4XAKA

Crystal structure of potent neutralizing antibody m336 in complex with mers co-v rbd
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Junctional and allele-specific residues are critical for MERS-CoV neutralization by an exceptionally potent germline-like antibody.
pubmed doi rcsb
source organism Human coronavirus emc
molecule tags Immune system
molecule keywords Spike glycoprotein
total genus 49
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09408 Spike_rec_bind Spike receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4xakA02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4xakA01
4ZPTR 2AJFE 4ZPVR 4KQZA 2GHVC 4KR0B 3D0GE 3D0IE 4QZVB 4ZS6A 3D0HE 2GHWA 5DO2A 3SCKE 3SCJE 3SCLE 4L3NA 4ZPWR 4L72B 2DD8S 3SCIE 3BGFA 4XAKA
chains in the Genus database with same CATH superfamily
4P2FA 4JP8A 3OJUA 3W4RA 4FAPA 4U86A 3HSZA 1NK8A 3N9UC 1SXLA 3EWGA 4TVAB 4RNOA 2ZZTA 4I2PA 3IO1A 4ITZA 5EN1A 2LPVA 1WI6A 4K0KF 4RUCA 1U1MA 3PFOA 1TKXA 3A8KA 3N5BA 2C2KB 3O5MA 2LYVA 4I2PB 4ZCIA 4OYOA 2F65A 2RKIA 3GCWP 2XM3A 4QIBA 1B4SA 2ZBIA 3AJ2A 4BC7A 2C2DA 1FKOB 4AUKA 1U48A 4QPXA 4K2JA 1UVLA 3AOCA 3OR1A 4DWSB 5B09A 4V19X 4YB5A 2F4VJ 1RT3B 2CJQA 5IFMA 1SUQB 4X62F 4F0HA 4QIFA 2YBTA 2GVZA 4DMZA 4ZITA 1YHQS 4M8LA 1WDDA 2OFHX 2EG1A 2UUBF 4YFUA 3MOZA 1H0HB 3BGFA 5KFSA 3ZTRA 4J9NA 3MUVP 1RWUA 2K1RB 1ROTA 1HQEB 2FLLA 4UW2A 3CGMA 1GXUA 2GHVC 4OHWA 5FDLB 4AE5A 4F4YA 4ECYA 1RAIB 2LEBA 1M1KT 1IBLJ 1IQTA 4C8LA 2YQ1A 1IWGA 3RJMB 4K8RA 2DCUB 3SDEA 1VLOA 2X1FA 1CULB 2Y9HA 4EO6A 5I98A 2RRAA 2DIUA 1ZAXA 1L5UA 4U85A 3RR8A 2DKOB 1GOIA 3O5IA 1X4BA 4ED1A 3ILLA 4NLYA 1GT8A 1FKTA 4X4NA 3M32A 1LQ9A 1YKWA 5HJYA 3J81U 4NRUA 2HHUA 4M95A 2ZH4A 4NA3A 4O3SA 3P49B 1RHQB 1TL4A 2DEJA 3PA7A 2YKAA 3PM9A 3UN5A 8AT1B 1YJNS 2X1GA 5EHHA 3T1HJ 3GONA 4ODQA 1CTNA 3FSIA 4FXVA 1B7YB 2CZ9A 2YNFA 2W1BA 3M8PB 1N32J 4F50A 1U1RA 2HW3A 2PPNA 3D6FB 2DITA 1R3NA 3PYFA 4ODRA 3QGHA 3W2WB 4EMDA 4DV3F 3L95X 2MPHA 1RTHA 4DV7J 3MMJA 4FPRA 2CNLB 1MLAA 2YNHB 2ROEA 4HBEA 5F8MA 3HHNB 1ZBTA 1LV5A 1RTHB 4WU3A 4YY3J 4A8QA 3WC0A 4NLUA 4LFCF 3TNVA 2HMIB 1ZM3A 2VG6A 3D6TB 2VD3A 4IG3A 4PWDB 3HT0A 1RCOB 1BQMA 5LSLA 1FT8A 2GVDA 2QRRA 3HDSA 1LWEB 3CCSS 1M1HA 4ELVA 2M9KA 4DSLA 4J9LA 1LKZA 4AYBD 5JH8A 1N5TA 1TV6B 1PCAA 2BBEA 2IM1A 2N4CA 1FD2A 4TYOA 2NYHA 2OSQA 3CT9A 4WE1B 3C16B 1H98A 5F8NA 3IA0A 4ZPVR 4HH1A 1KC8T 2KT3A 2ZH5A 1YJUA 9RUBA 4DRKA 1HIYA 3UW1A 4DZ6A 3NS7B 4MJKA 4WE1A 3TUZC 3H40A 4X2BA 1FKHA 3HZGA 3RRHA 4B3OA 3CO9A 3MTKA 1AA1B 4RW9A 3VAIA 2UXBJ 1OO0B 3PXGa 1H2TZ 3VQSA 2JEJA 3D4JA 5I4MA 1M5HA 3PTWA 1NKCA 1FNXH 3MPYA 4ECSA 1QAYA 5D6GA 1AYEA 4H4OB 3GYNA 5J2PA 3JTOA 3D67A 4PRFA 4KC5A 1KT1A 1D09B 4DQSA 2GIRA 2ZHAA 3KDNA 2B31A 4H4OA 3PG9A 4DX5A 1UZHA 5JJBA 4K7QA 3QRRA 1R8CA 2OPQA 1HR0F 1NHUA 2QA2A 2HWTA 3H59A 4RJVA 3TVKA 1XNQF 1N5SA 2KU7A 2EPIA 2MQPA 4DSKA 1M1GA 4JI2F 2L2SA 4CLZA 4NLRA 1TTHB 4F26A 2G1HA 4JI6F 3K59A 2BA9A 3UDCA 3DGPB 4JI7F 4LREA 2HNZA 3ILJA 3PKMA 4WKRA 2YNIA 1D9AA 2W7AA 3HKZD 3LGHA 4KPYA 1KN6A 5A8RA 5HMWA 1RT1A 4TN2A 4JI7J 2GJIA 5EDWA 2DGTA 2OP5A 1F2GA 2FJAB 2WRMA 2PD1A 2IJRA 4IOBA 5MLCV 1V6HA 4WFZA 3NGDA 1ZBCA 3T6BA 1L3TA 2H4WB 1T05A 2CPZA 1U8WA 3GFYA 3GR1A 4LF7F 1FTCA 1XNQJ 1NJXA 2MLZA 1K9TA 1JIHA 1FVQA 3IRXB 5E33A 3QATA 1RWNB 3MR3A 3LWLA 3CGNA 4M5LA 2ZM6F 1T9VA 1N48A 5E41A 4JV5F 2ZH1A 3V6DB 1NAQA 2KJWA 3O5QA 2YWHA 5K8MA 2HHSA 1NH7A 5D15A 2HZAA 1X4EA 3BEGB 4DZ3A 1MWZA 1C9HA 1RZMA 3OBIA 4M5GA 2UVUA 3ZZUA 3DLHA 4CWBA 3MEGA 3C3LA 1R31A 4CLFA 4EZ6A 1F5CA 4BDPA 1KHVA 2EFVA 3UR0A 3PHTA 3OW2R 1UCNA 1QUPA 2DVIA 3AS2A 4USJC 3KAGA 1EP4A 1LK7A 2JFKA 3PYEA 3MEGB 3HCXA 3NWRA 2M3DA 5CYQA 2ZJQQ 1L3SA 4EZ9A 1QVFR 4U7UD 3RFWA 4PPDA 3OPKA 1RTJB 5E3RA 2VL1A 2GIFA 4Z2GA 3OT9A 1EP4B 2Z2YB 1CBKA 3L7PA 5CYQB 2FIUA 4FBTA 3QAEA 1E9LA 2WOMA 1Y9OA 2Q1LA 2DYAA 1RTIB 2PDAA 3DLGB 3MEDA 3SDEB 2P4VA 1VISA 4CT9A 4YOEA 3CDBA 2ZD1B 3DU6A 4IOAQ 1X31C 3CMQA 4X4UA 2XHWA 1RQ0A 3MM7B 4JI5J 3VAGA 1X9SA 1RABB 3W60A 2AX1A 1FF2A 4K59A 1FJGF 2NZCA 1HA1A 2AJFE 2HWHA 2DH9A 2YX7A 3FZ2A 2W2OP 2B8QA 1NDLA 3ILOA 2CQ4A 2ZC3A 3N5FA 3KUEA 3PNIA 2CQIA 1T95A 2FJEB 4J9UE 3UO0A 3VVTA 1WC0A 2DPJA 1G6BA 1HD0A 2IBOA 1IKVA 2J7UA 3HT3A 1C1BA 2ALZA 2OPPA 3FQKA 2FHMA 3TC5A 2BM1A 2VF3A 5C7PA 4WIIA 3G4SS 2PFFB 2GAHC 5A8WB 2AYMA 3BPDA 3Q83A 3S1TA 4IQCA 4JFLA 2HPUA 3WHIA 3Q8RB 2YKNB 2Y3YA 1OWXA 1U2FA 1U26A 1HMVA 1F9EB 1PJ7A 1UW9A 3KLEB 1VQ7S 1U1KA 3CC7S 5G0RB 5AE2A 3OTOJ 4AL5A 1N0UA 1JCHB 1RCXB 2MZSA 2XMWA 2XZDB 2WZ1A 4C48A 1JJ2R 4C98A 4DR3F 2MKCA 1ITXA 1HI8A 2XSJA 4M5DA 4DR2F 4AQYJ 2MNTA 2AIRB 4UQGA 1R0BG 4QIEA 4DV4J 2J0QD 1KVIA 1VS3A 3ZNJ1 4Y00A 4MNLA 4ZVQB 2A2DA 1G4CA 2KT5A 1VQPS 3R1LA 2OLWA 3IR7B 3BJYA 2I38A 3NG8A 2CJBA 3PRDA 3MEKA 3MHYA 4MAKA 5DM6Q 1RISA 3ITHB 3BMBA 5IM0B 1OPIA 1FTRA 4MGVA 4J90A 3LP2B 4PWWA 4RR5A 3WZ0A 4GC6A 4DF4A 1VBYA 5KFYA 5H9EJ 3O2IA 3B6BA 3ZZYA 1RTDB 1P1LA 2XI2A 2LXFA 3NP5A 1SL2A 4GRSA 2Q79A 3LP2A 2DR7A 2Q43A 2DGSA 3OA5A 2XTJP 3AB2B 4CO0A 4J9RA 2Y8WA 4KGMA 4NLDA 1ZL1A 4QR2A 3ZNUA 1NDPA 2CA9A 5HKGA 2VASA 1NJIT 2ZHOA 3M2VB 4J5OA 3OVAA 1HJXA 