA 1ZAHA 3R5EA 3GNDA 2NX9A 1PS9A 1O60A 2YXGA 5E1QA 5U4NA 4DF2A 3V75A 1W5MA 2AGKA 3W2KA 1QPNA 4ZQMA 4Y96A 5F4XA 3RFAA 2E5CA 2CLFA 4MJMA 1T0OA 1OFQA 1Z44A 3DKJA 1XDLA 3W7LA 4CCEA 2Y70A 4MOZA 4JTLA 1ZAJA 1TYGA 4IX0A 2TMDA 2NUWA 3LXCA 3A21A 3S1WA 1KM1A 1UJPA 1I2PA 2QUTA 4FNPA 1T99A 2RDUA 1ZHAA 2VENA 4HT3A 3LHUA 3OIXA 3VI2A 3S42A 1FBAA 2AAMA 1Q3NA 4LUJA 5IBXC 4GNJA 5HUOA 4A2RA 3LI0A 1SO5A 4UTTA 3HPSA 2YGYA 4UMBA 2QR6A 3WJSA 2VELA 1LBFA 4N9CA 3QMRA 3G0UA 4H6KA 1JCJA 3B0UX 3W7QA 3HO8A 4P61A 4O10A 4K36A 2FPVA 1W56A 3W84A 1EA0A 2C6QA 4GRSA 2OJPA 5FEPA 2BSLA 5LZLA 4Z0JA 1FY6A 3MO7A 2QJGA 3LHVA 3FYPA 3M5XA 1LLWA 3RF9A 3W1PA 4UIOA 4JYDA 1QO2A 4AWUA 1HL2A 4IJBA 4ZVJA 1KLYA 4Y9AA 1W3NA 2PRLA 4LNYA 5FI8A 3L5LA 2E5BA 1KFKA 1I2QA 3TK7A 2A6NA 4EWND 3F4NA 3QMTA 3A5VA 2H3BA 4PL2A 4JX5A 4XKYB 4PTNA 4XUGA 2CLHA 1S3HA 4FIQA 4JNMA 4JYEA 1B4KA 4JTTA 3LLDA 3DXIA 1TJRA 5CZSA 5FEXA 1SSDA 4FO4A 4DBEA 1OFAA 1OHLA 3CEUA 2OX1A 2X1UA 3G1XA 2V81A 4H3DA 5AHIA 1KFBA 4TR9A 2FPYA 1RQBA 3EWWA 1X8FA 5L6UA 1GZGA 5FF0A 4I9AA 1UB3A 3PUOA 1XI3A 3SFKA 5CGQA 3W7EA 2P1FA 3NQCA 1K8ZA 2QUUA 2Z1BA 1TV7A 2ATMA 4MLJA 3KVMA 3PBUA 4BWLA 5EPDA 4RK8A 3HBLA 4UTIA 5D04C 4AXKA 1TSIA 3W6YA 1U83A 1UBSA 3GX9A 1OFBA 1QR7A 5T26A 3MMTA 1LOQA 5AB3A 3L0KA 3P5ZA 1P0KA 5I3FA 1GVRA 3EX3A 4MFEA 3TU9A 5U7SA 2OT1A 4ADSA 4JXCA 2ZZ6A 3KX6A 4OWGA 3SGZA 1DKWA 3WJWA 1DL3A 4UFLA 3DBPA 3LRLA 4WQ6A 1UUOA 2X30A 3B04A 1N55A 4UUIA 1VS1A 1YTKA 3W9ZA 1EUAA 2CW6A 1G7UA 3UQNA 2Z6IA 2A7PA 1G69A 4LV9A 1G4PA 2DORA 2FIQA 3INPA 5K9DA 4OU1A 5CG7A 1YADA 3O16A 1TPWA 4O1BA 4PC8A 3T55A 1JCMP 1OF6A 1PVNA 2QCEA 3DHFA 3JR2A 1YYAA 3TSDA 3DAQA 1JR1A 4QSHA 3O8AA 5D38A 3W88A 4CQAA 4H4IA 2FJKA 1Q6RA 1EIXA 3DFQA 1L9WA 4WOQA 1W54A 3NQ8A 3A5FA 1FDZA 2VEPA 2DP3A 4Y8FA 2VFEA 1N7KA 3W7GA 3U6WA 1PHQA 1IXQA 1KM2A 2V82A 4ZQNA 2ZRWA 3W71A 5EA9A 4AB4A 4UTUA 3T7VA 2W0UA 3W1NA 2GQAA 3IVUA 3S8HA 3ANYA 1G67A 1K8YA 4AH7A 3H53A 3TXZA 3MYPA 2V8ZA 1DJQA 2GPTA 1B9BA 4O54A 4RJEA 3ABRA 1VJIA 1RD5A 2JKPA 5D30A 2FLIA 3IGXA 1PV8A 2F7FA 3S1UA 3GXTA 1QOQA 1TTIA 4WY0F 3P80A 4IMFA 1NSJA 1TPUA 4QNWA 3E9AA 2Q8ZA 3DENA 3GZ3A 4JTEA 3OBKA 3QM3A 4NUWA 3UXAA 3NQFA 3THQA 4K39A 4MZ1A 3DKLA 4EIVA 4OT7A 4GXMA 5K9XA 3I6RA 4JICA 1RPXA 2D73A 4FX7A 1NVMA 2PRMA 4WOZA 1QO5A 3PG8A 3FJ6A 3W7DA 4NX5A 4GUHA 3PBWA 4O8RA 4MPQA 4JTKA 3W75A 4BK9A 3MI2A 3LXAA 3GDRA 1SZGA 1GWJA 1LORA 3W7MA 5AYXA 5HWNA 1H1YA 1YTDA 2ZBTA 3E12A 5E93A 2XN0A 3TIMA 3PVFA 4M6PA 3B8DA 1W5PA 3GK0A 4RXGA 2CZFA 4AWTA 3W7NA 1GVFA 1Q45A 2ZRYA 3RK8A 2E6FA 3S9YA 4NVTA 4U28A 1W3IA 4IXHA 4LS0A 2NZLA 4DPPA 1F73A 2GJLA 2NLIA 2YYUA 5DELA 3GAKA 2B7QA 3EX2A 1WYIA 4O15A 1P4CA 1TREA 4O52A 5D32A 1EP3A 3N73A 4O13A 4NNBA 4WJEA 3GIYA 3R12A 2J6XA 1OJXA 4EF8A 3NQ6A 1AG1O 4ZZ9A 4NXKA 3WK0A 2V9DA 3FYOA 3CLMA 1Q6LA 4JYFA 4IGHA 1F7BA 4A2SA 1F5ZA 1KM5A 2YFNA 1O5XA 5KSWA 2WO5A 1AW1A 3PG9A 2GOUA 2DJXA 5DLCA 2QCMA 3EX4A 3LM7A 3W3OA 1VGAA 4AHOA 3MP5A 4GUGA 4AMAA 1B57A 1LOLA 3KVJA 2PC4A 1R47A 1QDSA 3QW3A 4S2CA 5F4WA 4LV4A 4O11A 4MLRA 1P1XA 4RLIA 4LTSA 1X1OA 2Y6ZA 3EKLA 3A23A 1ML1A 2DU2A 2DZTA 3THAA 2GVGA 3OA3A 1OFEA 4UR8A 3TDFA 2WNZA 3RNDA 4MZ8A 5F2IA 1MO0A 5IM51 1CI1A 3IRDA 1S5TA 5J5RA 1GG1A 2O7QA 4N9BA 5K2ZA 1O94A 3NPWA 3QZEA 4HPXA 5FF7A 3WK2A 2OZ0A 2Y89A 5BRBA 3M7WA 2Q3RA 2Y7GA 4DO6A 1FXPA 3TSMA 3PR2A 5AN7A 1ME8A 3CQ0A 1W5QA 1YLVA 2FFCA 3QW4B 4JIPA 4N02A 4FF7A 3TNOA 5DXYA 3P5YA 2B7PA 4ADUA 3QC3A 1D3HA 2R8WA 4Q33A 5FF4A 4IMCA 3C4UA 3NL5A 3KRSA 4O28A 2Q3OA 3GXNA 4QISA 1ALDA 1KBJA 3NM3A 3O06A 4HNTA 1OX4A 4JN6A 2RHGA 2G5WA 3IGSA 2CLIA 1AL7A 4E38A 1FDYA 1R2RA 2PCQA 3UWQA 3WK3A 1PHWA 5ABTA 1XFBA 4YCPA 5A8GA 2I14A 3F4WA 4PA8A 1XL9A 4ZQPA 2QJHA 1W31A 4P2VA 3W7HA 3T78A 3VFLA 3OVPA 2A7RA 2E6AA 5MHBA 3L67A 1FCQA 2BX7A 5K9CA 2JBMA 2PE4A 5K3VA 3R8RA 1WAUA 4QQ3A 2VFDA 3NPXA 1QMLA 3GVGA 4JTUA 6TIMA 3RLVA 2BZNA 4QIUA 2CLMA 3HQ1A 1XBXA 5D2WA 2W79A 4PEKA 2OMAA 4ML9A 1IXOA 1GQNA 4MYXA 4QITA 4JTSA 2VFIA 3OEXA 4X22A 1M6JA 3LV6A 3ABOA 3CHVA 3N9SA 3LHYA 2JKEA 3M5YA 2TPSA 3B0PA 4JTGA 1TMHA 2P0OA 2FDSA 5AOUA 2DZSA 1DV7A 4MIMA 2ABBA 3PC0A 1LLZA 3SGUA 4NQ1A 3KVLA 5I3KA 1ONRA 1ZNNA 4O1CA 4BR1A 4LU0A 4MUZA 2QAPA 5HINA 3L68A 3TAKA 1SR9A 2V5LA 1I2OA 4M6VA 1QOPA 3LTPA 4YWIA 4HHPA 1DBTA 2JKAA 4JTIA 3W2UA 