4XAKA

Crystal structure of potent neutralizing antibody m336 in complex with mers co-v rbd
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike glycoprotein
publication title Junctional and allele-specific residues are critical for MERS-CoV neutralization by an exceptionally potent germline-like antibody.
pubmed doi rcsb
source organism Human coronavirus emc
molecule tags Immune system
total genus 49
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09408 Spike_rec_bind Spike receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4xakA02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4xakA01
2DD8S 2GHWA 3SCJE 3D0IE 4L72B 4ZPTR 5DO2A 3SCKE 4XAKA 3SCLE 4KR0B 4ZPVR 4QZVB 3D0GE 4ZS6A 3D0HE 4KQZA 2AJFE 4ZPWR 3BGFA 3SCIE 4L3NA 2GHVC
chains in the Genus database with same CATH superfamily
1YVFA 3O5IA 4ECYA 1UJ5A 1HPZB 4NI2A 3NS6A 3OL8A 4Z2KA 4UZBA 3DGVA 3LA0A 4MFBB 2DR9A 4O4GA 2PGCA 4U9RA 3RG6A 1NAQA 1WELA 4G3IA 1MMNA 3K2YA 3PX4A 5K8MA 2DNHA 2IC3B 1DTTA 1LWCB 5CQGA 3CH9A 4J9UE 3OFEA 3BS9A 2UUAJ 3V81B 3CIMA 2B7CB 2OD4A 1Q79A 2G13A 3FNNA 1BQNA 3MUMP 2ZE2B 4RW6A 1OY9A 4C8OA 2IVFB 2F21A 4WPAA 5FJ4A 1CPZA 5ETQA 4NE9C 2OPQB 3RU0A 1PG5B 5GAEU 1U48A 2XS5A 5JMNA 4NMXA 1M1GA 2JL9A 3MCSA 5F3ZA 3RW6A 2F3JA 2PT0A 5HROB 4EFAC 1M1KT 2HYIB 5BR8J 3W2WA 1RWOB 4N7TA 2YKOA 4DWIA 1X4CA 4MAVA 7FDRA 2PV1A 3H2VE 4LBPA 2EKYA 4NRTA 2QA4G 2XP8A 2X3GA 3N01A 3HKWA 3LUOA 3JQKA 2YKMA 3R3TA 1Q16B 1W2BR 3FGVA 4WXOA 2KHCA 1RT4B 4J7CA 2ZZNA 1MMLA 2O5DA 4URQU 4J9SA 1R31A 2BKNA 4BS2A 1U09A 3TUIC 1N56A 3OR2B 2X1BA 2CQ0A 1RBAA 1WD6A 3KDOA 4B3SF 3H5XA 1HQUB 3D6MB 5HBFA 3AB4B 4ATNA 3A3PB 4F0HA 2OUGA 2BRLA 1NWUA 2A3JA 2ZNZA 2KZMA 2DEJA 1IX5A 1Z2ZA 3DOMA 1WF2A 4DR7J 1VQYA 4HBEA 3POTB 1U0HA 4WWSA 2N87A 4C3MA 4IQCA 1U45A 3GB0A 1YATA 2VFRA 3QAEA 3CCJS 5ETSA 5M2UA 2R8HA 1YW5A 2DGTA 1XERA 2RSEA 1RWXB 1FA0A 1LNQA 3W61A 5LMNJ 1K47A 1VFJA 2BJ8A 2AKWB 3GYXB 4ECSA 2IA0A 3DLEA 3SSQA 4K0KJ 4TY8A 2ETNA 1DURA 4JV5J 2VDIA 4C3KA 2BABA 4UUXA 4P71A 1RWVB 4HI2A 3HXMA 2YQ1A 3PIOQ 5E33A 2IRYA 2GHWA 3AROA 3T1AA 2R7WA 3O5DA 2KT5A 1GX5A 3QOKA 1GFWB 4EI2A 5D3GB 5IS2A 3KUGA 1N1AA 4O0NA 2QSFA 3BO4A 3QWUA 2VPYB 3VAHA 2Q79A 4NEZA 1SYTA 3TVZA 4JUZA 3NXZA 1J2VA 1SUQB 5LSOA 3A3OB 1FJDA 4JFJA 1QD1A 3DM2B 4BLGA 2IDEA 3BJYA 4JFKA 3W8PA 3WIJA 5SZTA 3UN2A 5J2NA 1BGXT 5KOXA 2VN1A 3CSKA 4WU3A 4DRMA 3IWNC 1FKLA 1Q78A 3GR1A 2ZQSA 1AUDA 1F5BA 4DZ6A 4ER8A 2L48A 4USHA 1CJKA 1NJIT 3H25A 4LFCJ 5KG0A 1P6TA 3GIKA 2XM3A 3I82A 1M1HA 3MD3A 1DHMA 3NWRA 3DYAB 1SH3A 1N0UA 3N5BA 3ETOA 3KK1B 5MLCV 2Z4PA 2GHPA 1HWLA 1WSRA 2G9OA 5M2RA 5CYQB 3D68A 4CM0A 4IR9A 4ED3A 2C2KB 2QG9B 4YB1P 5IC6B 4U8YA 4QIBA 1RLDA 4EBCA 3G2XA 4U96A 1Q1CA 4OMFG 4QWEA 4PXCA 3TNVA 3CTRA 3WD4A 1NK6A 4DQPA 1SC4B 1F6TA 2W7OA 4XO0A 2QC3A 4P8UA 4H54A 3RW7A 3CZ8A 4USMA 2KKHA 3OR1A 4G1IA 4TKTA 2BM1A 2G2OA 3SCIE 3LOUA 1RB0A 1IR1A 1AZSA 3CC2S 4ZPBA 3H2LA 2FLOA 2W1BA 2CXEA 4B3MJ 4F4WA 4DV2J 1T9XA 4W9PA 1RQ0A 2XI2A 5KG7A 5HP1A 4O3NA 3BQ0A 4BC7A 1OSCA 4FAPA 2KXHA 2W24A 4DMZA 1RT5A 3I9ZA 3IKDA 4E2FB 3WIUA 3IN5A 5I42A 4DQSA 2VG5B 3KAFA 2KFWA 2ZC4A 4J37A 3M1VB 2WTFA 1S10A 1QPLA 4CLUA 1DLOB 1JNSA 3SSSA 4GGQA 1WAWA 2QLJB 1N5QA 4DSLA 1FFGB 1KDNA 3G6ES 1LW2B 4FYXB 4EYHB 1KLNA 1IKYB 1HBMB 2KE0A 2RJZA 1EYMA 4BBYA 2DGVA 3DNCA 1REVA 2K7KA 4DF4A 4NMLA 2ZHOA 4WKYA 3C14B 2BE2A 2Y1RI 4CLYA 2O3DA 2Q6BA 4FKXA 3PR5B 4WK3A 4A8KA 3NS7B 1FFRA 1KOHA 1RLCL 1XK8A 3MGJA 3GIIA 3VAWA 4DL6A 4QYRA 3OSNA 1FI4A 1H74A 5AJ3J 3RRHA 3GV8B 2ZD1B 4OHYA 1R6VA 3SBMA 2E1MC 4ZCIA 2VQFJ 3PYEA 1LKZA 4U8VA 1K8AT 5G0RB 2AZ3A 1SQGA 3CO9A 4DI6A 3G8SA 2QMWA 4B9MA 1MG7A 5LT5A 1PGZA 1ZBTA 3FAPA 1EZZB 2HSEB 5I3UB 3TEGA 3PR9A 4X65F 3H20A 3GIJA 4G1QA 1DARA 5K8OA 3A1YG 5HUAA 2NQPA 5E5NA 4QIFA 4OI0A 2LXFA 2UXDJ 1H0IA 2WONB 4DV7J 3CGNA 5I4MA 1SJ1A 2IA6A 3DRRB 2UU9J 3UO0A 2D9OA 3S6EA 2FLNA 4NEYA 2QFIA 3OTOF 4JI2F 4IRDA 4IQMA 3GR0A 4LF9J 2GX8A 3VAIA 2DYAA 3CO0P 3EZ5A 3O6QA 3HHLA 4W92B 4NLDA 2QSWA 1XEZA 3PR4A 1ROUA 2WB1D 3NRBA 3GSDA 2KO7A 2V0NA 3IXQA 3RBXA 3HP6A 5T7LB 2BJ3A 4YUDA 3BR8A 1F40A 2KJVA 1VCTA 3G82A 1U26A 1W1YA 4EO6A 2U1AA 2EFOA 1JWWA 1KFSA 1FKOB 1IR2A 1RT2B 3WL0A 1T9TA 3O5OA 4Y28C 2QN6B 4AYBD 3QFWA 4DV0J 4LRBA 4QT3A 1X4EA 4N41A 2MSTA 1JJ4A 2V8HA 1U4BA 2KRRA 4X4SA 4DG1A 1A6LA 3QZ7A 4NLGA 4N76A 2FVQA 3ZNUA 1ZU8A 3D66A 2E7VA 2APOA 2V2QA 1CEZA 2HHSA 3J80U 2NZ4A 3MEDA 3H40A 1NHVA 1TMJA 2CQ1A 3UDVA 4AFFA 3C6TB 5E3RA 2DH7A 1V9OA 4RW9A 1W9PA 3K58A 1EQMA 1HNVB 2XZDB 2UVWA 4IG0B 3CHEA 2BQRA 4O3RA 4ICLB 5CCMA 1N32F 4MNJA 2UUCF 2DHSA 3LTOA 8ATCB 1RYSA 1X4HA 3G6LA 3OJSA 4K4UA 3EICA 3SSRA 5F8LA 3D1QA 4YB5A 2ZH3A 3QGHA 2QMUB 2GHVC 2HQDA 1YBTA 3CJKB 2BJ7A 1TVRA 1FF2A 2E1AA 4G6VB 2IMOA 3JB9k 3TOQA 3KLFA 3QQCD 3M9NB 1GMUA 2C42A 4LFAJ 1XIQA 4C0BA 4ED7A 4OZNA 1V3SA 2Y78A 3MM8B 3WD1A 1WKJA 1P9QC 4X4OA 4F36A 3QT6A 3UCZP 1YSJA 5I98A 1NWRA 2OPPB 3TX8A 3CF5Q 3VF0B 1WOSA 4O2TA 1U1QA 4P8WA 3GFXA 4MK9A 3L3CA 2MLYA 3UI5A 3H4BA 2LPVA 3K89A 3TJ8A 3M9MB 4ZVTB 2CJ9A 3ZTQA 1IKWB 4MPKA 1HI1A 3ISZA 4YS2A 1U02A 1L5UA 2E5GA 1X5OA 2GA7A 4NLQA 3HK2A 4ILMA 