2LJ4A 2G41A 1IKYB 1WJ9A 1Q0NA 2IC3A 4KY3A 4N7TA 3UR3C 4YN3B 4NLPA 5D0EA 2RU3A 2CPFA 3LF0A 1SC4B 3NBPA 1X4AA 3HSGA 2MJNA 1VIOA 3MM5A 4DI6A 1H2VZ 2B9YA 3RB3A 3H42A 5CD4H 2J8SA 5J1EA 1FKAF 4LAXA 4EWTA 2WLZA 3IM9A 5J1NA 2NSCA 4NE9C 3TWZA 1Y0HA 3RB0A 3VZIA 2JC0A 4ZVOB 2VQEJ 2CPYA 4U8YA 2OFNA 4WCEQ 1DQ9A 4Z2JA 4ECWA 1N6QA 1HBUA 1HWUA 1P8GA 2RQ4A 3OTBA 4F4AA 3QZ8A 5JVGQ 2VQFF 3LAMA 4WKFA 4USKA 2MSTA 3OSPA 5HMYA 2FVCA 3Q86A 4CQ1A 4P75A 4OX8A 1X60A 2VPYB 2HNZB 4Y2MA 4ED4A 4G1IA 3KXDA 2W9AA 3T19A 3CNQP 2PT0A 3FCHA 3GU0A 1MW7A 1NZAA 1S99A 1XWLA 2PO4A 3M8WA 3BDEA 4IH5A 3OR2A 4ZVGA 4BHQA 1IBKF 3A8IA 2VZ9A 3MEEB 2HGNA 4C8OA 1FFSB 2I8EA 4BF8A 3CJKB 3CJ8A 4GVBB 4CLYA 2W8KA 3NOGA 5JXSA 3GIIA 1RJJA 3OR2B 2KKHA 2R2UA 1ZM9A 2WLYA 1K9MT 2DHAA 2BJ8A 4WFNQ 3CDUA 3OXLA 1NPPA 4ID5A 1UFKA 4IO9Q 2A1BA 1WNOA 3X1LB 2JDJA 3AH6A 3NNAA 2AT1B 1LQ0A 1NEEA 2AMCB 2HURA 1VMBA 1RWMB 1S1WB 2VKRA 2KB2A 4ZP7A 4DPWA 1RAEB 2KRBA 1UWBB 3BREA 1JXEA 4ZPAA 3NGTA 2DB1A 4RBTA 5KFIA 4E0DA 2KZMA 1Y3KA 3P96A 1YRTA 5KFAA 2E5JA 4DUZF 3H0PA 1WC6A 1DURA 1HFEL 2UV8G 2E1AA 2ZBCA 4ED5A 1GTEA 3Q22A 3VF0B 3H5SA 4LIRA 1VQ4S 2FDNA 1U45A 2M5YA 2AP6A 1U47A 4PUOA 2MF9A 2ZZMA 2P2CB 3B9DA 2HLTA 2VDIA 1X5TA 3DRYA 4OYPA 4CZCA 5DDOC 3WD4A 3VWSA 5BR8J 3MM8B 5I3PA 3OLAA 3UCZP 3QO9A 5ETOA 4ILMA 1BD6A 4J7CA 4DR6F 2ZD1A 1GMWD 2JZVA 1FRLA 4HHJA 2K06A 3TUJC 3ZXWA 4DX7A 3MM8A 1S1XB 1JNRB 4YEAA 3H2VE 3RRKA 3PHEA 3RB4A 2EFNA 4WWSA 3PYDA 2W2NP 5HBMB 3OL7A 2CPEA 2W4PA 5F8JA 1N36J 2YKMA 4Y28C 2ZZNA 4NASA 5AXKA 1M5PC 2ZBRA 4JV2A 1S1XA 4O4GB 3UD3P 1NK0A 3TVYA 1RT3A 4UOHA 5DRKA 5ETKA 1P5QA 4ZVTB 4A46A 2PBCA 4ECXA 2AJ0A 2BR0A 4KKOA 2KZZA 3IAM9 2YWWA 1E6YA 3JQMA 3KDOA 2OPSA 4F4WA 3OQ2A 5FIIA 4TY8A 4Q8EA 4USHA 3CWJA 5L39A 1VYAA 4TU7A 1NJZA 4H54A 3H5YA 2GC8A 1KLMB 1IKXA 2CXEA 1MWYA 2LFVA 2OMOA 3KG4A 2E7XA 5FDLA 3LP1A 5H9FJ 4FN5A 1FRXA 2L9WA 2I5JB 1N56A 4M5DB 2CDRB 5BJRA 1OGBA 3GILA 4Y2KA 1FRMA 2M88A 2AHOB 3O5EA 2MZJA 3GJQB 3Q8YA 3VVUA 1EETB 2XHCA 3CD5A 5FJ4A 3ALFA 1X4HA 4BBYA 2DHHA 2V2QA 2FQQB 3B8SA 4LF6J 3ARYA 1CSJA 1QE1A 3ENWA 3T6JA 5CYJA 2QMWA 1F5AA 3R2DJ 3RW6A 4J9MA 5FLXU 3BR8A 4J9SA 1D8YA 2B4OA 3CDEA 1HWIA 2KN4A 1JXVA 1S9GB 2LXUA 3FRYA 1HWKA 4I0WA 3D66A 1E6VB 1SBRA 1PIEA 1TKZB 5ETMA 3TX8A 4A47A 4RUAA 3H5UA 5LL6d 4RNMA 3G9CA 4P71A 2KXHA 1APSA 1GNKA 2LDIA 2ZHBA 2JEGA 3T5KA 4IOCQ 3FSYA 4N56A 3IBCB 2F9JA 2L9DA 2OUGA 3RU0A 3ZTPA 3MOJB 2R7TA 1D8ZA 3ZTQA 4DR4J 5HWCA 3KMSA 5BYRA 3FKBA 3JSRA 3J80Y 4LF4J 1UTAA 2YNHA 4ECQA 4F4XA 1LL6A 3M2VA 3MCSA 3MGJA 1NUEA 1SJQA 2B7BB 2Y8YA 3O3LA 1QM9A 1WF1A 1U0HB 4DOZA 1UVJA 4PEOA 1AB8A 2HMIA 3I4HX 2CQ3A 3UCUP 2IMOA 3NCQA 2NCKL 3T5LA 1WNEA 3SQGA 1BKFA 5HW8A 1X6LA 3GTYX 1EX8A 1JJCB 3DLLQ 2A10A 2OI2A 4ZVEA 1RAFB 2IAJA 4AXIA 5E2QA 1WDTA 1D1UA 2UXDJ 2VCDA 1FERA 4ED0A 2ZH8A 3A4TA 3BF4A 2J0SD 4GKKJ 2WW4A 1JLBA 4G2PA 1CJTA 4A8SA 2UVWA 3TQ1A 1NZ8A 3OV7A 1U1NA 4OYWA 1VC6A 4HARA 4QZVB 3AS1A 2C3MA 2DPEA 3R1HA 5H9EK 2DH8A 3T9ZA 2DHGA 3CJ5A 2H65B 5K14A 3WC2A 3AQPA 4LF5J 2RDJA 1FFQA 4LQ3A 3D0GE 3UI3A 1U0SA 2Q66A 3BBCA 1GEHA 5F8IA 1BMQB 2DGWA 3K5PA 2B5JB 3R9LA 5A8KA 3BDPA 3TYTA 4DQRA 3FQLA 2C3PA 2J5AA 4ZS6A 3VHQA 3GJSB 1O6XA 3FBFA 2ZITA 5HN0A 1M0SA 2JC1A 1HNWJ 1IX5A 4WJXA 4Q0BB 3MR5A 3T3FA 2A6MA 3M30A 1FESA 1OYDA 3PX4A 1UETA 3BO2A 3VTIA 2MZTA 4W90B 3KHGA 3EGNA 3GR0A 2DNPA 3M1VB 2XG8A 2IY5B 2KE0A 2CG8A 3A8JA 4QWAA 3CCUS 1ZYQA 2HHQA 1Y00A 1Q8IA 2Z30B 1TKDA 5BYSA 4BWMA 2OMLA 3TJ8A 4DR2J 4AQYF 3LPEA 2V63A 2KYZA 3KJFB 2KT2A 4J4NA 4LSNA 3BSOA 3S6EA 1VQ8S 3DLEB 3RMEA 1I94F 2M2AA 2C2OB 3ARSA 3CCZA 5KFGA 4Q8FA 2HG4A 4NXMJ 4B3SJ 1O51A 1WUUA 2LU2A 2PC6A 3D1HA 1W2IA 1Q7LB 2KHCA 4C97A 3EM1A 4FP9A 4PXEA 2KM8C 3KJVB 4AL7A 1HNZJ 1PJ5A 1NBEB 1OYEA 1B6CA 3H2UB 3VCDA 4ZJQA 2F63A 2M8DB 3JTPA 4RW7A 1HD1A 4DCPB 2GQCA 4RW4B 2BVZA 5LJ5Y 3GJTB 3N6MA 1NH8A 1M5VC 2WSEC 3M9MB 3QBCA 3JSMB 1FAPA 3KABA 4OJ1A 5HATA 4QYZJ 2BX6A 4Z2IA 3OD2A 2MKIA 2XEXA 2HHPA 2JJ4D 3BO4A 5LXRA 2UVRA 3CPWR 1D2KA 4ES3A 1BHNA 1H38A 4O4GA 4TQRA 2AU0A 3DU5A 1TL7A 2GW8A 4LR8A 1Q6HA 2MZQA 2QV6A 4U9RA 4DRNA 2HRUA 1LOUA 4JYAJ 2UUAJ 4A8YA 2CWKA 1X0PA 1FKBA 2VG7B 4XO0A 2RUQA 2YKOA 2M4MA 2DT3A 3KUHA 1GX5A 4P8XA 3Q2SC 4IFYA 3CMAS 3Q23A 1SJFA 4W92B 2H48B 4OZ5A 2G13A 4EBDA 1F1BB 4G6VB 4B3MF 1TKTA 4NCGA 2J0WA 4YMEA 2C2RA 4JI0F 2M7SA 4DRQA 2MJUA 4MKVA 2IM0A 3T1AA 2M0GB 2C28A 3SYZA 5HLFA 3CCWA 3FMWA 4HHHA 2XYPB 4P8UA 2VJUA 4DCJB 2CQ0A 3O6QA 4KT0C 4TU9A 1JLQA 1TUGB 4DS4A 5I42A 4RU2A 3TZYA 4FF3A 4TX0A 2V67A 4F25A 4CCHA 4WXOA 3IG1A 1UJ4A 3V81B 1VQOS 4P2SA 2YNFB 4QWCA 3VAJA 2GQQA 3H98A 4KH0B 2VFTA 3RAMA 2OPPB 2DSWA 3CJ0A 4KIAA 4OI2A 4P7VA 4BWJA 5DQGA 2OPRB 1NSGA 3V81A 1U49A 4NXNF 4N41A 3DRSB 4JOUA 4NCAA 4DV2F 4AXJA 2YKNA 3EUNA 1NK5A 2JWNA 4X4QA 4IPXA 3HX9A 2PI5A 3EY6A 4XDDA 2Y1JA 2DRAA 5T7LB 3IC1A 5IOLA 5HL7Q 3CXCR 2JEIA 4IFVB 2OGUA 3LQVA 1YI2S 2YBUA 2J6UA 3KOAA 2XP3A 3AHPA 1WB0A 2Z57B 1S59A 1TU0B 1CJVB 2EKYA 1U1PA 2L48A 6FDRA 1YZ7A 5EX0A 2XO6A 3FXYA 1RWPB 2IPOB 4A8KA 2N3OA 2XS7A 4JI1F 2HVIA 1GK8A 4HBOA 1RWOB 2AW0A 1DTQB 5A0YA 2JEFA 1FX2A 1RADB 3UN3A 1S6UA 3LOUA 2XB2D 3EGZA 2ATLA 4NLOA 