4XAKA

Crystal structure of potent neutralizing antibody m336 in complex with mers co-v rbd
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Junctional and allele-specific residues are critical for MERS-CoV neutralization by an exceptionally potent germline-like antibody.
pubmed doi rcsb
molecule keywords Spike glycoprotein
molecule tags Immune system
source organism Human coronavirus emc
total genus 49
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09408 Spike_rec_bind Spike receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4xakA02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4xakA01
4ZPTR 4KQZA 4L3NA 3SCJE 4L72B 3BGFA 4ZS6A 3D0GE 3SCKE 2GHWA 3SCLE 3D0HE 2GHVC 3SCIE 4QZVB 4KR0B 4ZPWR 2AJFE 2DD8S 3D0IE 4XAKA 5DO2A 4ZPVR
chains in the Genus database with same CATH superfamily
2DTJA 3HK2A 5J1NA 2HLUA 1IM4A 4CLYA 1F60B 2XHWA 1NDPA 2QA2A 2D69A 2W4DA 1JB0C 2AX0A 3B78A 5T7LB 5HVFA 5CAAA 3I55S 3QSYB 4F0HA 2OD6A 3HSDA 4DV1F 2K3IA 2N3OA 5DITA 3OL9A 3ISZA 3A3NB 4K50A 2V2QA 1FKPA 1AZSB 2FC8A 3DLJA 1HKJA 3O5LA 2G13A 5I4MA 1FRLA 2W9BB 4NEYA 2ZOMA 2IPOB 1VQKS 2H5JB 2C2ZB 1N4LA 1FKOB 1U79A 3EX7B 3CIMA 2V6AA 2RQ4A 2B8QA 2YQ0A 3DRRB 4CLPA 2Q5AA 4ZPVR 2JC0A 2Y0SD 1VQ9S 2JL9A 4Z2HA 2IRYA 1Q8KA 4XPEA 2D41A 3EZOA 1FFQA 3G6XA 2XY6A 2ZOGA 5HUAA 3WQPA 1A0OB 3CGNA 4UOCA 4NI2A 2UUCJ 2VG6A 3RR7A 1Q53A 4EBEA 1HJVA 2HFZA 2CPEA 5U47A 2RKIA 4ZPAA 3NXZA 1BQMA 5DLGA 5GAGU 1Q0NA 2YNHB 1RA6A 5HMWA 2W01A 1QPLA 1S1TA 2B4VA 2AWZA 1X9SA 3GFHA 4LBHA 4ERDA 4NYPA 1NWSA 2QMWA 2V34A 1S59A 5M2UA 4MAVA 3PY8A 1NWUA 4QIGA 1XR7A 3W9JA 5KFSA 5CD4A 1JLEB 2D74B 3D68A 2QX0A 5J1PA 3AS1A 1K0TA 4DV0F 3DI6B 1FCAA 3NGUA 4QPTA 4AQYF 3BBCA 4O2TA 3EWGA 4O3RA 4LFCJ 2FLNA 1CULA 4FF4A 5BXIA 3EJMA 1GNKA 4YDDB 2LU1A 3DOLB 3R5GA 3ZZUA 3JYMA 4NXMJ 3W2WB 5KG0A 5IT9Y 3NAIA 4UF4A 3D6HB 2IFXA 4NZ0A 2CJQA 1S1XB 2P9GA 4FDFA 5D75A 3MCNA 4M5IA 3NG8A 1LEOA 2ILYA 3M2RB 3C8YA 1YJRA 2FVQA 5HROB 2ZE2B 4KE5A 3KKFA 1FT8A 4WXWA 2E1MC 2YX1A 2KH9A 4GIVA 6AT1B 2C3MA 2YVSA 3UO0A 2BE9B 4J9NA 1YSJA 2AZ3A 2E5HA 4JFMA 1W1PA 3TEHB 3I0RB 1YBAA 4AL6A 4JYAJ 1DTTA 4LRCA 2W2NP 4K5RA 2RDIA 1N0UA 4ICLB 1S6QB 2HMIA 4DU8A 4PQUB 1U8WA 4NEZA 4C9DA 2WVBA 4O3QA 3G6LA 4DLEA 2XMWA 1U02A 3DCAA 3EVMA 2QSFA 1CC7A 5DLFA 4FBTA 2X3GA 4GVLA 5EX0A 2FPHX 1MW7A 3CSKA 1NCLA 1S4EA 1QZ2A 3MOJB 3ETOA 1MN7A 2FVSA 5D15A 4CIOA 4J9UE 3PXGa 3PR5B 2UUBF 4F2RA 3JQJA 1V5IB 5D8HB 3SFGA 1VQ8S 3JYTB 2QMUB 1F40A 4RNNA 2XG8A 2P2CB 5LT5A 2FYXA 2EXUA 1JNSA 4NA1A 3CD0A 3KCEA 1JWWA 2XS7A 2VASA 3R5BA 3CT9A 2CFXA 2VD3A 1TKZA 1YDLA 2ZVIA 4LJMA 3PZPA 1JNRB 2XO7A 2FY1A 2JWNA 3CC7S 1FO1A 3MCOA 3BM7A 3MAQA 4AL7A 1D6OA 4RUHA 3ITHB 3MM9B 1I94F 1Q1CA 4QR2A 4ZLNA 1UR9A 5J2QA 5BYSA 2LMIA 5JJBA 1TL4A 2KN4A 3SBMA 2DNNA 3I96A 3BQ1A 3S8SA 5F8NA 5CCMA 2WOMA 3MEEB 3C14B 3TCZA 3TW0A 2MTLA 1PYSB 3HHLD 2CQ4A 1YBUA 1S4FA 2AEJA 1ROFA 4BWMA 2UVRA 3E01A 3BB5A 1UVMA 5HBFA 4DPOA 2ZH9A 1RT6A 4LF6F 4C11B 3LPEA 2L3MA 2VG5B 3CJRA 3WIUA 4K4YA 1B4SA 5A6PA 2DR8A 4IFYA 1Y3JA 1HD0A 2YX4A 2VOPA 4K2XA 4QU7A 1W1YA 2OEMA 4XIUA 2EC2A 1YJWS 3HO1A 3JS9A 2IC3B 4O44A 3QT8A 1O6XA 1WORA 4C7QA 1NKEA 1UVKA 4WKYA 3FAPA 1EQMA 1GPFA 1JNZB 5I98A 2KZZA 4N19A 3KMQA 4RW6A 4DG1A 1RLDA 3LQVA 3H8YA 3Q24A 4WXOA 4JV5J 3D2WA 2K7JA 2C2NA 3PNIA 4OYIA 3B6BA 3ILOA 3SXLA 1KFDA 3HVTA 4XDCA 2YH1A 3J81j 2WK2A 4A46A 9RUBA 1T0TV 3CHEA 1FKLA 3ILIA 4F4KA 1URRA 4KY3A 3FSYA 3OOBA 3M6XA 3UN3A 2HFNA 3WX8A 1E6ZA 1QUVA 1RWMB 3UVJB 2F63A 1C0UA 1YWXA 3DLKB 3DMJA 3G82A 2WW4A 4BDPA 1F5CA 1NMVA 2M08A 1FWPA 1VYAA 4QWEA 1DRZA 2GZOA 2V4RA 3PHEA 4YB5A 2AF6A 2C2DA 2UXDJ 3GJQB 3QRQA 1K8AT 1FXDA 3S7RA 3UQIA 2XSJB 1T9WA 1KTVA 1BY9A 2MQOA 3P8BB 4ZVSB 2XGPA 3MDFA 3N6LA 3D9BA 3FBEA 2MQPA 1S9GB 3KK3A 5BXJA 3ULHA 4C0BA 2YKOA 2LKNA 2E7XA 1TL3A 3IP0A 1U0HA 2BJ3A 1MMNA 1EJ7L 1HBMB 1VRUA 4Q5VA 5A8KA 4R5PA 3W8PA 4LAWA 3ENVA 4WJBA 4NLSA 2VJUA 3VVUA 4LFBJ 1LW2A 3KDOA 2EKNA 4X66J 4IOCQ 4I2PB 1HNIA 4O3NA 2JVOA 3RM4A 1DHMA 4KR0B 2OTJS 3GWCA 2PN0A 2YPYA 3EDQB 3M32B 4OI3A 4DRNA 2JFKA 4RNOA 1UCNA 3EPIA 2MKKA 3HT0A 2CPDA 1RT7B 1NSKL 1U1KA 1ULRA 4DDFA 3EM1A 3BBFA 1HFEL 4IG0B 1TFYA 4ECVA 1Q5VA 1BC6A 5JMNA 1T11A 3TUJC 2ZH8A 4WFYA 4DR5F 1GFWB 1X60A 4JOUA 2YNFB 1UVJA 4B3TF 2J0WA 4OLPA 3KAHA 3GFZA 1FD8A 1HPZA 4P9SA 5CYMB 2I5JA 4BCAA 5E3QA 3BREA 1RQ0A 1JIHA 2RURA 3D1HA 3G2XA 2WSFC 2KRBA 2O92A 3OL6A 2FVPA 4CTAB 4W92B 4ITSA 5ETNA 3UI6A 2DVIA 4MK8A 1VC0A 2FUG9 3UN2A 1GT8A 2N7YA 2XBPA 1ACMB 2HGLA 4I69A 2QT7A 2RNEA 2RDDA 4L74A 1LQ0A 3C15A 1B0VA 5HBMA 1X6NA 3MPVA 4LAYA 4MKAA 1U8SA 2Y1IA 3PJXA 1RZMA 1SL2A 2Z58B 1LWXA 2KXHA 4RWXA 5FLXY 1M1GA 5KT2A 1VIOA 1VK3A 4OX9F 4J9MA 2OMLA 2HHPA 2N3LA 1SJ3P 1EP4B 3GIKA 3DLEB 3A8EA 2B5JA 1HIYA 2EEYA 4IH5A 2SXLA 2P9CA 3V4IA 5HP1A 3BV8A 3UE2A 2BKOA 4E0DA 1U2FA 2IF4A 2CKWA 4KAIA 4K4UA 2Y1RI 2ZD1B 1XBWA 5A6WA 1ZB5A 4MYTA 8ATCB 5F0WA 1VF8A 1TFWA 4RR5A 5JH8A 3M8QA 