3HHLC 1WI6A 1AA1B 3D9BA 1TKZB 4CYUA 1C9HA 3PO4A 2HEKA 4UOHA 4J5OA 1S0NA 4ZP9A 3PW2A 2M2BA 2R7QA 2IJNA 4JI0F 3DLKB 4O0IA 3OUYA 2FJWA 4OJ1A 4PYAA 1EHWA 2DCLA 2NXCA 4DWSB 1RA7A 1TK0A 2FPHX 3BEGB 3ARVA 1TKTA 2DO0A 4O23A 2L9WA 1QUVA 3R5CA 3TW0A 1PYSB 1S77D 4MAKA 4ZIVA 4ETXA 4JI1F 1B0PA 1VJWA 4M95A 2YBUA 1IJEB 3I0SB 2AJ2A 3H5UA 5AE2A 3NL0A 2RQMA 2QLXA 4MKBA 4KPCA 1U1RA 2D3ZA 3MURP 3NCRA 3GV7B 5LXRA 1VHIA 3I31A 3T9NA 3MCOA 5J1EA 4CWBA 4KPYA 2NSBA 2V50A 2XMKA 3PFEA 3ARRA 1RAHB 1FK9B 1D6OA 3KG1A 4DS5A 2R7OA 5KFDA 1HWKA 3OBIA 3ZZPA 3D0GE 4ZP8A 2F23A 1LL7A 4B3SJ 2IRUA 3RAMA 1Y10A 3MEKA 1EARA 2FGCA 3HVRA 2MHEA 5EHHA 4AL6A 1OWQA 4B3OA 3MHYA 4WFBQ 2WAQD 2HNZA 5HJXA 1JIHA 3MMJA 2G2YA 4Q22A 2RAQA 5F0WA 3I5CA 5HK4A 3TC5A 4F8RA 3Q8VA 4N77A 1D09B 1X31C 5DRKA 2C2EA 3DRPA 2F4FA 3MEEB 4HDHA 4DFKA 4PR6A 2CA9A 3W2VB 4P8VA 5KG5A 4TX0A 1O5JA 4I6WA 4LRCA 3MEGB 2KG1A 1PAUB 1QM9A 2ZR4A 5LMUF 1VQMS 2HQ3A 2YWWA 1ZTTA 5E3QA 5HMXA 1H73A 1GT8A 3N6LA 1LWEB 4ECVA 1GUVA 1OSDA 3MMBB 3EXCX 5IZHA 5IT9Y 5F9LA 3CEDA 2MKSA 5HQMA 1V3RA 3BMBA 4C11B 3NAHA 1TKXB 3AAWB 2DPJA 3KLIA 2R2UA 3N4WA 3MAQA 3ET6B 4PWUA 3HVWA 3MM5B 1R8AA 2BUNA 1CJUB 2G0IA 4QU6A 2VDHA 2C3PA 5HO4A 1CULB 3CWJA 1S9GB 2JEGA 2AMCB 4A8XA 2RF2A 3IG1B 1S0OA 1TFYA 2M08A 2N7CA 2LU2A 1R6YA 1AROP 4F4YA 1HWUA 3OT9A 9ATCB 4LIRA 5DLFA 1E9LA 1JLQA 1TZ0A 2FY8A 2CPXA 6FDRA 2HLTA 2HLUA 4WTYA 4M94A 2J6SA 1T9WA 4F0MA 2V68A 1EP4B 3NGDA 4AXIA 1T03A 3W62A 2YNIA 2RVJA 2G2ZA 2DG4A 3OTEA 2ASJA 2V4JB 5K5MA 3KK2A 5GAGI 2FVPA 2XBPA 3B6BA 4X66F 1Y0OA 3VZIA 3H2UB 2WVCA 1AT1B 4MJKA 4PQUA 4JV1A 4QIGA 3TR5A 4Z7YA 2F4VF 4IH5A 2A3BA 4ODRA 2OD6A 1WORA 4XDCA 1Q8LA 2Q66A 5H9EJ 4JOUA 3V6DA 1GX6A 1MSWD 3R2DJ 1X9WA 2WVDA 2PO4A 2ROGA 3UVJB 1VBXA 1P27B 2V9KA 3C2PA 3M32A 5B09A 2AGPA 1SL2A 2FJVA 2YQ0A 4H4MB 1VC0A 3TARA 3BKTA 2J0QD 2C2MB 1YBUA 2JDJA 1FVSA 5L1KA 3LPYA 4I1TA 3CGIA 1SC1B 5IWAF 1NO8A 3AA9A 4MNMA 2MHNA 4A47A 5A8KB 1UEVA 3DMJB 1N52B 2VHGA 4J9MA 5CXTA 4JI8J 5AXKA 3WX8A 2VCDA 1FWKA 2A0FB 3J7Z5 1E6YB 4BF8A 1X9MA 2RURA 2ASDA 4WBFA 1HBOA 4JB8B 3DGPB 1E6VB 1K1QA 4EZ6A 4ZDNA 2MXYA 1T05B 4X4VA 3ENAA 1S6QB 2E9ZA 2HFUA 2C2DA 2OFHX 4DV3F 4O4GB 1U2RA 1ZPWX 3GE9A 3QIDA 2M88A 1ITXA 2V69A 3CT9A 4C3LA 2J76E 4QW8A 3RR7A 4D3GA 4FYWB 1HQEB 4IFYA 3D0HE 3L4BC 4Q0BB 3IBCB 3PACA 3IWXA 4TNSA 3MR7A 4PWDA 2DR6A 1XNRF 4Y3CA 2C3MA 4RNHA 4ENOA 4WJXA 1WEZA 4KGVB 1RHUB 3EXYA 1FESA 4JBCA 4LF7F 3EUNA 4DRNA 2OO4A 3MFHA 1TMMA 2H9ZA 2ZDPA 3O8WA 4KV8B 1UVNA 2KTQA 1B7YB 1I51B 3KLGA 4ZPVR 4X65J 1U49A 1RTDB 4IDKA 3M7VA 4OZLA 3HHLD 1XTZA 1ZM4A 2XPAA 1FXDA 1HJVA 5EWGA 1KFWA 2BOPA 2FZCB 4DJBA 5MAOA 5CD4A 3J81U 3AHPA 1HIYA 4CZCA 4QCLA 4P2SA 4JI2J 1VMBA 2MZSA 3PFOA 4UUWA 4EGLA 2HVEA 2OMOA 5FDLA 3CC7S 2AJ4A 3NWGA 4P2FA 1FXLA 1TL3A 3GJQB 3KHGA 4ZVFA 3JTPA 1NH8A 3LP2A 1Q5YA 3KHHA 1FDNA 7AT1B 1KOOA 4I7FB 1C1BA 3RYLA 2PMHA 1T95A 1OMSA 4ZHRA 3FMWA 2VODA 2HFZA 1HKAA 2UVVA 3O5JA 4K5SA 4DV5F 5J2QA 2G0CA 2DG9A 2NREA 2Q3PA 3FUYA 1IM6A 2FY1A 4FF3A 4EK2A 1FCAA 2MPHA 3M8QA 4ZVQB 2XS7A 4DR2F 2UXBJ 1RP5A 4R0JA 4XPCA 1D9FA 4LF5J 3NGSA 1KQGB 3VVTA 1C2PA 5IV3A 1R43A 3HI9A 1S6PB 1RE1B 2ZBIA 3FSYA 1L3TA 1HNZF 4UF4A 1FD8A 5HWBA 1KHWA 1DQ9A 4UOFA 3QFHA 1F60B 4LSNB 3FQKA 4ZK7M 3OXLA 3D3BJ 2HHHF 3CVKA 3VAMA 4I0WA 4ZJOA 3IWLA 2CAJA 3B8HA 2VF3A 1MNEA 1N32J 4PG6A 1RSCA 5CA5A 1S1VA 1SV5A 2Z58B 1TL7A 4DQRA 2UXCF 1F3VA 1RTHB 2ILZA 4LIWA 3FEXB 5I3PA 3SIPB 1LWFB 5A76A 5KFXA 2F1FA 3UN5A 1QUPA 5DITA 3M2RA 3HT0A 3Q8SB 3PEHA 3GV5B 1O6XA 1H3DA 1HPZA 1Q5VA 4C2MA 2AWZA 4HTJA 1N0VC 4QR0A 2GNKA 2CJXB 9RUBA 4MFBA 2B43A 2FZKB 3WBZA 2I38A 3KJNB 1IBKJ 4UY8T 5E3PA 5ETKA 1JCHB 1L3KA 3BSAA 2IC3A 1LWCA 1HD0A 1BMQB 2POKA 3V81A 5DM7Q 2XSFA 5B0GA 4F7VA 2WZ1A 4IG3B 1WC3A 1JX4A 2P2CB 4NLVA 3UDLA 3QWPA 3NGTA 1MU2B 4X4NA 2ZE2A 1T9VA 3KK3B 2JOQA 1U1PA 2VL1A 3TEHB 2JWNA 2Y8WA 1VYAA 2JLFA 2VIHA 2LVWA 1FFSB 2MQ8A 3GYGA 5G4DA 1U8WA 5C42B 4MIBA 3MZIA 3OHBA 2ZWOA 5HROA 3G87A 3VGUA 3RM4A 3P4UB 4OZ0A 3BBBA 2DD8S 1CTNA 1JVWA 1FRMA 2FHJD 3N5FA 3ENWA 4EZ9A 5AE1A 3KFWX 4TW6A 4FVCA 4RO0A 1UJ4A 3PG9A 5RUBA 5KAKA 4DUYJ 1XMOF 4ZN3A 1V5IB 5F9NA 3R9LA 1SJ3P 1NDKA 2GFFA 1I3OB 3I4PA 1RT4A 3ARXA 1FVQA 1J5EF 1VBKA 2ZOMA 3TANA 1U6ZA 2KGJA 3R5BA 2CQ4A 5F8NA 2KG0A 3OR2A 3ARQA 4ZVRB 4KC5A 4ECQA 2AX1A 3C16B 2AV5A 4JI1J 1HQUA 3I9V9 4DCPB 3IM9A 4TYBA 2YWHA 2B9XA 3QO9B 2P4VA 3SXLA 4TU9A 3IC1A 2BXJA 1BY9A 1U25A 2KU7A 2MF9A 3POTA 5C2GA 1FE0A 2OHDA 2RUCA 2WBMA 4DEZA 1UJ6A 2H48B 2I0XA 1RWNB 2FVCA 4B02A 1B0TA 1Q53A 1GXUA 4B08A 3B78A 2F9JA 4LREA 2KB2A 3GFHA 4K5RA 2JJ4D 3PW5A 3CMES 2B5UB 3C19A 4P52A 5E3CA 3NOGA 2I9SA 3I87A 3EJMA 1KVKA 5A0YB 3M6WA 3T6JA 2RUGA 1RHQB 2IMWP 3OOBA 4YN3B 3AQPA 1LG2A 4DZDA 2PPPA 1IBLF 1OYDA 1RTIB 3WHIA 3AXMA 2FJDB 2XB2D 3ZXWA 4DBQA 3NEKA 4DDFA 5ETLA 5D3GA 4JI4F 1NK5A 2NPIA 1RWMB 1S0MA 1N36F 5KOWA 1SKRA 4GMKA 3MMCB 2V6AA 3N0VA 3T1YF 1N33F 3JTNA 1SUQA 3O5PA 5LMUJ 3V6JA 1GNKA 4L72B 4A8SA 1FDDA 3DM2A 4DR3J 2HS0A 2FIUA 3EVMA 4QZVB 2GQCA 2H51B 3IP0A 2Z57B 4M5NA 3UNGC 5KFNA 3GIRA 1J4IA 5HBMB 1S99A 3NMRA 1CSJA 3O5GA 1WI8A 1H7XA 4WCEQ 5LM7E 2PE8A 1GMWD 2YWKA 5KFHA 4KIAA 