1P27B 2A6OA 2W2PP 3UQAA 2YWGA 4F3MA 2RUSA 1FKKA 4NMXA 4DHVA 4CLKA 1UA1A 4PQAA 2DNKA 3IWNC 2QSWA 1XR6A 2UXCF 3PR4A 3FY1A 1C1CA 4URIA 4P10A 2AZ3A 1VQSA 4KHMA 4WFBQ 2L3MA 3SCLE 1GUVA 3SEOA 3TAMA 3CJTA 3W7BA 4U6PA 3MUMP 2BQUA 3NGSA 4DWSD 4W4MA 5IWAF 2PV1A 5HJXA 2B5JA 3IMQJ 4Q7AA 3SFUA 4CLPA 3OFEA 3GQCA 2JNJA 3PV8A 1N5YA 3ENVA 3CTRA 3AOAA 3IWXA 5HVHA 1S6PB 2WTFA 2UU9J 4IR9A 3TRGA 3M9NB 1SIWB 2G2OA 1HNIB 1V3ZA 1TL1A 3HD2A 4WYWA 3HJVA 3TUIC 5C24A 4ZKAA 2A3BA 1S9EA 4I4BA 3AJDA 5RUBA 3RBEA 2DJWA 1DLOA 2BYCA 3M8ZA 2IDLA 3FJ2A 2HEKA 3LANA 4EGLA 7FD1A 4ZVSB 3EPGA 2ZKTA 2QN6B 4MTVA 3EXYA 3DMJB 2LEPA 2OO4A 3SSSA 3GV8B 1D3WA 4KHRA 4R0EA 4NLWA 3NMRA 1VC5A 3THVA 1C4CA 3AQOA 5L1LA 1SKWA 4Y2CA 5THWA 4G65A 1XC9A 3GE9A 4JI3F 1FWLA 2C2MB 3BYPA 3R3TA 4Q5VA 4EBCA 1KT0A 1XBWA 3H2LA 4OI4A 4QWDA 5D0GA 4DR7F 2XULA 3KJVA 5GAGU 2MGZB 2RUDA 2WSFC 1MMLA 3A12A 1KTVA 4OQJA 1R0AB 1S79A 2XC9A 2VFVA 2HQDA 4USTA 5KT5A 4X66F 1R8BA 4LAWA 4I67A 4GIVA 3E8OA 3H4DA 4K4ZA 4IUFA 2AJ1A 1FE4A 2HQFA 3A3PB 3LGMA 1LW0A 2V2VA 1NPKA 4O3PA 2KI2A 3LGNA 1EHWA 4JI0J 4LF1A 3KAFA 2HNDA 2IA0A 2HBRB 4JUZA 3PO5A 1RHRB 1RYRA 1HYSB 5DO2A 3KAHA 2UUAF 1S1WA 1VQYA 2XQCA 2ZR6A 1HWJA 1XTZA 2IVYA 3D54A 1J5OB 2BDPA 5GAGI 3PRAA 1ZZNA 4K4TA 3MECB 4LFAJ 4HT5A 2BKPA 1W9UA 1VQ5S 3IRWP 4KGVB 3VAHA 1AUSL 4NI2B 4B9SA 4DH0A 1J5OA 1FXLA 2M8HA 3BGLA 4CNYA 4GKKF 2P9EA 2QA4G 4DSJA 2HZCA 1O0PA 4DRIA 3TP2A 3CCTA 3CUNA 4DL6A 3M7VA 1QSLA 4OI0A 4WKAA 1D0EA 1HKAA 1X5OA 2K2PA 2RIJA 2VH7A 3KK1A 2VPZB 1UFWA 2LA6A 1SH2A 1U4BA 4LF9F 4IRDA 3HP6A 1TKTB 1YBTA 3KUGA 1WTFA 4NCGB 4OX6A 2H5IB 3B82A 5D0RA 1PJ6A 1RBAA 5KFVA 2EWHA 4ZLPA 5C25A 3KK1B 4DV5J 1U02A 4DL3A 5DGAA 2ASLA 1E6RA 2AOSA 1RTIA 3DLGA 4V1Ak 3VQTA 4K4VA 1WHWA 2JLGA 4FNHA 2YKMB 1W1VA 1U6ZA 2ZVIA 2CNNB 2A3CA 2KVIA 2DT2A 3HD1A 2CRLA 2VN1A 3I6PA 3KWMA 3O5DA 1K1SA 2O1PA 3BGRA 3JQKA 1YBAA 4LAYA 2DBBA 2EG2A 1BGXT 1RWVB 4URQU 5DZ6A 4LFCJ 2P6TA 5ETNA 3W63A 2K8IA 1HNZF 2XP8A 2DGUA 2ZOFA 3GSDA 4L3KA 2YKQA 1NK4A 4MFBB 4J9PA 1MNEA 2PA3A 4IH7A 4M5MA 1IKXB 5GADI 3G6YA 1MU2B 4QWEA 1PAUB 4LF6F 3BH6B 4A8OA 2BJDA 2CJAA 5B8IC 1NWSA 3QFHA 3MAQA 5HBFA 4DN9A 2HQGA 2Y78A 4WBFA 2AZ1A 2RDDA 3D3CJ 2K7JA 2UUCJ 1FWPA 1JLFB 3NCPA 3G87A 1ROUA 2D3O1 1KQSR 4DR5J 3I9ZA 4NYPA 3G82A 2HAIA 4P52A 3ARZA 1ZBVA 3ZZTA 3EYZA 3OJSA 1UVKA 1KDNA 4HI1A 2GJ2A 4ZLJA 1V5VA 2MQOA 3G82B 2RB7A 4OZ1A 1W9PA 1QY7A 2FB0A 2UV8A 4OI1A 3W1YC 4S0MA 4EK2A 3I0RA 4RWXA 3EPIA 1S0NA 2ZWPA 4RUHA 1FCAA 3R5CA 1J5EJ 2KM8B 3ISZA 5EX3A 2B9XA 3ARXA 3F41A 3AAWB 5C42B 2ADBA 1JQGA 4FXWA 4UZCA 4HTJA 2K3IA 2G8ZA 2PA8D 4AFFA 2XNQA 3ARVA 3BYRA 3LH2S 2IC3B 1FFRA 4KE5A 4F4ZA 4WKHA 1XMOF 1X9MA 2UXDF 4BLGA 1MROA 5I3UB 4PQUB 1RHUB 3PDNA 2PPOA 1UEUA 2DNGA 2DO0A 5KFPA 2QLJB 1HBNA 3SSQA 1FKLA 2ZH7A 2DXFA 2FVRA 1K0VA 1X4GA 4ICLA 1FDAA 5J1EB 4CO4A 3MR7A 4YP3A 5HAOA 2M2BA 2FLPA 2UXBF 1NWRA 2EBGA 1OWQA 2C3YA 3N28A 5CZXA 4DFJA 2R8KA 3O5JA 4HACB 5IXUA 1IWAA 4G1QB 4WK3A 3MR2A 1FK9A 1QJHA 1FO1A 2WVDA 3C15A 3JXVA 4GVLA 1XHGA 5HQMA 3MCNA 2O5DA 3DRPB 4MH8A 4X64F 1CJTB 1QTNB 3T1YJ 3ZZOA 3MAAB 3A1YG 1RSCA 4DV6J 1V3RA 1WHVA 4P2XA 4QPTA 4WYLA 5F3TA 3D1QA 3P8BB 3TZXA 1TUVA 1MMNA 5K14B 1NSAA 4ES2A 3WDOA 2E9TA 4B3SF 2HFZA 2VC0A 4R25A 3WBZA 3G6XA 4F8RA 3K89A 4OI3A 2E7VA 1S49A 4MKAA 3AOBA 1RT5B 4DN0A 2JLEA 4HH0A 5A8KB 2MGZA 3N0VA 4PKDB 3BR9A 3H7HB 3GJRB 5E0OA 1SJRA 2R8HA 2UP1A 1EIBA 1YK9A 1HI0P 2WK2A 4UOFA 1PKUA 2OD6A 2LEAA 1S0VA 3IR6B 4ODNA 1S76D 1FEEA 4LBHA 2MHEA 1RA7A 3PYGA 3M1VA 4UOCA 5F0UA 4ZIVA 2FHOB 5L38A 2NS1B 2WHOA 1JJ4A 2V0NA 1KD1T 4HDGA 2PV3A 1K0TA 3K2YA 4HYKA 4LF8F 2DSVA 1U25A 4IG0A 4NLQA 1FI4A 3UDEA 2WSCC 1UJ6A 4C11B 2DR5A 4H4MB 1H0GA 1RXOB 1JLGA 3BKUA 3QIPA 4RKUC 2MQMA 4WP9A 5KG6A 2B4PA 3R6GB 4E98A 2BACA 2K7KA 4OYXA 1Q8KA 3TZWA 3BQ2A 1N34F 5HT1A 1Q8BA 4NI2A 2XP9A 3FUYA 5L8RC 2XZWA 2FGOA 3DM2A 1HW9A 2KO1A 3KLFB 3EZ5A 2ZJRQ 1K47A 3QJLA 4I64A 3DHWC 1VCTA 1KR4A 1UEVA 2PGCA 3H8YA 3CD0A 2R2SA 2CG4A 5J2QB 2E5LJ 1WSVA 3GFXA 3FAPA 2MSSA 3CCES 4RZRA 2KR7A 1LWCA 5DG9A 2X51A 1SC1B 4NYOA 5DLGA 2ZR5A 1RT7B 2SXLA 2KGJA 3M8QA 2CQ2A 4ZK7M 2D9OA 2BJEA 2NXEA 4CIOA 4OL8A 5KFEA 4DUYF 1W1PA 4CM0A 1XRVA 1FKFA 1LWCB 1OQ3A 1SYTA 3M6VA 4W98A 1BQNB 1NXIA 2V34A 2V50A 4WIQA 3WH0A 4GMKA 3KHRA 3RBDA 2R7OA 2CQCA 1KQFB 3DDIA 5DETA 1XMOJ 2KG0A 2ACYA 4W9QA 1FKOA 2ACMA 5M2UA 2R7SA 5KG4A 2UZAA 4DV0J 2HVDA 2BMBA 3FEZA 3OTDA 3QT8A 1FFWB 4OJHA 4RL1A 2DH7A 3G6ES 2JL9A 5BYQA 3OL8A 1JB0C 2QEXS 4J37A 1I1GA 3V6JA 4QQBA 4I68A 1JLAA 2LQBA 4P7TA 4OX9F 3ZZRA 1S7HA 2WB1D 1C0UB 4O23A 1Q1KA 3MPUB 2B8PA 3HM9A 4KH1B 2XMJA 3IS9B 5HANA 1ULRA 3IGVA 2W9BA 4TY8B 4C8YA 1FFGB 3IGNA 3VR1A 2D3UA 1TMMA 2AV5A 2ZQUA 4U7CA 2D1CA 2DT9A 5SZTA 1H7WA 3LP1B 2IYGA 5LSOA 4USWA 2GIQA 4J9KA 2H1YA 2KJVA 5HROA 4K4UA 3NAIA 1Q95G 2FKEA 1HQEA 1RU2A 2RILA 3P3DA 4LBIA 4ZN3A 3NL0A 1IR2A 2BANA 2D9PA 2E1RA 1JLQB 3E51A 4YS2A 1YJ9S 5IT9Y 1Z1ZA 3POTA 3U1NA 2J9DA 3GPKA 4ECUA 2R7XA 2PMWA 1WTBA 3FNNA 2KFNA 4LFBJ 3NEKA 2V6AA 3NOCA 4USUA 4DXLA 2NXJA 1OY8A 1REGX 1NSKL 4QIVA 2XP5A 5L1KA 5E3QA 2B43A 3DRSA 3PR5B 5KFXA 4K4YA 4Z7CA 4GC7A 1PSDA 3ISND 1RT6B 1TR0A 3BSAA 