2VIHA 5LSLA 3Q83A 4LIRA 4ECTA 3QSIA 5A8WB 3TAQA 3EZ5A 3QMQA 3OA5A 4K4TA 4UUWA 1U1PA 4OI0A 1FEHA 1EQ3A 3RB6A 1CEZA 4HT5A 2AMCB 3HD2A 1VBXA 1NHUA 3M8RA 3VGUA 2KZMA 4X64F 2KJVA 2VDHA 2AJ4A 1CBKA 3HSGA 2Q43A 3HZEA 2J9DA 4F7VA 4DFMA 5B0AA 3AD8C 2J0SD 5D0HA 1H0GA 4TU9A 4QR0A 2QIFA 2DD8S 1U25A 3MDYB 1HMVB 4ZCLA 1UETA 4R0EA 4ZPBA 5FIIA 4P71A 5DQHA 5LMUJ 3K58A 4WWSA 4NZCA 4QJVA 5HK4A 4P7TA 3J7Z5 1N5QA 1Y7PA 2RUDA 1RHQB 1VBYA 3WC2A 2ZBRA 2HGNA 2NXUA 2OPSB 2PN6A 3OR2B 3J7A1 3MM6A 1I5OB 1RBLA 5CHCB 1BHNA 3I4PA 2V4JB 3OTOF 1E6NA 2WRMA 2VQEF 1BWVA 2WM0A 1Q95G 1RADB 1YJTA 2DPIA 2PD1A 2W9CA 2IVMA 4NLVA 1G3OA 1KR4A 2V2KA 2ZM6F 3JXOA 1B7FA 3AHPA 1MWQA 3LTOA 4ED7A 1HNVA 1MN9A 1ZBVA 3KNGA 4OYXA 2HWIA 4CLKA 3B4DA 3KMSA 3HM9A 2IM3A 1IKXA 2HLTA 1DY3A 2NYHA 4JI3J 4PG5A 2HVIA 2GX8A 4B3RJ 4DJBA 1W26A 3ARWA 1TV6B 3HHEA 1X4CA 2YBVA 2BZ2A 5LL6d 5C24B 1D0EA 1R0AB 3ARXA 1O6IA 4PG6A 1KTQA 1H38A 4USUA 4HBEA 1FKRA 2DT3A 3C3LA 2PO4A 4M8LA 3ZTSA 4RW7A 3KLFA 5GMKa 3MR6A 5D3GA 1T9UA 4DF8A 3KLVA 2NREA 3M4XA 3MPWA 4DV7J 4PEOA 3SDEB 2AD9A 1X31C 1MNEA 2KO1A 4ANCA 4J4NA 2QL7B 4U7UK 5GADI 4DR1J 4QIEA 3ZZPA 2XP3A 3KK1B 2VFUA 2Y9HA 3MEDA 1XTZA 4F8RA 4L6V3 3MD1A 4OJHA 5KFNA 2I8EA 2FB0A 3BDPA 2DKOB 1D9AA 2QV6A 2CRLA 1GOIA 2DNQA 5D0EA 5K8OA 1RWVB 2Z2MA 3KDNA 2BW7A 4KTQA 4ZCIA 3BF4A 1WG1A 3POTB 1HNZJ 4LF9J 1U0SA 1SCJB 1NJIT 1SB6A 3C6UA 1SQFA 3DOKA 3VZHA 5L9NA 1X5SA 1WTBA 1U4BA 2OPQA 2MPUA 2V94A 1FRIA 3GSIA 3W61A 4IYQA 2W7OA 4CO5A 3GB0A 3VQTA 4ILRA 1UEVA 4F4ZA 4DPXA 3GTYX 1RJJA 3NKYA 1UW9A 2OEKA 4ED2A 3O5RA 4Y2KA 1VQSA 3UNGC 3N79A 2KR7A 3DLGA 4UOFA 2ZZMA 1HARA 1U1NA 3WQVA 2FD2A 2WBMA 4FPIA 1NMEB 3NS5A 4DUZJ 2VBXA 2FJEB 1WG4A 3R2CJ 2Y78A 1SV5A 1Y9OA 3K8VA 3H4BA 1KOOA 1V6HA 2DGTA 4UY8T 1XN9A 1Q8IA 2FY8A 4OYPA 5J2NA 4TQSA 3ZZYA 5KFLA 5GADU 1RT3A 5DM7Q 4WIWA 5KOWA 4A48A 1HWJA 4MKYA 4WIQA 1FNXH 1EQ0A 3VTIA 1KVIA 3CCQS 3MZIA 2G2OA 1BXNA 3US5A 3NOGA 3MI7X 2J76E 2F23A 1LW0B 4LUBA 2VONA 1IWGA 4Z7CA 3JXVA 2BW2A 4K7QA 2GVDB 3P5TL 3MPUB 5E3PA 4DLGA 4QWCA 3VAJA 1S6UA 4P2SA 2RH3A 2DSVA 2LQBA 2C3PA 3AD9C 1XIQA 1UA0A 1DTQA 3IWXA 1UZDA 1S9EA 4JP8A 4RZRA 4DRMA 2IJRA 3NGRA 3NS7B 1XR6A 1NB7A 2KO7A 2OHDA 2APOA 2XCPA 1SL0A 1G6BA 4IR9A 4DR4F 4WK9A 4F4YA 4HH0A 4LR9A 1EKRA 3DLHA 2BKPA 1RTHA 1JLFA 5HMXA 3QJJA 1H7WA 4GKJJ 1HQUB 4CCHA 2B9XA 4Y2AA 1CC8A 1ITXA 3CIZA 2UXCJ 1FWLA 2XS5A 1GX6A 4DRIA 1KLMB 2DIVA 1WEXA 3NCPA 3NNHA 3M6VA 1IKVA 2R7QA 2XP6A 2C2EA 3TRGA 2MSSA 3CMAS 4B02A 4DV4F 2MLYA 3M2VB 4XK8C 1XMOJ 4ZP8A 1IKWB 1IR2A 5D78A 3HHKA 3MR3A 2LLZA 2FLLA 2J7UA 2YKMA 4NLDA 3IR5B 1QAXA 1QVFR 3D3CJ 3NWRA 1OPZA 2C22A 5KFHA 4A8SA 4B9LA 4JFJA 2HEKA 3ZNUA 3AD7C 1WC1A 3DRSB 3W66A 2W25A 3RAXA 2AP6A 1WOOA 2KVIA 2HQ3A 2ACYA 4QT3A 1H3DA 2B8PA 2HK2A 1KOHA 2F3JA 3U1NA 4DZ3A 2G0IA 1QLNA 3OUYA 2P5VA 4RO0A 2BJ7A 3DNCA 3I9V9 3LPYA 3Q8VA 3BSOA 3OV7A 3OPKA 3WQWA 2QF8A 2BX6A 4Y28C 2OKQA 2M5YA 1VQMS 5E3AA 2R2RA 4MJKA 3LGNA 2KFWA 5H9FJ 3JAMY 1T95A 1VHFA 4I6AA 3CC4S 1SPBP 2RUQA 3VAKA 3AJ1A 4J9VA 4GO5X 1GMWD 3CCUS 2BBEA 3D6MB 1L3VA 4ZHRA 2HHXA 4OZJA 1LWFB 2FZKB 5GQBA 4F26A 3P5BP 2EVZA 2MQQA 5J2PA 5ADZA 4F4XA 3OVAA 1Y00A 1ZOTA 4NYZA 5H9FK 1WC5A 1UL3A 4CO4A 2LDYA 1UJ5A 5AXNA 3BGRB 1F9FA 4DX6A 5J1EB 3VHQA 1CQMA 2HBYB 4OI6A 1Q79A 3R97A 2A6OA 3AS2A 2JEFA 2VG7B 2QG9B 2CVEA 2YXLA 2MMYA 2CNNB 2R42A 5F3TA 1FTCA 2FGCA 2GHVC 4C3KA 5KOXA 4U96A 4CYUB 2MGZA 3FRZA 2E5LF 3NI6A 4JV0A 3N5FA 4X4QA 4MGVA 4DRJA 4OI4A 4P2MA 1LV5A 2J0XA 2BEFA 2WVEA 4QWAA 2ZH4A 1QSYA 4IQ2A 1FRHA 3MM8A 4ZPWR 2K7KA 3B8HA 5KTQA 4M5HA 1J5EF 3RR8A 4O23A 2I0XA 4C0OC 3R6GB 1TKTB 3W64A 1NLKL 4YMEA 3AQPA 2O01C 3E2EA 2IYIA 1H7XA 2FHJD 3KHHA 2DHAA 1RTJA 3DGVA 2A3AA 1FE0A 2GIQA 1VC6A 3ET6B 4DWSD 2RHSB 2FJVA 2BA9A 2C42A 2OI2A 5DDOC 1APSA 4RUCA 1WNEA 1XERA 1CJVB 3TZWA 3W5XA 2Q6CA 4B3MJ 3FNNA 4WJXA 5G0RB 3MMBB 4NLUA 4OJGA 2DRBA 3OVBA 2F65A 1HXVA 2UZAA 3H98A 3QJPA 1T9YA 3FDSA 7FDRA 2JVRA 1GEHA 2X1FA 2AWGA 4IFVA 1JLAA 2CQDA 5HANA 5JVHQ 3QATA 3G6VA 4J9QA 4JI2J 5I42A 2OD4A 4V19J 1Y0OA 3NGKA 1EHWA 2RAQA 2DRDA 1VFJA 4W5UA 3Q8PB 4DUTA 1T3OA 1IR0A 1GXTA 2YWWA 3PX4A 1HW8A 4PUOA 5FDLA 4Y2IA 2YWGA 3N28A 3OHAA 3CCLS 4B9TA 2IVFB 1TL7B 4DRKA 2B6AB 3O5MA 2UU9J 2GIFA 1UJ4A 3GYNA 2QGFB 4M5KA 2HG4A 1BUXA 1N48A 3HVWA 2OUGA 3NL0A 4AE5A 1PC5A 4M5LA 2BJ1A 1VOMA 4U9RA 2GJFA 3NP5A 1N6QA 5LJ5Y 4BF8A 4ENOA 1HL6A 1CJUB 8AT1B 2J6UA 4P8WA 2RF2B 3S6EA 1YJVA 2MZSA 2CPXA 4LR7A 2YKNA 4O0NA 2QO3A 2MZRA 1ZAXA 4AFFA 4LF4F 3EXYA 3M6UA 4WFAQ 2GJIA 4ODLA 4NOHA 5I3QA 2C1EB 5JXSA 2RMLA 5CQGA 1GMUA 4BS2A 1YJ7A 2Y1LB 2MKYA 3MF5A 4IQCA 3M9NB 2IA0A 1KONA 3FKBA 2WHOA 4EU0A 4RW4B 5AXMA 1RYSA 3KABA 3DKDA 2E29A 4NNRA 2C3YA 5EN1A 2CDQA 4DSIA 2VPXB 3T19A 3OTDA 5KFXA 1H72C 1QTNB 2EG1A 2HK3A 2XMAA 1WB0A 4DS4A 3KJFB 3W1YC 3TANA 1JXVA 2UV8A 1NPRA 1SJ4P 3ARQA 1NDCA 2EULA 1AFIA 2PSZA 2R4FA 3QLHA 3RW7A 2W2QP 1UWBA 5LSRA 2DGWA 1TVRB 5L38A 4ODOA 3OFHA 4RBTA 2D9PA 2CQBA 4DL5A 