2AF6A 3LAMA 4KSEB 2LXIA 3P3DA 2AHOB 2WCXA 2WSFC 3UQSA 2W8KA 4USIA 5DJBA 1F8AB 3AY0A 2EKNA 3M6VA 2XHWA 3KLVA 4ED2A 1FRXA 2GS8A 2VKZG 2DXEA 3DRSB 3TUPA 1VRQC 1UPMB 3F56A 3DYAA 5DGAA 4RLEA 1FXRA 1IR0A 1KR4A 4DX8H 4MH8A 1UA0A 2VPZB 4ECWA 1JNDA 2VJVA 3KK1A 1WHXA 4AL5A 1BLUA 2COLA 2Y0BB 1ELOA 3EDQB 1RT3B 4DRHA 4DR1J 3LWLA 5CYQA 5GMKa 2RDDA 1Q81T 3Q23A 4TN2A 2DPEA 2K8GA 2ZITA 2BBEA 3TQEA 3QJJA 3DLGA 2ZBPA 4LF8F 2QL5B 2FKEA 4WP9A 2DR7A 1NDPA 2F7VA 3K57A 3A8JA 5FLXY 1RBLA 2LCWA 4R5EA 4P7VA 4KO0B 1TU0B 4UT4A 4LUBA 4MTVA 2AYBA 2WLZA 4RPFA 1HFEL 3I4HX 4ZVSB 2Q5AA 2LQJA 3P5TL 2Y3YA 4TU7A 1S1TB 2GQQA 2XC9A 4X66J 1NSGA 3AD9C 1R8PA 1W2IA 2I5JB 1CLFA 5EWFA 2DGWA 4NASA 2C22A 3H4DA 2PD1A 1TL1B 3CB4A 2BZ2A 3R97A 1UW9A 1F1BB 3IGNA 3WIVA 3QT8A 2WW4A 3VGVA 2OEMA 2RRAA 4ANDA 4EWTA 3VVUA 2NUHA 1UKUA 3W3SA 3VQSA 4EYIB 4LSLB 3E51A 1VQOS 1S79A 3D67A 1D2KA 2VG5A 4CDIA 1QTMA 1HWJA 3GWCA 2JHEA 2QF8A 3M1VA 3FC9A 2A2CA 1MWQA 3I55S 1DLOA 1VRTB 2B4UA 4HLBA 1NJZA 3ISNC 3D28A 1VQ7S 1LW2A 1TAUA 4HACB 1IKYA 1HBMA 1LV5A 3WL1A 3BGOP 4N8OA 1VQ6S 4TYAA 5L46A 1Y3JA 3C14A 4IFVB 2BJEA 4WXWA 1LFWA 3DLBA 1UWBB 5IWAJ 2YQ3A 2PPNA 3UN3A 5B0FA 3KYLA 4OZ5A 2VBXA 4WFXA 3R7NB 3W9JA 4YQWA 3P96A 1R7IA 1D7JA 2RDJA 3D6TB 2RU9A 1U1LA 3HVAA 1ZCNA 2MKJA 3HFKA 2DSVA 1AB8A 3H0PA 2D69A 2ZD1A 2ACYA 4TXSA 2ZJQQ 4A48A 1IQTA 4RW4B 2J6UA 3B8SA 1SQEA 4OX7A 2XCAA 5G0RA 2R7TA 5K8PA 2H1YA 1RADB 2EC0A 3FFIB 1K0TA 4P8XA 5I3UA 5DLGA 3MM7B 1OGGA 4DV3J 3TDBA 4QPXA 3UDEA 2XP3A 1LOUA 2XG8A 4G50A 4HT7A 2ZNYA 1U8SA 2WONA 3GCXP 4DV4F 1O51A 3DRRA 2ZH4A 1Y3KA 1IN0A 1RKJA 4MSPA 5ETOA 3RBEA 4OYXA 4AE5A 1XNRJ 3V6KA 5BYQA 3W60A 4MKVA 2K06A 2CPEA 3T1HF 1FD2A 2W2NP 3R1LA 4M5IA 3KMQA 5L39A 2CJBA 4R5PB 4EBDA 4DUZF 5T7LA 3MTJA 3MFIA 2BVZA 1VC5A 4OI4A 4ZP7A 2LKNA 3S01A 4I6YA 2IPOB 1NSKL 4RZRA 4DSIA 4I56A 5IQQA 1K73T 3ARZA 1FKOA 1RT2A 4WKAA 2MY7A 3IS9B 4DT4A 4X4PA 1LQ0A 2NUUG 2V2KA 5KFBA 2FLPA 1HA1A 2NSCA 2VC1A 3OV7A 1N5YB 4F4ZA 1QSSA 1ROTA 2FJAB 2BE7D 4IKAA 4KJIA 4X4UA 3S1TA 3OJUA 2A1BA 2AZ1A 2J7UA 3C6TA 5D8HB 1Z1ZA 3JYJA 1SQFA 3B9EA 3RAXA 3HT3A 3PXGa 1HNVA 4IG0A 5EX3A 1ZA1B 3M8ZA 5L9XA 1TFWA 3MM9B 1RKIA 4ICLA 1H0HB 4NLPA 1OQ3A 3AFGA 1UVIA 5KG6A 2KFNA 2DH8A 2H4WB 3JXVA 4X4TA 1RAIB 2HQGA 4ED1A 1K1SA 4X62J 4DR2J 1X60A 1RT6B 1LK7A 2XCPA 3CW2C 1TAQA 2HMIB 1RUSA 3CJKA 1WHYA 3H42A 4OX8A 1HNZJ 1SXLA 3EGVA 2FJEB 3AOAA 4ETZA 1OS5A 4JI6F 4A8YA 2BKPA 4AL7A 1UP1A 4OHVA 1ZOTA 4DHVA 2Z2MA 1L3UA 3GG1A 2HHHJ 3LP1B 4CO3A 3MM8A 4BCAA 2MY8A 1RWWB 4OLPA 4ECUA 1JLFB 4LFBF 3JSRA 4E8UA 3AT1B 1HNIB 2BW2A 4A8QA 4F4AA 2OPPA 2Q43A 5IXUA 3DU5A 1EETB 5AE3A 1SBRA 1I5OB 3A8EA 4Z2XA 1N5VA 4O3OA 1NK8A 3K0JA 1BC6A 3MOJB 1IKWA 1C1CB 3ZTRA 4FBUA 4GKKF 2AOSA 4NLXA 2AEJA 4PYDA 4UQGA 1IBMF 2GVDB 3FRZA 2WW8A 3BZQA 3EMTA 3PYGA 1YJ7A 1TKZA 5C25B 1DBDA 4OV6A 1HXVA 4ZP6A 1FWLA 2VG6B 4DU7A 2BQ3A 2CPIA 2YNIB 3CCES 4M8LA 3DLKA 2CFXA 2DNZA 4O3SA 1VQ4S 2QEXS 1IKVB 1CS4B 4U7UD 4DWSA 2MDAA 4FVMA 1S1UB 3O5LA 4DL2A 3CMAS 2G41A 4YFUA 2ZH1A 1S4EA 4QPTA 2CWXA 3F73A 2D1CA 3IR7B 3CCUS 2EK6A 3O2IA 3B82A 3WX4A 3CCVS 3J80Y 2XY7A 2UUBF 5KFRA 2HHWA 3G6XA 1Y11A 4KGMA 4G1PA 1UZDA 1R8BA 1E6ZA 1NZ8A 3L7OA 3UI6A 3J7YI 3I0SA 3WQVA 2JRSA 2DNYA 2IM0A 3BV8A 2X1GA 5E2QA 4LQ9A 1HNXF 1HBNB 1RACB 2B31A 1JQGA 4AY1A 2KI3A 4CLZA 2RHQB 3LGMA 3M2UB 3H8YA 4TY9A 2XYHB 1XMOJ 3FEZA 4ZS6A 4IOBA 2BR0A 4QBUA 3UI4A 4ZIWA 3SV3A 1FK9A 1J5EJ 3K8VA 3OXGA 3PRAA 2HGNA 4OYMA 1CG2A 3OLBA 1RBOB 2W4CA 4QIVA 2HRTA 3PHEA 3ZZZA 1SVDA 5K8NA 3U27A 1HWIA 2FHMA 2ZBCA 2ZH5A 2CQDA 4J4OA 3A8KA 1XC9A 1WEXA 2HVZA 4QR2A 1FJGF 1X0FA 4OL8A 3JYTB 2VPWB 2WLYA 5BYSA 1X6LA 4DRKA 3MEEA 2ZZTA 1NMWA 1Y7PA 2QMXA 3W2VA 2CUYA 4OLOA 3MEGA 1BQMB 5HQLA 3TZWA 5GAHU 3DRXA 3EPGA 1NK9A 2R8KA 2QL9B 2VFSA 2V4QA 3SFUA 2AYMA 4WKHA 5T14A 4RR5A 4KHRA 2BEFA 3BQ1A 3ILLA 2MB0B 3BBCA 3BDPA 2W4PA 1FKPB 3ISND 4C8KA 1U0SA 3LGHA 1G6BA 1LWEA 3K17A 3UE2A 3MMBA 3DKDA 5DIUA 1NPKA 3R8YA 3D6HB 2B56A 1Q6IA 4C11A 4FYYB 2LGOA 4JYSA 1IBLJ 5D15A 3W66A 3L7UA 1TKXA 2EULA 4NA2A 4ZVPB 3E01B 3FBEA 3W8GA 3OL9A 3ET6A 2V67A 3MM5A 2OSRA 3DN9A 3BXWA 4RWXA 2H54B 1VISA 3PJWA 1CJUA 4JI4J 2KM8B 3FCHA 4FN5A 1N36J 1CULA 1S9GA 1NB2A 1FTCA 3T1YJ 1N33J 5CCLA 1QSLA 5HJYA 3IG1A 1WSVA 2PA8D 3V4IB 3M2VB 2H5JB 1YZ7A 2XMAA 1IJFB 4NXNF 4DV6F 3MPDA 2ACMA 1S9EB 1EIBA 3HSDA 4NLYA 1FT8A 5AXNA 1MLAA 5H9FJ 3DXSX 1RCXB 1JJCB 2VBZA 1TL5A 1EP4A 4G65A 2HAIA 1KVIA 5CYMB 1RXOB 4WTOB 4QR1A 1FE4A 1ZM3A 5EGYA 3TO8A 1OGBA 3NKYA 1WG1A 4U7UK 2UV8A 2F5GA 1T3NA 4DPTA 2L08A 3HCXA 1NU4A 2V4JA 1WUUA 3KAIA 4CP5A 2J9EA 2HK3A 4ODMA 4IH7A 3MECA 4CLLA 1I1GA 1W9VA 2KXNB 1NPPA 2EFVA 5L1LA 2X3DA 2JLGA 2XY5A 3D1OA 2VBWA 1R8HA 2DKOB 2QL7B 2DT3A 1FKRA 3TRGA 4OYBA 2DNLA 4Y34A 4ZOSA 2MKCA 3CHCA 1BHNA 3HPOA 3BGLA 1DTQB 2BQUA 3AB2B 2LYVA 4KRWA 1O6IA 2YKPA 3M8QB 3UVJA 4JI7F 3EGZA 4LF8J 4QWDA 3LALA 2RS2A 4TVAB 2RE1A 3ZZOA 5F8IA 1NHUA 1TTHB 1Q1KA 3ALGA 1SJRA 4RWWA 2OPRB 3P5BP 4PPZA 2XMVA 2Z56B 3HM9A 4H4MA 2K1RB 1EJ7L 3GIMA 1B4SA 2OEKA 2WM0A 8AT1B 3IAS9 4A8OA 2HGLA 4LF2A 4MIAA 1XNQF 3MUVP 3BB5A 2ROPA 1VLOA 1F2HA 2DO4A 4M5GA 4PEOA 4MYUA 4JV2A 1QVGR 4K7QA 