5I3QA 4ED6A 1T9XA 2QTWA 1MG7A 2OSRA 4X65F 2IBKA 1Q8LA 1S6QB 4ETXA 5I3UA 1Q78A 2DY1A 4KB7A 3ZTSA 3BXWA 4MNMA 1SQEA 3AA8A 5CHCB 5A0YB 2W24A 3RB6A 3KACA 2XZTB 1TUWA 4CYUB 1NB2A 4FZVA 5DG7A 1BC6A 4ZPTR 2NXCA 3FEYB 1R6YA 1RWWB 1AFIA 2WB4A 2HIYA 4WFAQ 3MD1A 2OTJS 1S57A 7AT1B 2RVJA 1R9HA 1S1UA 4PG4A 5B0DA 2XLIA 2OTLS 4CH1A 4ZP8A 3QRQA 2E44A 3MPDA 1NH6A 3DRPA 1RUSA 3LW5C 1B70B 4NRTA 5KFTA 2VQEF 1S1UB 3WIJA 3PJ9A 2R8IA 1YRXA 3ZTOA 5F3ZA 4Z2KA 5KT7A 3VALA 4DV5F 1SCJB 1SJ4P 1HNXF 4DF8A 1X4DA 1ICEB 3M8YA 4IG3B 4LBPA 3F56A 1V9OA 1WORA 4FYWB 8RUCA 3DYAB 2XNRA 4X4OA 4B02A 3DRRA 4DZDA 5DJBA 3N6LA 3OUYA 3TEGA 1VRTB 4A8XA 1YITS 5D3GB 1HHTP 1LW2A 2MY8A 3QRPA 1MMDA 3M30B 3N4WA 1LXJA 1JNSA 3OXGA 4MK8A 4ZVRB 3TVZA 1MWQA 1OJ4A 3UN2A 4LF2A 1D7JA 4JI4J 4X4TA 3QGPA 3D1OA 3GV5B 3I56S 1KWMA 1S9EB 1S0OA 4Z2LA 2F9DA 5GMEA 5HO4A 1HKKA 2ZBPA 4Y65A 2FPHX 3P6YC 3AB4B 3DMJA 1XERA 2G0JA 1IUJA 1WOOA 2PN0A 3OOBA 1AXQA 1H72C 2BEFA 2F2DA 2RHSB 2DISA 3JSYA 3MMBB 1FKPB 1R7IA 2J9CA 3RZAA 1J5EF 3WL0A 3HFKA 4C11A 3PRVA 1Q86T 2F3JA 2DGVA 4R0JA 1OY9A 3MMBA 3OL9A 2HFOA 1FKPA 2HK2A 3O1LA 2WAQD 2RF2B 5KFMA 3G6MA 2EBEA 4X4RA 2XO7A 2X3GA 1N8RT 5KFNA 1YJTA 4O4RA 2Q6CA 2OJ3A 4RW4A 2HHXA 2IFXA 3F73A 4B3MJ 1FJCA 1JWWA 3MZIA 1UPPA 1Y5IB 1WOPA 4YB1P 1QZ2A 2UUCF 3LAKA 3R2CJ 5IQ6A 2R42A 5EUHA 2ZKUA 1Y10A 3HFZB 5C5JA 5DM7Q 2I1RA 3FRZA 2ASJA 1BY9A 3QIDA 3HVTB 3OSNA 2VIHA 3ETOA 2K8GA 3DGPA 1C4AA 3I4PA 4HLBA 4NPOA 4OYMA 3PCOB 1FA0A 1T3OA 2X1AA 4YR0A 3SV4A 3IRXA 2HHHJ 1S48A 1RWKB 3I6CA 3O5RA 3DNCA 4HT7A 5IQQA 4DIPA 5DITA 2PFDA 1TL7B 2QLXA 2FHKA 1CJUA 4MMOA 2DK2A 4UUXA 3HLUA 4KV8A 2H4YB 3NI6A 1T02A 2DXEA 4Q45A 2AYBA 2KTQA 1VR6A 3CHEA 2GS8A 1PGZA 3ODKA 2H9ZA 3PW5A 1ACMB 1ZU8A 1N0VC 2RQMA 3MD3A 3MECA 4URSA 5K8OA 4YHHF 1VHIA 2R9LA 5FD1A 3VAKA 2ZR4A 1RYSA 1N4LA 3EICA 2G0CA 1UW4A 3K5OA 3J81Y 1R0CB 2V4JA 1C0UA 1MN9A 4MIWA 4MIBA 4EI2A 2W9BB 4NMLA 5U47A 1URRA 1RBOB 2P6SA 5IV4A 5KFCA 1CC7A 1FD9A 1M5OC 2OIHA 2KFYA 4LF7J 2VG7A 4FKXA 3B9EA 4DEZA 2DNZA 1T9WA 2R3VA 1GTHA 3GYGA 2UXCJ 1TCOC 1WSRA 5KG0A 1MSWD 1Q16B 2Z0GA 1I5OB 3HSJA 5J2PB 3IG1B 1OPZA 4PXDA 1NMEB 1T7PA 1RTJA 1Y5LB 2BANB 2DR8A 1GAOA 2RQKA 2O92A 4YR2A 4JYSA 1S12A 5JUMA 3WD2A 2UUTA 1X7VA 5HW7A 2OPRA 3JQJA 4CLLA 5HLFB 3A3OB 5D4LA 2AF6A 2FD2A 4UTGA 3CEDA 4DR1F 4JFMA 1C1BB 1F9FA 5KG5A 1NHKL 3PKYA 1TQLA 4JI8F 4X66J 4CP5A 1XMBA 2BM0A 3NY0A 4NZ7A 4ANCA 1Z2ZA 5A6PA 1B0TA 1I51B 4Q43A 3QT5A 4QIGA 3CJQA 4TYAA 3TJAA 2CAJA 3I5AA 3VV2B 1HMVB 3KLEA 4K4SA 4FYDA 4P74A 2QZ8A 1Q82T 4DR1J 1VDHA 3O8WA 3E01B 4EU0A 3K5NA 2CIMA 2IRUA 5D77A 5B7WA 3H4BA 4DWIA 4PZVA 3HK2A 3QSIA 5E7OB 3THTA 2ZJPQ 4JI5F 3NLCA 5KFLA 1RE1B 3MXHP 5BXIA 1IBKJ 5CABA 1NNDA 4I7FA 5A6WA 4LVOP 1BWVA 1DQ8A 4B08A 2E1PA 1C2PA 1CJVA 1ZZFA 3EVMA 4FDFA 2LKNA 2HFNA 4OV1A 5GADU 3C8YA 3S8SA 3BBBA 4ANEA 2QFJA 4NOHA 2AD9A 1ZK6A 2NXNA 1M5SA 4F36A 4JFKA 2ASYA 2XGQA 1J4HA 4M5JA 3TAMB 4C3LA 3IK8A 3BZQA 1DTQA 3OHAA 4MIAA 1WAWA 1WELA 2GVDB 4UOGA 3R6LB 3CZ8A 4P2MA 1NK7A 4TNOA 1FRIA 5KOXA 4YQWA 1JLEB 4I56A 4IH6A 3EX7B 3KK2A 3H5XA 1G1XA 2MDAA 3I31A 2I2YA 2GMHA 3CJRA 1EHNA 1S6PA 1F5BA 2B6AB 2W4DA 1C1CB 3AD9C 1AZSB 2BE9B 3DGVA 1S1VB 2GGPA 2GO9A 2OKQA 1MROB 2AEJA 2RUGA 3FFIB 4DWSC 3GG1A 3HULA 5KFRA 1K73T 1CQMA 4OZ0A 1XEZA 3OTEA 2CQHA 3WQVA 4K4XA 4UQTA 1LG1A 3UQBA 1IKWB 2DGQA 2M52A 2N82B 4ETZA 5T14A 2G4BA 5D8HB 1GMWA 3ISNC 4QYRA 5ETTA 3ARQA 2OEJA 3MMAB 4Q44A 3ZC4A 3GV7B 3LWMA 3HI9A 4JFIA 1T11A 1YATA 1B0PA 1S7IA 2ABYA 4ES1A 3KK2B 2ZH2A 3UNYA 2R8JA 2CPIA 2HWIA 2NSBA 4USMA 3UVJA 3M8SA 1VBXA 3DKDA 4RBVA 1JXLA 5B08A 2JX2A 1JK9B 3PVXA 2RS2A 1JKHB 1Q53A 1F6TA 1UWAA 2G0IA 2KRRA 2XI3A 2ZDPA 2CPDA 2WVEA 3ELHA 2VFRA 3NBPB 2DR9A 1SR0A 3ETMA 2GAGC 3G8QA 4F04B 2HIQA 4X65J 2ZNZA 3QQCD 1NKEA 2HVHA 2H51B 2HGMA 1ZA1B 4ODOA 3UI6A 1WG1A 5J1PA 4AL6A 1XK8A 4DFMA 1ZAVA 1RT5A 4WK9A 5KT4A 1RKIA 1RD6A 2BE7D 2I9SA 1J27A 1RT2B 1R43A 2QA1A 1G7CB 4FNIA 2FLNA 3G8SA 4E8UA 3MCOA 3GIJA 3RTVA 2ZC4A 3C19A 1OY6A 2YQ0A 2QFIA 1YSJA 1RT2A 1LL7A 1RT1B 1NCLA 2E1MC 2HNDB 2XWXA 4O3OA 2W9CB 2IMWP 3QJPA 2CJXB 2VV5A 4IDKA 3I87A 1SVDA 3M2UB 4O3NA 1IBLF 5KG7A 2BW2A 4AY1A 2EK1A 4WIWA 2F4EA 3NTPA 1WC5A 4Y3CA 4KJIA 3EDQB 2A2CA 4IDKB 4PTMA 3W9JA 4ECRA 5LM7E 1X5PA 3MEEA 2UVVA 4WP3A 3AXKA 2BRKA 4ZHRA 2ZFHA 2AJQA 3R27A 2FJVA 4H4KC 5F8GA 2QG9B 3WQWA 1WKKA 4CO5A 3C14A 3KLHA 1VQMS 4JBCA 3IBFB 2IJFA 1HLWA 2X3DA 2M08A 2BV3A 5KFKA 2R8GA 2CADA 4P73A 4TW8A 2VFSA 2YY3A 3HJFA 3CHDA 4DRMA 2MLXA 1NDCA 3ZZPA 5A2QY 2QL9B 4DV1J 1HNXJ 4CLUA 5J2QA 1RK8A 4K0KJ 1UPMB 3VAWA 2NZ4A 5C25B 1CQNA 4Y2AA 2ILYA 3KG0A 4RW8A 1Z4UA 4L75A 2OELA 3M8QB 4OLOA 2MZ1A 1VQ6S 3JYMA 3ENQA 1S5ZA 4MPKA 2X1BA 3MEDB 2VODA 1N34J 2JZ5A 3W3SA 4DUYJ 1A7XA 3GSIA 3M6XA 3N01A 4C4WA 2KFWA 1ZPWX 1TKXB 5KT2A 2HHWA 1Y7PA 2J9EA 2W01A 4N19A 3U1LA 4CLWA 2HHHF 2RRBA 2QC3A 3NS5A 4XTTA 4IQMA 2E5LF 3RRGA 2IRXA 1TFYA 1R89A 4C0BA 1TVRB 2GHWA 4P6QA 4JI1J 4C6AA 4DWSA 5D78A 2YQ3A 4V19J 1IKVB 1Y3JA 4G50A 4LAVA 3U27A 3GB0A 4ELTA 1E15A 1TVRA 3C6UA 4KSEB 1D9DA 3Q8PB 2L41A 3CW2C 4CO2A 5KFHA 1DQAA 4MK7A 2RQCA 1WC4A 2EFGA 3G71S 4DQIA 5HVFA 3B78A 4KKOB 4ZPDA 1HBOA 