1JUEA 1F6PA 5I3IA 1C9DA 4CNNA 3SIZA 2PRHA 1S5WA 2C15A 4ZQOA 5H91A 1NF0A 2DJLA 2NWSA 4A21A 2H8XA 2QF7A 2ZRUA 5F2GA 4R7JA 3I7SA 4MY9A 3T40A 3UWZA 1FWSA 2J27A 3DI0A 3LHZA 3G0SA 4NT0A 5EKYA 5EL1A 3S1XA 3P61A 2C19A 1K7FA 4XTDA 1M7OA 5LHFA 4A22A 1TIMA 1A5SA 2RDTA 1WBJA 3W83A 3BGGA 1TCDA 3UWWA 4MJZA 4MY1A 5CZTA 3UNDA 1BKSA 3IIVA 5CZJA 1IF2A 1ICPA 4Z1CA 4UTLA 4RZ6A 1EWEA 3CB8A 4LWWA 4KWWA 1G4EA 4NJGA 3S1VA 2V30A 2FB3A 5SWUA 1P0NA 1P5BA 1TPEA 3P7YA 3LB0A 1J5TA 5CPNA 3O05A 1IIGA 3M6YA 4NNCA 3N2XA 1HUVA 2P10A 3NR0A 3W23A 2DZXA 1KFLA 2QUVA 2ZDRA 2VFFA 1OX4B 1XBVA 1SZNA 3E02A 2O7SA 4RKAA 4DO5A 3M41A 4LVDA 5HNRA 3C56A 3W1UA 5KZDA 4FEZA 3PB0A 1H60A 1SU5A 2VXNA 4RV8A 4UCGA 1XUUA 3M16A 5CSRA 4HNVA 2JGQA 3LCGA 3LHTA 4BI6A 1O4UA 4R53A 1W3TA 1FXQA 1VR6A 1OFRA 3L5AA 3KFTA 1Q6OA 3M1ZA 3TE9A 2H8ZA 3HF3A 3IIPA 1AMKA 3TR2A 3LRMA 1LBMA 3QRHA 3IIZA 3W7KA 5CPMA 3TX9A 4LS2A 3MI3A 3PBVA 3NGJA 1WXJA 2NUXA 4MKNA 3GLCA 1SFLA 3E49A 3W73A 4NJHA 4RZ4A 3C2OA 4HPJA 1GJPA 3QPZA 3IIXA 4Q4KA 3I68A 1YXYA 4DO4A 4QJ1A 3WJZA 3W7OA 4IWWA 5HULA 2CLKA 3PUDA 3Q37A 5BNKA 3G1SA 4RZ5A 1KV8A 3F1QA 4QNEA 3BK0A 4M5PA 3NO5A 5CZ0A 3AJXA 3HGSA 3OG3A 3STEA 5DBUA 5KMYA 1LRTA 1AL8A 3Q58A 1OYAA 1HG3A 5DCEA 1TPH1 3N9RA 6ALDA 2NWRA 1G4SA 2RFGA 3W2MA 1X1ZA 3W1QA 3LDVA 1A5AA 3C8FA 3DFTA 4G1KA 3N2MA 3NQVA 4LS1A 4TX9A 1H1ZA 1OG0A 2ZRVA 3USBA 1A53A 4WD0A 1V7YA 2YSWA 4FNQA 1VCGA 1KBIA 3HG4A 3IVTA 1S5VA 3R13A 1Q6QA 3H54A 4FXRA 2G97A 4BFAA 1ZCOA 5HQEA 3TMLA 3WJXA 2Y7FA 4DQWA 3NNTA 4IQLA 3FLUA 4QM1A 2RKXA 4WUIA 4Z0SA 4K7VA 1KTBA 1SW7A 3HGJA 3VNDA 1FDJA 4LVFA 2RDWA 3I7RA 4NZFA 1MEHA 3MP4A 4L4MA 5LNVA 3PS7A 3O07A 4NJIA 2DZWA 3LLFA 1SPQA 3ABQA 4JS3A 1SZEA 3G1YA 3B06A 2ZYFA 4GFSA 4DPQA 1X7FA 1QCWA 2J9ZA 3NZRA 2W6RA 3STFA 2NV2A 3G8EA 3S5OA 5DN1A 1VPXA 1JQXA 1RQHA 3N3MA 1TQJA 4KFOA 4ONVA 3W7CA 1SQ7A 2FPTA 1TPB1 4W9TA 3W76A 3CU2A 4WXZA 3ELFA 3C52A 2ZCGA 4RR4A 3TQ0A 2VEIA 1PL9A 3NM1A 1F74A 2YW4A 3NQ7A 4XWUA 3QSRA 1H50A 3NQAA 4O0ZA 2YPIA 3L21A 5D02A 3L66A 1GPWA 2ZZ7A 2Y88A 1YTEA 1I8JA 4UTWA 2NX1A 3QJAA 2QCDA 3W1MA 1L2UA 2J24A 4S1FA 1R2SA 3P8JA 1THFD 4AAJA 2CZDA 4UFHA 3TROA 4Z1BA 3BG3A 5C54A 5D05A 3B4UA 3DZ1A 2DZUA 4MYAA 3LCLA 1GVSA 1FX6A 3Q94A 1TRDA 3UYCA 2QCFA 1F6KA 3O1NA 2X16A 5HMSA 5DCBA 1XCFA 2R14A 1KTNA 1GEQA 5BOOA 4GWEA 4DF0A 3B03A 3QF0A 4O1DA 4BI5A 1BWKA 3BPWA 4MZYA 1G7VA 5AC7A 4LVGA 5TQLA 5FF2A 4O4WA 3PAJA 4YMZA 3T44A 5D33A 5G5IA 4LY8A 3NXFA 4LUIA 1HO1A 1AW5A 4DXVA 4WXYA 5DXXA 4UFIA 5AC6A 1ZAIA 3EX1A 5DY3A 1Z41A 4AF0A 1PIIA 4NZJA 3CC1A 4WZHA 3MW7A 2ZRXA 5AHMA 4UTTC 3BLEA 1KW1A 4CNPA 3KRUA 3P82A 3LBCA 2G96A 1FWTA 1LROA 3BG9A 5G4EA 3FKKA 3C2EA 2FTPA 2CLLA 4XBSA 1Z48A 3BLIA 1K3UA 4IXXA 2ZZ5A 2ALDA 1Z42A 3W22A 1B3OA 1LDCA 4LOCA 3EB2A 4RCXA 2V5BA 2YR1A 3P81A 3SI9A 3HB9A 3TXVA 3JRKA 1KM4A 4POCA 3EEGA 1EX5A 3PB2A 4CCCA 3G0XA 2Q8LA 1SW0A 3DH7A 4A3UA 2GUUA 5D2VA 1HO4A 1K02A 1R30A 3M0ZA 3Q2DA 4ICNA 4AEOA 5IBXA 5D03A 1WA3A 4FNRA 1ICQA 1LRQA 2NXHA 2BLEA 3G1DA 3MJYA 3UZJA 4O1AA 2ZA3A 4JIQA 1W1ZA 1GTEA 1UASA 2A85A 3WJYA 3PM6A 3OVRA 3LCFA 1SZFA
chains in the Genus database with same CATH superfamily
2DZBA 2I17A 3BG5A 4HNCA 3TSBA 1FWNA 2H3DA 1TJ1A 2X05A 2XZ9A 3C2FA 2QS8A 1M1BA 3FIGA 4I8DA 3ALFA 4C1NB 1FWCC 5HR6A 1OX5A 1BRLB 2A3HA 2X2YA 3OIHA 3MYOA 3RHGA 1VLIA 3ORWA 1ZBWA 4I7UA 5JH2A 3H2CA 3CQHA 4PR4A 2V5KA 1GQKA 4AVNA 3OLGA 3VM5A 1DIEA 4R9OA 1B0IA 2I5GA 2INZA 4TX8A 2Z6JA 3GAYA 3H6OA 1MUCA 4DELA 3ERPA 5KINA 1NF7A 5CLWA 3T81A 2ZTKA 1V02A 4DM2A 1BWVA 1LWIA 2GDQA 4JX6A 2WSRA 2WWCA 4CNSA 4JR5A 4M7SA 5G1YA 1FCBA 3WK1A 4HQVA 4C90A 1OFDA 5AFDA 2Q01A 4KS0A 2ZZ4A 4TU1A 3MHUA 4US5A 3T4CA 4N42A 4UOJA 3C0JA 3E2RA 4RE0A 4F0KA 5BRQA 3U2OA 4IP5A 3SN4A 1IZJA 1SJBA 2B4GA 4KF1A 4XTIA 1XLDA 2GZXA 1K9TA 1G9HA 4O57A 1TE1A 2AQVA 2HBVA 2J7CA 4AD4A 5E9XA 4K7YA 5ECUA 4CQCA 3WD4A 3C86A 5EMKA 5KEZA 4J3XA 4OVXA 3VPLA 5I3GA 2PZ0A 2XISA 1J18A 5LHEA 1AZ1A 5HMEA 1W5OA 3CASA 2IPFA 1FWGC 4N9EA 1HF6A 2BHUA 3W7IA 1GYNA 2XIJA 5A6JA 3ARUA 4GBDA 1L8NA 1HKJA 4PSRA 3DG3A 3NG3A 1VEPA 5HUPA 5BXTA 3OVGA 3UWEA 3DI1A 3E74A 1FOBA 1XRFA 3L12A 5HJLA 2X1RA 1OFPA 2DZVA 5FEZA 5A6KA 4NZ4A 3IV8A 3LS9A 1OFOA 4NG3A 3VNZA 3N04A 3OOQA 1QU4A 4A05A 3TC6A 3B40A 2R94A 5FEWA 4UQCA 3SR7A 4D6DA 1AVAA 1PWLA 5K7JA 