1HBUB 2LEBA 1TU0B 1N34F 3MMCB 4DMZA 3ADAC 3KLGB 4H4OB 3PEHA 2V2VA 2VBWA 4AT1B 2HURA 3UDLA 3K89A 4DL7A 3GQCA 1YZ7A 5DIVA 1ZBTA 4WFBQ 5F8HA 4WTYA 2E1CA 2D1CA 1F5BA 3T41A 1RT1B 3QIPA 1HI8A 1I1GA 2E1AA 4J5OA 1J4HA 4YP3A 1X6LA 3I0SA 4W9QA 2L9NA 4GKKF 4R0XA 2R7RA 4DR3J 3OT9A 3PYGA 1JKHA 4ZVOB 1T9TA 4TW8A 2YWEA 1LK5A 1HBNB 2QJ3A 3JSMA 5F8IA 3B9AA 5L8RC 4ELUA 3EMTA 3K8WA 2CQ3A 3V5RA 3PKMA 1FJCA 3IBCB 1FRKA 2V5HG 3GILA 4RUBA 1SKSA 1VS3A 4P8XA 2Y8WA 3A4TA 1FVQA 1LG2A 4DN9A 2VUGA 1NNDA 1S7HA 1XK8A 1Q7LB 4EO8A 1WOPA 2F8HA 3G8QA 1IBKJ 2AIRB 2Q6BA 3EPGA 1JNTA 2ZBIA 4PWDA 3G87A 3BYPA 4K4VA 4KKOB 4X4PA 2V8PA 1VR6A 3TWZA 4C8MA 3WIJA 3R3TA 4ED8A 4CM0A 4J9KA 3ILJA 4KGZB 2YNIB 4JI1J 3TX8A 2F4VF 1FX2A 1XJWB 2C2KB 1HNWF 2V2ZA 4ZK7M 4FPRA 3MECA 3GJTB 1VQ4S 5HW7A 4LSZB 1ZAWA 2NUHA 3TA0A 2DGXA 2VQFF 3QZ7A 3FCHA 4LF7J 1S77D 1TCOC 2D9FA 1WNOA 4N77A 3BSCA 2XI3A 3N6MA 2JC1A 3GFXA 1FKGA 2DSWA 2HZVA 2W7PA 4NL5A 2NS1B 3KUEA 3W4RA 3BH6B 2G2YA 3C16A 3T9ZA 3MAAB 1TMMA 2DYAA 1RBOB 2RQMA 2MDAA 3OXFA 3CCVS 5B0GA 4MIWA 3UCGA 3CCES 3RBEA 8RUCA 1S12A 3D1QA 2RRAA 4USIA 1IWAA 4O4GA 1D1UA 3UW1A 4NA2A 1BL4A 1C4AA 3DRPB 5CA5A 1IKYB 5AE2A 1NZAA 2JLGA 1IR1A 4PYDA 1L3KA 2MY7A 5DQIA 1WF0A 2BDPA 2XMVA 2W8KA 1VQ6S 2BMBA 3MMAB 1YX2A 4JYAF 1UPMB 1R8HA 1EX8A 1S1UB 4Q2LA 3V6KA 4DL3A 4M5DA 1HJWA 2KJWA 2RS8A 1HQ2A 1N33F 3QBCA 2KI3A 5HLFB 4QU6A 2PPOA 1K9TA 2V8GA 2WW8A 1R7IA 3MM7B 2R8KA 3G96A 4C4WA 3QO9B 2ZR6A 3VGSA 2HQDA 4GC7A 1TL1B 2K2PA 5DG9A 4KH1B 3P49B 4F3MA 4MNJA 2HBQB 2KG1A 3CVKA 3TVKA 3E3XA 1E9LA 4EGLA 1NPKA 3QFWA 4IDKB 5IC4B 3PR4A 3HHLA 1TFVA 4WTOB 1RHMB 2YNGA 1TMJA 4OI1A 3AJDA 3AXMA 1S1VA 5T41A 1ZETA 1WKLA 4ZLPA 3O5DA 1ZM3A 2GQQA 2PEHA 3CNQP 1IQTA 1JX4A 3GJSB 1OWXA 5E33A 3D4JA 4J90A 4B3OB 2HAFA 4F3OA 3PYDA 2XY7A 1UZHA 1WC4A 5E5NA 3WD2A 4RW8B 1Q16B 1R8PA 1PAUB 4O3OA 4Q43A 4DL6A 3K5LA 1UAWA 5IT9U 2O9OA 3V81B 1N52B 2BJ9A 2CQHA 1SYTA 3VAIA 1DFDA 2PMHA 4URGA 2OPRB 3BN4A 3C6TA 5D77A 1O51A 3UDVA 2MF9A 4ILMA 3RAQA 1KT1A 3M30B 2LPVA 2WAQD 4DSFA 3QFHA 3M8PB 3CDUA 4LBIA 2VA2A 5HVGA 4XTTA 5BJRA 4PKDB 5KG7A 3RB3A 2MZ1A 4Z2XA 5DDRC 4DWIA 4W98A 4YY3J 4DQSA 1D9DA 1GX5A 2MZQA 1U26A 3LP1A 4I0WA 3ZFVA 4DN0A 4ITZA 3CCZA 4C48A 4EBDA 4V1Ak 3FZ2A 4CLTA 1XNQJ 5G4DA 3CULA 2K1RA 4WBFA 5DZ7A 4DR6F 3CDBA 3NWGA 3VGTA 1VRTA 3H5UA 1FKDA 3D67A 3LWLA 2KE0A 5CZXA 4DR2F 3BBBA 1QSLA 4B9UA 3Q8SB 2AJ1A 3T5HA 3KNAA 4I7FB 4KFBB 1SL1A 2PIIA 4F0KA 4DV1J 4ED4A 2ZITA 2DT9A 1LNQA 3R5CA 3PYEA 1OQ3A 3WL1A 2CVIA 3CDEA 5J2MA 4NLOA 1GH8A 4C8OA 1HI0P 3M2UB 5HKGA 1V3ZA 1JMTA 4W9PA 1ZZFA 3CGMA 4OHZA 4KJIA 3O1LA 4M1KA 1FE4A 3CGIA 1P1LA 3W2VB 3IAM9 4WU2A 4TX0A 3MUMP 5JVGQ 3HFKA 2LQJA 3H40A 1MG7A 2BVZA 1X9WA 2DGOA 3U7JA 2RQCA 5DIUA 5KT4A 2QN6B 2AJFE 5M2RA 1HWUA 2EFPA 3V6DA 4N76A 2NZCA 2Z8QA 1EB0A 1RKIA 2H54B 4U7CA 2KHDA 3C66A 3KK2A 3CJSA 2EBGA 4ELTA 3TNVA 2A18A 4DBQA 3TC5A 1LFPA 3QWUA 4W4MA 2PI5A 5AE1A 2ZDOA 2HNDA 4R8UA 1RTIB 5DQGA 2BANA 3KAGA 1QSSA 2RJZA 3BH7B 5KFMA 1MU2B 3RTVA 4CQ1A 2MJNA 5GMDA 1K44A 3GIJA 5EWFA 3WKZA 1VQOS 3IM8A 1XRVA 1TL5A 1VRQC 2CIMA 3CJ0A 1L1PA 3SSSA 4AQYJ 2MQNA 3J7AN 3AQUA 3Q23A 3U27A 1RTZA 3IM9A 2QLFB 1H74A 3BGUA 4P74A 2VZ9A 1FKSA 1ZS6A 3D5MA 1SC4B 1MSWD 2IM1A 4YHHF 2CNKB 6FDRA 2FAPA 3DYAB 3UI4A 1JLCA 3HFVA 1S7IA 2D3OR 3K17A 2XYGB 1KD1T 4RU9A 3KLHB 2A3BA 4LF2A 3SZ2A 2AT1B 2V63A 2OLHA 2GA7A 3H90A 1HQEB 1X4AA 4WPAA 3UD3P 2XULA 2GHPA 1HKIA 2CPJA 4GVBA 1FK9A 1T05A 3WL0A 2B7BB 4U85A 1G1XA 2ZHBA 4V19X 4LSNA 4WKFA 3ZO7A 2L41A 1ZZNA 1BE4A 1S1WB 3ARVA 3P6YC 3DGPB 1U47A 3DC2A 2DG4A 2XMKA 2Q66A 4QIBA 4X4OA 2IA6A 3MR5A 1AYEA 1ZCNA 1GXLA 4G6VB 4IO9Q 3KJVA 2PI6A 4IRDA 2V68A 4ECRA 4F2SA 1WJ9A 5HWBA 2X7IA 4PQAA 2FHKA 2L08A 1OS5A 2UUBJ 4NLGA 1WKKA 1NSGA 2CQPA 4CT8A 1U2RA 3D0IE 5ETKA 1JQGA 1SJQA 2VB6A 2OGUA 3QAUA 4C8YA 2PMWA 5LXRA 1DQ8A 2HSEB 4LMZA 2KI2A 3KHLA 2ZJRQ 2IBOA 2DIUA 1FHTA 3J80U 1S5ZA 4O4RA 2GW8A 1R8BA 2IIHA 1HW9A 4USJC 2K8IA 4ZCKA 1I94J 4TQRA 5KFBA 4UZCA 5EGYA 3D54A 2ZVSA 1N32F 3T1HF 1NDKA 1RAHB 3CD6S 3FEZA 3BQ0A 4M5GA 1RP5A 4A8OA 4KHMA 4CWBA 3L4BC 4ZDNA 1XWLA 3R5AA 3EICA 5B8IC 4LF6J 2M7SA 1VC5A 2I9SA 3KTQA 3FFIA 2ASDA 2IBKA 3TAMB 2C3UA 5CH7B 4DHVA 4H4KA 2ZR5A 4RPFA 1VBKA 3ARSA 2W4CA 1CPZA 4S3KA 4AL5A 5D4NA 1T03A 2W2PP 3WH0A 2JFDA 1FDAA 4FYXB 3MM5A 4DCPB 3BO4A 3IG1A 3AA9A 4MFBB 4ZLJA 3LAKA 3UDEA 2EFVA 2J8SA 1NWRA 2VH7A 2WONB 4D3GA 1U48A 3CWJA 1BQNB 3AS0A 1C1BA 4Q0BB 1SUQB 2XWYA 3KG1A 2E44A 3PRAA 3MEGA 3JQKA 3RU0A 4U8YA 4MTVA 3UI5A 3CJKA 2AGOA 3TI0A 5IM0B 4URIA 2AJ0A 2LQ5A 3AROA 4ID5A 3B4MA 1JVWA 1NJXA 3RBXA 2FQQB 5K8PA 2DSZA 3LP0A 4GC6A 2H48B 2BRLA 3EUNA 3CJ8A 1WSRA 2RSEA 3LP2B 5DG8A 1TQLA 2RIJA 4UZBA 2Z30B 2UVUA 2IJNA 4FXWA 2VOOA 3TARA 2C2OB 5KT6A 3IAS9 5HWCA 4LF8J 1NPPA 4PTMA 2XPBA 2VJVA 1HBOA 3PW7A 1KHWA 4WK1A 3FBFA 2LEAA 4FZVA 4JUZA 2PDAA 2NCKL 5HQMA 3IRXA 3O2IA 2ZC3A 1L5UA 4NSBA 5KFIA 3EXCX 1RKJA 4J91A 3MFIA 1HYSB 5ITHA 3JQMA 4QW8A 3B9EA 