1RGVA 4LMZA 3H90A 4O0IA 1SJ3P 3AD8C 3O5LA 1E6ZA 5HK4A 4IO1A 4NZCA 1S1TA 2B4VA 1FD8A 3HVAA 1I94J 3KLVA 1N1AA 1EETA 3FBBA 1HPZB 1KLMA 2FLOA 2QYGA 2BQRA 1RA6A 2VA2A 2EC2A 2KO7A 1B7FA 1RLDA 2RURA 3KHHA 2DNRA 5E3AA 2BE2A 2R2RA 2HLUA 1S1TB 2VBZA 2ZE2A 4R8UA 2I5JA 2YVSA 3AT1B 2CJKA 3ONQA 3HSDA 3M05A 3TA1A 4C0HA 2ERRA 3X3UA 3B8HA 2ASDA 1RKJA 1V5IB 2ZE2B 3CIMA 4R8UB 1XNRF 1EDQA 5K9FA 3JTNA 2EVZA 3AJ1A 4HDHA 2VA3A 4ODLA 1U7LA 1LFPA 2Z8QA 5LOQA 5B0FA 2RRNA 2XMUA 5IC6B 1DTTB 3EVOA 1UA0A 4B17A 2AX0A 1HBNB 1GH8A 4U84A 5D4PA 1N36F 1EKRA 2ZVSA 2F4VF 1S6QA 3UE2A 2E29A 4MNKA 1H74A 1S9GA 1T9UA 2VPWB 2YNGB 5E3CA 5KFQA 2BQ3A 3I5CA 1UR8A 4LT6A 1KLNA 4QU6A 1EB0A 4PUOB 2RS8A 2U2FA 1U24A 1ZA2B 2IRYA 3DDNA 2V94A 1U0HA 5F8LA 1Q5VA 4ZCKA 4U67Q 3CH9A 4TU8A 2YX4A 1L1PA 2QYCA 1F2HA 4DJBA 4K5RA 5GMKa 2CPXA 3SQGB 1AROP 1HWLA 3J7YU 3HVRA 3MAAA 3R5BA 5C2CA 5KAKA 5IS2A 5DDRC 4LFBF 1A7GE 4D3HA 2XPBA 3GG0A 3W8PA 2W7OA 4B3RJ 3MAHA 3QAUA 4LSZB 1RACB 4G1QA 4DL0C 2OEKA 2D9FA 1VF8A 2DEIA 4OV6A 5GMDA 3QT6A 4ODKA 1WI8A 4PXBA 3P45B 1FKGA 3M6WA 5AJ3F 3DRXA 4NSBA 5MAOA 4ED7A 4NZ0A 5J2NA 1TK8A 3B7XA 2MB0B 3CF5Q 1T0TV 1UAWA 3I82A 4QOTA 3HHLD 4ZLLA 5DQHA 3HHLB 4DT4A 4RUBA 1DARA 1JLBB 2MYFA 3JYJA 2XMTA 2VPXB 1HW8A 2VKZG 2DT1A 1KHWA 3CJ2A 1LW2B 3DCAA 4ZMMA 5GPRA 5F8HA 1KFSA 3A13A 3RYLA 5KFUA 4PG6A 5GAHI 3HHLA 1IR0A 3RGCA 3O5OA 4WU2A 3C6TB 3IP0A 2EI5A 3NRBA 3V4IA 3ARUA 2QLWA 1S4FA 1X6NA 2Q3PA 2W2MP 1Q5YA 3OVSA 1IN0A 2CUYA 2G2ZA 2HFUA 3CCMS 4K50A 3D6HB 1UL3A 4WK1A 1L3VA 3QMQA 1JLGB 3QIPB 3JB9k 2AGPA 2BZ2A 3KK3A 4DCOB 2DGXA 4FXDA 3ZZ0A 3QGIA 3QNWB 2P9CA 3C46A 2HHTA 1NK6A 1ZTWA 2NR0A 1ELOA 4IG0B 1YVFA 3O5FA 4RW6A 3C14B 4G3IA 4DL4A 2Y0BB 1WHYA 4KFBB 5JVHQ 1O8BA 3DFEA 4DX8H 2V8DA 1H2UX 5I42B 2QLBB 3V2UC 3DOKB 4USIA 1FRHA 1RT7A 3DLEA 5M2PA 3D3BJ 2PEHA 3IR5B 3I32A 1RHKB 2GA7A 2YNIB 4OX7A 2WVBA 3M2RB 6AT1B 3KLFA 1VBZA 4DR6J 2EK6A 3DOKA 2J7WA 3LTOA 4Y2IA 4QW8A 3BQ1A 2HBYB 4NZ6A 3TEHB 3EGWB 5BR8F 2XY7A 3TI0A 3TR5A 3D0HE 5D4OA 3AQUA 4I6YA 3B4DA 3NNCA 3CDWA 1RAOA 3OFHA 2J76E 5L1IA 4FBUA 5B0EA 1RBLA 1UJ5A 3ENAA 4M5HA 1QSSA 4BS2A 3AFGA 5HBMA 4ZJLA 1GMVA 3NWGA 1LWFA 4TQSA 1WEYA 2AYEA 1BLUA 2P9GA 3SZ2A 5AJ3J 1U09A 2IHR1 3DC2A 3W8GA 2O66A 3W62A 1M5KC 2CFXA 4U95A 5B0CA 3CGIA 5HVGA 5DZ7A 4OYBA 5C2GA 3SV3A 2K1RA 3BSCA 1NRKA 1R6VA 4J9OA 1DAXA 3C6UB 1HJWA 1EZZB 2MLYA 2DHXA 3KFWX 3KJNB 2QJ3A 4ILRA 4LRDA 4TY9A 4QBUA 3THPA 5KFDA 3BS9A 2HS4A 4YB7A 5CQGA 2XYGB 1NSPA 3KLGB 1CLFA 2GVZB 2LU1A 2FC9A 4NWBA 2FY1A 4K5SA 3CULA 3GP9A 4LGXA 4ZCMA 4DV1F 2YKPA 2V9WA 1VOMA 4RBUA 3KLGA 4B9VA 2WOMB 3KLIA 2CDQA 5F9NA 4PAAA 1W1TA 4RWWA 3J80U 4LF8J 1LNQA 2OD4A 2CZ4A 4OMFG 4DL7A 4WXWA 1NLKL 3NAHA 3PZPA 1DJ0A 4XK8C 1P9YA 4R5EA 1CULA 3UDVA 5CXTA 2C2NA 4KGZB 3ZZZA 5ETVA 4UF4A 3VZHA 4ANDA 4ECZA 2XP7A 1NWUA 3B9AA 4FVMA 2V9KA 1RWXB 3W2WA 1E44A 2VHGA 1KSPA 2GCFA 2MHNA 4MKBA 3BO3A 2KHDA 2DSZA 2R7VA 3WX8A 1LEOA 1YTYA 1U1LA 4CYUA 1A9NB 4A4JA 4FF4A 2DHSA 3R5JB 1XJWB 1FEHA 4QCLA 1B64A 3CMES 5HP1B 1RAGB 2FJBB 2J0XA 2BRLA 1OGGA 5G0RA 2WM0A 1XIQA 2DNHA 3DOMB 1NMWA 2WONB 1Y0OA 5DIVA 5ETSA 3SSRA 5LMUF 4DR5F 5EWFA 1AFJA 1SQGA 1PBKA 2V8VA 4DQQA 4MTPA 2V69A 5HP1A 5G4DA 2RMLA 1QUVA 2KXNB 2HKEA 2ZQVA 1F8AB 2QE5A 2Z2ZA 3LP0B 4RNFA 5KFBA 3G8TA 4DFKA 2DD8S 1TL5A 3MM9A 1W2BR 4WF9Q 1IBMJ 2HHVA 1YJVA 1RHMB 4DR4F 2IAJB 2QT7A 2RU9A 2C2ZB 3AY0A 3NGUA 4HEA9 2H5JB 4YB6A 3HXMA 4DLGA 1D7HA 2R4FA 3BGOP 3BV8A 4PXCA 4LF9J 2CQBA 3L9ZA 4CTAB 4PYDA 1JLEA 4FKYA 3LUYA 1ZTTA 4PG5A 2YTCA 1QAXA 5HSPA 1DHMA 3NNHA 2FDMA 1S1VA 2GGPB 3KK3B 2HVZA 4B9MA 2DIVA 3KNGA 1SL0A 1QTMA 3L09A 3FCWA 4ATNA 3W5XA 5L9NA 2AWGA 3G6VA 3Q0AA 2OFGX 3C16A 3BKFA 4L74A 4NEZA 5D0HA 2E9RX 1TL1B 2BKNA 2FJDB 4HVZA 5C24B 2GMLA 3BBFA 3TOQA 3RG6A 2GO8A 4J9QA 1FVSA 2LA4A 3SMZA 4A48A 5HMZA 4Q0BA 5J2MB 3J7ZT 2HK3A 3VGUA 1N5YB 2DT0A 1B0VA 2CWXA 2V5HG 4L6V3 1E6PA 1JNEA 2B5UB 2DTJA 1Y11A 3UVJB 2F23A 4OZJA 1VRUA 1PAEX 3ILIA 1NKBA 3KADA 1Y5NB 2HRTA 3EIPA 2RF2A 4RX6A 2O9OA 1PO6A 2CPJA 3JSBA 4A8MP 1AW0A 4DSFA 3MI7X 4LR9A 3KTQA 4FS2A 3KCEA 5B0GA 5KG2A 5EWGA 3IAS9 2GX8A 4ZOSA 3O5GA 3VGVA 4KFBA 3QWUA 2DNLA 2ILZA 3ARTA 2DNYA 2CJ9A 3PW0A 2DRBA 3W64A 3T9NA 3GMGA 3LPYA 2DGOA 5HWBA 4RPFA 4KRWA 4C8NA 1GX6A 4NEYA 1YW5A 3SCKE 3HKWA 2LQ5A 3UD4P 3D9BA 4J9VA 1DFDA 1EARA 4RW7B 2W9CA 4DV2J 2LQ8A 1LW0B 4URGA 1EYMA 2K3KA 2BKOA 1OMSA 1VK8A 1PYOB 1CC8A 4GVBA 3HVTA 4LIWA 5HI7A 2D74B 5CH7B 4Y6IA 3JAMU 3C2PA 5IT9U 1Q4RA 5KOWA 1KOOA 1BQXA 2HBQB 1T9YA 1VQ9S 3QT7A 1D6OA 5GPGA 5ETRA 2UU9F 2XPAA 1R27B 2D3ZA 1YX2A 1VI7A 2BJ7A 4DR7J 2IIHA 4ZVFA 2AWZA 2F8EX 1UKUA 1FXRA 3H20A 4QU7A 3D28A 3RM4A 4YDXA 4MKYA 2E5GA 4B9LA 2RD5C 3Q89A 1YZ6A 2OHDA 4JYAF 3V6DA 2DPIA 2LDYA 4CH0S 1WEZA 3WIUA 1YQHA 3GZ7A 5KT6A 4C0OC 5L1JA 3M9OB 4FVCA 3PY8A 2V4JB 3PIOQ 3WX4A 1PYSB 4HI2A 5DS7A 3PW7A 2APOA 2IDEA 2XMMA 5B0AA 2PN6A 3TJ9A 5GAEI 1B3TA 2JH3A 2C2EA 2DCLA 4XAKA 3CO0P 1NJWA 1W1YA 3KLIB 5IT4A 1NK9A 2CJYB 1UVIA 3Q8SB 3FBEA 3R8YA 5JMNA 4RNNA 4YHHJ 1YGYA 1PBAA 5K8NA 3JAMY 5DIUA 3UCGA 3I0SB 1U2CA 3GLJA 3DN9A 3AODA 2EEYA 3BH7B 1VQKS 4J91A 2CQ1A 1GPFA 2E7WA 2XMKA 4R5PA 1A0OB 4JFJA 4M5IA 