1DRZA 1RTJB 5A8KA 4U85A 1F9FA 1FKBA 1UA1A 3DMJA 1OY8A 4H4KA 4AD6A 1C4AA 4LR9A 2XGPA 1E6YA 1X5SA 3LQVA 3ETMA 4NCGB 3RGIA 3KHLA 1YJRA 1HKMA 4BWMA 1SC3B 4QU7A 2XZWA 3DLJA 2I2YA 5LSRA 1Y4ZB 2MQQA 1FTRA 4P72A 3DGPA 1E6VA 1RT7B 1PJ6A 1T05A 4C8NA 1S6QA 3HFZB 4J4NA 3RB6A 4F3OA 4HHJA 2VOPA 3G6YA 1YRXA 4GKJF 2XI3A 1QSYA 3EY6A 2WK2A 1U1MA 2XMWA 1HQEA 5AT1B 4P2MA 1UVMA 4DCJB 4Q0BA 1OWXA 3HHDA 3M30B 1Q0NA 2HFNA 3G86A 2PA3A 4USTA 2XSJB 3JXOA 4XDDA 4TLQA 4I2QB 2BJDA 3HSGA 4DL4A 3AQOA 3SV4A 1TUVA 3PA7A 1YI2S 2ZHBA 2FTRA 3GILA 1QAJA 4DX6A 1D7IA 3RR8A 3D2WA 1I94F 3QRRA 4KV8A 4ZVEA 3M4XA 2J7WA 3BF4A 4PG8A 1N34F 2YWGA 3GPAA 1RTDA 5B0EA 3R6GB 2KYXA 2QRRA 5A2QU 5ETPA 1EHNA 2Z2ZA 1WTBA 4DV4J 5D0HA 2FVSA 1LJYA 2OAUA 2DNMA 2HZVA 4C8ZA 5KFGA 2DHAA 3BSOA 1YJVA 1SKWA 2V8DA 3LAKA 1RCOB 2AYEA 1FNXH 2CNLB 3T1HJ 3D5MA 2QGFB 2FDNA 3VV2B 2QT7A 1G7CB 5KFAA 1F0XA 2BYCA 3RB3A 4LMZA 1AFJA 1F2GA 4I7FA 3BO3A 1R9HA 4DUZJ 1QE1B 1KNZA 4QWAA 1JLAB 3PYDA 2H5EA 3W9HA 5KFCA 2VBYA 1UFKA 3QYYA 5FLXU 1YHQS 1WOOA 2J8SA 4ZVUB 4TLRA 3I32A 1IKXB 5B0CA 1T94A 1NZAA 2DHGA 2EBEA 3FBBA 5D4LA 5THWA 4JV0A 3GLJA 4EO8A 4OI6A 2XLJA 2ZZMA 3FCVA 3NOCA 2GC8A 4DFJA 2FVRA 4IYQA 3QSYB 4TU8A 1X4AA 5HSPA 1OO0B 3TJAA 5DGBA 1S6PA 1J4HA 1YDLA 1ZK6A 1WOPA 4UQTA 4LSNA 2D9FA 2VPXB 1UR8A 3AS1A 2CQ2A 4DR4F 1R8CA 4X4QA 1Y5IB 2DH9A 2KHDA 2HS3A 1WC5A 2CQHA 3KUEA 4DFPA 2DR5A 1A7GE 4KH0B 4RNNA 1PC5A 2JH3A 1KEKA 4B17A 1RTHA 1MWYA 2HIYA 2YTCA 1WC6A 4EU0A 2R8JA 4NRUA 1LWFA 1YK9A 1HKIA 3IR6B 5FD1A 5L1IA 2G1HA 1F9HA 2J8AA 3SFGA 2OFGX 2HPUA 2HBZB 3MWBA 2V5HG 2XNQA 2UVRA 1EX8A 4CM2A 4IR1A 1NH6A 2HNDB 4RNMA 3C15B 4S0MA 4LR7A 2XO7A 2ZH9A 2F2DA 4CRJA 4LFBJ 1R27B 3OTBA 5CABA 4TNOA 3BYRA 2MEWA 3J81Y 2DNNA 4Y0FA 3KCEA 3FJ2A 2E5IA 1NMVA 1FRHA 1N5TA 1RI7A 4ED5A 3CCTA 4IG3A 4RUBA 3DDKA 4LF6J 1MU2A 4NWBA 5F8MA 3OW2R 3KK3A 3G9CA 2B7BB 4MIWA 4GKKJ 3G6MA 3NS5A 4DF8A 1IBMJ 5JUMA 5C42A 2YKQA 2ATCB 3AS0A 3CPWR 1GXTA 1UTAA 2PMWA 2QZ8A 3OD2A 3QT5A 4DPWA 5LJ5Y 1QPFA 1APSA 2MNTA 3OFGA 3DLGB 5KFLA 5HLFB 2GO8A 2IVYA 5HI7A 1IBCB 2K8IA 3ALFA 4J9OA 2ZH6A 4KAIA 1NKCA 2E5LF 2RQKA 3N79A 3EDRB 2KT2A 2GIRA 1NJXA 4F67A 5E3AA 2PI4A 1FJEB 1C0UB 4A8FA 4MMOA 4UY85 5B7WA 2KFYA 4GRSA 4OV1A 5DS7A 2XWYA 4I67A 4FS1A 2OGUA 4CNZA 3C16A 1UFLA 2UUBJ 1VQ9S 1N6QB 2O9OA 4WIIA 2CQBA 3QO9A 1T8EA 2QV6A 5F41A 4Y2AA 1E6RA 1T0TV 4CLPA 2DSZA 1HNXJ 4Q7AA 1NEEA 4ZPTR 4DCOB 3WQPA 5GPRA 3B4DA 1YG0A 1CJVB 3PX6A 4DR7F 2AEMA 2QJ3A 2ASLA 1SB6A 4XIUA 3FZ2A 2AEFA 3LWMA 4JFIA 3HVTB 3PJ9A 4FYDA 1JLBB 3KTQA 4MNLA 4G2PA 3BDEA 2HW3A 1JNRB 4U7CA 2WSEC 4V19J 1D8YA 5EUHA 5KT2A 4WFAQ 1D3WA 4HHUA 4WZMA 4IQ2A 5LXYA 4DU8A 1WC0A 1GQEA 2KDOA 3W5XA 1FERA 5A0YA 2ROEA 2RKIA 3KABA 4H4OB 4DX5A 4HI1A 1FJGJ 2HKEA 2MQPA 3EZUA 2MQOA 4CI0B 4W5UA 4R8UB 1RTIA 1ZB5A 1TUGB 3GFZA 4ODKA 2BANB 5KFVA 1URNA 1ZH5A 2GW8A 5GADU 1P8GA 3MPUB 1FDBA 4J91A 2XHCA 3MMCA 2R2SA 2D3OR 3TWZA 5ETNA 1VI7A 2YNGB 5GAEI 3FEYB 2IAJB 2LJ4A 4RU2A 5ETTA 4PABA 5HBMA 2R8IA 3PNIA 3P49B 5C5JA 4DRJA 4DRQA 5IM0B 4WU2A 2XP9A 5F8HA 3RFWA 2FLLA 4NOHA 2ZKTA 2YX7A 3RM8A 1HNWF 2CJYB 1W1VA 3WD0A 2EW9A 2HHPA 4ECZA 2LQ5A 1P5QA 3DRSA 2GAHC 1NSAA 3OL7A 2W9BB 1BWVA 3KKFA 4NNRA 2ZQTA 2LQ8A 4LRAA 2N4CA 3R2CJ 3BGUA 3OTCA 1RT3A 2W2PP 4DV6J 3D1HA 2X1AA 4J90A 2W7PA 1C4CA 2ZH7A 3BR9A 2WRMA 4NLUA 4RUHA 1GTEA 3W65A 4PKDB 4C8MA 4K4VA 2BW7A 3B4MA 1G2EA 5HWCA 3DU6A 2MZQA 2WB4A 2B6AA 1LQ9A 2DGQA 3C66A 1OPIA 4ODLA 4RW8B 1NB7A 1EKSA 4KO0A 4DL0C 1F3FA 1YQHA 3RZAA 3DRYA 4DR6F 1GTHA 5A6PA 3UD5A 2MZ1A 1VGYA 2R7RA 3RTVA 1S1TA 5LJ3Y 2AT1B 4Z2HA 1TQLA 4P75A 3ILJA 2W01A 5D77A 3OVBA 2I5JA 2J9DA 4RU9A 4MK7A 1TL1A 5D4OA 4DV2F 4PAAA 3MXHP 4B9NA 2I1RA 1FEEA 5C7PA 2GO9A 2N3LA 3FVYA 2EFNA 2ZUAA 4OX9F 5HW6A 4N5SA 5L1JA 5FIIA 4LSLA 1Q6UA 1PBAA 3CD7A 4JI7J 1HYSB 1VHFA 1TFVA 2PV3A 4P74A 1WTFA 3RMEA 4F3MA 1VRTA 1TV6B 1ZA2B 3PDNA 3NCQA 3QRQA 1PJ7A 2XYGB 5DEZA 2W8LA 4HACA 3QGIA 1NK4A 4OI3A 4CTAB 1JJ2R 1H2VZ 4IFVA 1NCLA 1X4DA 4LVNP 1SIWB 1XNQJ 2KZZA 3WC2A 1N5SA 1UWBA 2ILYA 2LA4A 5L8RC 1FAPA 5BXJA 2R7VA 1QAXA 3K59A 1KWMA 5DZ6A 3GG0A 5DG9A 3PV8A 2O01C 3LUYA 1X7VA 3R27A 2M1IA 3ZTPA 4RW4A 1WWHA 4ODOA 4CLKA 3DXBA 2ZKUA 3KJQB 4F04B 1YBAA 2KI2A 2FQQB 3Q22A 3HMJG 2ZVIA 3QPIA 2P6TA 3FFIA 1PYTA 2ZJRQ 3NGUA 3DLHA 3QSIA 3RM9A 2PEHA 1SH0A 4IO1A 3MM7A 1D7HA 2OSQA 2B5JB 3R5JB 2DXFA 4BHQA 1HJWA 2QLFB 3CCRS 5KG2A 4GKJJ 2FUG9 4PWWA 2WSCC 3TZYA 4M5DA 3JAMY 2JFDA 2QE5A 3MDFA 5F3TA 3NGRA 3EGWB 4QQBA 3IRXB 4FDFA 4O3PA 4OYWA 3IM8A 2I6WA 3PZPA 3ARSA 1S12A 2OPSB 4ODNA 2BJ1A 3O5FA 2G1DA 2AWGA 4NYOA 3AQUA 1VDHA 3Q8YA 1P1TA 2V94A 4FF4A 1EIYB 1FJCA 1FKKA 1I94J 1WNEA 1QVFR 1F5CA 1R3NA 4ZMMA 5L38A 2DT9A 4R5PA 3DI6B 3X1LB 2IJFA 2WVBA 3QIPB 3VR1A 4LGXA 2ZQUA 2HHVA 3IA0A 1N34J 2QYCA 5F8GA 3PEJA 5D4PA 1S5ZA 3PKYA 3Q0AA 3HHEA 3MM6B 1O8BA 4MKAA 2J9CA 3E8OA 2G0JA 3O1LA 1W7WA 3A13A 2IBOA 3CNQP 3UCGA 3IS9A 1ULRA 3Q2TC 4B9LA 1FKTA 3TVKA 3UR0A 3PKMA 3QJPA 2XYPB 1FFWB 2CG8A 3C46A 1N5YA 2XMMA 3ILOA 2OELA 4YMEA 2MMYA 4HTIA 2YNFB 2ZHAA 2R2RA 4ED8A 2EG1A 1QLNA 5KG3A 4ZJQA 3WH0A 4B3RF 1FKSA 4ILLA 1YRTA 5T41A 1IUJA 1JXLA 2CRLA 4X2BA 3ENVA 3MM9A 3VZHA 