1ZPVA 3MAHA 3HLUA 3J7YI 1YW5A 1NH8A 1M5VC 1JLGA 1LWCB 2AQ4A 1UEKA 1FESA 3O6QA 3R1HA 1UR8A 2BOPA 1J4IA 1LWEB 1OY9A 5C42B 3WZ0A 2M70A 4FYDA 3CCJS 1JNDA 3UR3C 4H4MA 5GMEA 1URNA 3M8YA 2LKZA 1N36F 2HNZB 5IQ6A 3GV8B 3HVRA 2E5GA 2BJ8A 5D4OA 1E6YA 1B0PA 2J7KA 4ZA1A 3ENQA 2RQKA 2J7WA 1ROUA 2NPIA 4AXJA 1SKUB 1RCXB 4FBUA 3HHNB 1NK8A 3IGNA 3G71S 4NCGA 2MJUA 1C0TA 3TA2A 1SXLA 2QLWA 3UFCX 3ISND 3P45B 2AGQA 4DR5J 3J81Y 5CABA 1YLXA 4B3TJ 1WC3A 2BJEA 2HPUA 1RUSA 3EZUA 3T6BA 1B70B 1TAUA 1NK0A 4IG3A 4OX7A 1IQZA 4DX7A 3OFFA 3G6MA 1LG1A 1Q1KA 4FS2A 1GQEA 1WHXA 1G2EA 2KT2A 1S0NA 3VAGA 4M94A 1PYTA 4ZMMA 4D3HA 2R7VA 2IAJA 1RAEB 2AYMA 5KFVA 1T8EA 3I5BA 3MPYA 1CJKB 5A8RB 1EETA 1IXKA 2JRSA 5F8MA 2HHHF 1E6VA 1DJ0A 3SQGA 1N5YA 2XYHB 3CMQA 4UQGA 3OR1A 3OVSA 5LSOA 3T5LA 4C6AA 5I3UB 1AUDA 3FCWA 4J7CA 4MPKA 5KFPA 3H42A 4Z2IA 4ZN1A 3PR9A 2AOSA 2CWXA 3MR2A 3NMRA 2HNYA 3HT3A 4F25A 3D0GE 3KLIA 1HWLA 4OX9J 3W5ZA 4ZJOA 2HHSA 2BQ3A 3KAIA 1FAPA 3A1YG 5IOLA 1LL4A 4MTPA 2CWKA 4ECQA 4M95A 4I6WA 1SJRA 1EAYC 2ADCA 2VF3A 2H3EB 2R7WA 1YRUA 1TUGB 3R5JB 2F5GA 3RB0A 1C2PA 2QYGA 2BUNA 2HHTA 2L9DA 1VBZA 2BE2A 3KUHA 5KT5A 4WFNQ 2POKA 4YEAA 1NH6A 3QNWB 2IMWP 3BDEA 2UXCF 1S6PB 1A7GE 1RHUB 2Y8YA 1UJ6A 4TLQA 5ETLA 2DR9A 5LMNF 1QD1A 2GVZB 2LXIA 2KXNB 3NBPB 4CO2A 5C25B 3TUPA 2OAUA 5DGAA 2ZZTA 2ZQTA 3SEOA 3PA7A 3BN7A 2WVDA 2BKNA 5HMZA 2XCAA 2PV2A 3KLEA 5AT1B 1JNEA 4ZVPB 3O5JA 3AT1B 4OV1A 4JI6F 1U45A 2Z2LA 3ZTPA 2EFOA 5MAOA 3DHWC 4F0MA 2FZGB 2FDNA 4IKAA 1DLOB 3N0VA 2LYVA 4KPYA 2G0JA 3DOMA 2ZNZA 3UD5A 2GO8A 1KDNA 2H4WB 3BGLA 3E51A 4ZP6A 1JLBB 1REVB 4Z2LA 3FQKA 3UI3A 2MKJA 1UFLA 1MROB 2GAHC 5K14B 1PG5B 2XLJA 1NHVA 4LAVA 2KHCA 1QE1B 2VQEJ 4OZNA 3ONQA 1A6LA 2DT2A 2DXDA 4ETXA 2I38A 4G1QB 3DFEA 2DHGA 3MHYA 3QQCD 2ZM6J 3M8WA 4P72A 4LFAJ 1YRXA 3IGVA 2D3O1 2B5UB 3GYGA 1NU4A 3HF5A 2KB2A 1B6CA 3AJ2A 4X62F 2OFGX 4NPOA 4DQIA 1WF1A 3FUYA 3FBCA 3D1OA 2ZHOA 2L9WA 2RUSA 1K9MT 3OJUA 4WKAA 2DGVA 4R0JA 1EYMA 1UWAA 3ILLA 3Q8UA 4ZIVA 1RWPB 2H4YB 2DNZA 3V2UC 3QT5A 4KC5A 1KFSA 4HT7A 3O5TB 4F36A 2E9ZA 1X4GA 2DNHA 4YB7A 2KXFA 2OH2A 2R2TA 1CJTA 3PIPQ 2DT1A 3NRKA 4JI7F 3BKFA 1JLQA 2QTWA 4WIIA 4J9SA 2OPPA 2XZDB 4WYLA 3BZQA 2FHJA 2MKCA 1FFSB 1Q82T 2ACMA 2KFYA 1VDHA 2IDLA 2QMXA 1U2CA 4MK7A 3CD5A 1OWQA 9ATCB 4QZVB 4DWSA 3AA8A 4RNFA 3HJFA 1HKKA 1FKPB 3PFEA 2UUTA 4QT2A 2PV3A 1VK8A 3TZYA 4UOGA 4HI1A 2PV1A 1KNZA 5F8JA 3QGHA 5CYQA 2H5IB 3X1LB 3DM2A 3QYYA 2XP5A 1W9PA 4Y65A 3VF0B 2EBEA 4JYSA 1E44A 4MIAA 1ITPA 4ZN3A 4ZPCA 4ILLA 3AAWB 4ZIWA 3K5OA 2WK4A 3WD1A 2HVHA 1J5OA 2O67A 4NI2B 1JK9B 4B3MF 2VG6B 1RT5A 5F9NA 1M5PC 4LF5F 1VQ7S 1OPIA 3MUTP 1W9UA 4K4SA 3I87A 3CJ4A 1UFKA 2XLIA 2RKIB 1BWEA 1BQMB 4ODRA 4EEYA 1QAYA 3L09A 2F7VA 2IHR1 2GFFA 1S1TB 3H5SA 1YGYA 4ZS6A 1WDTA 1MWZA 1FXRA 4Q7AA 4HACA 2MSTA 3DU6A 2OELA 1RCOB 3M8ZA 1C1CA 2HRYA 3OXGA 3VZIA 4BC7A 1MWYA 2DXFA 3CCTA 1GTEA 1Q6HA 3CJQA 4FNHA 4ER8A 2CJXB 5K5MA 2PPPA 1N5TA 2UU9F 1FD2A 2F9DA 3KJQB 2ZUGA 1MLAA 4S0MA 4LRAA 1N88A 1KQKA 2UXBF 5HVHA 1WHVA 4J9LA 3H5XA 4LSLA 5L1JA 3WD4A 1CULB 2CQIA 2RRBA 4F3QA 1RTDA 2LQ8A 4EWTA 1CS4A 3UDCA 1RT2A 4HTIA 4DL2A 4JI0F 4PG7A 3ZNJ1 1NXIA 4K5SA 3A8IA 2ZQSA 3Q8QB 1D7HA 4B9SA 2QA4G 4KO0A 2B9YA 5C2GA 3T6JA 3ARYA 4L3KA 1BLUA 4HR2A 5DRKA 3GPAA 1Q8BA 1GXUA 3I5AA 2VHGA 2WBRA 2RHQB 4TVAB 4NWBA 1WD6A 1NBEB 2O5DA 4JB8B 3T1YF 3THVA 1UPPA 4RU2A 3SQOP 3PX0A 2AYEA 2MHNA 4USKA 1H6KX 2LGOA 4WE1A 2AJQA 1LFWA 4JI5F 1DTTB 4ODKA 1KLNA 2QLBB 3OSPA 2HMIB 2ESCA 3GP9A 2EFQA 3M1VA 5IV3A 3CCWA 4NCAA 4YN3B 4TLRA 1IBMF 2FJAB 2P4VA 2PMZD 2O66A 5AJ3J 5KFEA 5CCLA 2HHQA 1Z4UA 1PJ6A 1X5TA 2MXYA 3QPIA 4E8UA 3IHZA 4I2QB 2G4BA 3GZ7A 2LJ4A 2VPZB 2VFRA 4QBUA 4RW9A 4OZ2A 4YDXA 1CSJA 4LQ9A 2HVDA 3BPDA 4DV4J 3GSDA 5D4PA 5BYQA 1WG5A 2DJWA 1XMQF 3FEXB 4U86A 1TKZB 1CTNA 1FKKA 4LRBA 3H7HB 2ZBQA 1O0PA 3A13A 5E7OB 2CZVC 1WEYA 1TKXA 2XLKA 3PM9A 3HJVA 2XNRA 5AXLA 4ECUA 1Q5YA 1Y5LB 2BJDA 4ZITA 3HZGA 2MZTA 1OSCA 4DFKA 5J2QB 5EX3A 4P6QA 1YK9A 3ZZZA 2LXFA 5GAHI 2E9TA 4TW6A 4FXVA 3FGVA 5A0YA 2FIUA 2YBUA 1FRXA 4A8YA 3HVAA 4DV6F 2WOMB 4MNKA 3VVTA 1AROP 2NSCA 3EYZA 3WHIA 2IMOA 2RS2A 3E01B 2V8VA 3EE3A 1IBLJ 2GGPA 4TY8A 2MB0B 1RT6B 4OYWA 1NDLA 1NO8A 1FJDA 2V9KA 3UD4P 5ETPA 1W7WA 4EYHB 4HKQA 1EARA 1NM2A 2N87A 5KFKA 4IFYB 1RT4B 1T94A 4C8LA 2HFSA 2H1YA 4LVOP 4P7VA 2CJKA 4CT9A 5T7LA 3LA0A 4O44B 3VR1A 1OO0B 4M5NA 2FTRA 3FMBA 2R2UA 4OFZA 4RW6B 4DG1B 5KG2A 2MLZA 2CG4A 3DHXA 1PJ5A 1AZSA 4LF7F 2BV3A 1BKFA 1SBRA 4K4ZA 2W9BA 5E3CA 3PRBA 4FAPA 4NLPA 1V5VA 2DNOA 3IMQJ 3HVTB 3D6TB 2DNGA 2J9EA 1FKOA 5KG6A 1FKAF 1JJ4A 2ZJQQ 3KJNB 3DRRA 2P6TA 4UTGA 4LQ3A 1J2VA 1T9VA 2CYYA 3O5FA 3VWSA 1NK5A 2O3DA 2E5LJ 5IFMA 2O1PA 4OL8A 2PC6A 2V69A 4G65A 1RAIB 4HH1A 2ZR4A 1HNXF 1C0UB 4JV1A 3CH9A 1TAQA 5GAHU 3HULA 3G82B 2YKQA 5F9LA 5ETRA 4DUYF 2UZ5A 1RU1A 5EDWA 2CJ9A 1DBDA 5DF0A 1MMLA 3W7BA 2IJFA 1Z2ZA 5DJBA 2DPEA 3LAMA 1UW4A 1J5EJ 4A8FA 4X4RA 1TP7A 2HS4A 1N8RT 3HSJA 4QQBA 