2ZH9A 3AXMA 1HR0J 4Q2MA 1NDKA 1D7IA 2KFZA 4QWBA 3WL1A 4NXNJ 3OVBA 2W7PA 4ZP6A 1XR7A 2V2KA 3S7RA 4L3NA 3TCZA 4OI6A 4ILLA 3J81j 1TELA 5GAEU 2OPSB 3K58A 2OH2A 1WKJA 3MPWA 1YJWS 1REVA 2P5VA 1H7XA 5E3PA 4CI0B 2VONA 1OSCA 2O67A 1ZS6A 2R7QA 3QJJA 3DLJA 4QW9A 4IFVA 2WONA 4B9TA 4KGKA 1YDLA 4NLSA 3RUBL 2HRYA 2FGCA 4DG1B 4O3QA 4O0NA 1CJKA 1T03B 4JI2J 2O01C 4KTQA 4MSPA 2XSJB 2MQ8A 3MM9B 3PR9A 3O44A 3EJMA 3OFFA 2MQQA 5AE1A 1CJKB 1IM4A 2DG4A 1FNMA 1PILA 3BN7A 3K17A 5E5NA 4JI8J 2HVEA 5CD4A 5LMNF 2HFVA 3MCMA 4CTAA 1RTDA 1SH3A 1HNVB 1N5VA 1FDBA 2MQLA 3K8WA 4MYUA 2EULA 4DROA 1F3VA 1VFJA 1E6VA 4I1TA 4OZLA 1G3OA 1YIJS 2F21A 4NCBA 1HQUA 1C0TA 2IUZA 3GWCA 3MM6A 4ZJOA 2XS2A 1N88A 1N52B 4C3MA 3KJQB 4PQUA 5IM0A 4JI4F 3QZ7A 2B6AA 2CQGA 2J7KA 4C8ZA 1QSYA 3MM6B 1TZ0A 3MPVA 1T94A 1WC3A 5CYMA 1O6IA 2JHEA 3U1MA 4CDIA 3W61A 1Y4ZB 1FKIA 1OQ6A 5EGYA 3TARA 1IJFB 4EEYA 4KBIA 2R7WA 5CYMB 3PX6A 1JJHA 1S4EA 2C42A 3CD6S 3DI6A 1Q7YT 4X4PA 2CKWA 1DLOB 4ZA1A 2V68A 1A6LA 4MK9A 1EQ0A 3PFEA 3A3NB 1L3KA 4OZ3A 3IXQA 3V5RA 5HQLA 3RM9A 3RR7A 3DOLB 1F60B 3HHKA 4WPAA 3ZFVA 5K8PA 2NPFA 3T1HF 1N6QB 1J2VA 4RNHA 2ZM6J 4KYZA 2GV1A 4AD6A 5CAAA 3VGTA 2VICA 1HXVA 1JKHA 2EC0A 1RT4B 2VOOA 2M70A 2NUUG 1P6TA 4Z7YA 3C15B 1SI9A 1KONA 2MXYA 2IVMA 3L7UA 4HKQA 4UUWA 3OLBA 1OS5A 3J7AN 2XLJA 3B4MA 1HHSA 4TW6A 1H0IA 4KAIA 3CIZA 3TA0A 3PW4A 1QDUB 4N76A 4KGXB 4QT3A 2V2ZA 2P8IA 2FC8A 2XS5A 2QMXA 1Q1CA 1JVWA 1SIZA 3QOKA 2G1DA 3TANA 2KI3A 4PYAA 3MFIA 2Y1IA 4F0KA 4DSIA 1XNRJ 2PE8A 3G96A 4A8FA 4ODPA 2ZNYA 2NLWA 1Q6UA 1AT1B 3QLHB 4OZ2A 2N87A 1N33J 2MEWA 5HMXA 2ZH3A 2F8MA 2KVQE 2W25A 3D6MB 5GAHU 1HL6A 3WKZA 1UZDA 2ZUGA 3GFHA 1HNWF 4I6WA 4NLGA 2CVEA 1HYSA 1FKJA 4TKTA 4P72A 4DPTA 1I6JA 2H5EA 2BOAA 3P5TL 3K57A 1F0XA 5HQ8A 1ZM2A 4PABA 3OL6A 2ROPA 1FJEB 3FVYA 1FHTA 1VJQA 1UEKA 4X64J 5HTGA 5KFWA 1KVKA 1PYTA 4H4MA 4G1PA 3UFCX 4X4SA 4KQZA 1FWKA 1TL3A 3UI4A 3T41A 4ED2A 4C8KA 2HAFA 3B54A 2OLHA 2D7SA 4LF5F 3WD0A 2LMIA 2KYXA 3TAPA 1LXNA 3QO9B 4OYIA 4GKJJ 2Z4PA 2VG5B 2RNEA 3VAFA 4ZVHA 2VFUA 3CJ4A 5KT3A 4QT2A 4EO8A 2HZVA 3RM8A 3Q8UA 1AUDA 2OAUA 4NA2A 4LRBA 4ALZA 5ETQA 4DS5A 2XSFA 3IM8A 1BE4A 4F7VA 3DHXA 3O5PA 2QF8A 4HHUA 2YPYA 3JYTA 5LT5A 2AQ4A 2Z2MA 1YRUA 1NO8A 2RKIB 5F41A 3G86A 3L4BC 3JYTB 1BL4A 2QIFA 4U7UK 4C8MA 3BGRB 4RLEA 4DBQA 5M2RA 2DG9A 5AT1B 2HGLA 1W25A 2O3DA 2Y0SD 1R8AA 2C3UA 2NUHA 3CE8A 1HQ2A 1VGYA 3MM7A 4TLQA 3MFHA 2VJVA 1NJYA 4LF4F 1WF2A 4ECTA 1WWHA 2LECA 1FJ7A 4M63A 2NPIA 2CZVC 2MTLA 3MURP 3CC4S 4C9DA 1KQGB 3IWLA 4NXMF 4D3GA 4DV7F 2OEMA 1KQKA 3OR1B 1ZAWA 3V4MA 3HMJG 4WZMA 2B0GA 2BE2B 3GFZA 2BOPA 4UDMA 3NGRA 3IS9A 2B9EA 3J7YI 3TW0A 3ICLA 2CNOB 5DF0A 1VC0A 4M5NA 4DSEA 1UFLA 3TUPA 2PPPA 4OHZA 3I5BA 4NX9A 3IFEA 5ETLA 4F4KA 2IM3A 1HI1A 2B56A 1OSDA 3I96A 4OHYA 2MKYA 5KFFA 2Q5AA 5DQIA 3QGGA 1YJRA 2MZRA 2EFOA 2VDHA 3DXBA 3R5GA 1OIAA 2CPHA 2HQ3A 1NWTA 1TAQA 5AXLA 3R7SB 4NLXA 1U1QA 3EMTA 4B3OB 5CZVA 1PINA 1KOHA 5CA5A 3UPFA 5DGBA 3NMAA 2FY8A 4F3QA 1W7WA 2MPUA 4ZCLA 4N5SA 4IQXA 4DV0F 1EKSA 4DLEA 2A3EA 4ENOA 1N33F 1FKRA 2YBVA 1VQNS 5T7LA 2R7UA 1EJ7L 4I2QB 2B4UA 3DOMA 3Q2TC 2BW7A 1W26A 1RT6A 3CVKA 4TNSA 3FDSA 4PCQA 2PMHA 1ZM4A 3AD7C 3UNGC 4C02B 2WCXA 4ICLB 1U8SA 2JLFA 3CHCA 4ZPBA 1KFWA 4X62J 4DL5A 2UUBJ 3EZOA 3KMQA 4L72B 1QD1A 1X8DA 2C3OA 4N47A 5J2NB 4HACA 2VB6A 4UY8T 4N77A 4U96A 2RE1A 4IKAA 4WP8A 1KP6A 2UUWA 2DR6A 2VUGA 4DZ2A 4NYZA 3TX0A 3T1YF 1S0MA 1WG5A 2N7YA 1G2EA 1KFDA 5KG3A 2KXFA 4KR0B 3DYAA 3IN5A 2FVPA 4GKJF 2JOQA 1TV6A 4CRJA 1Z2LA 1SKSA 4L73A 1JNDA 2J9DE 4DFPA 1T8EA 1U79A 1U6FA 4P8WA 1BQMB 4MT1A 3M8RA 1K8AT 3ET6A 5LMNJ 4QYZK 3V4IB 1KEKA 2AEFA 1FKDA 3EXCX 1QPFA 2HS3A 2COLA 2RSQA 1H73A 2QSFA 2KH9A 3ET6B 2QA4S 4KHPJ 4OIXA 2DNNA 2FUG9 4ZVPB 1M5YA 1Q81T 5GVQA 1LJYA 3WD3A 2G9OA 1VRTA 2LQJA 3RBXA 3W5ZA 3K5LA 3OXFA 5D3GA 4N8NA 5DG8A 5J6EA 1F3FA 4DL2A 1Q6IA 2FAPA 2ZBQA 1DY3A 1TMJA 2DO4A 3CB4A 2W4CA 3CJSA 2V8HA 3VGSA 4CLSA 4DX6A 1W9VA 2GHPA 5L46A 4M5KA 1CVJA 3P4UB 4DPOA 3PO4A 2FVSA 2XP6A 3AROA 3PEJA 4ELUA 4ED3A 2QL5B 3CD7A 3R5DA 2A18A 2H54B 2Z2LA 2XGPA 2DNOA 2BJ9A 3CDAA 3MMCB 1R8PA 1J6YA 1VBKA 2WVCA 2MKKA 4DRPA 5ADZA 4F02A 5KG1A 3CCRS 3JXOA 1TFWA 2ETNA 2LP4A 4WFYA 3M2RA 4PR6A 4UY85 2X7IA 4RW6B 1HARA 4LJMA 2GFFA 2FHJA 2GZOA 1TL3B 1X5SA 2B3TB 2QL7B 1BUXA 1WC1A 2Y1LB 3U7JA 2YH1A 4F2RA 1WG4A 4F0MA 1RI7A 4JB8B 2C1EB 2RDIA 1CPZA 5SUHA 3HPOA 1NU4A 2MKJA 1R0AA 3KNAA 3SQOP 2JVOA 3QYYA 2YH0A 3UWTA 2KG1A 3JSMA 4LRFA 4ECVA 3QPIA 1SV5B 1FRJA 4KPCA 2GJFA 4LRAA 1JLCA 2AKWB 4DU7A 1QPLA 3K7RA 3UDLA 4LQ9A 4AT1B 3M4XA 1K1QA 4FN2A 3E3XA 4CT8A 3GIKA 3T5JA 1BQNA 1GXLA 5A8RB 1XQIA 2GNKA 1JLCB 3L3CA 2RSEA 3D0IE 2ITKA 2ZQTA 3HVWA 4ITSA 4XIUA 4A8WA 4OJGA 3EE3A 1U1OA 3HZEA 3IKDA 1WD6A 2VBXA 1ZETA 5IT0A 2FJWA 2ZWOA 4ZDNA 4B9UA 2I0XA 4Z2HA 2DRDA 3QSYB 1T05B 1U2RA 1LWFB 2C22A 5IC4B 2WBMA 1S72S 3HHLC 1WKLA 1D9FA 1JLAB 4WJBA 2CNKB 1RDRA 3BKTA 4CM2A 2QO3A 5LXYA 4Q22A 5AXMA 1RHJB 2B51A 3EVWA 1HKJA 1HHQA 1XN9A 3I55S 4EUVA 3E2EA 1ZCNA 4DPYA 3S01A 4F2SA 4F3OA 3P5BP 3F0NA 5IWAJ 2VOPA 1SPBP 4B3RF 2DXDA 4IFYB 2D41A 4DV4F 1HKMA 2YWEA 5H9FK 2XLKA 5HROB 1FJDA 2GQ2A 2HS0A 4LFAF 