4TIMA 3CHCA 2V63A 3NZPA 2QDEA 4IMGA 3DFNA 3MBDA 3D0CA 5M1TA 1XH1A 5G2HA 1UA3A 3MMUA 3GYCA 3BICA 2WJEA 1GVYA 1QHZA 1BHGA 3RLUA 2FMOA 2B7OA 1DE5A 4Q32A 5CH9A 3USZA 3F5KA 4HNUA 3SY5A 2CZEA 3UD6A 3O6DA 4GZJA 2NSXA 2YZRA 1XYBA 4C6PA 4LFYA 2NW0A 1REQA 5JXQA 4Q6XA 3QV6A 3CTLA 2WLYA 1ME9A 3RXZA 4I8YA 4Z1YA 1ZS2A 3BJFA 5JVLA 3QH2A 2CLEA 5DFAA 3VX0A 4ORIA 1HJUA 1KA9F 2V3GA 4RV3A 3W6LA 3TQVA 1DE6A 1BF6A 4HOZA 1WOBA 1H3GA 3HPZA 3WCZA 5C2XA 3MBFA 3GXDA 1NH6A 4F2BA 1B54A 4H9XA 3NTYA 9XIMA 1V6VA 1J93A 5FACA 3MMDA 2W66A 2PLCA 5CPLA 3HGRA 3LQLA 4YN5A 4QAWA 2KAUC 5HQMA 5F2LA 3EKZA 3NAVA 3ITLA 4YVPA 5ABHA 1FWWA 1Q7MA 1QUMA 1ISZA 2NQLA 4S3AA 1RY8A 3NA8A 2F38A 4PCNA 1V0MA 2EG7A 4KERA 4UTJA 2OKOA 3AXKA 3IJ8A 1DOSA 4DWSC 2HSAA 3HG3A 3EXTA 5DEZA 3MA8A 3N12A 1J10A 1R3VA 3BARA 3OYXA 9RUBA 2OWXA 2ZC1A 1T8QA 2XG9A 3W01A 5D2TA 4LC8A 4M1RA 3QR3A 1YQ2A 2IKJA 1I0DA 2YDAA 4RL3A 3ZT7A 4ACZA 2X1TA 2PDYA 4DI8A 4Z1DA 3WBXA 5AHEA 1JPIA 5LXXA 1Y5XA 3QQ0A 4XD4A 3POHA 5C2CA 2TODA 1JCNA 2D69A 4NAEA 1ECQA 4FLQA 3WN6A 1N8WA 4JGDA 3HN3A 2QDDA 3E0IA 3V18A 3H24A 2Z0IA 1DHPA 4I5XA 1JUBA 3NL6A 4ML4A 3MCOA 1XXXA 5DO8A 1JCLA 4LUSA 4Y9PA 1U1UA 2EGZA 4O4VA 1UD2A 4PMQA 3KAOA 3NVDA 3UG8A 4UTKA 2VVSA 3EX6A 2BS9A 2Z7GA 1XGZA 4UNKA 3LV5A 1XRTA 3BJSA 3CS2A 1JCXA 3VMOA 5DT5A 2WVTA 1ZFJA 1D9EA 1EB3A 2VC9A 2V5DA 3LCIA 4GQGA 7TIMA 2PBOA 2XFFA 2VVNA 2W27A 4H04A 4PB4A 5I3HA 4TO8A 3T2OA 4TVDA 3CQIA 3LX9A 2G37A 1F07A 2VMFA 1W2PA 3HPAA 1E43A 1PBGA 3TWBA 5BWFA 5A6BA 1NP0A 1KM3A 4Q8WA 1K8XA 1RCXB 4XZLX 3UXLA 2VFGA 2C16A 3N2TA 1XGEA 3TTOA 1SZRA 2J7EA 5JU6A 5EYWA 3VUPA 3GSMA 1XLKA 2FZBA 1QNPA 1J4EA 4HYWA 2C0HA 3QYSA 4B9YA 1ZBKA 4AYGA 1BYCA 1JCYA 1OCQA 2JEPA 4WY0A 1YDOA 5EMLA 4DYKA 4HKPA 3ZFHA 1V6YA 3CPGA 3MQTA 3CL8A 2C14A 3IJ9A 3NO1A 1KXTA 2FYMA 4HVXA 2DVXA 3N4EA 3EXSA 4Q4SA 1WUEA 1F4AA 1IZCA 3TH6A 4CQ8A 2WMKA 1W9VA 1GQJA 3BH4A 3EWUA 5HAOA 1A5CA 4JDYA 3G6MA 1VBHA 4LVBA 3CPUA 5BMXA 2HV5A 4AD3A 3SUTA 3H2MA 3V5CA 1UWRA 4GY1A 3AHTA 2WANA 1DWGM 2J66A 1K9FA 2PMQA 1BLIA 1PTGA 2FKPA 4CQDA 1RK6A 5LGXA 2DIKA 3A22A 2WNNA 5CKSA 4A3HA 2FZ9A 3PJWA 4CNOA 4PMNA 1IHIA 1DJGA 3GKAA 1B31A 3CPRA 3ZWSA 1FCVA 3QPYA 3VC5A 4GJIA 3R10A 1ONXA 2HQAA 1XC4A 1YXCA 3A4JA 1UP0A 6XIAA 1HKKA 3L5MA 2BY3A 4YL2A 1XIBA 3TYZA 1GKPA 3PBGA 4O19A 4G9PA 2H90A 1ZALA 3PJTA 1VEOA 3QVQA 3CZJA 1VYRA 4CNUA 3KXQA 1SO3A 2VGBA 3M5ZA 1C8XA 1UQZA 1OB0A 3DG6A 1BFNA 3PUEA 4TQTA 4NXSA 4H9TA 4UTMA 4TTGA 3WD3A 4FX8A 1H7XA 2OG9A 3GXPA 4QR6A 2J7HA 5MKGB 3UA3A 1P6WA 1MNZA 4NI8A 5GNYA 1W1B1 3GFYA 5LA2A 1L6SA 1S5NA 1MEWA 3IEBA 1UKSA 2E9LA 2PGEA 5CCZA 3ZQ9A 2D0GA 1DJWA 1H7PA 3GR7A 1TR1A 4L1WA 3TC3A 1M9HA 5KTLA 4EXBA 3SUSA 4NL1A 1JYVA 3TA6A 4ZMGA 4HBKA 3NURA 1W1A1 2PDXA 1UG6A 2EHHA 2VJXA 1CENA 4KIRA 4Y2WA 4N4PA 1UUQA 2J8FA 2QHAA 2G3JA 1EH9A 1W6TA 4CLMA 1RK5A 1RZMA 1I4NA 1V8EA 3PWAA 2VZUA 5F1UA 2QV4A 3SCVA 4PTVA 1R3YA 3U57A 1ZBVA 2GDUA 1MW2A 1VHCA 3GH4A 4PMDA 4F9JA 4H7VA 1YNPA 4GUJA 3HU7A 1I2NA 5AY7A 3TOYA 4C60A 2XN1A 4EACA 1OGSA 3LCHA 1V93A 4AF0B 1PB0A 1S46A 2V2CA 4KEVA 3GRIA 3KS5A 1O1ZA 2CWNA 4B2DD 4HTBA 5HMDA 4DY1A 1XGDA 1FWIC 1EKOA 1XG3A 4JZ5A 4ADTA 1JRCA 2NVAA 2V3DA 5LGZA 2INFA 4O14A 3NQ2A 1GKQA 2CESA 3EPNA 2V5CA 1IEWA 3TW6A 4JX4A 5EGRA 1DJZA 4ZGYA 4IMDA 1JPMA 5C6MA 2G3FA 3FDGA 1W9DM 1VHNA 4RNHA 2H6RA 1LTDA 3DUGA 2OZTA 1EOMA 1K03A 1IWPA 1XP3A 2DSUA 4HPNA 4O17A 3HJZA 1JJKA 1NDZA 3AC0A 3FVDA 2OCZA 1C3FA 1UROA 3VE7A 2REQB 2V3EA 1WUFA 3GNPA 2ZUMA 1G6CA 3N11A 1E55A 3VYLA 3WD2A 3LZ3A 5JBFA 4MADA 1RV8A 3U2ZA 4AZBA 1X6UA 3C2VA 1MQPA 3K46A 4Y90A 2KZHA 4R3UA 2WPBA 4QDWA 1QBAA 3TZFA 2D3NA 4JY8A 3ZLGA 2UV8G 1HKWA 2J79A 4JBRA 1LLOA 3B8VA 2BHZA 4Q22A 1EGMA 2YFOA 4C7DA 3ZT6A 3IJLA 4NKCA 1ZAHA 4W4QA 3GXFA 1FRBA 2PLMA 3R5EA 2NX9A 2YXGA 3VOCA 2GVYA 4MPKA 2Z1VA 1XLLA 4B4FA 4GABA 5CG0A 1CXHA 4WJ8A 4DVOA 1BKHA 1OFQA 3DKJA 1XDLA 4U2ZA 4CCEA 4NP7A 2IW0A 2Y70A 4MOZA 1TWDA 4U2YA 1FFQA 2EO7A 3L2MA 2F8QA 3LXCA 4PMYA 3S1WA 1PX3A 1HVXA 1I2PA 4ZCWA 1ZB5A 3OIXA 1QK2A 3OGSA 2PTXA 1FBAA 5AECA 2WC3A 2AAMA 2I5IA 3TP4A 5HUOA 3R43A 4KGLA 5HJXA 3CUFA 1O5QA 4K2SA 2WWDA 4H6KA 3W7QA 2DT1A 1TR9A 3S6OA 4AZCB 3HO8A 1S39A 2FPVA 1W56A 4DJDD 4PUNA 1YNQA 2JFEX 5LZLA 1FY6A 4DB7A 2OQLA 2QJGA 3K1DA 4A8NA 1US0A 1HZYA 1WKYA 3RF9A 4RNJA 3W1PA 