2YNHA 3G9CA 1VI7A 4HDGA 3KK3B 5D0RA 5J6EA 1WDDA 4DF4A 1TL3B 1HR0F 3M9MB 1U0HB 4KV8B 2JSXA 3R8YA 1VRUB 4WP3A 5A8KB 4R5PB 3IKDA 1ZM9A 1SKWA 4GGQA 2E5JA 4LT6A 4Q45A 5C7PA 4PPZA 4NMXA 2DXEA 2DO4A 1LW2B 3I5CA 4NLQA 2A2CA 2ZH6A 1HNIB 3I4HX 4CO0A 3TZZA 4PG8A 2RT3A 2CUYA 4OZ0A 1JLEA 2XTJP 1XNRF 4CLSA 1BMQB 3AXKA 1M1HA 1H73A 4ODPA 3H2VE 3KWMA 2F1FA 1RHKB 3DI6A 4DXLA 3JSRA 2H65B 4RX6A 3QRPA 1PBKA 1FFWB 4K8RA 1R8AA 4X4VA 4DU7A 4DI6A 2FJWA 5KFUA 2JNJA 3TJ9A 2VICA 3DOLA 4PPDA 1WWHA 3TAPA 4X65F 3W2WA 3R6LB 3W8GA 2OTLS 2LXUA 1S1XA 4ZVFA 3TR5A 4NLRA 2R8IA 3EDRB 3B8SA 1HPZB 3VAHA 1RE1B 3H59A 4Z2KA 3M2RA 2RQSA 1M5KC 2I5JB 3SYZA 2KM8C 4ZVGA 1YG0A 4G3IA 5HROA 2DGQA 2ZE2A 3DU5A 4DV3F 2DG9A 4IT6A 2WZ1A 4G1IA 2ERRA 2WB4A 4C02B 2G9OA 2WSEC 1YJNS 3DDIA 3CCMS 1Y3KA 1OYDA 3FJ2A 4ZLLA 5IWAF 3I0RA 3HI9A 5A2QY 2X1GA 1VIXA 2XP7A 1H0HB 1VHIA 1QPFA 3O5OA 4BLGA 3C15B 2HFUA 1M0SA 3MMJA 4ICLA 1S6QA 3EY6A 4PQUA 5HBMB 4HDHA 1U6FA 1VQNS 2L48A 4OX8A 4LF4J 1Z2LA 4DEZA 3K5PA 3QT7A 2ITKA 3Q2SC 2P6SA 3GU0A 1Q78A 5A76A 3NEKA 1TUVA 3P96A 1PINA 4FF2A 4F67A 2CJBA 3FRYA 3G6ES 5B7WA 5B0EA 2HZAA 4HI2A 4PABA 3HHLC 1FDBA 3GIMA 2DY9A 1F1BB 3JYTA 4N7TA 2ILZA 2B5JB 3VV2B 4JFIA 2X1AA 4WFZA 4JI4J 3V4IB 5HP1B 4ZVHA 2UVWA 4HLBA 4NXNF 4EFAC 2DR7A 1TK8A 1SC1B 2IRUA 1EIBA 3M8QB 1I6JA 2QRRA 3VGVA 4A4JA 4IUFA 2EPIA 1IVZA 1Q4RA 2ZZNA 2L2SA 3MUVP 2IY5B 3FZBA 3BEGB 1XMBA 1FJEB 2HQFA 4DV2F 3ITHA 3MM9A 4WF9Q 4I1TA 1N34J 2EKYA 3CHCA 2MEWA 1KRPA 1FI4A 2XEXA 2XZWA 3OLAA 3P3DA 1NK9A 4J9PA 3NCQA 3IFEA 4DH0A 5DZ6A 3MEEA 3C14A 1S72S 2IM0A 2NXEA 3HMJG 3NGTA 2CAJA 2GAGC 3K0JA 3PCOB 3R7SB 3IS9B 3IN5A 4GKKJ 2DCUB 2UP1A 4QWBA 1AW0A 2HW3A 4C11A 2U2FA 2VG5A 1DURA 5B0CA 3A8JA 2ASLA 3I6PA 1ICEB 2OSRA 4YFUA 1YITS 4A8KA 1LKZA 2GQ2A 2VN1A 1QY7A 3RUBL 2XYPB 4CLWA 4QIWD 3TO8A 4Q44A 3MM6B 5KG1A 3ZC4A 5HJXA 3J7ZT 2ZQVA 2IC3A 1W1VA 4DZ2A 2QA4S 1RWXB 3CB4A 2G8ZA 2F4FA 1WOSA 2XQCA 1UKUA 1S48A 2W9CB 4PYAA 5C2CA 2V4QA 4NRUA 2KFZA 1WHWA 1PO6A 3O8WA 4DRPA 3KFWX 2OSQA 1WEZA 3AB4B 1H98A 3NS6A 2PE8A 1HNVB 3JTOA 1Q8LA 2Z0GA 4KT0C 4FF1A 4KYZA 3W62A 3C2PA 1P9YA 2NXJA 1CG2A 1IKXB 3VAFA 2EW9A 2Z2ZA 2F40A 3RRKA 1ZA2B 1WF2A 2V8DA 3FY1A 1V9OA 4TU8A 2F4VJ 2QFIA 4RNMA 3AH6A 1W2BR 1HNWJ 1OSDA 3ENAA 3UVJA 4RL1A 2QLJB 2HGMA 2DNKA 3DLKA 4DRQA 4OYAA 3TX0A 2VQFJ 2J9CA 2HFOA 3CXCR 1TR0A 4A8MP 3PVXA 3FCVA 1YJUA 2RSQA 3R2DJ 4LREA 5DGBA 5ETVA 2XSJA 4JI8F 4RW7B 4O3SA 3KLFB 4ODNA 1FFGB 5D3GB 1X5PA 4OX6A 2W2OP 5F41A 4KGXB 2NZ4A 1NZ8A 1T7PA 3MGJA 4B3SF 2XP4A 1S9GA 2FGOA 1PBUA 4ED3A 4NLWA 2OP5A 4K0KF 1FERA 1D7JA 1HBMA 4OV6A 2M0GB 3RBZA 2U1AA 4USHA 4U95A 3OFEA 1C9HA 1RYRA 4ECYA 4C0HA 1XEZA 2KT5A 3R7BB 2BRKA 4L75A 2BYCA 2VODA 3EIPA 3BSNA 4I2PA 1RWKB 1PGZA 2MYFA 2JHEA 3MEDB 1D2KA 5H1SV 2OMOA 4U6PA 2Z56B 4JFKA 4OHVA 3M32A 5FJ4A 4QWDA 4QCLA 2V67A 2XHCA 2J6TA 3CE8A 3MFHA 2XP8A 1RT7A 3Q22A 1UFWA 3PYFA 2WSCC 1N33J 4ECWA 4IG0A 1YQHA 4PXBA 2WB1D 2RE1A 4LBPA 3GJRB 2B9WA 5LXYA 2DGSA 2DH7A 3ZZRA 2DEJA 1F3FA 3QWPA 3ARZA 3C6UB 4Z2JA 4HHUA 1HI1A 3DOKB 4PXEA 4O0IA 1P6TA 2YNFA 2PT0A 2KL8A 3TJAA 2X51A 2DR6A 2AYGA 2OPQB 3UQBA 2E1PA 4C3MA 1NWTA 4I2QA 2CQ2A 5CYMA 2AYBA 2CA9A 2XP9A 2XZTB 1NKCA 1N0VC 1D09B 2W24A 4NX9A 1U1OA 4OYBA 2RUGA 1UEUA 2W1BA 4NLYA 4CTAA 1R8CA 4MMOA 3DLGB 5KFWA 3JTPA 1CLFA 5BR8F 1KQFB 3SV4A 3H9RB 4P10A 4USTA 2V8HA 1SV5B 1L3SA 3UCZP 2B4OA 1YTYA 5DO2A 5J2NB 2ZHAA 4OZLA 3GIIA 5KFTA 2ZH7A 1RT3B 2QE5A 1ROTA 4DV5F 4QIVA 5KFDA 1HKMA 3AOBA 3CO9A 3M7VA 3FQLA 2NXCA 3I32A 1EP4A 4BWJA 4OI2A 3DLEA 2F4EA 1KQGB 4AXIA 2BOAA 2G1HA 2R7SA 4RNHA 4IH6A 4PRFA 1KFWA 2RILA 1LXJA 1RABB 4N5SA 5IT4A 2ZD1A 1U09A 3DRXA 3H2LA 1RT4A 4FYWB 1U24A 3NRBA 4B17A 2MPHA 4FNIA 3IKGA 2YQ1A 1IX5A 4A8WA 1N5VA 4N8NA 4CI0B 1DTQB 2DNYA 5A8WA 1UMJA 1BQXA 3NGSA 1S9EB 2XC9A 1YHQS 4WFXA 2R2SA 1S49A 3BKTA 3IA0A 2CPYA 2KKHA 5JUMA 3H25A 2CNOB 1RAGB 3DXBA 2MQMA 2HZCA 2XO6A 4NLTA 1FDDA 4DSEA 2EI5A 4CH7A 2FHOB 3UQSA 3B9DA 3TZXA 1NAQA 2A3EA 1S99A 4KHPF 2KG0A 3OTBA 1OIAA 3NY0A 4L76A 4DR6J 1RTHB 1JLFB 1P8GA 3Q0AA 4K4XA 3IBFB 2A0FB 3BO2A 3QGIA 3HX9A 4O3PA 4DR2J 4ECZA 2HS3A 1HMVA 2IDEA 2VC1A 2E5IA 4ES1A 1IKVB 1ZBKA 5KAKA 1U1RA 4HTJA 4MK9A 2PI4A 1NJYA 1Q81T 4K2JA 4YB6A 2KT3A 2OPSA 3OR2A 2ZKUA 1I3OB 2PA3A 1UA1A 1RHRB 4MIBA 2V4JA 4QW9A 2UUAF 3UQAA 3BS9A 3T3FA 4H4KC 4X2BA 3QJLA 4Y0FA 2G41A 2YKMB 1U6ZA 4LF8F 2W4PA 4KPCA 1JXLA 4F50A 3FMWA 3CCRS 1PILA 4PAAA 4MH8A 1FTRA 4FS1A 1FJGF 4I4BA 1U49A 3AY0A 4YB1P 4CO3A 2RUCA 2XM3A 3K2YA 5KG4A 1X9MA 2F2DA 1SI9A 4KV8A 4KHRA 4B9MA 3VCDA 1RWWB 4GMKA 3N5BA 2BABA 3RGIA 2RU3A 4WKRA 4CLUA 3OUYB 1Y5IB 4DPUA 1W1TA 4TXSA 1I51B 1TV6A 2DH9A 3TEGA 2EFGA 3FSIA 5K8NA 5C24A 2NYIA 4C8KA 1TZ0A 1SJFA 1R0AA 4DR7F 4KQZA 2P8IA 2AGPA 2H51B 5KG5A 1NSAA 2KGJA 1UP1A 2RDJA 4FVCA 1RHJB 4IH7A 4ZP9A 1Q6UA 4MT1A 1QM9A 3RZAA 1ZYQA 3J80Y 4ALZA 4ZHRB 1C4CA 1Y11A 3SDEA 1KKHA 3FSXA 3D66A 1TK0A 4FYYB 5HQLA 1RB0A 2X1BA 3NMAA 5J2PB 4E2FB 2B3TB 2K8GA 