3IHZA 1LL4A 4Q2LA 4X84A 4RU9A 3VAMA 3FBCA 4LUBA 3H9RB 4P9SA 3SBMA 3GCXP 4DUTA 1CS4B 1S6OA 2PI6A 1RU1A 4RO0A 2XWYA 3TO8A 3D7SB 1ZOTA 3M32B 5LJ3Y 4YR3A 4DR3J 2XYHB 5A76A 2PV2A 2A3JA 3UF8A 1EQMA 3AS0A 2L08A 2B9WA 3GPAA 1CS4A 1J4IA 4IT4A 1SKUB 2F7VA 2VBWA 4OHVA 3ZO7A 4NNRA 5B0BA 1TAUA 3D68A 1PG5B 5A8WA 1P9QC 3MR6A 3NGKA 3DLBA 3QFWA 4XDCA 5GQBA 1JX4A 2N7CA 4OX9J 3R97A 3PIPQ 2RT3A 2YWFA 3HO1A 3CCLS 4DRHA 1LWXA 1DRZA 1NM2A 2E5IA 2U1AA 1VLYA 4DG1A 4L76A 4ZIWA 2QMUB 5FLXY 3ARPA 3V6KA 2EW9A 4WTOB 2HBZB 2XY6A 2AJ4A 4X4VA 3E01A 3CCQS 1UP1A 2AEMA 4TYBA 3KHLA 2MKSA 5CCLA 4J4OA 3GYXB 2R7RA 3BPSP 4C3KA 3CCJS 4W9OA 1GMUA 3PEHA 1NPRA 4JI3J 3RAQA 2XP4A 4DPXA 5AXNA 3C66A 3LP0A 3QWPA 2J6SA 1ZBKA 2L9NA 4PWDA 4I7FB 4OFZA 1PC4A 2NXUA 3D5MA 3SCJE 2XCPA 2N4DA 3GIMA 1K44A 2B7CB 2ZOGA 3HHEA 4WFXA 3NXZA 1SJ1A 3LA0A 4ZN1A 2RH3A 1T3NA 4B3TF 1AZSA 4S3KA 3O5TB 3FFIA 2F5GA 4LR7A 1H3DA 2FTRA 5CCMA 4M94A 4ML4A 5KFZA 2AJ2A 3SCIE 1KRPA 1FX4A 1FJGJ 1EQ3A 3OUYB 8ATCB 3W65A 3KZ7A 2VBYA 5J2MA 1CG2A 1WEXA 2EFQA 3F44A 5D4NA 5KFJA 2POKA 4IQ2A 1KKHA 1RAAB 2XMAA 1PC5A 1Q79A 1IKYA 1RAJA 3UD5A 1WACA 2FJXA 4B3TJ 3R7NB 2J8AA 4ERDA 2MQNA 3K5MA 3DI6B 1YJ7A 1WOSA 3K0JA 3ARWA 1KTQA 4FYVB 2BJ3A 3OTCA 1GQEA 2LLZA 1HNIA 1DZ5A 4PG7A 1P1TA 3R5AA 1IJEB 3DOLA 2ADCA 4M1KA 3T5HA 3MMAA 3Q8VA 3RBZA 2N3LA 2E9ZA 3FZBA 1VRUB 4B9NA 1DBDA 4EYIB 1ZH5A 3PJXA 3MMCA 1RT4A 4PPZA 4BC9A 5AE3A 2XCAA 4DV3J 3J7A1 1ROFA 2ATCB 4OZNA 3OTOF 2DG3A 2FZKB 2Z56B 4O2TA 4W5UA 3IKGA 1VJWA 3KG1A 4QR1A 3L7OA 1UR9A 2V4RA 1S97A 1B99A 4BCAA 1HJVA 5BXJA 3CSKA 4Y0FA 1NB7A 1NMVA 4JV1A 1RTZA 2V8GA 2YX1A 3D2WA 5IV3A 2UZ5A 3TA2A 4ID8A 1CEZA 5K20B 3SXLA 4FYYB 5LMUJ 4I69A 4OYAA 3Q24A 2IF4A 3M2UA 3NCRA 4H4KA 4N8OA 5IZHA 1SKRA 2MY7A 3CJKA 1U6BA 3KKFA 1SH0A 4KO0A 4OHXA 3V6HA 3NKYA 4XPCA 3PX0A 4U8VA 1TK5A 1TK0A 2IA6A 1KVJA 1R8HA 2EFPA 1XMQJ 4KHPF 4Z2XA 1TFVA 1RB0A 4KO0B 2HNYA 1RP5A 4EFAC 1IBCB 1CJUB 1WF0A 2JRSA 4TXSA 1VQLS 1T9TA 4KV8B 1V3SA 2PEBA 1NSQA 4JI6J 3I9V9 1HBMB 5ETPA 4GO5X 2F40A 3OHBA 1F9HA 3ULHA 2MMYA 1SQFA 3WQPA 3KLHB 1FXDA 2BUNA 2RQSA 1PBUA 2W2QP 1LG2A 1GRJA 2ROGA 4ZLNA 1IR1A 1HBMA 3FEXB 3FGVA 2RUCA 4FF1A 1L3UA 1NHVA 2ZQSA 2Z58B 2BABA 3DM2B 2F4FA 7FDRA 2LGOA 3UI5A 3AA9A 2XY5A 2LKZA 4LSLA 3MDFA 3H25A 3CC2S 2ZDOA 2VG5A 1UVMA 1RLCL 2CQDA 1LK5A 1MN7A 1O5JA 4MYTA 4DDFA 5F9LA 1BWEA 4O44A 4CNZA 1QAIA 1YG0A 1ZBWA 4Z37A 5ITHA 3EZUA 1VIXA 4EYHB 4JV5J 1SC6A 1YWXA 3BN4A 4IRKA 5HUAA 4R5PB 4O44B 1KBRA 5L9XA 2DNMA 2YXLA 1VK3A 3IBWA 1JMTA 1F40A 1SB6A 2G2YA 3RGIA 1JNZB 2A3AA 3I0SA 4K2XA 4OLPA 1UVNA 1JNTA 2V4QA 5DDQC 2VU5A 2F1FA 5EWEA 1LFWA 1ZPVA 5KTQA 3DDKA 4HTIA 4YUDA 2LQ9A 3EGVA 4GO7X 2IYIA 1E6YB 3UQSA 1IBMF 4DQPA 2FZCB 2GMJA 4PWUA 2M1IA 1FKSA 2ESCA 3TDBA 1SUQA 2HFSA 4LVNP 3NS6A 4DRJA 1HBOB 3ADAC 3TQEA 3W9IA 2ZOMA 2BJ1A 4GGQA 4ER8A 1S10A 4UZBA 1REVB 4MFBA 4YY3F 4CO1A 4IYQA 2NYIA 2I6WA 3SI8A 2AGQA 2RHQB 2JVRA 1MU2A 2EKNA 2E1CA 1X4CA 4CO3A 4UT4A 3MTJA 4O3RA 3FSXA 2LCWA 3CJ3A 3I0RB 1URNA 2JFDA 1JLFA 2LXIA 3G6LA 3O5KA 1HNVA 1VHFA 1T03A 4W9PA 2ZEJA 3POTB 2WVFA 3RW7A 4DPUA 1QVGR 1HPZA 3UQIA 1HQUB 2IM2A 4P8VA 2MKHA 2ZUAA 1XR5A 2H3EB 3MWBA 5C42A 4IR1A 3FMBA 3W9HA 2R2TA 2QGFB 3J7Z5 1DTTA 2HSEB 3JS9A 4PG8A 1M90T 2QLFB 1TKZA 2FZGB 4FPIA 3KAIA 3PACA 4LRCA 1N54B 2FHJD 3WD1A 1UMJA 3BB5A 3HF5A 3ITHA 2YNGA 2RJZA 3MF5A 2IVFB 3Q8QB 3BSNA 1QE1B 3TAQA 4IRCA 1IVZA 4QIWD 1N5QA 5H1SV 4I6AA 1C0TB 1EAYC 4R0XA 2BXJA 3PJWA 4OYZA 3M8PA 5DEZA 3WIVA 4I2QA 3W66A 4DU8A 3RAXA 1SC3B 4JV0A 2D3OR 1YLXA 2PI4A 1I3OB 2F8HA 3US5A 3MUTP 2YPZA 4FF2A 1IKWA 9ATCB 4WZQA 2CYYA 3DLKA 1SL1A 3U02A 1WHXA 4NLVA 2ZH6A 3PRBA 4ODMA 2KDOA 4HR2A 4ZPCA 3TZZA 4ZP9A 1YBUA 2HQIA 3AS3A 3SFGA 3DLKB 1IQZA 5HW6A 2DY9A 2YWKA 2JSXA 2VG6B 2ALYB 2WW8A 3FCVA 3MM5B 4QJVA 1FDDA 2PMZD 2RAQA 3LUOA 3HFVA 1J4RA 4XPEA 4Y34A 1XMQF 1GFWB 2FVQA 1EIYB 1FDNA 4IT6A 2IJNA 3GIRA 1FK9B 2HQCA 2D69A 2W8LA 4ZVUB 1ZB5A 3BQ0A 3MDYB 4FS1A 1LWEA 5DDPC 2NREA 1GXTA 1X9WA 1HKIA 3A8EA 2NQPA 3KYLA 1BXNA 2WBRA 3PW2A 3LALA 1KNZA 3DRRB 4USVA 1N32F 4MAVA 1HBUB 1FRKA 3C6TA 3R7BB 2VC1A 5DLFA 2J6TA 2PSZA 3DXSX 4TLRA 4YDDB 3ARRA 3OFGA 4NL5A 1IXKA 5A2QU 3ALGA 1E6NA 4RW9B 5D75A 4C7QA 6FD1A 2FYXA 4ZPWR 1X4FA 3CCVS 2V8PA 2AGOA 3BGUA 4DUZJ 1FE0A 5T41A 2XMVA 2E66A 3HHDA 1S77D 3QLHA 2HNYB 2XBPA 2CQPA 4K4WA 4EBEA 1ITPA 2VQFJ 4E2FB 1QAJA 4WKYA 1RAHB 4F67A 5LSRA 1X0FA 4MNJA 1VRQC 2Y1RI 3N6NA 4S3JA 3M6UA 4ID5B 2EXUA 2Q6BA 5F0WA 4CLTA 4FYXB 4ZHRB 3CHFA 1S9FA 1H6KX 3K8VA 3W2VB 2AYGA 2HYIB 1QLNA 2DNQA 3W5YA 4Q7NA 4OJ3A 2OPQB 4TW7A 5K5MA 1UWBA 3NRKA 3BM7A 2DSUA 2QX0A 3LO3A 4NA1A 4WTYA 4ED8A 4CH7A 3W2VA 1FNOA 1TP7A 2A0FB 4C2MA 2KL8A 2LVWA 1KS2A 2PIIA 1IM6A 4HL9A 3N79A 4LSNB 4LSLB 4QR0A 2CVIA 4NLTA 3G2XA 5KFOA 2E5HA 3SIPB 2WK4A 1SV5A 3EDRB 3FK4A 4DV6F 3FC9A 4RW8B
chains in the Genus database with same CATH topology