2WVFA 1JNZB 2D9PA 5HW7A 4X64F 3ZZ0A 2K3IA 4N8NA 3O5MA 3ITHB 1PILA 3VTIA 5DETA 3I6CA 3MUTP 1FRJA 1RT6A 4UW2A 4J9PA 1X5PA 5HMYA 4RBUA 2HMIA 2J5AA 4RUAA 1FKHA 4CO4A 4ZN1A 3ULHA 5GADI 5KFIA 2CPDA 1BKFA 1S9FA 1VC6A 5EDWA 1DAXA 2Z2LA 4JFMA 3LP1A 3NLCA 4DR4J 2OEJA 1JLFA 1NH7A 2DJWA 1TK8A 3AS2A 3DOKB 4IUFA 1HNIA 3CIZA 3A8IA 3I0RB 3RAQA 4R0EA 4NLOA 3UI3A 1NK0A 1EETA 2O1PA 1Q7YT 1N54B 5D6GA 4BDPA 1EDQA 1HKKA 2CKWA 4C02B 2HVHA 3AS3A 5GMEA 2DT0A 1C1CA 4K2XA 6FD1A 3DC2A 1GH8A 1SL0A 4DQQA 2DXDA 2GIFA 1TR0A 1Q86T 1D8ZA 2GVDA 4WYLA 3SZ2A 1RISA 3AODA 3H9RB 1K9TA 4I69A 4WP3A 4F50A 4OZ3A 3K8WA 2NXEA 4X4RA 3RBDA 4CLTA 5C25A 2R9LA 2GJFA 4KT0C 3ARYA 1R89A 1XQIA 2VG6A 2Q6CA 5E41A 3FZBA 3DDIA 3IBFB 4W98A 4DZ2A 3GONA 2RUDA 2MSSA 3J81j 1IKVA 1CS4A 3CCZA 4I2PB 1S1UA 3MECB 1LL6A 1D9AA 3K5NA 3PYFA 1R0BG 3HDSA 4URIA 4C48A 1NWSA 4ES1A 3TAMB 1JXVA 3PM9A 1YJWS 5HMWA 3CJSA 2GV1A 1WHVA 2XMTA 5C24B 2V4RA 1ZPVA 3WZ0A 1X8DA 2FYXA 1IM4A 1X9SA 3CE8A 3UQAA 1HBNA 3VHQA 4DSEA 1S72S 1NRKA 5IT0A 2MKIA 2ERRA 3G96A 3PCOB 2FB0A 3M2UA 2L9DA 2E5LJ 2KFZA 4WP8A 3RB4A 2RU3A 1BWEA 2FZGB 3TX0A 5IQ6A 2YPYA 1ZBCA 1X6NA 1IWAA 1PCAA 2DIUA 2QA2A 2HAFA 3AJDA 2PPOA 4ZA1A 3CJ2A 3EE3A 3N9UC 4HR2A 3MAHA 4Z2IA 2D74B 4DROA 4NA1A 4DSJA 1NWTA 1QZ2A 2EI5A 5A8RB 1XR6A 3JS9A 1RAAB 4FBTA 2NCKL 3KLHB 4YY3F 2KO1A 2OTLS 2YBVA 2IFXA 3JYTA 4TYOA 1PYOB 1LL4A 2AGOA 4QIWD 2QFJA 2NR0A 3DHWC 1TELA 4OHXA 5F0UA 1CJTB 1BQMA 4IO9Q 4IT6A 3G8QA 2I8EA 1PBUA 4PQAA 4CIOA 1HLWA 3ZZUA 1M0SA 5IT4A 1X4GA 3OVAA 2VASA 3N6MA 1VQNS 2RT3A 1EB0A 4K4ZA 1L3SA 1QTNB 1VS3A 1FKIA 2MKKA 1CBKA 1FKPA 3IMQJ 1BE4A 4ZVHA 2CZVC 4ZCMA 3O3LA 3L9ZA 4PPDA 2SXLA 3I5BA 3EVWA 5KFFA 4UTGA 4U95A 2YKAA 1NBEB 3KG0A 2H4YB 4PUOB 1Q7LB 1Y9OA 2CQIA 1ZETA 3MR6A 4CLFA 3E01A 2HFOA 4U6PA 3DHXA 4GC7A 3MR3A 3AD8C 4LSZB 1ROFA 2XGQA 4K59A 4YR3A 3EVOA 3NY0A 2Z0GA 4A8WA 3GJRB 2B51A 1NDLA 4KY3A 2CJAA 2M52A 2DGUA 3IFEA 2YPZA 3V4IA 3M2VA 4V1Ak 2M2AA 3SQGB 5KFYA 3I5AA 5CHCB 2D41A 1PJ5A 2OIHA 1S9EA 3VAKA 1FNOA 3ICLA 2R3VA 1JJHA 3OTOJ 5B08A 2UP1A 1ZTWA 3KUHA 3CJ3A 5D0EA 5J6EA 1U1KA 3V5RA 3CJRA 5CYMA 3D7SB 2VA2A 4FXWA 3T3FA 2ABYA 1DQAA 3KJFB 3QLHB 3N6NA 4OI1A 3MOZA 4W9QA 1IQZA 3RJMB 1HNWJ 1WG5A 4LRFA 4DLEA 5U47A 1F9EB 4HARA 4OJHA 2K3KA 5IFMA 3MR2A 2BJ9A 4PCQA 5ETMA 1KN6A 2C2ZB 5ETVA 1SL1A 2R8GA 3Q86A 3I96A 2ZC3A 4NSBA 4HDGA 4R25A 2B4OA 4F2SA 5GMDA 3C6UB 5ETRA 1FFQA 2FAPA 1DTQA 1BQXA 2KYZA 4Y2IA 4DLGA 3GSIA 5HATA 5KFKA 2MJUA 5E7OB 3O5QA 3U1LA 2IUZA 1NXIA 5KFOA 4ES3A 1A7XA 2F63A 3WDOA 1UW4A 2CQ3A 2OPRA 4DRPA 1NMEB 2K1RA 4DR6J 2XLIA 1WACA 1Q8BA 5BXIA 3T41A 3MMAB 3HF5A 2IDLA 4KFBB 3OQ2A 3W63A 4WE1B 3H7HB 1HR0F 2OLHA 4WFNQ 3AA8A 4K4YA 2CYYA 4M1KA 4UDMA 1RTJA 2UUCJ 1GEHA 2VONA 1XMBA 5L9NA 4OX9J 1BXNA 3K5LA 4GVBB 5LL6d 2JZVA 1UEUA 2UZ5A 3GMGA 1TL4A 4JYAF 2XWXA 4BC9A 2HBYB 3Q8UA 3QGGA 4NCGA 2A3AA 4NZ7A 2LMIA 1L3VA 2IY5B 2ZFHA 3TP2A 1Q8IA 1N48A 4JI8F 2MYFA 4TQRA 4P9SA 4KTQA 2LEBA 4P73A 1RT7A 4KHPF 2O66A 3TCZA 3RUBL 4N19A 1RAOA 4TQSA 1QY7A 4YDXA 2KM8C 1M5PC 3NI6A 2EG2A 2A6MA 3DLLQ 2V8PA 5HANA 4WIWA 7FD1A 1XBWA 3SCLE 1U47A 3FCWA 3PW4A 2CVIA 3M30A 2VKRA 2EEYA 4M5LA 5DQHA 2XSJA 2DNKA 2AW0A 4C8YA 3P45B 4I2QA 5H9EK 5IOLA 4FNIA 4NPOA 4PTMA 2NS1B 3AOCA 2JFKA 3SDEB 3TA2A 3SI8A 1B64A 2MLZA 3BREA 4K4XA 1KLMB 4RKUC 1JKHB 1CQMA 2XLKA 1J6YA 3FKBA 2EFGA 5EX0A 2XQCA 3NCPA 4JI0J 2DIVA 5KFZA 4CO2A 1KQKA 2GGPB 2CZ4A 2BA9A 2PC6A 1UVLA 2PN0A 2UUTA 2YH0A 4YR2A 1B70B 5JVHQ 1RAGB 2J0WA 1FD9A 2HBRB 2AJ0A 1UFWA 1G1XA 2M0GB 4LF4F 3MPYA 1XN9A 3GQCA 3GYNA 2BV3A 1U79A 1GRJA 3NBPB 2DG3A 4B3TF 3QNWB 4OFZA 2XP4A 1XMQF 1HMVB 4FN2A 4AQYF 3CHFA 3NNHA 2FJXA 3CD0A 1QE1A 2BOAA 2VFVA 3LH2S 4EEYA 4OYPA 1GXLA 1JLAA 5HTGA 1P1LA 3ZZYA 1LXNA 2ZOFA 4F3QA 5F8JA 5M2PA 1DY3A 1S48A 1ACMB 4Q44A 3BGRB 4RUCA 3KADA 5B0BA 1UCNA 1IKXA 4FF2A 5DG8A 2VG7B 3AJ2A 2DSWA 4JI3F 3MDYB 1S76D 1WKKA 2MQMA 1IWGA 1FRKA 3ARWA 2C3OA 5JH8A 4UOCA 1YRUA 3FDSA 2E29A 5GAGU 1S49A 3BYPA 3KLEB 3D0IE 1PIEA 2RKIB 2HWIA 2UXBF 2ZOGA 3MR5A 4LF5F 4WYWA 2N82B 1HARA 2EXUA 5KFWA 3VQTA 2HS4A 4B3RJ 4URGA 4J9QA 3LO3A 4S3KA 3KG4A 2KR7A 4LQ3A 2HHQA 4ODPA 4CLWA 3SCJE 4DV1F 5KFQA 2XO6A 3VALA 1B6CA 2CQCA 4X64J 2PFDA 4HBOA 4ILRA 2MPUA 3QT7A 1S0VA 2LP4A 3QAUA 3H5SA 1OJ4A 4CLSA 5CYJA 2OLWA 2ZH8A 2MLXA 1LW0B 1Q4RA 2X7IA 2VU5A 4KR0B 2YNHB 4P10A 1SKUB 1LFPA 2RRNA 3T6BA 3U02A 1E6NA 1ZAVA 2ZEJA 2FHOB 1RZMA 5HMZA 5KT6A 3CC4S 2BDPA 4MTPA 2HNDA 1CC8A 3C15A 5DIVA 2KT3A 4M5JA 1N8RT 2M5YA 4UZCA 4ZLPA 2CDRB 4F4KA 3SCKE 3PO5A 5A2QY 1BD6A 4NYZA 1VQLS 4W9OA 1RT1B 4P2XA 5J2PB 5A8WB 3HD2A 3CJ5A 1RHRB 2O67A 5HT1A 3CHDA 3QRPA 2EK1A 4J9NA 1IBKF 5CZXA 3MF5A 4WIQA 1PINA 2KXFA 4KGKA 2A2DA 2E1PA 1Z4UA 4Y2CA 4LBHA 3DOLB 1KS2A 3KAHA 2PI6A 3EYZA 2B9EA 4NLSA 4CH7A 2ZQVA 2DCUB 1NJYA 2VH7A 4KKOA 4NYPA 3VAJA 3NTPA 3D4JA 3JAMU 5GPGA 4ED0A 2OFNA 3RGCA 4WK1A 2ATLA 3PIPQ 1O0PA 5HLFA 4YB6A 4ML4A 5JJBA 4HL9A 1EQ0A 2B6AB 1KT0A 3X3UA 4DPYA 2CQPA 4ZITA 3UD3P 2RD5C 4DL3A 1Y5NB 2DTJA 3D3CJ 1FRLA 2RB7A 2QO3A 4I6AA 2DT1A 4DUYF 5KFPA 1C0UA 2CG4A 3UPFA 1ZM2A 3MAAB 2WK4A 3L09A 3BM7A 2FD2A 2X51A 2CADA 2FHJA 2HQFA 4PG4A 2F4VJ 4HEA9 4C8LA 