2GIRA 2ZH2A 3KK1A 2KTQA 2XMJA 3K5NA 1Q6IA 2CPFA 3AODA 2GMJA 2OO4A 5KT3A 4YHHJ 2GHWA 2MGZB 5F0UA 4ZJQA 3BR9A 2DEIA 1YVFA 1IJEB 3FC9A 1LJYA 3POTA 6FD1A 1Q86T 4HHJA 1RA7A 2VPWB 3MM8B 2F9JA 1RXOB 4C8ZA 3ZZOA 1QJHA 2ZNYA 2UUCF 4Y34A 4AY1A 1HLWA 2ZDPA 4ZPDA 4C97A 1O8BA 1SH2A 2CPZA 4QOTA 4USVA 1WI8A 4GRSA 3PX6A 5E41A 1RTJB 3OSNA 4TYOA 3CTRA 3B82A 2ALYB 5ETTA 1WHYA 1P27B 1J4RA 2QL5B 3OL7A 4YR2A 2YWFA 2ZJPQ 4ZOSA 3LUOA 3RRGA 1FJ7A 1N1AA 3HXMA 4UY85 3BGOP 3SFUA 1JJCB 5SZTA 1M90T 2NUUG 2RU9A 3L7PA 5IV4A 4RUAA 2QEXS 4ZJLA 2Y1JA 1SC6A 3MEKA 3DRYA 5B09A 5DG7A 4YS2A 2JZ5A 4J37A 1D8YA 2LA6A 1ZK6A 4IFVB 1EIYB 4DCJB 1JLAB 1DQAA 3ICLA 4LFCF 1FKIA 4EBCA 3GFYA 3GE9A 3GLJA 5I42B 3MD3A 3Q8RB 4KRWA 4HBOA 4H54A 5CXTA 4NXMF 3W9HA 4YQWA 4NRTA 1S0MA 2FC9A 5L1IA 1IM6A 3IS9A 1LW0A 1VGYA 5HMYA 2HAIA 3J81U 3GCWP 4PUOB 1X4FA 4DZDA 2OLWA 5FDLB 3SMZA 3QIDA 2F8MA 2GVDA 3DLLQ 2CQ1A 4XDDA 1R9HA 4ANDA 2FLOA 4CP5A 1W25A 4P75A 3L7UA 2MHEA 1MMDA 2NSBA 1N32J 3T1HJ 1N6QB 4USMA 4X4UA 3ETMA 4ECSA 2ATCB 1KS2A 4DZ6A 2N82B 3JB9k 1HWIA 3LUYA 1PC4A 1Y5NB 1V3SA 2YKNB 3O5PA 5CZVA 2FZCB 7AT1B 4YOEA 2E7WA 2V0NA 4ZPTR 1ZPWX 2Q3PA 4Y2CA 4LFAF 2PGCA 2ZQUA 1HA1A 2AV5A 3GG0A 3RYLA 3N01A 1U1QA 1YBTA 1HQUA 2K3KA 2PBCA 2LU2A 3IR7B 2YX7A 3G8TA 1KLMA 3OFGA 2ROGA 5L9XA 5KFGA 3IC1A 4NASA 4IR1A 2ATLA 3HP6A 4DPYA 1FKFA 1S6OA 3OHBA 3M2VA 4PXDA 2CPIA 3W9IA 4X4NA 1H2VZ 1IKWA 5CD4H 1X7VA 1AB8A 3PRVA 3IWNC 1K73T 3AOAA 3QLHB 1UWBB 4CO1A 2MKSA 4TY9A 2X3DA 4DL4A 3DRSA 2JEJA 2VBYA 4MYUA 1B0TA 4F02A 4N41A 3O44A 3SSRA 3G6YA 3SSQA 1SQEA 3DDKA 2P9EA 3RFWA 1WC6A 1ZAVA 5L1LA 3QIPB 2HQGA 3I56S 1FFRA 3NOCA 5EWGA 3EGNA 3F44A 4DPWA 3I0SB 1NK6A 1LOUA 2M2AA 5IS2A 2BM1A 3MTKA 1YIJS 3NCRA 2MY8A 4P73A 4RKUC 5GVQA 3GV5B 2ZC4A 1JKHB 4M63A 3PEJA 3K59A 3MURP 4DQQA 3D28A 3JSMB 1LQ9A 5MLCV 4DFPA 3CDAA 2CXEA 4CM2A 2IM2A 5DETA 3I9ZA 4MNLA 3T1AA 2B31A 3CC2S 2HIQA 4C98A 1LWFA 2LFVA 2XNQA 3Q89A 4UW2A 3O5IA 1E6RA 2ZBPA 4R25A 3PG9A 4OYZA 1N36J 3BR8A 2D7SA 3JSYA 3BGFA 4P52A 4HARA 4C3LA 3TDBA 4KGMA 4JV5F 3LH2S 3BGRA 4U67Q 5J1EA 4PWDB 3CPWR 4DWSC 2C28A 2ALZA 1GK8A 3PJ9A 3RGCA 2VG7A 1F5AA 3Q8YA 4DOZA 4IO1A 4ZP7A 3BXWA 3UCUP 2QZ8A 3CDWA 4CYUA 4N8OA 3IXQA 5HSPA 2DISA 2I6WA 1FEEA 3KG0A 2VFSA 1J6YA 2N4CA 3MECB 2KRRA 1X4BA 4QYRA 2R8HA 1VLOA 4G50A 3H20A 4PXCA 3QAEA 2RVJA 4FN2A 1EHNA 1ZA1B 4J9RA 2UXDF 3HSZA 2HBRB 1E15A 4KSEB 1KC8T 4PG4A 1TKTA 4UT4A 5C5JA 4HL9A 2CQCA 1DZ5A 3BKUA 3C16B 1FD9A 4Q7NA 2LDIA 2E7VA 3NNCA 5EHHA 2ZKTA 2AEFA 4FVMA 2HHHJ 1PIEA 1WELA 4O4GB 5HI7A 5K8MA 3ET6A 4DPTA 2HFVA 1W9VA 2PEBA 4LFBF 4NZ7A 3V6HA 5HJYA 4X66F 1X4DA 1JJ2R 2HVEA 4OZ3A 5AXKA 1CJVA 1KWMA 3GYXB 4RWWA 5G0RA 4U7UD 2LP4A 3MMBA 2GC8A 3T5KA 5HTGA 1OMSA 4RJVA 2KM8B 1OGBA 4WP8A 1LXNA 4HHHA 4M5DB 2WTFA 2A1BA 1FXLA 4UOHA 3EVOA 3CUNA 4HYKA 2ETNA 3TOQA 2DHSA 1WI6A 1FA0A 3A3OB 3SI8A 5AJ3F 4Z2GA 2EK1A 2VDIA 4NYOA 5LMNJ 3ZTQA 4DV0J 1TL7A 4DFJA 4FYVB 2B6AA 5FD1A 3IRWP 2M3DA 1S97A 2YTCA 3PW4A 3ARPA 3FBBA 1PSDA 3U02A 3W5YA 4Y00A 3H4DA 3CJTA 3THTA 4UDMA 3OW2R 3WIVA 1NRKA 1SIWB 3KOAA 2W7AA 3QOKA 2DNPA 1RGVA 4IQXA 1HWKA 3HHLB 1CJUA 2HVZA 3QGPA 4JI6J 2YNGB 1NH7A 4OZ5A 2RF2A 1S1VB 3NNAA 1H2TZ 4Y6IA 2WVCA 2PPNA 4PWUA 1YRTA 4L3NA 5EWEA 5DM6Q 4E98A 3GONA 3ARRA 1FDNA 3SCKE 3HKWA 5DDQC 3RAMA 4JBCA 4OMFG 1ZBWA 1NHKL 4WZQA 1G7CB 2C2RA 5LJ3Y 3KUGA 1Q7YT 4F04B 2VL1A 3QZ8A 2YKAA 1RD6A 4QYZJ 3UWTA 2ZH1A 1FKTA 2IVYA 1RU2A 4RW4A 1SIZA 3GV7B 4W90B 2UVVA 1JCHB 1SQGA 1IBLF 5SUHA 2NPFA 3MXHP 1NUEA 3PACA 1KEKA 2JH3A 3MCMA 1KP6A 1F8AB 2DRAA 3C6TB 4DCOB 2XPAA 2DHXA 1EKSA 2KVQE 3CHFA 1M1KT 3N6NA 4B08A 3CCSS 4QYZK 4X62J 1TVRA 1NKBA 1FKHA 1OY6A 2RRNA 4ED5A 1HBUA 4U84A 4CNYA 4I64A 3MMCA 2R3VA 2XMMA 3KLGA 4H4OA 1UTAA 3FVYA 4XAKA 2DHHA 2YQ3A 3LP1B 1GMVA 4WCEQ 4Y2MA 2JZVA 3BJYA 3MPDA 3CF5Q 5DEZA 1LK7A 2H5EA 2K1RB 3GR1A 4MSPA 1GRJA 2HBZB 1VRTB 1RT1A 3R7NB 3PW2A 2G2ZA 4JI7J 3GPKA 5DS7A 5KFFA 1HHTP 3OD2A 1RK8A 4CZCA 3O5GA 1R6VA 3FXYA 4Q8FA 5LMUF 5E2QA 3JYJA 1Y4ZB 2OEJA 2OJ3A 1G4CA 1HBNA 1VJQA 2I1RA 5HQ8A 5B08A 5IT0A 4ODMA 3ENWA 3QGGA 1ZH5A 3H5YA 1B3TA 1O5JA 5J2MB 4CLZA 1YKWA 5KG3A 1IBCB 4M5JA 4MKVA 5AE3A 2AX1A 3S1TA 3DXSX 3THPA 3BO3A 3A8KA 4NE9C 2DY1A 2JLEA 4LF1A 1VQYA 3PW5A 3A3PB 4FP9A 5FLXU 5GPRA 5HL7Q 5CYJA 4KKOA 4LIWA 1N5SA 5F8GA 2HQCA 4JI3F 4ED1A 4Z7YA 3BSAA 2BE7D 4B3RF 5ETQA 1SJ1A 2ABYA 2YNIA 3ZZTA 4DSKA 1KT0A 3V6DB 2LA4A 5D4LA 2IRXA 4LF5J 4ID8A 1FWKA 1B64A 3KK2B 2OIHA 5ETSA 2MKIA 3L7OA 4B9VA 1AUSL 2EWHA 2DNRA 2KDOA 3CHDA 3RRHA 2E1RA 2HNDB 4R8UB 2BANB 2YBTA 3EVWA 1B99A 3MAAA 4DV7F 3KHGA 5KT7A 1NK7A 3CEDA 2ZWOA 3F41A 3IK8A 5LM7E 5RUBA 2CG8A 4DR1F 1FF2A 3DRPA 1IKYA 2WCXA 1X0PA 1LL7A 2UXBJ 1F2HA 1RISA 4DX5A 3P4UB 3QRRA 4J9OA 2DK2A 2LEPA 4C8NA 2XB2D 4YR3A 1T3NA 3F73A 4Q2MA 4J4OA 2M4MA 2E9RX 1M5YA 1D8ZA 3MMAA 4WKHA 4RLEA 3WX4A 4Q22A 4I56A 4JI0J 2KYZA 1S1UA 1JLCB 4X4SA 4IT4A 3KAFA 4ZVUB 4R5EA 4K4WA 2HQIA 4P8UA 1PAEX 4PCQA 5HLFA 2R7OA 1HNZF 