3WX7A 2XIQA 3WZ0E 1PKLA 4CQBA 2YKKA 1KLYA 4Y9AA 1W3NA 5FI8A 2E5BA 4YYFA 1KFKA 1I2QA 5A95A 2A6NA 3F4NA 1B3WA 1DJXA 3QMTA 4U3AA 1A0CA 2H3BA 5AZ1A 2V3FA 5CAHA 1TVNA 4Q8PA 4FIQA 4JYEA 1B4KA 3R25A 3LSBA 5A2BA 4J27A 3VDCA 2BVDA 2VO5A 3S2LA 4WK9A 1HIZA 2V81A 5AHIA 1TKKA 5I3DA 1RQBA 4WSKA 5L6UA 2QUNA 2DV0A 3II1A 2V5JA 3IJIA 4GISA 4INFA 4ZE4A 4TVUA 3QBUA 2C1IA 2P1FA 3NQCA 2QUUA 4D72A 5FCZA 1ZLPA 1PO9A 5J8LA 2HPIA 3KVMA 2E25A 3PBUA 1JDAA 3HBLA 3RX2A 3GX9A 3OG2A 3WY1A 3K4DA 3MO4A 3WL0A 4C6LA 1LOQA 3CMJA 1JNEA 5AB3A 3L0KA 5JBDA 4M81A 1A5LC 3P5ZA 1GVRA 3EX3A 3V0UA 4DJEC 3TU9A 5U7SA 2CXGA 4JXCA 3GS6A 5D8WA 5KZ6A 1DKWA 4GIYA 1V6XA 4UFLA 3DBPA 2ZOXA 3H21A 3LRLA 4WQ6A 4J28A 2PWHA 3I6EA 1UR9A 3H70A 1ITUA 1N55A 1YTKA 4ZXOA 2D3LA 5GQBA 4P7RA 3ICJA 3UQNA 4DZIA 3BJTA 4LV9A 5I5RA 1G4PA 3NO3A 2OEKA 2FIQA 2AL2A 1TPWA 4CU8A 1SMDA 4XAYA 2J7DA 3BV7A 2GWNA 4PMVA 1PKMA 3P0WA 1JR1A 1J9YA 4Z2KA 4CQAA 2FJKA 2YA2A 3DFQA 1TWZA 1L9WA 1VEMA 3GG8A 2VEPA 4V15A 1KM2A 4ZQNA 4ACZB 3W71A 5LXEA 5E6YA 3C0QA 3IWPA 4A3QA 3CV2A 3LBOA 2OLSA 3IVUA 1JDEA 1G67A 1HKMA 3S47A 3TXZA 3MYPA 2CIPA 4NAEB 1NDYA 1ADSA 3KCJA 4PUJA 2DT2A 1E6XM 2XIBA 4O54A 3ABRA 4KEMA 4DN1A 1RD5A 3U5UA 1V4YA 1PV8A 3GXTA 4WRHA 2DIEA 4LUSB 1W9BM 3CBWA 3EA2A 1R9YA 3QM3A 2XH7A 1ZSXA 3FYYA 1ONWA 4RW3A 4EIVA 4OT7A 3B8WA 4S3EA 1KKOA 2PF0A 4WKFA 1QO5A 3O2LA 3CAWA 4Q4OA 1PUDA 2ADAA 4GA8A 1ESWA 1ZPTA 1TV4A 3LXAA 1LORA 4OOZA 3W7MA 1W32A 5AYXA 5HWNA 1YTDA 3E12A 4M6PA 2XIOA 3B8DA 3GG0A 1E1CA 4M3PA 1GVFA 4IQJA 4IGSA 1YRRA 1NDVA 3S9YA 1ODZA 3KUMA 4ZXLA 4HP5A 3VGEA 4DPPA 5HPOA 3UNTA 4O15A 1SMAA 4AD1A 3CWHA 1VBJA 2X7WA 2J6XA 3VKBA 3UEQA 1CDGA 3PZQA 1AG1O 3T6CA 4ZZ9A 3EYPA 2V9DA 3FYOA 4JQ2A 3CV6A 1OEPA 4HYRA 4A2SA 1F5ZA 3EKGA 4B16A 4HU8A 4ATLA 1A3WA 3EDJA 1AW1A 2DJXA 2VCAA 1MFVA 3IJDA 3PWGA 3PZ9A 4AFYA 3LM7A 3W3OA 2DQWA 4IF2A 4TXEA 5JMUA 3W6MA 4AMAA 1B57A 1B30A 3KVJA 2PC4A 4PMOA 3QQWA 2FVMA 3N18A 3L2LA 4LTSA 1LL4A 2W67A 2BG5A 2DZTA 1QASA 3OA3A 4UR8A 1P0EA 3TDFA 2WNZA 4V1XA 2WCGA 4BZYA 4G7EA 3URAA 1S5TA 5J5RA 1GG1A 2O7QA 4N9BA 5K2ZA 1XLHA 1G01A 2OYMA 4HPXA 3WFLA 4JPGA 1O1HA 5BRBA 4DHGA 1CBGA 3QY6A 3PR2A 4CD7A 3AZRA 2PZNA 1YLVA 1Z89A 1UBPC 4NI3A 1JZ5A 5DXYA 4F8XA 1D3HA 2PGWA 2AOSA 4F9DA 2E67A 1OZMA 4H41A 5TAOA 3GXNA 4QISA 2VM8A 2PWGA 3GHSA 2G0WA 3WQWA 1K1DA 2PTWA 3NM3A 1E4MM 1OX4A 5D4YA 1J01A 2CLIA 2ZXBA 3Q4DA 3EOOA 1R2RA 4W88A 3UWQA 5ABTA 4PA8A 3T8LA 2QJHA 2DQXA 2PDHA 2A7RA 2E6AA 5MHBA 3V0TA 3RPMA 2GVEA 2PP1A 3BDKA 3IARA 1NIUA 1WAUA 4QQ3A 2VFDA 3GVGA 4QIUA 1WZLA 4GI9A 5D2WA 4F79A 4HA4A 1UC5A 5FJIA 3VD5A 3TYDA 4H9YA 1DIKA 4IIBA 1DP0A 4QITA 3VNMA 3BLKA 3VTRA 3M7SA 1G1YA 1R7OA 2EEXA 1EDTA 2Q71A 3ABOA 2JKEA 4UBPC 2A3AA 3B0PA 4JTGA 4JIEA 4M24A 4DNHA 4MUZA 5GNXA 1KGUA 1TCMA 1S2CA 3HPFA 4M6VA 3WQ8A 5HXMA 1HJSA 4YWIA 4HHPA 1JUEA 2WVSA 1W2VA 3U2EA 3RMEA 3QGVA 4CNNA 1S5WA 2C15A 5H91A 2VZSA 1AH0A 2DJLA 1YKWA 4A21A 2H8XA 2QF7A 4L80A 5F2GA 3SDOA 4E8CA 3MUAA 2J27A 1EC7A 3GH7A 5EKYA 5EL1A 3QKZA 5TNVA 4RPPA 2UY2A 4A22A 2W3ZA 1TIMA 3DESA 3AWNA 1A5SA 1VD6A 3LENA 1WBJA 3BCJA 4MJZA 3DCPA 2BFGA 5CZTA 1N8IA 1DWFM 3UNDA 1PTDA 4DM1A 4ERAA 3IIVA 3CHFA 5CBBA 4Z1CA 1J0KA 4RZ6A 1EWEA 3CB8A 3ANVA 1FA2A 4B5TA 5SWUA 1P5BA 3P7YA 1J5TA 2PDBA 4NNCA 3BWWA 3CQJA 4CEUC 1Y5WA 3NR0A 3W23A 1R6WA 1X8CA 4AQLA 2PSNA 1K70A 1SZNA 2VZVA 1K8CA 3E02A 4RKAA 4DO5A 3C56A 3PB0A 1NFGA 1BPLB 2VXNA 4GD0A 3AMGA 1GHRA 2PWEA 3ZVHA 3M16A 5CSRA 3AYSA 4HNVA 8RUCA 3E1F1 4KT2A 1LF1A 1J6PA 4ZENA 1OFRA 3M1ZA 4ZOBA 1AMKA 3IIZA 1AMYA 3LPFA 3URBA 4LS2A 2WVVA 3PBVA 4LANA 3M0YA 1Q6DA 2OQYA 3E49A 1OCBA 4HPJA 3EAUA 4DUOA 1GJPA 2Z1KA 1FH9A 2NQ5A 4AIBA 2ZWZA 5FAJA 3I68A 1YXYA 1TJ0A 3EDEA 4ZO7A 4GNVA 5HULA 4E3VA 2CLKA 3Q37A 3BQ6A 4ZSTA 4U31A 3RR1A 3STEA 5I77A 1J0HA 5M3WA 4BQ5A 1ITQA 4HHMA 4Y9NA 1DPMA 2POTA 3N4FA 6ALDA 3CH0A 3CAKA 3WDPP 2RFGA 2XU2A 3DFTA 3N2MA 4TX9A 2WZMA 3V4BA 1A53A 1MFUA 2OVLA 1CTNA 4CD8A 4NIRA 2J4GA 2QMKA 1DWAM 4RE2A 5HQEA 2Y7FA 1AJ0A 3ZLHA 2GSHA 1KQYA 3FLUA 3EWDA 3VD3A 4AVOA 3NWRA 4WUIA 4GXWA 4FXJA 1KTBA 3T0CA 3HGJA 4IM4A 2BVTA 2YL5A 4NZFA 3GR4A 5LNVA 1XW8A 3PS7A 4F2TA 2DZWA 4P8WA 3WEMA 1IR2A 1PDYA 2VGGA 1MI3A 1QCWA 1NDWA 2W6RA 2NV9A 1MXDA 3GVQA 1RQHA 3N3MA 1UR0A 2PF8A 2GSEA 1M68A 2BP1A 1E71M 4W9TA 4KCWA 3O0KA 3ZJKA 