3JSMA 2NPFA 1U2CA 1FKJA 1N6QA 2IYGA 3J7A1 2PI5A 1HHTP 4ELVA 1HI0P 2ESCA 5D75A 2Y0SD 2LQBA 1Y5LB 3GTYX 1DZ5A 4XPEA 4GVLA 2H3EB 4OZ2A 3WD3A 4ERDA 4ZCKA 3T19A 3FRYA 2G4BA 3BSNA 2BMBA 4XK8C 1CJVA 4IQXA 2E9TA 5JVGQ 2BX6A 2NXUA 3M6UA 2HURA 4MKYA 3RRGA 2B9YA 2HZCA 3HVTA 1W26A 5GQBA 2OKQA 4C0OC 3A12A 4KQZA 1JLBA 2CPHA 1HBUB 2H5IB 4QJVA 3NNAA 2PEBA 1YIJS 4OJ3A 2CZ9A 1H7WA 3UDCA 1B99A 1ZS6A 5K14B 1T11A 1VIOA 1PSDA 3NGKA 3B54A 1JXEA 3BN4A 3W64A 1T9UA 2FC9A 2G8ZA 3EX7B 4IRCA 4H4OA 1KSPA 1VQSA 1KD1T 4YY3J 1MWZA 3CMQA 3UW1A 3I56S 1E15A 4R8UA 4JFLA 2V8GA 1NHKL 2XTJP 3CJ4A 3E3XA 4JP8A 2W9CB 4DR5F 3S8SA 2BANA 3I6PA 2CPZA 2DHXA 2NLWA 4Y6IA 1X4FA 2MTLA 2F8EX 4DPXA 4M5HA 3ZZRA 2GCFA 1HJXA 2KH9A 4CH1A 3BN7A 2HG4A 1VRUB 2XP7A 2YNGA 2JX2A 1KTVA 4DXLA 2AJ1A 4YDDB 1ZBWA 4ID5B 4W4MA 2AX0A 2Y1IA 4YP3A 1C0TB 1H2UX 2IAJA 5IV4A 2B3TB 4KB7A 2PDAA 4M5DB 1UETA 1XRVA 1AW0A 2HQIA 3AXKA 3OPKA 4DR3F 4LR8A 2HQCA 3MD1A 1LK5A 5AXMA 3CD5A 4LAVA 2B4VA 5IM0A 2MGZB 4F2RA 2R7UA 2Z8QA 3M8PB 3AOBA 2K7JA 2DEIA 4DFMA 2LU1A 1J5OB 4LF7J 3KMSA 3DCAA 4MK8A 4DOZA 4PZVA 4QWCA 2Y1LB 3LP0B 1R0AB 1KT1A 4AXJA 1PBKA 4Y2KA 2HGMA 1YKWA 1T02A 2W9BA 3PJXA 2CNOB 2UVUA 3ODKA 4Q2LA 3TI0A 2HVIA 3DDNA 5KT4A 3WD2A 4K4SA 1JLCB 1GMWA 1J4RA 3KJVB 2LECA 4DR1F 2M9KA 4NCAA 1ZAWA 2MQNA 4OYOA 2O92A 4RW8A 3UFCX 1M5YA 4OQJA 4ED6A 4ZLJA 1S1WB 2DY9A 1PAEX 1FX4A 1FHTA 1S4FA 4USUA 4USVA 3CDWA 3U7JA 5D0RA 1WEYA 3OA5A 4E98A 4O4RA 5HVFA 4ID8A 3G8TA 2F4EA 3CJ8A 2R7SA 3Q24A 4L3NA 4Z2LA 1G4CA 5EWEA 5J2MB 5KG1A 1JNEA 1U6BA 4CNYA 3FY1A 4KH1B 5HL7Q 4DV5J 2W7AA 4OYAA 2ZBRA 3CXCR 3M9OB 2RS8A 2EC2A 3JQMA 3RRKA 3ADAC 5KTQA 2XMUA 1ITPA 4QOTA 1IXKA 2GJ2A 2RDIA 3NNCA 3R5DA 2GVZB 5KT5A 2EFQA 1EAYC 2M70A 4C4WA 2CJQA 1HYSA 2ZR5A 2IM3A 3OVSA 2DPIA 3CCLS 1TV6A 4LF1A 2WOMB 4Q7NA 3ARTA 2MKHA 2NXNA 4CH0S 3BQ2A 3T5HA 1GOIA 1YJUA 1VR6A 1RD6A 4RW7B 3GPKA 1S1XB 3QATA 4CTAA 1HR0J 1JLGB 2ASYA 5HVHA 3LGNA 4KBIA 2HIQA 1FWPA 4PRFA 2ADCA 4Y65A 1JLEB 2P5VA 1HKJA 1WB0A 1ZZNA 5DQGA 2UXCJ 4HH1A 3O5RA 4JYAJ 2F8HA 3W5YA 4NLRA 3O5KA 3FXYA 4F26A 1B7FA 4P7TA 2UUWA 4O44B 2NZCA 2HNYB 4Q8FA 1HHQA 2LA6A 1Q6HA 2DHHA 2YKNB 3FK4A 3SMZA 1SC6A 4KHPJ 4C7QA 3R7BB 1V6HA 3H98A 2C2OB 2DITA 2GJIA 3M8WA 1V3ZA 2B5JA 2AU0A 1YJ9S 4NI2B 1K0VA 1T7PA 1KHVA 4JI5F 3ARUA 4YOEA 3KACA 2A10A 1OYEA 2W25A 1VQKS 4S3JA 2C2NA 4K50A 4B9TA 2NXJA 1UPPA 1OQ6A 2P9CA 1G3OA 3RBZA 1DTTB 3IRXA 1SJQA 2OPSA 3A4TA 4KGXB 2XZTB 4CT8A 4J9KA 2C1EB 1M5KC 2QIFA 3HZGA 4HT5A 2RH3A 3PX0A 2YXLA 1BQNB 4PG5A 2J7KA 4LT6A 4RW6B 3B9AA 1B0VA 2CQGA 1RHMB 3BH7B 2QYGA 2PSZA 3DI6A 2E44A 2QLWA 3QIPA 2JLEA 4OX6A 1CC7A 2R2TA 3S7RA 2LLZA 1UEKA 3JTOA 3O5EA 2HWHA 1ZM9A 4RBTA 3TZXA 2AJQA 4FF1A 3MM6A 2BM0A 3W2WB 2VUGA 2NYHA 4ED4A 2F8MA 2NYIA 2R7XA 4ZPDA 2UV8G 1L1PA 5DZ7A 2VFTA 3VGTA 3CJTA 4M63A 2A3CA 2YKMB 3OL6A 3K5PA 4YR0A 4GIVA 1UVJA 1FO1A 2PMZD 4LF4J 1JK9B 3ZO7A 2XY6A 1YJTA 1WC4A 1Q82T 3P6YC 4OYIA 2YNFA 4B3TJ 2L41A 2RQ4A 1XMQJ 4AQYJ 2AQ4A 2CIMA 3SEOA 5K9FA 5DF0A 2DR8A 1AUSL 2BACA 2FHKA 3TUZC 1NUEA 3HKZD 5KFTA 4YEAA 4Y00A 1U1OA 2HHUA 2P9EA 3QMQA 1E6PA 4CO0A 3DOMB 3HFVA 2E1CA 2ZM6F 4ZPCA 2DNQA 2ZDOA 3KDNA 1PO6A 1LG1A 4QWBA 4U84A 4JI3J 1U0HB 2W2MP 1KQFB 3ITHA 1URRA 4LVOP 2VV5A 5HKGA 3W1YC 4J9LA 1Q95G 2EBGA 1RWPB 4P6QA 4C98A 1W1PA 4X62F 3V6HA 4A46A 4HKQA 1MROA 5DDOC 3MCMA 3W9IA 4C0HA 1ZYQA 4O3QA 4OZ1A 3DLEB 4TY8B 2VJUA 2HK2A 2EWHA 3BPSP 2D3O1 3DOKA 1RABB 3GJTB 3TA0A 4N47A 4DV1J 4FPIA 3THVA 1HHSA 3B7XA 2HHXA 4D3HA 4DL5A 3I0RA 3M8RA 4LJMA 1KBRA 4L6V3 2F40A 1KP6A 2V2ZA 3KXDA 1H2TZ 2FGOA 3O44A 2ALYB 4DWSC 4J9RA 4WKRA 2LDYA 5DDRC 1KC8T 3Q89A 2ITKA 2XULA 2DNPA 1N88A 4ZPAA 3OTDA 2J0XA 4OJGA 2R42A 4DZ3A 1WG4A 3OFHA 2LXUA 5J2NB 3US5A 1FEHA 3TAQA 5J1NA 4NXMF 5E0OA 3JQJA 1I6JA 3UNYA 2FC8A 2ZH2A 2DGSA 2RUSA 3GFYA 3Q8PB 4IT4A 4I2PA 1RTZA 1U24A 2MZJA 3VAGA 5DDPC 2JC1A 1CJKB 4XAKA 3DFEA 2JEJA 4UOGA 4GO5X 3TAMA 2RSQA 4A8MP 4IRKA 1RWUA 1UMJA 2F65A 1RU1A 1QDUB 1HI8A 2CJKA 1TUWA 3R7SB 4N56A 4FPRA 2YX4A 1X0PA 1NSQA 8RUCA 3GP9A 2OMLA 2DY1A 5C24A 2OPQA 4WJBA 1VBZA 2DRAA 4GC6A 4K4WA 4F25A 1ZL1A 6AT1B 1SR0A 2PIIA 3HSJA 5DO2A 4C6AA 3W5ZA 1WJ9A 1UVKA 2OTJS 2ADBA 2F9DA 3GZ7A 3OR1B 2KL8A 1RHJB 4QYZJ 1AZSB 1A9NB 3HULA 1DQ8A 3M8SA 5EN1A 2CPJA 3ZC4A 2A18A 5KT7A 5ITHA 4B9SA 5A6WA 3TVYA 5A8RA 4PG7A 1NM2A 5HP1B 2RHSB 3KLHA 3CULA 2W4DA 3J7AN 3WC0A 3B9DA 1RT5B 1RHKB 1VF8A 3PVXA 5I42B 3UQBA 1N4LA 1GAOA 2V2VA 3G4SS 2OH2A 3HJFA 1CJTA 4X84A 2Z2YB 1AFIA 2L2SA 3HD1A 4K2JA 3LPEA 1H38A 2AIRB 1REVB 4HH0A 2ZBQA 2E5HA 2BE2B 3EZOA 4ITSA 2C3UA 2Z30B 4M5KA 4DL7A 4MNKA 1SH2A 3CDBA 1M90T 2ZUGA 2VC0A 4PUOA 1W25A 2HBQB 3A3NB 1SIZA 4DR5J 2XNRA 4YHHF 2D3UA 1MMDA 2M8HA 4DX7A 2RILA 3Q8QB 2DSUA 2MZTA 3JSYA 1M5HA 1ICEB 4ECRA 4EBEA 4Y2MA 1Q8KA 1S7HA 2B4PA 3AJ1A 3HO1A 3SQGA 4U67Q 1NDCA 2VZ9A 3IKGA 4G1QB 4A4JA 5HAOA 4PXEA 2KN4A 4FXDA 1VOMA 2EFPA 2DRDA 4MGVA 2CPYA 4PXDA 4FKYA 2V8VA 1H98A 3M6XA 3KHRA 3QLHA 3VWSA 5H1SV 2LDIA 3IRWP 5CZVA 4Z7CA 4LAXA 3HHLB 4LAWA 2LEAA 3EWGA 2B0GA 3FSXA 1UZHA 3BO2A 3KWMA 4QT2A 1SPBP 4NA3A 5KFUA 3C3LA 4MT1A 3H5YA 2QX0A 4KE5A 1WNOA 1GK8A 1S97A 3G82B 3C6UA 1NJWA 1FX2A 1RYRA 