4AD6A 1PJ7A 4LF9F 4L73A 3RMEA 3MM7A 3U1LA 4FKYA 4EYIB 2F21A 1ZL1A 4G1PA 3QO9A 2ASYA 4GVBB 1FK9B 1HJXA 4YR0A 1NSQA 3UF8A 1T05B 2DR5A 1XQIA 1TL1A 3T1YJ 2C3OA 3U1MA 3I82A 3M9OB 3SV3A 4LSNB 4JI5J 3QT6A 4PR6A 3UNYA 4JI4F 4BHQA 3ARTA 3WD3A 3X3UA 1E6PA 3OJSA 3ZXWA 2OFHX 2UV8G 1PYOB 4P2XA 4IDKA 4OJ1A 4M5MA 3NLCA 4LAXA 1ZU8A 1XR5A 1IBMJ 2EC0A 3MTJA 2AKWB 3G4SS 3D6FB 1P5QA 3KJVB 4DUZF 3TYTA 5KFAA 3LO3A 1RDRA 4S3JA 2Q1LA 1YZ6A 4ELVA 1M5HA 4Y3CA 2ADBA 1KVKA 5H9EJ 4KB7A 2ZH5A 4B3OA 2LECA 1IJFB 1S79A 3ELHA 1XMQJ 2EG2A 4XO0A 2YWKA 3LALA 2MQLA 4WP9A 4OHWA 3N4WA 4WK3A 4RW8A 4X84A 5GAEI 2J6SA 4B9NA 2DT0A 2MZJA 3HPOA 3V81A 2PA8D 2YWHA 2DGUA 1KHVA 4OYMA 2HIYA 4OZ1A 1RWUA 1PCAA 2BACA 3I31A 3ODKA 4OJ3A 2OPRA 5H9EK 1Y10A 1R27B 2FDMA 2DBBA 4QPXA 3D7SB 2E66A 1LL6A 5ETMA 2BR0A 3M30A 4OHYA 2Q79A 4F4WA 3J7YU 2QC3A 1L3UA 3M8PA 4TKTA 3TP2A 4DV6J 3TJ8A 4YUDA 2DSUA 3W60A 2R7UA 2QL9B 5F8LA 2LVWA 4ZCMA 5THWA 2FJXA 2VCDA 3L95X 2XWXA 3TVYA 5A2QU 3KG4A 1R3NA 3TUIC 1HHSA 1PKUA 1AXQA 1V3RA 3FFIB 3H0PA 2XGQA 4DSLA 1QVGR 4UQTA 2AEMA 2IUZA 2BXJA 4GKJF 2B51A 4DIPA 2HHWA 3BMBA 2NQPA 3CZ8A 4A8XA 1Y0HA 2R7TA 3SCLE 3ZZ0A 4Q8EA 1T03B 1HKAA 5F3ZA 2LQ9A 2DB1A 4N47A 2QLXA 5DDPC 2Z4PA 3L3CA 4I7FA 4KFBA 3MM5B 3IG1B 3HCXA 4OYOA 2VPYB 4WYWA 4X64J 4XPCA 2VA3A 1C1BB 2DH8A 2ROEA 2JLFA 1XMOF 3LW5C 2VU5A 2AU0A 5E3RA 2OFNA 3MEGB 4HVZA 4CLLA 2GCFA 1WSVA 3CJKB 5L1KA 4FKXA 2CQ0A 4EK2A 2K06A 3M2UA 2GV1A 2YH0A 3WC0A 5GAEU 3N9UC 1RAAB 2FJDB 1FVSA 3M8SA 3T9NA 3RM8A 4IOAQ 4U8VA 2CZ9A 4ID5B 3W2VA 1Z1ZA 2CNLB 3LP0B 1N56A 4TN2A 5HW6A 4ED6A 4L72B 1HNXJ 2JJ4D 3M05A 2GS8A 3V4MA 3LGMA 1OQ6A 1GMWA 2VKRA 3D0HE 3SCIE 4DUYJ 1YATA 2M8DB 1SVDA 3OTOJ 1NK4A 4F4AA 3WD0A 1WUUA 2DITA 1IUJA 3LOUA 1HBOB 4Z37A 3CW2C 4CDIA 2HKEA 3MOZA 3S01A 4ZVTB 3IRXB 1NEEA 2FVCA 3ARUA 3Q86A 1HR0J 2VBZA 5HO4A 1K1QA 1K47A 1REGX 1FKJA 1TTHB 1VJWA 3HFZB 2UUWA 1KQSR 5B0BA 1JLGB 1RTIA 3FEYB 4PZVA 1AT1B 2F8EX 3PO5A 4OIXA 4EI2A 2N4DA 2A10A 3BPSP 3KACA 2GO9A 1MU2A 2MKHA 4TNOA 4USWA 3B7XA 4H4MB 3KADA 1XNRJ 3DN9A 1FRMA 4MAKA 2JX2A 1E6YB 4KIAA 3VAMA 3MWBA 3EGVA 1UVLA 2YY3A 4WZMA 2FKEA 3PTWA 1X4EA 1S0OA 3F0NA 2B9EA 1RLCL 2FVRA 4ES2A 2DNMA 4KGVB 1S57A 2BM0A 4NCGB 1FNMA 2ZBCA 4AUKA 3NGDA 5KFJA 1WC0A 1ZM2A 1C0TB 4BC9A 1VCTA 2HWHA 4X65J 4EZ9A 3DYAA 4HEA9 1SC3B 1RWNB 2GQCA 3UR0A 3KYLA 2G1DA 1TKDA 5M2PA 3KLHA 4W9OA 4IG3B 5IQQA 3CJ5A 3R1LA 1WKJA 4DV3J 1HQEA 2B7CB 5K9FA 1KN6A 3R27A 3IBWA 3GR0A 1BD6A 4IPXA 2M2BA 4MNMA 1ELOA 4K59A 5IC6B 2IAJB 5IWAJ 5KFOA 3L9ZA 2GNKA 2FHMA 3OL8A 1D9FA 4C2MA 2WLYA 1EETB 1S1WA 2JOQA 1F9EB 2JEIA 2Y3YA 2GJ2A 1E6VB 3SQGB 1N5YB 1WAWA 2YKPA 3DGPA 3OR1B 4TNSA 2J5AA 2CPHA 1R6YA 3RW6A 4ODQA 1W2IA 4LRDA 2HNYB 4LR8A 3JTNA 3KLIB 1RI7A 2Z2YB 3O5EA 4PWWA 3TQEA 3T5JA 1DAXA 2KYXA 3RBDA 1ZBCA 3G8SA 1SH0A 1EDQA 4TW7A 3C19A 1YI2S 1K1SA 1SH3A 4JI2F 3JAMU 4AYBD 4NXNJ 1RAFB 2MNTA 5HATA 4QR1A 2GMHA 2BE2B 2HHUA 5IZHA 4IRKA 3LWMA 2CDRB 3IR6B 2VFVA 1NMWA 4ETZA 2VV5A 2XI2A 2AHOB 3W63A 1R43A 3KZ7A 4DV2J 2M88A 3R9LA 2B56A 5KFZA 4DSJA 1KBRA 4JFLA 3O5QA 3WBZA 3RG6A 2D3UA 3PFOA 1UVIA 5KFYA 1UVNA 3PDNA 5D0GA 2VFTA 3KLEB 4EMDA 1SKRA 3K5MA 2R9LA 3D3BJ 4CLFA 5ETOA 3OQ2A 1PBAA 4ES3A 4ML4A 3K7RA 3DOMB 1VMBA 1X5OA 2WLZA 4DT4A 1FNOA 4FXDA 4MKBA 3TAMA 3PV8A 1VQPS 3MCSA 1QDUB 3TA1A 1RWOB 3HHDA 2JEGA 3H2UB 2DO0A 1S76D 4UUXA 4TU7A 3PHTA 3GG1A 2XS2A 4MFBA 1FX4A 4NZ6A 3OBIA 5KFQA 1VQLS 1TUWA 2HRTA 2WONA 2R7XA 4DR4J 1BQNA 2ZFHA 4Q0BA 1SUQA 3PJWA 2QSWA 5L46A 3CO0P 1P1TA 2COLA 4RBVA 3SIPB 2M1IA 2B0GA 2NXNA 3CMES 1AFJA 4IRCA 2J8AA 5IM0A 2BQUA 4ECXA 4NCBA 1GUVA 2R8JA 3KHRA 2XSFA 1BGXT 4DS5A 2KU7A 3TUZC 4NLXA 4IQMA 3LF0A 1L3TA 3BQ2A 2D3ZA 4CH0S 2XMUA 2M8HA 3LP2A 3IWLA 5HW8A 1U1LA 1CJTB 2DG3A 3HKZD 2ASJA 1QAJA 3I6CA 4I68A 2I2YA 1GAOA 1WTFA 4CNZA 5KFCA 1JLQB 3OTCA 4RBUA 1NJZA 4JI8J 2AZ1A 2PFFB 3LGHA 2RB7A 2OPPB 1YJ9S 3ISNC 2ZOFA 2VC0A 4DR3F 4B3SJ 1VQ5S 4DROA 3TVZA 3DDNA 3MR7A 1M5OC 5D6GA 4K0KJ 1T9XA 3LANA 5KFRA 5BYRA 1HYSA 1NSPA 3RJMB 1JJHA 4DWSB 4ZVEA 3JSBA 3UPFA 4OLOA 1A7XA 3UN5A 1U6BA 1LWCA 3O5KA 3HDSA 3O3LA 2NR0A 4OHXA 2V9WA 3G86A 1LWEA 3EGWB 5C42A 3EGZA 4EZ6A 1J27A 1X0FA 2CADA 5CYQB 2HNZA 1IN0A 3DM2B 1H0IA 2BQRA 2HS0A 4JV2A 2ROPA 1X8DA 3DLBA 4N56A 1S0VA 1F9HA 3M6WA 4ZKAA 2B43A 1IBKF 2A6MA 2W8LA 4KGKA 2V50A 3VAWA 1RSCA 2A3JA 1QTMA 4LRFA 2DNLA 2D9OA 3OTEA 5B0DA 1F3VA 1AA1B 2NLWA 3AFGA 1U7LA 3GMGA 1SR0A 2FJBB 4ZVQB 1J5OB 2XY5A 4DQPA 4JI1F 1RT5B 2ZUAA 2FLPA 1R31A 1GTHA 1XHGA 3VALA 4DX8H 3ALFA 1EZZB 4A47A 5L39A 2J9DE 1F6TA 1D7IA 3CJ2A 1S10A 2AJ2A 4HACB 3CJ3A 2VKZG 4I6YA 2CQGA 3AB2B 1H2UX 4NA3A 2KFNA 2R8GA 1K0VA 5BR8J 1C1CB 4IOBA 1JXEA 4ZVRB 3C46A 4FN5A 5IXUA 2XMTA 1CJKA 5A8RA 2HRUA 4LGXA 1T02A 4ANEA 3FK4A 4A8QA 2QFJA 2IYGA 1DARA 1OY8A 4KBIA 2WVFA 3DMJB 2EK6A 5I3UA 1VLYA 2AW0A 2C2MB 1NB2A 2Z57B 1HD1A 3ALGA 1ZTTA 1P9QC 2GMLA 1F2GA 4DV5J 2W9AA 4LSLB 1R0CB 4X4TA 1TK5A 1RAJA 3W65A 3PO4A 1RTDB 5LOQA 1CS4B 4WU3A 