1XYCA 1H4PA 5BXPA 1GOIA 4WXZA 3A13A 4RR4A 3TQ0A 2VEIA 1PL9A 7ODCA 3BAIA 3NM1A 3NQ7A 4XWUA 4L4OA 1H50A 4U5IA 3L66A 2EPLX 3RM8A 2C7FA 1YTEA 4DUWA 4Q7NA 3WMCA 5IOBA 2NX1A 1S5MA 3GW3A 1E6NA 3WL1A 1R38A 3NXLA 1XF0A 2H9AA 1Q4WA 4AAJA 4UFHA 4Z1BA 4U33A 5B7YA 1S38A 5D05A 2NSOA 1GVSA 1FX6A 9XIAA 2ANUA 3A9BA 4ES4A 1JG9A 2GGEA 3VDGA 3WLPA 4W93A 5DCBA 4KBXA 3CL7A 1U2YA 1VKFA 1WDPA 1BWKA 2XH0A 4A8RA 4R7WA 3ZMRA 4DWSD 4PRTA 3PAJA 3T44A 4JCMA 4LY8A 4E2VA 1V03A 1DXEA 3WLRA 4FI4A 1XD0A 5XIAA 2VCBA 4IGMA 4WZHA 5DT7A 3IJ7A 4Q8QA 3BLEA 2PLJA 4GI4A 4MAVA 5DANA 3VCCA 3KRUA 3WFZA 2WZHA 3VD7A 3ZM8A 3BG9A 1QVBA 5G4EA 2OZ3A 4V33A 1Z48A 3BLIA 1EEXA 4IXXA 3TQPA 2BMBA 1Z42A 1BSLA 1CGYA 2CNCA 2YR1A 1NWUA 3SI9A 5AZ0A 1MZRA 2Z1WA 1KM4A 4POCA 4CCCA 2ZUUA 2Q8LA 1SW0A 1NOWA 3FA3A 2WSKA 3I4EA 4H2CA 2XVNA 3LPOA 1GONA 3M0ZA 3QGAC 5T8GA 3NDZA 3WF0A 1ICQA 4UZUA 2ZUSA 4UWMA 2BLEA 2X40A 1PIGA 2A79A 4O1AA 5AC5A 2AL2B 1XKJA 2WKGA 2BV9A 3QN3A 3PM6A 3VILA 4AEFA 1SZFA 2GDVA 2VGIA 4KRUA 4UTHA 2R1MA 2ZA1A 3KBNA 3HGOA 3EDFA 5H2ZA 2F84A 2I1OA 1CXLA 1JF6A 1XYZA 5TIMA 3FA4A 3AQUA 4WGHA 4IMAA 1TPVA 1GW1A 2V69A 4XV0A 1POJA 4Q3MA 3M64A 2EJ1A 2NUYA 4KKXA 1QI5A 2FZNA 2QF8A 3STCA 3N19B 4KWUA 3VVGA 1W0MA 3KBMA 4ZODA 2XVGA 5I6SA 3AIVA 4FS9A 5CSSA 3SCRA 2CITA 5CBJA 1WDWA 5A5WA 1S1PA 3BW2A 4QDMA 1JD9A 2D1ZA 1QWGA 3A4AA 4N6EA 3CB3A 4IL0A 4QLJA 4FPSA 3CHDA 4HIBA 5C9WA 2QDGA 2QUMA 3O15A 2FQIA 3PHAA 1BGGA 4NZ3A 4FHAA 4F48A 5A1AA 3FN9A 3N6JA 3LGEA 3O6AA 3OP2A 1LBLA 5CBIA 3M5VA 1BSIA 2ZXAA 3O63A 2BHYA 2WHMA 1A5KC 3U2CA 1IYXA 1GK8A 4BQ3A 2XUCA 1BAGA 3UESA 2D2OA 4ECLA 4QHRA 3V16A 3U9IA 2YCEA 3L4WA 1TZ7A 3QR1A 3MC5A 4B5WA 2RGMA 1LYXA 4D6IA 5C9UA 1V3MA 4QQUA 3L4UA 4HJWA 1C29A 4AEEA 1IT8A 1PX8A 2PWUA 4J2MA 4S2BA 1H51A 1YE4A 3D5HA 1NAL1 4E2BA 1X96A 2QT3A 4MNMA 1KC7A 3OODA 3V1PA 5AVNA 3UY8A 3VGGA 1VH7A 2CHRA 4UXDA 2C3ZA 1KGXA 4XSMA 2OYLA 1FVPA 4PMZA 3CZEA 5K4ZA 1QFEA 2WPGA 1AQFA 4XKYA 1FUYA 1W3LA 4FIRA 4LVAA 4XIMA 1XYAA 3PF3A 1L6GA 1H61A 1MDRA 2PAJA 2ZFAA 4LAOA 4HD5A 4OIFA 4AY1A 1SUXA 5DF0A 3ZO9A 1XM3A 3CGTA 2P53A 2XVLA 3H7VA 3W37A 2ZQ0A 1QPRA 2WJZA 3R8HA 4NU7A 1NQKA 2XGZA 4C6FA 4E0CA 3SW6A 3BW4A 4JKLA 5LA0A 2WMJA 1QNRA 2Y7DA 4R9XA 1H11A 1EEPA 2VL4A 5F4SA 2G50A 4S3KA 1CWYA 1LUCA 1H1NA 4G7EB 4Q8UA 2QDHA 4NAFA 1VFOA 4A4AA 1LCOA 3W87A 1A5BA 2Y5JA 2HDJA 1NWTA 3LCWA 1VRDA 4BCEA 1VQTA 2NV1A 4R34A 3KVKA 4ORMA 2O92A 1AQHA 5REQA 4IX2A 3C0SA 4R7OA 4XZBA 1EF2A 3MUY1 1XLGA 3D46A 5HNNA 5AYYA 4WIWA 1B4EA 5EB8A 1VZWA 2G4JA 4GX9A 3GNNA 1ZJAA 8CGTA 1HX0A 3RLGA 5EBUA 4K8GA 1R8LA 1WBHA 1VBRA 3U7BA 5D9MA 1ISVA 4L56A 1FCUA 1TWWA 2WV8A 1NJJA 2CEQA 2PPGA 4OUEA 2DDXA 1SFJA 1MXSA 1F9CA 2Z1SA 4CCDA 3AYTA 3B8TA 5D9OA 1QNSA 1TVPA 3W85A 4X9SA 4MFDA 4N7QA 4GGHA 1JXJA 1MEIA 5EFFA 5HR7A 2XJ7A 1DEDA 1LG1A 1QI3A 4JTHA 3PAOA 3OBAA 5EMJA 3P84A 1W91A 3KBWA 3B8SA 3QGKC 5AHNA 4IIFA 2BOEX 1JZ7A 1ME7A 3P14A 4WX2A 1NU5A 2AQOA 1AODA 1ELSA 2QCNA 3NDOA 1E15A 2QAFA 4DBDA 1KD0A 3P60A 4R33A 2C0AA 4ZBCA 5A8OA 3E0VA 5EU9A 4CUCA 3RYSA 2HVOA 5EMUA 3SRDA 4UFKA 2CBUA 3DU0A 5CLTA 1TV5A 2A5HA 3W1TA 4J3TA 4QLKA 4E4FA 3HURA 1L8PA 1XLFA 4JIHA 5GVJA 1R5YA 1TWIA 2GGHA 2GJNA 1LWJA 1OCNA 1CCWB 3W7RA 4HSHA 4JIRA 1EYEA 1M7JA 1OF8A 4LT9A 3CIWA 2X0HA 2Z1XA 4P8VA 1TPDA 3URQA 4AC7C 2WNQA 4FNSA 4JEQA 4W86A 3G22A 5GNZA 2WKJA 3KE0A 2CLOA 1W1YA 4AISA 1RCQA 3ISIX 2WZTA 3NL3A 4MKVA 3F03K 4LQ1A 3N34A 5IDZA 3CL6A 3BSHA 4RX0A 1FWDC 1KM6A 1EA9C 4IP7A 3QEZA 1K9DA 2GJPA 4C5YA 1VC4A 5IDIA 3SFWA 3SY8A 2F61A 1UR2A 1V7AA 1GYLA 3PFRA 3SJ3A 3QY7A 3KHDA 3RLHA 1XJBA 1E0XA 1FWRA 1S2TA 5CSYA 3GDLA 2V2HA 4CN6A 2VC7A 5D2YA 2J77A 2NQ9A 2GGJA 3BGAA 3GDTA 2WMHA 2QGYA 3HV9A 3NZ1A 5DQPA 1L6YA 2B7NA 2W4XA 4NX0A 4X63A 1E9LA 2WSQA 3A47A 1VFFA 1ZJBA 1PZ1A 3NDYA 1TTJA 4PCFA 3WH7A 4QG6A 4O18A 2ESCA 1AW2A 1F05A 2WVVB 5FKYA 4MDOA 1ITXA 2MANA 3RG6A 1KBKA 4MNJA 3OHIA 4J7RA 3GIPA 3A24A 2J62A 2X0YA 1DORA 1KCLA 1W3KA 2FH8A 3IUDA 1R3RA 3B05A 2XFRA 3TJXA 5D09A 5AHFA 1TA3A 4M19A 3LRKA 1WDRA 1OZQA 1L2QA 4ZA0A 2D22A 3ATZA 4Z08A 4NZCA 4Y7EA 1EGVA 3GY1A 3XIMA 3TJLA 3B0VC 1T41A 2BY1A 3WQEA 3NQDA 3TMQA 5G2IA 1FH8A 3EWXA 3BOFA 4FSAA 4S3CA 4V28A 4UMAA 3FSUA 2A21A 3DHDA 3GZAA 1E51A 1H63A 1PX4A 1R3WA 4OUIA 4AZGA 2DUAA 2XSBA 3VKJA 4KGJA 5BW6A 5L9FA 2CERA 