5D4NA 4NZ6A 3ZNJ1 2L3MA 4ZVOB 3QJLA 2IM1A 3UR3C 4K8RA 1CVJA 4H4KC 1VQ8S 2B8PA 3V2UC 4KYZA 4L3KA 3EGNA 3T5JA 4DG1B 2LKZA 3KNGA 5GAHI 1XR7A 4XTTA 4WF9Q 2IRXA 4E0DA 3IAM9 3MMAA 3TA1A 4KFBA 2EPIA 4I4BA 3MEDB 4WE1A 5DQIA 2Y8YA 3J7YU 2CWKA 4RW9B 2M7SA 3PW7A 4C9DA 2CDQA 1PKUA 3MI7X 3KZ7A 3M8YA 4L76A 4GVBA 4B9VA 2QA1A 4DH0A 1UAWA 3NG8A 2VOOA 4DS4A 4Z2GA 2PN6A 1U7LA 3IBWA 4IOAQ 5H9FK 2KVQE 4CQ1A 2B9WA 3V4MA 4JI6J 1WKLA 4ALZA 4NLTA 2VQEF 2KJWA 4ELTA 5LSLA 2M3DA 2R4FA 1TVRB 3HSZA 3MPVA 2KVIA 4QW9A 1R0CB 3KLFB 4FXVA 4RNOA 1JB0C 5HQ8A 4AT1B 2CVEA 3ARPA 1AYEA 2MJNA 2N7YA 4F02A 3ZTSA 1ZAXA 3K5MA 2VICA 5ADZA 4ODQA 3ZFVA 3JSBA 1SKSA 3HHNB 4EUVA 2DBBA 4CCHA 4HYKA 2BE9B 2UUAF 2AP6A 3EM1A 4F4XA 4I68A 1RAJA 2IBKA 2OJ3A 5HW8A 5KFEA 2DNGA 1MN9A 3SDEA 2FDMA 4ZVGA 4WFYA 4KKOB 2OP5A 2GQ2A 2CNNB 2W2OP 1WDTA 1KLMA 1W9UA 4DWSD 1D0EA 2YH1A 1JKHA 1EKRA 1U6FA 2UZAA 4JI5J 5CH7B 2IM2A 2D7SA 5IT9U 1WHWA 5BR8F 1S6UA 1JMTA 2GGPA 4CYUB 4ZPWR 2E5JA 1XHGA 5KFMA 2IYIA 2MKYA 4QYZK 1LWXA 3MTKA 2H65B 4ES2A 2U2FA 4L75A 3OUYB 1HW9A 3R1HA 1U1NA 2RNEA 2VD3A 1WF1A 2DVIA 3CCMS 4OHWA 1TKTB 2JEFA 3JSMB 1FKGA 1YWXA 3AD7C 1P9YA 2BRKA 1OIAA 3RB0A 3NBPA 3HJVA 1FKFA 1M5OC 3R6LB 1HQ2A 1HMVA 1LXJA 2HWTA 5B0AA 3G71S 2A6OA 4L73A 4F0KA 4Q5VA 3PY8A 1NNDA 3GJSB 1GMVA 3BGRA 1FDAA 1FNMA 2IF4A 1HL6A 3BPDA 1NSPA 3KNAA 1VBYA 2Y9HA 2VG7A 1M5SA 3D54A 4R0XA 1YGYA 1M5VC 2C28A 1QAIA 3H90A 3ZTOA 3FQLA 5J1EB 4K4TA 1AXQA 3PTWA 2ZJPQ 3ZZTA 4NL5A 1RWKB 4DUTA 2PV2A 4YB7A 1VJQA 3LW5C 3KLEA 5CD4H 2JC0A 3CCQS 1HW8A 5LMNF 2ZWPA 4GO7X 3ILIA 4Q2MA 2QTWA 2J9DE 5B0DA 2RIJA 5D78A 1PC4A 4ANEA 4K0KF 3PRVA 1SCJB 4B3OB 1NKBA 4JV5F 3H59A 4NZCA 2HNZB 5AXLA 2ZM6J 4DPOA 3DRPB 5C2CA 2JVOA 1KKHA 5K20B 3Q2SC 2DRBA 2J6TA 5GVQA 4MYTA 4USKA 2GMHA 3MCNA 1VQPS 4IPXA 2ZVSA 4CO1A 1D1UA 1LW0A 3TZZA 4B9UA 2YNHA 2VB6A 3GCWP 3P8BB 5BJRA 2N3OA 5CAAA 2YVSA 1UR9A 2ALZA 3T5LA 2L9NA 2AYGA 2P6SA 4Q43A 4TW7A 4RJVA 3F0NA 2HVDA 3KOAA 2YX1A 1X4BA 1RT1A 5J2PA 5A8WA 2HHTA 4DSFA 4WZQA 3AH6A 3THPA 3G6VA 1CQNA 3KLIB 4TW8A 3R5GA 4LAYA 4WKFA 1KQSR 1QAYA 2XPBA 2JVRA 3R5AA 4LFCF 4HVZA 3DOLA 1EQ3A 5D0GA 1GPFA 2YBTA 1TKDA 2PBCA 1XJWB 3NP5A 2RF2B 4LF6F 4NXNJ 2WBRA 2E1RA 3THTA 2ZR6A 3EPIA 1TP7A 3ELHA 2LFVA 1VQ5S 3IO1A 1S6OA 1FJ7A 1ZBKA 1T3OA 3TJ9A 1RA6A 1JLQB 3PW0A 3C8YA 2AD9A 2N4DA 1KRPA 4NXMJ 2C3YA 3CGMA 3U1MA 4DRIA 2J0SD 2V63A 3TAPA 1YLXA 3UQIA 1ZBVA 1T03B 1RJJA 2IIHA 2HFVA 2DB1A 3BKFA 3SQOP 2IVMA 3MAAA 3KK2B 1DFDA 3K7RA 1XR5A 4B3MF 1RAFB 4ELUA 3VCDA 4V19X 3MPWA 3WKZA 2HRYA 1IVZA 2CPFA 4PQUB 2QLBB 3W4RA 2HZAA 2JZ5A 4ZKAA 3J7ZT 5KFSA 1WF0A 4USWA 2E7XA 3N28A 4URSA 4ZJLA 2XS2A 3V6DB 1XWLA 1DJ0A 3D6FB 1VK3A 2GZOA 2YY3A 4C97A 3QZ8A 5KFJA 3EIPA 1TCOC 3TYTA 4Z2JA 2M4MA 1W1TA 3IR5B 2Q1LA 1NK7A 1UWAA 1J27A 4FP9A 4NX9A 3M32B 1H72C 4IH6A 4OIXA 5HVGA 1HBUA 2GMLA 5IC4B 5J1PA 1HD1A 4KHMA 2RRBA 4ITZA 1T9YA 2DK2A 1YTYA 1MW7A 5K14A 2C2RA 3BSCA 3QBCA 1SJFA 1KTQA 4LRDA 1VK8A 3BH6B 4PXBA 4WK9A 4OHZA 3OXFA 1KFDA 1LEOA 3NMAA 3FBFA 3CJ0A 1V5VA 2GIQA 4NZ0A 4USJC 1S7IA 3LANA 1A0OB 1QJHA 1YITS 3UD4P 3U1NA 2W9CA 2E9RX 4W90B 2E7WA 5AJ3F 3CUNA 2DGXA 2VQFF 2W9AA 1E44A 2V34A 4OYZA 1Y00A 5KT3A 1S57A 1SJ4P 4ZCLA 4NCBA 1HBOB 1VRUA 3JYMA 2KRBA 3PRBA 4EMDA 2IJRA 4ID5A 4I64A 3CCWA 1REGX 1C0TA 2K2PA 4FZVA 1TK5A 3HX9A 2BKOA 5HN0A 3WQWA 3VAFA 3FMBA 4DIPA 1YZ6A 1NLKL 2UXDF 4ANCA 4DV7F 4IFYB 2MGZA 4RX6A 5B8IC 2UU9F 4KGZB 3M8PA 1K9MT 4PWDB 1MN7A 4YHHJ 1J5OA 4LF9F 4DN9A 1KONA 3LP0A 5LOQA 1R0AA 3LF0A 2P9GA 5DDQC 2IHR1 2MZRA 3ONQA 2E66A 2XP5A 4U86A 1RU2A 1ZZFA 4FNHA 2VA3A 3W7BA 4CT9A 3NAIA 3L95X 2AGQA 3GU0A 1NPRA 1RK8A 3K5OA 3UCUP 4DQIA 3OSPA 1VLYA 4Q45A 1H6KX 3KLGB 1JLCA 2P8IA 2RMLA 1H0GA 4Q8EA 3ENQA 3OLAA 2YWEA 3QGPA 3KJVA 2X1FA 4IDKB 4DSKA 4LBIA 4QIEA 3HHKA 3HZEA 3FSIA 4DV0F 1OY6A 4RL1A 4Z37A 2JSXA 3KAGA 3NRKA 1S1WA 3IHZA 2DNRA 4ECTA 3T9ZA 1S59A 4HHHA 1NKEA 2GMJA 5FDLB 4ECXA 1VIXA 1K44A 1OPZA 1D9DA 1FRIA 2OI2A 3O5TB 3Q8RB 2JNJA 1JNTA 1TL3B 2JEIA 1RAEB 3IK8A 5J2MA 1Y0HA 2QA4S 3SYZA 1X5TA 3LP2B 1BUXA 3BKUA 3FBCA 2YWFA 2RQSA 1C1BB 1U2FA 2Y1JA 3HLUA 3BBFA 2XMJA 2V9WA 1YJNS 4ZHRB 4DPUA 5JXSA 2FJBB 1RDRA 5J2QB 4AUKA 1RGVA 2A3EA 1UL3A 2GVZA 1FKDA 1YX2A 1BL4A 4ZLNA 3CD6S 1FKAF 4OI2A 2VFUA 3TUJC 3F41A 4FS2A 1KVJA 2WOMA 4NLWA 3OFFA 3CDEA 1MROB 2RUQA 2XP6A 2DGOA 3CDUA 4RW7A 2CNKB 1S1XA 2DISA 3L7PA 4FYVB 2DNOA 2W2QP 3VGSA 3UF8A 4RNFA 2B8QA 1JLGA 4ZLLA 4OZJA 3Q83A 3BGFA 3T5KA 2WHOA 2RQCA 4LFAF 3TQ1A 5SUHA 4BWJA 5KG4A 1JLEA 3PHTA 1F5AA 1SI9A 3E2EA 2GAGC 2M8DB 2WVEA 4DN0A 3OHAA 5I3QA 2MQLA 1WC1A 3F44A 1S1VB 1SV5B 4IOCQ 1B3TA 2PFFB 4CO5A 3CCSS 2XEXA 5DM6Q 1TL7B 2HRUA 4L74A 3M05A 4O44A 2LEPA 2HFSA 4M5MA 5BYRA 2HNYA 1Z2LA 5DG7A 3CDAA 2YKNA 3CJQA 2EVZA 3PRDA 1WDDA 2AJFE 2LQ9A 4RBVA 3UWTA 3IGVA 4WFZA 3M2RB 2VQEJ 2DT2A 4J9VA
chains in the Genus database with same CATH topology