3OJUA 3W4RA 4FAPA 4U86A 1NK8A 3N9UC 1SXLA 4RNOA 4I2PA 3IO1A 4ITZA 5EN1A 2LPVA 1WI6A 4K0KF 4RUCA 1U1MA 3PFOA 1TKXA 3N5BA 2LYVA 3O5MA 4I2PB 4ZCIA 2RKIA 4QIBA 2ZBIA 3AJ2A 4BC7A 2C2DA 1FKOB 4AUKA 1U48A 4QPXA 1UVLA 4ERDA 3OR1A 5B09A 4DWSB 4V19X 4YB5A 1RT3B 2CJQA 5IFMA 1SUQB 4X62F 1YHQS 4QIFA 2YBTA 4DMZA 2UUBF 4M8LA 2OFHX 2EG1A 4YFUA 3MOZA 1H0HB 3BGFA 5KFSA 4J9NA 3MUVP 1RWUA 2K1RB 1ROTA 1HQEB 2FLLA 4UW2A 3CGMA 1GXUA 2GHVC 4OHWA 5FDLB 4AE5A 4F4YA 4ECYA 2LEBA 4BS2A 1M1KT 1IQTA 4C8LA 2DCUB 3SDEA 2X1FA 4EO6A 5I98A 2RRAA 2DIUA 1ZAXA 1L5UA 4U85A 3RR8A 1GOIA 3O5IA 1X4BA 4ED1A 4X4NA 4NLYA 1GT8A 1FKTA 3M32A 1LQ9A 2HHUA 4NRUA 4M95A 2ZH4A 4NA3A 4O3SA 3P49B 1TL4A 3PA7A 2YKAA 3PM9A 1YJNS 2X1GA 5EHHA 4ODQA 1CTNA 3FSIA 4FXVA 2YNFA 3M8PB 4F50A 1U1RA 2HW3A 2PPNA 3W2WB 2DITA 1R3NA 3QGHA 4ODRA 4DV3F 3L95X 2MPHA 1RTHA 3MMJA 4FPRA 2YNHB 2ROEA 4HBEA 5F8MA 3HHNB 1ZBTA 1LV5A 1RTHB 4WU3A 4A8QA 3WC0A 4NLUA 4LFCF 3TNVA 2HMIB 1ZM3A 2VG6A 4PWDB 2VD3A 4IG3A 1BQMA 5LSLA 1FT8A 2QRRA 3HDSA 1LWEB 3CCSS 4ELVA 2M9KA 4DSLA 4J9LA 1LKZA 4AYBD 5JH8A 1N5TA 1TV6B 2BBEA 2IM1A 2N4CA 3CT9A 1FD2A 4TYOA 2OSQA 3IAM9 4WE1B 5KFFA 5F8NA 1H98A 3IA0A 4ZPVR 4HH1A 1KC8T 2KT3A 2ZH5A 1YJUA 4DRKA 3UW1A 3TUZC 4MJKA 4WE1A 3H40A 4X2BA 1FKHA 3HZGA 3RRHA 3CO9A 3MTKA 4RW9A 3VAIA 1OO0B 3PXGa 1H2TZ 3VQSA 2JEJA 5I4MA 1NKCA 1M5HA 1FNXH 4K50A 3MPYA 4ECSA 1QAYA 5D6GA 4H4OB 3GYNA 5J2PA 3JTOA 4PRFA 4KC5A 1KT1A 4DQSA 2GIRA 2ZHAA 2B31A 4H4OA 5JJBA 1R8CA 2OPQA 1HR0F 1NHUA 2QA2A 2HWTA 3H59A 1XNQF 3TVKA 1N5SA 2KU7A 2EPIA 2MQPA 4DSKA 4JI2F 4F26A 2L2SA 4NLRA 4JI6F 3K59A 2BA9A 3UDCA 4JI7F 2HNZA 3PKMA 4WKRA 2YNIA 1D9AA 2W7AA 3HKZD 4KPYA 1KN6A 5A8RA 5HMWA 1RT1A 4TN2A 2GJIA 5EDWA 2DGTA 2OP5A 1F2GA 2FJAB 2WRMA 2PD1A 4IOBA 5MLCV 1V6HA 4WFZA 3NGDA 1ZBCA 3T6BA 1L3TA 1T05A 2CPZA 3GR1A 3GFYA 4LF7F 1FTCA 1NJXA 2MLZA 1K9TA 1JIHA 1FVQA 3IRXB 5E33A 3MR3A 3LWLA 3CGNA 2ZM6F 1N48A 5E41A 4JV5F 2ZH1A 3V6DB 1NAQA 2KJWA 3O5QA 2YWHA 5K8MA 2HHSA 1NH7A 3OBIA 1X4EA 3BEGB 4DZ3A 1MWZA 1C9HA 2UVUA 3ZZUA 3C3LA 3MEGA 1R31A 4EZ6A 1F5CA 4BDPA 1KHVA 2EFVA 3UR0A 3OW2R 1QUPA 2DVIA 3AS2A 4USJC 3KAGA 1EP4A 1LK7A 2JFKA 5CYQA 3MEGB 2ZJQQ 4DQRA 2M3DA 1L3SA 4EZ9A 1QVFR 3HK2A 3RFWA 4PPDA 3OPKA 1RTJB 5E3RA 2VL1A 4Z2GA 1EP4B 5CYQB 3L7PA 2FIUA 4FBTA 3QAEA 1E9LA 2WOMA 1Y9OA 2Q1LA 3MEDA 1RTIB 2PDAA 3DLGB 3SDEB 3K5MA 4CT9A 1SL2A 4YOEA 3CDBA 2ZD1B 3DU6A 4IOAQ 4X4UA 2XHWA 1RQ0A 3MM7B 3VAGA 1X9SA 2AX1A 1FF2A 4K59A 1FJGF 3FZ2A 1HA1A 2AJFE 2HWHA 2DH9A 2YX7A 3N5FA 2CQ4A 2ZC3A 4C4WA 3PNIA 2CQIA 1T95A 2FJEB 2DPJA 1G6BA 1HD0A 2IBOA 1IKVA 2J7UA 3HT3A 1C1BA 2ALZA 2OPPA 3FQKA 2FHMA 3TC5A 2BM1A 4WIIA 2PFFB 5A8WB 2AYMA 3S1TA 3Q8RB 4IQCA 4JFLA 2HPUA 2YKNB 1OWXA 1U2FA 1U26A 1HMVA 3KLEB 1U1KA 4AL5A 3CC7S 5G0RB 5AE2A 1N0UA 2MZSA 2XMWA 1JJ2R 4C98A 4DR3F 2MKCA 1ITXA 1HI8A 2XSJA 4M5DA 4DR2F 2MNTA 4UQGA 4QIEA 2J0QD 1KVIA 1VS3A 4Y00A 4MNLA 2A2DA 2KT5A 1VQPS 3R1LA 2OLWA 3IR7B 3BJYA 2I38A 3NG8A 2CJBA 3PRDA 3MEKA 3MHYA 4MAKA 5DM6Q 1RISA 3ITHB 5IM0B 1OPIA 1FTRA 4MGVA 3WZ0A 3LP2B 4DF4A 1VBYA 5KFYA 5H9EJ 3O2IA 3ZZYA 1RTDB 1P1LA 2XI2A 2LXFA 3NP5A 2DR7A 2Q79A 3LP2A 2Q43A 2DGSA 3OA5A 3AB2B 4CO0A 4J9RA 4KGMA 4NLDA 1ZL1A 4QR2A 1NJIT 2VASA 5HKGA 2ZHOA 3M2VB 4J5OA 3OVAA 1HJXA 2LJ4A 2G41A 1IKYB 2IC3A 3UR3C 4NLPA 2RU3A 2CPFA 3LF0A 3NBPA 1X4AA 3MM5A 2MJNA 1VIOA 1H2VZ 2B9YA 3RB3A 5CD4H 5J1EA 1FKAF 4LAXA 4EWTA 2WLZA 2NSCA 1Y0HA 3RB0A 3VZIA 2JC0A 2CPYA 2OFNA 4WCEQ 1DQ9A 4Z2JA 4ECWA 1N6QA 1HBUA 1HWUA 1P8GA 2RQ4A 3OTBA 3QZ8A 5JVGQ 2VQFF 3LAMA 4WKFA 2MSTA 3OSPA 5HMYA 2FVCA 4CQ1A 4OX8A 4Y2MA 2VPYB 2HNZB 2W9AA 4G1IA 3T19A 2PT0A 3FCHA 1MW7A 1NZAA 1S99A 1XWLA 2PO4A 4QPTA 3BDEA 4IH5A 3OR2A 4ZVGA 4BHQA 1IBKF 2VZ9A 3MEEB 2HGNA 4C8OA 2I8EA 3CJKB 4BF8A 2W8KA 5JXSA 3GIIA 1RJJA 3OR2B 2KKHA 2R2UA 1ZM9A 2WLYA 1K9MT 2DHAA 4WFNQ 3CDUA 3OXLA 4ID5A 4IO9Q 2A1BA 1WNOA 3X1LB 2JDJA 3AH6A 3NNAA 1LQ0A 1NEEA 2VKRA 4ZP7A 1VMBA 1S1WB 2KB2A 2KRBA 1UWBB 3BREA 1JXEA 4ZPAA 2DB1A 4RBTA 5KFIA 4E0DA 2KZMA 1Y3KA 3P96A 1YRTA 5KFAA 2E5JA 4DUZF 1DURA 1HFEL 2UV8G 2E1AA 2ZBCA 4ED5A 1GTEA 3Q22A 3VF0B 3H5SA 4LIRA 1VQ4S 2FDNA 1U45A 2M5YA 2AP6A 1U47A 4PUOA 2MF9A 2ZZMA 3B9DA 2HLTA 3DRYA 1X5TA 5DDOC 4CZCA 3WD4A 3VWSA 3MM8B 5I3PA 3OLAA 3UCZP 3QO9A 4ILMA 1BD6A 4DR6F 2ZD1A 2JZVA 1FRLA 4HHJA 1ZETA 3TUJC 3MM8A 1S1XB 1JNRB 4YEAA 3H2VE 3RRKA 3PHEA 3RB4A 2EFNA 1HD1A 3OL7A 5HBMB 5F8JA 2CPEA 2W4PA 2YKMA 4Y28C 2ZZNA 5AXKA 1M5PC 4JV2A 1S1XA 4O4GB 3UD3P 3TVYA 1RT3A 4A46A 5DRKA 4ECXA 1P5QA 2PBCA 2AJ0A 2BR0A 4KKOA 2KZZA 4F4WA 1E6YA 2OPSA 4Q8EA 3OQ2A 5FIIA 4TY8A 4USHA 3CWJA 5L39A 4TU7A 1NJZA 4H54A 3H5YA 2GC8A 1KLMB 1IKXA 1MWYA 2OMOA 5FDLA 3KG4A 2E7XA 5H9FJ 3LP1A 4FN5A 1FRXA 2L9WA 2I5JB 1N56A 4M5DB 5BJRA 1OGBA 3GILA 4Y2KA 1FRMA 2M88A 3O5EA 2MZJA 5FJ4A 1EETB 3CD5A 3ALFA 1X4HA 4BBYA 3B8SA 3ARYA 1CSJA 1QE1A 3ENWA 3T6JA 5CYJA 2QMWA 1F5AA 3RW6A 4J9MA 3BR8A 4J9SA 1D8YA 2B4OA 3CDEA 1HWIA 2KN4A 1S9GB 2LXUA 3FRYA 4I0WA 1HWKA 3TX8A 4A47A 1E6VB 1SBRA 1TKZB 1SL1A 4RUAA 4RNMA 3H5UA 5LL6d 3G9CA 1APSA 2KXHA 1GNKA 2LDIA 2ZHBA 2JEGA 3T5KA 4IOCQ 3FSYA 4N56A 3MOJB 2F9JA 2L9DA 3RU0A 2R7TA 1D8ZA 5HWCA 3KMSA 5BYRA 3JSRA 3J80Y 2YNHA 4ECQA 4F4XA 1LL6A 3M2VA 3MCSA 3MGJA 1SJQA 2B7BB 3O3LA 1QM9A 1WF1A 4DOZA 1UVJA 2HMIA 3I4HX 2CQ3A 3UCUP 2IMOA 3NCQA 3T5LA 1WNEA 3SQGA 1BKFA 5HW8A 1X6LA 3DLLQ 2A10A 4ZVEA 4AXIA 2IAJA 1D1UA 5E2QA 2VCDA 1FERA 4ED0A 2ZH8A 2J0SD