4MGGA 5HPCA 2WJDA 4GX8A 2OFJA 4RDWA 4D8AA 1HNYA 3C6CA 3QR0A 3N6HA 2X2GA 4KESA 4D6EA 1VYPX 2JGYA 3TFCA 4F40A 3GNOA 3W07A 1M65A 4J1OA 1WNOA 3MJMA 3MKKA 4UFJA 3UZZA 2D2GA 3W74A 3A3WA 3NPVA 4ZQCA 2DEPA 3G5EA 1JNDA 4V2XA 3VMNA 4W7VA 1ADOA 4PE8A 3BCFA 1YEYA 3IJ6A 1VCVA 4JL2A 2WOQA 4GCAA 2I9EA 6ENLA 4Z42C 5HNTA 2QJIA 2E1DA 5DX7A 1SW3A 3ZS4A 1XR2A 3U8GA 2O55A 2YCIX 1K6WA 2P8BA 1JULA 4DJED 4B15A 2HPMA 3CUIA 1O5KA 3CIXA 3VUSA 2PCEA 3PTQA 4MJ2A 3EEZA 3TKFA 1FHVA 4C7GA 4JFVA 8TIMA 2E8YA 5C5YA 1UJQA 1A5MC 1DVJA 2EPNA 3S2NA 6PTDA 1IXPA 1F3TA 5AKQA 3BURA 4TOQA 3QSTA 1FKXA 1KR1A 4LBRA 4WCJA 3LU2A 4LRTA 3U48A 5LNSA 1VLWA 3EWBX 2NQZA 1OABA 3EGJA 3VOJA 4MMWA 1NTHA 2I16A 5B7ZA 2R91A 3E0WA 1MRAA 3AHVA 5CXPA 1H5YA 4L7ZA 3VX1A 3FEQA 1YNYA 5CJNA 3ZYZA 4CVUA 3B9OA 3S3GA 1ISWA 4HSNA 4DJDC 5G2WA 3BMXA 3FFSA 5J5DA 1LWHA 1Y8BA 4AZ6A 4Q8VA 5HOSA 1YDVA 3KOXA 3ITVA 1J79A 4CGTA 1MQQA 5DMNA 4WGXA 5FESA 1S2UA 4GVFA 3R0UA 3PTMA 4W87A 1GOXA 4JFTA 2VZOA 1JZ8A 1P7TB 3WYZA 3DX5A 1TRIA 1U5JA 3CEPA 3Q65A 4GPNA 3F2CA 2J9YA 2W9MA 1KFEA 4IMEA 2QCHA 2E9MA 4UNIA 5EY5A 1SSGA 3SAZA 1EUNA 5TBOA 3PSWA 3ABZA 2IPGA 2YXOA 3ZIZA 1MSSA 2VOMA 3G24A 3B9DA 1UMLA 2VZTA 1O66A 1KTCA 4DWDA 1FKWA 4QXIA 1IIHA 3FGCA 2XFYA 3QHNA 1CB2A 1TB3A 3OU8A 3W81A 1WZKA 4ASTA 4C6OA 1ISYA 4GYPC 3GHTA 3WQ5A 2PC8A 5FD0A 1XIFA 2QXWA 1RXOB 1ZP4A 1UH2A 2RH9A 1PWMA 2Y1HA 3LCXA 2I9UA 3WNNA 3WNPA 4C7FA 1UOKA 2CU0A 3S5YA 3UBPC 1PS9A 1XHGA 3LA4A 3N25A 4DLMA 4DF2A 1I60A 2AGKA 3N9KA 1MRQA 3R8GA 1ODUA 3RFAA 2E5CA 1MNSA 1DTUA 2CLFA 4MJMA 1T0OA 3PN8A 1V3IA 1DJIA 4AIEA 1DHKA 1CXKA 1GZ1A 3W7LA 3ZOAA 1KBBA 4JTLA 1ZAJA 2TMDA 1BD0A 2NUWA 4CD5A 3A21A 2QUTA 4FNPA 3UR8A 1T99A 2RDUA 3AIEA 2PP0A 1EBHA 4L9ZA 5EFDA 3S42A 3ITXA 1ONEA 4HMCA 1Q3NA 5M17A 3OLIA 4LUJA 1X6LA 1SO5A 4GGBA 4KIEA 3HPSA 2YGYA 4S39A 3WJSA 2VELA 2WVUA 1EIBA 4KETA 4PMRA 3U4AA 3E5BA 1XCXA 3N15A 2CYGA 1HP4A 4O10A 4ZOCA 4YVXA 1IWAA 3W84A 5CQ1A 2UY3A 3QLLA 3PTDA 4U5KA 3LHVA 3FYPA 4UIOA 4WDXA 4AWUA 1HGYA 2VD8A 3PK7A 1UKOA 4XG1A 4L65A 4P5UA 3AISA 4EWND 2IMRA 2WK2A 2DFAA 2TAAA 3TA9A 4YPJA 3UGVA 3H2EA 4ILSA 4HTYA 4XKYB 4XUGA 2E4TA 4JNMA 5JUVA 4JTTA 1DWJM 3DXIA 1GVEA 5FEXA 1IWBA 1SSDA 4DBEA 1IEVA 4WKAA 2X1UA 1KFBA 3AU6A 2VURA 4GZ7A 1X8FA 2GQ3A 3K8KA 1CZ1A 2EPKX 1NARA 1UB3A 4IL2A 3PUOA 1PEZA 2C8NA 4FP1A 5CGQA 3W7EA 2D2HA 3WEOA 1RHCA 4AWEA 4MLJA 2VP8A 4Q4PA 4BWLA 1OCJA 3TVAA 3P3BA 1U83A 1OFBA 4XK2A 3MMTA 4J3WA 4CU6A 2ZADA 4JAWA 4FALA 3KLLA 3R4IA 1P0KA 1E6QM 2IXVA 4N0RA 2ACRA 4ADSA 3KX6A 3KLKA 3SGZA 3UP8A 1F8MA 4R88A 1MW3A 3ARZA 2X30A 4GY7A 1S2WA 4CN4A 4DBWA 1VS1A 3VAVA 1BVZA 1EUAA 2CW6A 1XQKA 3BOLA 4JEJA 2A7PA 2DORA 3INPA 3GVVA 3N29A 5K9DA 3TLLA 5E0FA 4S3DA 3VGBA 4O1BA 3BAWA 1IE7C 3TYAA 2HCVA 3LGDA 4MKSA 3W29A 3CHEA 1YYAA 4H9MA 3TSDA 3DAQA 1JYWA 3ZJ6A 4QP0A 2VDIA 4OZOA 1X97A 2WAGA 3S4TA 4BJHA 4G56A 1JF5A 3COTA 1Q6RA 1E40A 2OKTA 5ENLA 4WOQA 1W54A 3M0VA 1YIXA 4NF7A 3SUUA 4Y8FA 3KTCA 2VFEA 1N7KA 1UD8A 3OLDA 3U6WA 1Q6FA 2VDHA 3ZVIA 4R27A 1RSCA 5BROA 2Z2AA 3THUA 4LEFA 3EBVA 2P88A 5EA9A 4AB4A 2GQAA 5CAKA 3ITOA 1QI2A 5TD4A 3NEHA 1D8CA 1TTIA 2WMIA 1A5UA 2OTDA 2Y2WA 1TPUA 1ZBCA 3TYBA 1U33A 2Q8ZA 1OIFA 3DENA 3GZ3A 5JH1A 2NQJA 3UXAA 1SFSA 5A94A 3OO2A 1VPYA 1UWUA 2PI6A 3DKLA 5LA1A 3I6RA 2P0IA 1Q2SA 1RPXA 4FX7A 1RP8A 3VIKA 3FJ6A 5AYIA 4NX5A 2XGIA 1P6CA 2YDSA 4O8RA 4MPQA 4JTKA 2OSWA 3SADA 1XYMA 1AQMA 6TAAA 1SZGA 3BMVA 3POCA 2ZBTA 1I1WA 1YHTA 3GUGA 2XN0A 4AWTA 3RK8A 1QI0A 3DHPA 4NVTA 4GKLA 1W3IA 4IXHA 1D7KA 4LS0A 2HVMA 2NLIA 4D1JA 4WF7A 1P4CA 1B90A 4O52A 1X7IA 1EP3A 3WBEA 2YDQA 3R12A 1OJXA 4EF8A 4YVVA 3WK0A 3MV01 4L61A 3T2PA 1YBQA 3CLMA 5IFPA 5IRPA 1V51A 1WZMA 3CTTA 2WO5A 2XHYA 5IXEA 4KWOA 3EX4A 1WCGA 3EDDA 1QTWA 4AHOA 5T91A 1LOLA 4BA0A 1M04A 1QDSA 3T42A 4S2CA 3VZYA 4LV4A 3MDWA 4FLRA 4NRSA 1UD6A 3A23A 1ML1A 2DU2A 3THAA 2GVGA 3ZSSA 3UCQA 1SR0A 1LT7A 4XO6A 3DGBA 3B0YA 1DJHA 1O94A 2GOKA 4MM1A 1FP9A 3WKZA 3WK2A 4J35A 4KW2A 1BQGA 3BQ5A 2QVNA 4LAUA 2Q3RA 4UQAA 1UPPA 1ME8A 3TW9A 3CQ0A 2FFCA 3QW4B 4N02A 3QOMA 5BXSA 3I3BA 3TNOA 2YZ5A 3P5YA 1PIFA 1AD4A 3I10A 2R8WA 3KBJA 2PD9A 4O28A 3TTYA 2WBGA 1T7LA 1C90A 4HNTA 2VCCA 1E0UA 2RHGA 3LPPA 3IGSA 4C6MA 1FDYA 2ZVRA 4WHBA 4DXKA 2RUSA 2HBXA 3IUIA 4YCPA 5A8GA 3W7HA 3PZNA 3VFLA 1E72M 4XD6A 