1JNEA 1U6BA 1YVFA 4CNYA 3FY1A 1HQUA 3O5IA 4ECYA 3I9V9 5GAEI 1UJ5A 1HPZB 5HL7Q 3NS6A 3FEYB 4TYBA 2IAJB 2LJ4A 3OL8A 4Z2KA 2W7AA 4RU2A 2YWHA 2B9XA 3CXCR 3M9OB 3QO9B 2RS8A 3SXLA 4TU9A 4MFBB 2DR9A 5HBMA 2R8IA 4O4GA 3IC1A 3RRKA 3PNIA 2BXJA 3P49B 2PGCA 4U9RA 5C5JA 1NAQA 1BY9A 4DRJA 5KTQA 1U25A 1WELA 2XMUA 4DRQA 4QOTA 5IM0B 1IXKA 2GJ2A 2RDIA 3NNCA 2KU7A 3R5DA 4G3IA 2MF9A 1MMNA 3K2YA 3PX4A 5KT5A 2EFQA 3POTA 5K8MA 4WU2A 2M70A 2DNHA 2IC3B 1DTTA 2XP9A 1FE0A 5F8HA 2RUCA 4C4WA 1LWCB 3RFWA 3CH9A 2CJQA 5CQGA 2FLLA 4NOHA 2WBMA 2ZKTA 2YX7A 3OFEA 4DEZA 2ZR5A 2IM3A 3BS9A 1HYSA 3OVSA 3V81B 3CIMA 1UJ6A 3RM8A 1HNWF 2B7CB 2DPIA 2I0XA 2OD4A 3CCLS 1TV6A 1Q79A 1W1VA 2WOMB 3WD0A 2EW9A 4Q7NA 2FVCA 2HHPA 4B02A 3ARTA 4ECZA 2G13A 2MKHA 3FNNA 2LQ5A 4CH0S 1B0TA 1P5QA 1BQNA 1Q53A 1GXUA 4B08A 3MUMP 1GOIA 3DRSA 3BQ2A 3T5HA 3B78A 1YJUA 2F9JA 2ZE2B 4RW6A 2KB2A 3GFHA 4K5RA 2JJ4D 4C8OA 3PW5A 2IVFB 3CMES 2F21A 5FJ4A 3OL7A 1CPZA 1RD6A 2W9BB 2OPQB 4RW7B 3RU0A 3GPKA 1S1XB 3KKFA 5GAEU 4NNRA 4CTAA 1U48A 2ZQTA 2XS5A 5E3CA 2N4CA 1JLGB 3BGUA 2JL9A 3MCSA 3OTCA 5F3ZA 1RT3A 3RW6A 2ASYA 2F3JA 2I9SA 2PT0A 3I87A 3LGNA 4KBIA 5HROB 2HIQA 5A0YB 4EFAC 4PRFA 1M1KT 2ADCA 4Y65A 3M6WA 2HYIB 1JLEB 2P5VA 1HKJA 3D1HA 2X1AA 3T6JA 2W7PA 3W2WA 1C4CA 2RUGA 2ZH7A 2YKOA 3BR9A 2IMWP 3OOBA 1WB0A 2WRMA 5DQGA 1ZZNA 4NLUA 4RUHA 1GTEA 3AQPA 1LG2A 4PKDB 4DWIA 4C8MA 4K4VA 2PPPA 3LWLA 1IBLF 1RTIB 1X4CA 4MAVA 3B4MA 4HH1A 7FDRA 2PV1A 3H2VE 1G2EA 5HWCA 2EKYA 4NRTA 3DU6A 2QA4G 2XP8A 3O5RA 2X3GA 2F8HA 3N01A 2MZQA 2WB4A 3HKWA 2B6AA 1LQ9A 2DGQA 3C66A 1OPIA 4ODLA 4NLRA 3O5KA 2FJDB 4RW8B 1NB7A 2XB2D 4KO0A 4DL0C 3FXYA 3LUOA 2YKMA 3R3TA 4DBQA 1Q16B 1YQHA 4DDFA 1W2BR 3FGVA 4F26A 5D3GA 4JI4F 4WXOA 1B7FA 3RZAA 1NK5A 2KHCA 4P7TA 3DRYA 2UUWA 2NPIA 1RT4B 4O44B 2ZZNA 1S0MA 1GTHA 1N36F 4DR6F 1MMLA 2O5DA 5A6PA 4URQU 2HNYB 2MZ1A 4J9SA 5KOWA 1SKRA 1R31A 3MMCB 2LA6A 1Q6HA 3N0VA 1VGYA 4GMKA 4BS2A 3T1YF 1N33F 1U09A 2YKNB 3SMZA 1SC6A 2R7RA 3JTNA 3TUIC 3RTVA 1SUQA 1N56A 1S1TA 3OR2B 3O5PA 2X1BA 4C7QA 5LJ3Y 1V6HA 3V6JA 3H98A 2CQ0A 4Z2HA 1TQLA 1GNKA 2DITA 2GJIA 4L72B 5D77A 1WD6A 4A8SA 4B3SF 3OVBA 1FDDA 3DM2A 3H5XA 2I5JA 1V3ZA 2B5JA 2J9DA 4RU9A 2AU0A 1YJ9S 1HQUB 4MK7A 2HS0A 1K0VA 5HBFA 2FIUA 3AB4B 4ATNA 1T7PA 4Q8FA 1KHVA 4JI5F 3ARUA 4QZVB 1TL1A 2GQCA 4YOEA 3KACA 2BRLA 5D4OA 1NWUA 2A10A 4DV2F 3UNGC 5KFNA 3MXHP 2W25A 4B9NA 2A3JA 1J4IA 2ZNZA 5HBMB 2KZMA 2I1RA 1VQKS 4S3JA 4K50A 4B9TA 1FEEA 2GO9A 1S99A 2N3LA 1IX5A 2EFNA 3FVYA 1CSJA 4OX9F 3O5GA 5HW6A 1Z2ZA 3DOMA 1WI8A 4N5SA 1H7XA 1WF2A 5L1JA 5FIIA 1VQYA 4LSLA 1Q6UA 4WCEQ 1OQ6A 3CD7A 2PE8A 2P9CA 4HBEA 3POTB 1G3OA 2YWKA 2N87A 4C3MA 5KFHA 1DTTB 3IRXA 4KIAA 1SJQA 4IQCA 1U45A 2AF6A 1VHFA 3LAMA 4KSEB 2LXIA 1HYSB 3GB0A 3P3DA 2OPSA 1TFVA 2WCXA 2PV3A 2WSFC 1YATA 3UQSA 2W8KA 1WTFA 4CT8A 4J9KA 3RMEA 4USIA 4F3MA 1M5KC 2VFRA 1VRTA 2QIFA 1TV6B 3HZGA 3QAEA 4HT5A 5DJBA 1F8AB 2RH3A 3AY0A 3CCJS 3M6VA 5M2UA 3PDNA 2XHWA 3NCQA 3KLVA 2R8HA 4ED2A 3PX0A 1YW5A 1FRXA 2DGTA 1BQNB 4PG5A 2VKZG 3DRSB 2J7KA 1XERA 4LT6A 5DEZA 4RW6B 3F56A 3B9AA 1B0VA 2CQGA 3DYAA 2W8LA 5DGAA 4RLEA 2RSEA 1FXRA 1IR0A 1KR4A 4DX8H 4MH8A 3QGIA 1NK4A 2PSZA 1UA0A 2VPZB 4OI3A 4ECWA 1JNDA 3DI6A 2E44A 3KK1A 1FA0A 1WHXA 2QLWA 3QIPA 4CTAB 1JJ2R 1H2VZ 2JLEA 4OX6A 4IFVA 1CC7A 1X4DA 4LVNP 1SIWB 4AL5A 2KZZA 3WC2A 1BLUA 2COLA 2R2TA 1VFJA 3S7RA 2LLZA 1N5SA 1ELOA 1UWBA 1RT3B 4DRHA 2ILYA 3JTOA 3GYXB 3O5EA 4ECSA 2HWHA 2LA4A 5CYQA 1ZM9A 2IA0A 1FAPA 3DLEA 4RBTA 5BXJA 4TY8A 5L8RC 3SSQA 2AJQA 4FF1A 3MM6A 2BM0A 1Q81T 3Q23A 3NMRA 1DURA 4TN2A 3W2WB 4C3KA 2DPEA 2VUGA 2BABA 2K8GA 4UUXA 2ZITA 2R7VA 1QAXA 4HI2A 3HXMA 3K59A 2BBEA 3QJJA 2F8MA 2NYIA 3DLGA 4LF8F 3PIOQ 2R7XA 4ZPDA 2UV8G 2FKEA 3GG0A 1L1PA 5E33A 2IRYA 2GHWA 5DG9A 2DR7A 2VFTA 3PV8A 2O01C 2F7VA 3K57A 3AROA 3LUYA 5FLXY 3T1AA 4M63A 1X7VA 2R7WA 3O5DA 3R27A 2LCWA 2A3CA 2M1IA 4R5EA 2KT5A 4KO0B 4P7VA 4RW4A 1WWHA 1GX5A 2YKMB 3QOKA 4ODOA 3OL6A 3K5PA 5D3GB 3DXBA 4GIVA 2ZKUA 4LUBA 1N1AA 1FO1A 5IS2A 4YR0A 1UVJA 2PMZD 4MTVA 2QSFA 3BO4A 2AYBA 1YBAA 2WLZA 3QWUA 1JK9B 2KI2A 1HFEL 3I4HX 1YJTA 2XY6A 3Q22A 2VPYB 2Q5AA 3VAHA 2Q79A 1Q82T 3P6YC 1SYTA 3TVZA 3HMJG 4JUZA 1J2VA 2P6TA 2LQJA 3FFIA 3QPIA 3P5TL 2ZJRQ 1SUQB 4TU7A 2YNFA 3DLHA 1S1TB 2GQQA 5LSOA 2XC9A 2L41A 3RM9A 2PEHA 1FJDA 1NSGA 1SH0A 4IO1A 2RQ4A 4JFJA 3MM7A 1R8PA 1D7HA 2AQ4A 2CIMA 1W2IA 2OSQA 3DM2B 3SEOA 2I5JB 2B5JB 1CLFA 5K9FA 5EWFA 2DGWA 4BHQA 5DF0A 3BJYA 2C22A 1HJWA 4JFKA 3H4DA 3CCRS 5KG2A 2DR8A 2PD1A 1TL1B 2BACA 3WIJA 2FHKA 2BZ2A 3CB4A 3TUZC 3HKZD 5KFTA 2FUG9 3IGNA 5SZTA 4YEAA 4Y00A 1U1OA 2HHUA 2WSCC 2P9EA 5J2NA 1BGXT 5KOXA 3QMQA 2RRAA 2VN1A 3CSKA 4WU3A 1E6PA 4EWTA 4DRMA 4CO0A 2NUHA 4M5DA 3IWNC 1UKUA 3JAMY 3W3SA 3VQSA 1FKLA 2E1CA 2JFDA 4EYIB 2ZM6F 4ZPCA 2DNQA 2QE5A 2ZDOA 4LSLB 3MDFA 5F3TA 3E51A 1PO6A 1LG1A 1VQOS 4QWBA 3EGWB 1S79A 4U84A 1D2KA 2VG5A 1Q78A 4QQBA 1QTMA 3GR1A 1HWJA 3GWCA 3IRXB 2ZQSA 2JHEA 1KQFB 4O3PA 1AUDA 3ITHA 1F5BA 2QF8A 3PZPA 1URRA 3ARSA 3M1VA 2OPSB 2L48A 4LVOP 4ODNA 2A2CA 3O5FA 4USHA 2VV5A 5HKGA 3I55S 1DLOA 1NJIT 4J9LA 2G1DA 1VRTB 2AWGA 4NYOA 3H25A 3AQUA 5KG0A 1P6TA 2EBGA 2B4UA 3GIKA 4P6QA 4C98A 4HLBA 1P1TA 1NJZA 3ISNC 3D28A 3I82A 1VQ7S 2V94A 4FF4A 1LW2A 1FJCA 1W1PA 3MD3A 1FKKA 1DHMA 3DYAB 4X62F 1TAUA 3V6HA 1WNEA 1QVFR 1SH3A 1IKYA 1HBMA 1F5CA 1R3NA 4ZMMA 5L38A 1N0UA 3WL1A 1LV5A 2DT9A 3N5BA 4N8OA 4R5PA 3DI6B 3X1LB 3ETOA 4A46A