3L67A 1P0BA 4LPCA 2PE4A 4C65A 4QDPA 3RLVA 2YL6A 3HQ1A 3BL3A 2VQUA 3UCDA 3DC8A 7ENLA 2CHNA 2OMAA 2PWDA 4ML9A 4LXFA 1IXOA 2VRJA 3PPGA 3AI0A 2GJXA 2IKGA 4F66A 5I06A 2X09A 4LCQA 4WLCA 1ZL1A 3OEXA 1E5JA 4F3HA 4W8LA 1XFCA 1HJWA 1M6JA 3E2QA 3LHYA 3M5YA 2FDSA 2DZSA 4MIMA 3UJFA 3PC0A 1LLZA 3SGUA 3KBVA 1EXPA 3KVLA 4NQ1A 1ZNNA 2PS2A 4BR1A 5C8BB 1J2BA 2F6KA 1GPFA 3TAKA 4H6QA 4B5SA 1R3SA 2PDFA 3E3HA 3LTPA 4L6HA 3MUZ1 1F6PA 1Q8AA 3W82A 2PRHA 2JIWA 4ZQOA 3UZXA 2DIJA 3DBNA 2ZRUA 4D6CA 4R7JA 1L0PA 4EPBC 1E73M 2D24A 2VHLA 4MG4A 4NT0A 2XH2A 4JCLA 3S1XA 3P61A 3HA1A 4QS5A 3AXIA 2C19A 3W24A 4B2DA 1Q4NX 2FH6A 4NILA 1JAKA 1POKA 4B5UA 2INEA 3TTQA 3BGGA 3SCUA 4MY1A 1KB3A 3IAQA 5CZJA 1ICPA 3CJPA 4YHEA 4NJGA 3S1VA 1H2JA 3CZKA 2V30A 5XIMA 3WNKA 1TPEA 3V5OA 3O05A 1IIGA 3M6YA 3AUJA 5CJMA 2XWDA 3LGGA 3ID7A 3PJUA 2DZXA 1KFLA 2QNEA 4EPDC 2ZDRA 2VFFA 3TLQA 4H1ZA 2O7SA 4CKQA 3M41A 2PD5A 5KZDA 3M6DA 1FWFC 3DG7A 1HJXA 4PULA 3VIPA 1QXLA 1E6RA 4HCLA 4Y9OA 3LHTA 2G3MA 3CK5A 5ABGA 1HKVA 2F2KA 3KFTA 3D6NA 3HF3A 3IIPA 3TR2A 3LRMA 3QRHA 3W7KA 2EQDA 5CPMA 3VKKA 3FGCB 4MWAB 2UY5A 3JVAA 4IPNB 5IHRA 2NUXA 1SFLA 4RE4A 4NJHA 3C2OA 3THCA 4FLSA 4GO8A 3UJ2A 3IIXA 4Q4KA 1IV8A 4XAPA 2VYOA 1KV8A 4FLOA 4QNEA 4EK7A 5I2UA 1JAEA 3BK0A 1UWTA 3NO5A 4M5PA 5KMYA 4Q7IA 4FXFA 1TPH1 2BBFA 7CGTA 3GU9A 3I3DA 4H8HA 3KM8A 2NWRA 3PP7A 3QLDA 3LZ5A 3W2MA 1A5AA 3C8FA 3TTEA 1HL8A 4WD0A 1IT0A 1RP9A 1VCGA 3NUKA 1KBIA 1B3ZA 1SJAA 1CEOA 3R13A 4GQQA 3AHXA 3WMBA 4FXRA 1WE5A 3OGVA 2BGQA 3AALA 1ZCOA 2Q8XA 4DQWA 3NNTA 4BEQA 4PZVA 3PZTA 4IQLA 1OSEA 3WDHA 3S2CA 1B3VA 3VKCA 2FZDA 3GFZA 3SCSA 1SW7A 4LVFA 2RDWA 4QX4A 3VNKA 1JCTA 4B4HA 4XIAA 3PANA 1HKIA 3N2CA 3ABQA 2ZYFA 2C1GA 2CBIA 1ZGDA 3TZNA 4DJDA 3WLQA 4JTRA 2YBVA 3NZRA 3WDIA 4ZE5A 2F2HA 3STFA 2NV2A 3G8EA 4I5RA 4A35A 1VPXA 1JQXA 4MB4A 1UZ1A 1NM9A 5A8MA 1TPB1 1XC6A 5HJYA 3G1RA 3M46A 3GG7A 3W76A 3Q67A 1EJWC 5BU9A 5HATA 2HK1A 4GQBA 4MB3A 3SCWA 2YW4A 3CYVA 1W9UA 3WDRA 3QSRA 3NQAA 3L21A 5D02A 2ZZ7A 1CGWA 3SGGA 4HZ8A 2NVCA 4XVEA 2QCDA 1GOWA 2PDQA 2YXXA 1RAKA 1SJDA 2J24A 4W5UA 1R2SA 3ARWA 4G5DA 2CZDA 2XYLA 3TROA 4PTMA 5C54A 1T5AA 3B4UA 1W3JA 3H2NA 3GC5A 3C8NA 3MKCA 1XPGA 3Q94A 3HV8A 2WC7A 4QBXA 3UYCA 2QCFA 1F6KA 4IIEA 2X16A 1KWKA 4GWEA 3GXIA 4O1DA 1G5AA 1RALA 3MSYA 1G7VA 4HN8A 4DUXA 2HZGA 4DZ5A 1KWGA 2ON3A 5G5IA 3LMZA 3NXFA 1A3XA 4LEQA 1FWEC 3DEQA 2VX6A 4UFIA 1XISA 4IHCA 2CCRA 3EX1A 5DY3A 4XZWA 3L4ZA 2WSPA 3RJXA 3PJXA 4PUMA 4K1WA 5T9BG 5AHMA 3WUGA 4UTTC 3NCOA 1KW1A 4BF5A 3LBCA 2G96A 5B80A 1FWTA 3C2EA 3MZNA 4IIHA 4J3ZA 4G2DA 1B3XA 4JHOA 1XLJA 4HCHA 1H5VA 3T9PA 4DNMA 3P81A 3KS6A 3HB9A 3JRKA 3EEGA 3PB2A 3G0XA 2OPJA 4J3SA 5A8QA 1NELA 4F4RA 4PFHA 5D2VA 5CC3A 1GZJA 2WW5A 2Q09A 2MNRA 4ICNA 2WZIA 5D03A 3UR2A 4HU3A 4KMQA 3HFYA 2VX7A 5HA7A 3G1DA 3UZJA 3APYA 5BOEA 2VX5A 2Y8KA 1W1ZA 2XM1A 1UASA 4Y9MA 1F8IA 4TX6A 3LUTA 3WJYA 4O8AA 1B2YA 3GU1A 3LCFA 4IICA 1FHLA 1Q7QA 3SEPA 1OIMA 1LP6A 2JF7A 2XZ7A 3W4RA 1XDMA 1UZDA 5LIKX 3QHMA 1RUSA 1EF3A 5AHLA 4GC4A 5G1TA 3N3TA 1LRNA 3LY0A 1TELA 3G1VA 2EBNA 4YLWA 5D2XA 3GDKA 3ARSA 3LNMA 3K8LA 4I5UA 3MP3A 3WQ6A 4JKKA 6REQB 3ENLA 1CGVA 3L4XA 1EPXA 2HS8A 4EP8C 3S5ZA 4NNAA 2ISWA 3MI6A 3DIPA 4OHQA 2J75A 1ISXA 1V79A 3UZYA 3IS4A 5M03A 3ARXA 4D2JA 2V67A 1EQPA 3WH6A 4IISA 2VEMA 1OYBA 2FVKA 2WMIB 1UKQA 1RA0A 3QPEA 2C91A 3SM0A 4DF1A 2ZRZA 2GFTA 5GJNA 4X0VA 4Y6GA 1PCWA 3LK6A 1TPFA 1TFVA 1LOSA 1WAWA 1FH7A 4OBRA 2ACUA 4QGCA 4WDUA 5A2CA 4F2UA 2WC4A 4J9JA 1R2TA 4PMJA 2VEFA 2ZZ1A 4BQ2A 2XFWA 1PZ2A 3NZQA 1YDNA 1UIOA 4ZO8A 3KOYA 1LL7A 1V6TA 3P2VA 5AC8A 3TYCA 3NIYA 5E5CA 3LSCA 1EX1A 1Y0EA 2OELA 2YA1A 4M0XA 4REQB 3GYEA 4DXXA 3FX4A 1T96A 3FA5A 4H00A 1IEIA 4XAZA 1E6SM 2Z2UA 3RU6A 4FR6A 3VOGA 1BTMA 4YXGA 3K4WA 3T0TA 3ZLFA 2FGBA 3SY1A 1KRBC 4LC6A 3CZGA 2A1YA 2A7NA 2BWGA 2X1SA 1JZ3A 4E2DA 3OGRA 1PCKA 4E8GA 2ODOA 1YBQB 1XLEA 3W72A 3N6QA 4J5NA 4YTUA 3PFMA 3BGJA 4AW7A 1E4NA 3TYEA 3OZOA 3W1RA 5CC5A 2YL9A 4OV9A 1EGZA 1WOAA 8XIMA 2VEKA 1TIWA 3LG3A 1DJNA 1AJ2A 2A2IA 4YTRA 2QCGA 3SUWA 2Y62A 3TR9A 2J6VA 4JTFA 4HK6A 5BU6A 3CUXA 3PZMA 5LNUA 2AQWA 3W27A 4M6QA 5HWMA 4DX3A 3R0DA 4Z2IA 3VIIA 2UY4A 3RN6A 4P7OA 2J88A 2D23A 1UKPA 5A6SA 5LKYA 1V0KA 3MY9A 4LUTA 2OSXA 2JQXA 3PZOA 2Z4GA 4E5TA 3W1LA 5K4XA 3UWVA 1XUZA 2PDWA 3DYPA 3TN4A 2HNHA 3DFPA 4YYCA 1GQLA 1HJVA 4XAFA 3ONBA 4EAMA 2L5HA 4QAIA 3SO7A 4MVAA 1Q6EA 1XDJA 1RQEA 2WCSA 3G18A 3W1XA 2SFPA 2EPHA 3R58A 1EWDA 3HOJA 7REQA 2QEZA 4JY9A 2EXOA 1N8FA 4TV5A 1CECA 4XD3A 2WBKA 2VEGA 3BVJA 3SUVA 1UIPA 1P48A 1W37A 1J2WA 1H7RA 1XH2A 2QV5A 4K8HA 3TFXA 2R1LA 2VRKA 5F1VA 3CMGA 4K8EA 2VFHA 3IGHX 2XVPA 4ZOEA 1NY1A 2XWEA 1JIBA 3GDBA 3GXMA 5I3JA 4M82A 3G1HA 5HWJA 4FA3A 1KO0A 2E6YA 3UF9A 4E6MA 2EG8A 3L0GA 1M5WA 2QCLA 1KCZA 1M41A 3HG5A 5FSEC 3UPMA 1QNVA 3RO8A 2WHJA 3C2RA 3CWNA 3PPFA 4IQDA 1KFWA 4DRSA 4DJFD 1OT1A 1D3GA 3UG5A 2RGLA 5BWAA 5A6AA 3S6DA 2G95A 1IGSA 4JD4A 5CJ5A 4QLLA 1KLZA 4FXSA 1ZENA 3BLLA 3TN6A 2AMGA 2VR4A 3C61A 4Z2JA 3UG3A 1GVOA 1LL6A 4A29A 2UZ9A 3N14A 3MWAA 3KCOA 2QKFA 4DEFA 3R7MA 2DZPA 3A3XA 2G4FA 3LI1A 3NEVA 3TC7A 4PUDA 1ECEA 3FV9A 5E0KA 1YE6A 1VFUA 4IUOA 2ZTJA 3EWYA 2WSYA 3L9CA 3TJ4A 2HMCA 3A12A 1KRMA 1TTPA 3QTGA 3AZSA 3YPIA 3GQYA 3AO0A 5DRIA 1REQB 1X38A 4ICCX 3G3MA 3VOFA 3A4WA 1ZZMA 4DZHA 3ZWTA 2EF9A 4IPJA 3GDMA 3KBSA 3BSGA 1OGBA 1KFCA 3B8IA 3BXWA 4AD2A 3VCRA 3LERA 4UR7A 5KITA 1KFJA 3QTPA 3PY2A 4WSHA 3LN3A 4C1LA 5G4WA 4LAZA 2CBJA 3IIOA 5ECVA 2C1HA 5LIUX 2YYTA 4FF5A 4GJ1A 4X60A 2PP3A 3G1FA 1WQ5A 1W1IE 3PNZA 3SSJA 1TV8A 3KL0A 2W61A 4LBSA 3TYUA 4XBKA 3MWCA 3CWOX 5MKGA 4N6FA 4JNZA 4EOUA 3WLNA 1WXYA 3DECA 3VU2A 4O0KA 1HFBA 3PPCA 3UZ5A 1T6MA 3VOHA 3K30A 2O56A 4AYSA 5BOFA 1C8YA 3SCQA 3ARRA 3BO9A 1MDLA 2R1PA 2EKCA 3O6YX 4JQAA 2JIEA 1ZP3A 1FHDA 4X61A 3UG4A 1CXEA 1H7NA 3UXDA 4BI7A 2BTMA 4JFSA 3KEHA 1UWQA 1GT8A 1FQ0A 5FF3A 4WR3A 3IV3A 3IVSA 3SSZA 1IZKA 5CPQA 1KXVA 2Y63A 5I79A 2DT0A 2OGJA 1TJPA 2A6LA 1QW7A 2CWXA 1EP1A 4HNNA 4U10A 1B3YA 1BG9A 3UWYA 5I78A 2ABAA 1TV3A 1NEYA 1CIUA 1I2RA 1A3HA 5DRCA 3L0NA 4J3UA 3FAXA 5F2MA 3RM4A 4MUPA 2YBTA 3VINA 2BASA 5HMFA 4IIDA 3NSNA 4HMEA 1HTIA 4F0MA 2AKZA 4UCFA 4B92A 5C0QA 3HG2A 2WYSA 3F4CA 1EBGA 1JRBA 1HXJA 4KPLA 3SQSA 3O9NA 3WNOA 2R1NA 1JXKA 1BXBA 3FOKA 4KWSA 2O4QA 1GEHA 4UQ9A 4I7WA 4F0SA 2WLZA 5BCAA 4JTJA 4JOMA 1CYGA 5FJUA 1VJZA 3FNDA 4W85A 1XLIA 2HS6A 1L6FA 4Z2LA 1VAHA 3WNLA 4QROA 2OSYA 3BLPX 5D37A 1A5NC 3D3AA 4G8TA 4FAMA 2YW3A 5FJPA 4FNTA 4HHHA 3HIJA 3MUXA 4Z17A 3ZJ8A 2E7FA 3MUIA 1G4TA 4ENLA 3BLFA 2ZVIA 4J40A 2B0MA 4TMBA 4M8UA 3W70A 3B0XA 2YCLA 4DLFA 3AAMA 1JZ4A 2ZUNA 2Y61A 4KCUA 1F4HA 2CFFA 2QCDB 3LTYA 1W1PA 3H2OA 1J0YA 3DFHA 1QW8A 1TVLA 4MWAD 5J04A 2ZX8A 3RCNA 4YCOA 3QFEA 3MMWA 2VKZG 4XSLA 3LD5A 1UPMB 4WY0B 1LM1A 3MHFA 1UYQA 4AHPA 2PBGA 3GB6A 4GLEA 1WKFA 1VENA 2ZIDA 2V0TA 3CMFA 4DWSA 3CAQA 3DFOA 1VFTA 3GG1A 3JS3A 3SRFA 3PZIA 4ZB0A 3TQKA 1R86A 4GK8A 1VCFA 4BQ4A 3UERA 4AZ5A 1V5XA 1YXDA 2ZA2A 5DBTA 2E5DA 1F76A 2ZZ3A 2V2DA 4KH2A 2VTFA 3F4DA 3W1AA 3KDNA 4RNIA 4IGNA 3ARQA 1WDDA 1UP3A 1NP2A 1H7OA 1O95A 3NYZA 2MUCA 3FS2A 3VNLA 2Y7EA 4PCTA 3C0LA 1JI2A 1KV5A 4LCRA 3QYQA 3I7QA 2HROA 1XBYA 1SO6A 3PBYA 3UJSA 2A3LA 1HGWA 1E5NA 3C3NA 2TYSA 2PDJA 2ICSA 3CH9A 4P7LA 2ZX7A 3NQBA 3UWUA 4E8DA 1CX9A 1Y5VA 1RLDA 3ME3A 4PH6A 4AZCA 2PDLA 4C6DA 3RR4A 4UC5A 3QY8A 2XINA 3AMKA 4RUBA 3KOZA 1DQXA 3OPSA 3QQ1A 3FXGA 1H7WA 1BYAA 3G8RA 1WV2A 5LIYX 4KFPA 3W7PA 5DCDA 2YA0A 1IEXA 1UD3A 1UD5A 2GQ9A 4OV4A 4FNUA 3L4YA 1YPIA 4LY4A 2OWWA 4LW7A 5BXRA 2HJPA 4YNGA 1JVNA 3ZR6A 4ERIA 3A3HA 5E9AA 1EP2A 4B5NA 1RVGA 4CEXC 2IKHA 2E68A 4RXFA 2DZAA 3MUCA 3DYOA 1Y65A 3L4TA 4TUFA 5HANA 3FEMA 1E6PA 4JN7A 1EL3A 3W2LA 2NX3A 1RPKA 4GBUA 5BMWA 3FDKA 1TJ2A 1MW0A 1B9ZA 1Q5MA 2DSZA 2E3ZA 3SN1A 2POZA 3GNDA 4YS1A 3GUWA 1VRXA 5E1QA 3VCNA 3V75A 1R87A 1W5MA 3E5PA 4EAYA 1Q7ZA 2IXUA 1XLAA 3BTNA 3W2KA 1QPNA 4ZQMA 4Y96A 5CGTA 1N82A 1VFMA 3WF2A 1Z44A 2DH3A 1I75A 4H8NA 3V1HA 2OEJA 1QHOA 4IX0A 3WUBA 3EPOA 1UJPA 2OWCA 3ITTA 5G1MA 1E0VA 2VENA 1P0DA 2CKSA 4HA0A 1EDQA 1HVQA 3B8UA 4UQEA 5IBXC 4ROQA 4A2RA 1CB7B 4UTTA 4UMBA 4P7NA 4GFIA 3IK2A 3QMRA 3G0UA 3PZUA 4HZ6A 4D9PA 1JCJA 4P61A 1V3JA 1M3UA 2UWFA 5A6TC 3UFYA 1X6NA 6XIMA 1IEQA 3XINA 1PXGA 1JZ2A 4GRSA 2OJPA 1E70M 4KRTA 3HFTA 3S1GA 4PUWA 2FGLA 4WEVX 1GYMA 1LLWA 4XISA 3FY1A 1HL2A 1TUFA 2AL1A 1WKDA 2PRLA 4AZ7A 3L5LA 2CC0A 1FWBC 3S2MA 4ATWA 2Y8VA 1U30A 1WPCA 3A5VA 3WLHA 2J7FA 2OU4A 4PL2A 1XH0A 3IJQA 4JX5A 3GW0A 9CGTA 1WO2A 3SB0A 1VP5A 2G41A 3WQPA 4S3FA 2GYIA 3LLDA 4QJ4B 2D0HA 5CZSA 4FO4A 3CQKA 1OFAA 1OHLA 3CIVA 4PTWA 2OX1A 3G1XA 2DH2A 1BYDA