2EFNA 4BBYA 2J0QD 1RT2B 4FF3A 3A12A 3AQOA 5B0FA 3HD1A 2JDJA 2QA1A 4CRJA 1M5SA 3NAHA 4LVNP 4I67A 4KO0B 3WDOA 3OLBA 1N54B 3PW0A 1XC9A 1FRJA 1OGGA 1HHQA 3CD7A 2B4UA 3B54A 4EO6A 3AS3A 5GPGA 2DCLA 4URQU 1KSPA 2W2MP 3PRDA 1VISA 3E8OA 3VQSA 1S6PA 3GIRA 2HYIB 2QYCA 3W3SA 5EUHA 4URSA 4DL0C 4WE1B 2GVZA 3NBPA 5T14A 5C25A 1QUPA 3IO1A 4DQRA 1U1MA 1FKBA 3M1VB 1R0BG 4KHPJ 3V6JA 1F0XA 2B4PA 1RBAA 3RB4A 2H9ZA 2MQ8A 1NJWA 3Q2TC 3PIOQ 4OQJA 1DLOA 2G0CA 4KH0B 2Y0BB 1S9FA 1KVJA 2A3CA 7FD1A 1A9NB 1ZTWA 1JLBA 5HAOA 1REVA 4GO7X 4RW9B 3ZTRA 1MROA 1RAOA 2RD5C 1CQNA 2ZEJA 3AOCA 5K14A 4TYAA 3PKYA 3GCXP 4CH1A 1QE1A 1R89A 4QIFA 2UUAJ 4ATNA 2ZH3A 5I3PA 3KXDA 3F56A 4EUVA 1TKXB 4G1QA 2DPJA 3K57A 1TELA 1OJ4A 4TYBA 3ZTOA 2N7CA 1QAIA 4ED0A 2CJYB 1CVJA 2MLXA 2HHVA 1FJGJ 5HN0A 1D3WA 1X4HA 4DRHA 5A0YB 1OYEA 1DQ9A 5HT1A 3R5DA 3OXLA 5E0OA 4P2FA 4P8VA 4NMLA 3TQ1A 3BYRA 3NTPA 2CZ4A 3RM9A 5K20B 4YY3F 1RACB 3SCJE 2LCWA 2CJAA 2GGPB 4TY8B 2A2DA 2M52A 2HWTA 5GAGI 2M9KA 2ZWPA 2PFDA 1B7YB 4DR7J 1ZM4A 2YPZA 1XNQF 1WACA 4G2PA
chains in the Genus database with same CATH topology
1J6YA 2N4CA 3MECB 3MF5A 2DTJA 4JI0F 3HK2A 5J1NA 4IQCA 4PG7A 3M9NB 2IA0A 2HLUA 1KONA 1IM4A 2KRRA 1X4BA 4QYRA 1F60B 4K5SA 2ZQSA 2R8HA 2WHOA 4EU0A 4RW4B 2XHWA 3Q8QB 2QA2A 1D7HA 3KABA 1JB0C 4G50A 2W4DA 3H20A 4PXCA 5AXMA 2QA4G 4B9SA 2AX0A 3QAEA 2RVJA 4KO0A 3B78A 5T7LB 4FN2A 1EHNA 2B9YA 2E29A 4NNRA 2C3YA 5EN1A 3T6JA 3ARYA 2CDQA 4DSIA 4J9RA 2UXDF 3I55S 1BLUA 5DRKA 2VPXB 3T19A 3OTDA 1E15A 5KFXA 2EG1A 2OD6A 1Q8BA 4KSEB 1KC8T 4PG4A 1TKTA 1WB0A 5C5JA 1GXUA 4DS4A 4DV1F 2K3IA 2N3OA 4HL9A 2CQCA 1DZ5A 3I5AA 5DITA 3OL9A 2WBRA 3TANA 1FD9A 2UV8A 4Q7NA 3ISZA 1SJ4P 2LDIA 3ARQA 4K50A 4NWBA 1WD6A 2O5DA 3T1YF 3THVA 1AFIA 2PSZA 1FKPA 4RU2A 3NNCA 5EHHA 2R4FA 2ZKTA 3QLHA 2FC8A 3RW7A 2AYEA 3PX0A 1UWBA 5LSRA 2DGWA 2MHNA 1HKJA 3DLJA 1H6KX 2LGOA 4FVMA 1TVRB 4WE1A 3O5LA 2G13A 2AJQA 1LFWA 4JI5F 5I4MA 5L38A 1DTTB 4ODKA 1FRLA 2W9BB 4ODOA 3OFHA 4RBTA 1KLNA 1WELA 2D9PA 3OSPA 2CQBA 4O4GB 4DL5A 5HI7A 5K8MA 1HBUB 2ZOMA 2LEBA 1VQKS 1N34F 1W9VA 2HMIB 3MMCB 4LFBF 1N4LA 4DMZA 4NZ7A 1FKOB 1U79A 3V6HA 3EX7B 2ESCA 3KLGB 3CIMA 4H4OB 4X66F 2EFQA 3M1VA 1X4DA 1JJ2R 3CCWA 3PEHA 5AXKA 2RQ4A 2VBWA 3DRRB 2Q5AA 4ZPVR 4NCAA 2JC0A 3GYXB 4TLRA 4RWWA 1IBMF 2Y0SD 5G0RA 3UDLA 2FJAB 3MMBA 4DL7A 3GQCA 2GC8A 2PMZD 2O66A 3T5KA 5HTGA 5DIVA 1VQ9S 1ZBTA 2JL9A 5KFEA 5CCLA 4WFBQ 5F8HA 4WTYA 2KM8B 2E1CA 1Z4UA 2D1CA 2HHQA 1X5TA 4Z2HA 1OGBA 2IRYA 1F5BA 4XPEA 1LXNA 3QPIA 1RT1B 2MXYA 2D41A 3QIPA 1HI8A 1FFQA 3G6XA 2XY6A 1I1GA 2ZOGA 4M5DB 4E8UA 3IHZA 5HUAA 2E1AA 4I2QB 2WTFA 4J5OA 2A1BA 1J4HA 3GZ7A 2G4BA 2LJ4A 1FXLA 4YP3A 1X6LA 3I0SA 4W9QA 2L9NA 4GKKF 2VPZB 3CGNA 3CUNA 2VFRA 4R0XA 4HYKA 4QBUA 4RW9A 4UOCA 4YDXA 1CSJA 4LQ9A 3TOQA 2R7RA 2DHSA 2VG6A 1Q53A 3RR7A 4EBEA 3GSDA 5D4PA 1HJVA 1WG5A 1WI6A 5BYQA 1JKHA 1FA0A 2DJWA 1XMQF 3SI8A 4TW8A 2HFZA 2CPEA 2YWEA 1LK5A 3FEXB 5U47A 5AJ3F 1HBNB 2RKIA 4ZPAA 4U86A 4Z2GA 1BQMA 3JSMA 1TKZB 2EK1A 5DLGA 5GAGU 1CTNA 1FKKA 2YNHB 5F8IA 3B9AA 5L8RC 4ELUA 1RA6A 5HMWA 1QPLA 1O0PA 1S1TA 2B4VA 2AWZA 3K8WA 4NYOA 2CQ3A 1X9SA 5E7OB 3V5RA 3GFHA 3PKMA 4DFJA 2B6AA 2CZVC 1WEYA 1TKXA 5FD1A 4ERDA 2XLKA 3IRWP 3PM9A 1FJCA 1FRKA 2M3DA 2V5HG 4NYPA 1S97A 3GILA 1NWSA 2YTCA 2XNRA 3PW4A 3ARPA 1SKSA 1PSDA 1VS3A 2QMWA 4P8XA 5AXLA 3U02A 4ECUA 1Y5LB 4Y00A 2BJDA 3H4DA 3THTA 5M2UA 4MAVA 3HZGA 3OW2R 2MZTA 3PY8A 1OSCA 1NRKA 4DFKA 1SIWB 5J2QB 3KOAA 1NWUA 5EX3A 1FVQA 2W7AA 3QOKA 4P6QA 2DNPA 3ZZZA 4QIGA 2LXFA 1RGVA 1XR7A 5GAHI 2E9TA 4IQXA 1LG2A 4TW6A 1HWKA 4FXVA 3HHLB 4DN9A 3FGVA 5KFSA 2HVZA 5A0YA 3QGPA 2VUGA 2YNGB 1NNDA 1JLEB 1NH7A 1S7HA 2D74B 2FIUA 1XK8A 2YBUA 4OZ5A 5J1PA 1Q7LB 4EO8A 2RF2A 1S1VB 3NNAA 1FRXA 3AS1A 1H2TZ 2F8HA 3G8QA 3HVAA 4A8YA 1K0TA 4Y6IA 4DV6F 2WOMB 2Q6BA 4DV0F 3EPGA 1JNTA 4MNKA 2PPNA 2ZBIA 4PWUA 3DI6B 1AROP 4PWDA 2NSCA 1YRTA 1FCAA 4L3NA 3EYZA 2IMOA 4K4VA 5EWEA 5DM6Q 4E98A 4KKOB 4QPTA 4AQYF 4X4PA 2RS2A 3E01B 3ARRA 2V8VA 4O2TA 1FDNA 2GGPA 4TY8A 4C8MA 3SCKE 3WIJA 3HKWA 3R3TA 5DDQC 4ED8A 3RAMA 4JBCA 4OMFG 1ZBWA 2MB0B 4O3RA 1RT6B 4J9KA 2FLNA 4WZQA 1NO8A 1G7CB 4FF4A 2YNIB 1FJDA 3TX8A 1GNKA 2C2RA 4YDDB 5LJ3Y 2F4VF 2LU1A 2V9KA 3DOLB 3UD4P 1Q7YT 3ZZUA 1HNWF 3JYMA 4ZK7M 4FPRA 3W2WB 4EYHB 2VL1A 3MECA 5KG0A 3QZ8A 2YKAA 4HKQA 1RD6A 2N87A 5KFKA 5IT9Y 1VQ4S 4QYZJ 5HW7A 3NAIA 4IFYB 3UWTA 2ZH1A 1RT4B 1ZAWA 1T94A 1FKTA 2IFXA 2NUHA 4NZ0A 2CJQA 2IVYA 4C8LA 1S1XB 2P9GA 3TA0A 2DGXA 2VQFF 4RW4A 1SIZA 3QZ7A 2CJKA 4LVOP 4P7VA 5D75A 3GV7B 3FCHA 4CT9A 1S77D 3NG8A 4W90B 1TCOC 2D9FA 2UVVA 4FBTA 1WNOA 5T7LA 4N77A 1IBLF 3BSCA 2XI3A 2ILYA 5SUHA 2NPFA 3M2RB 2JC1A 3N6MA 3GFXA 3C8YA 1YJRA 1FKGA 2FVQA 3MXHP 4O44B 2DSWA 3VR1A 5HROB 2ZE2B 3PACA 4KE5A 3KKFA 1FT8A 1OO0B 2FTRA 1KEKA 2W7PA 4WXWA 4NL5A 2NS1B 2E1MC 2YX1A 2JH3A 2KH9A 3FMBA 3W4RA 4GIVA 2R2UA 1F8AB 2DRAA 3T9ZA 2C3MA 2YVSA 3C6TB 4OFZA 4RW6B 4DG1B 5KG2A 4J9NA 1YSJA 2XPAA 2DHXA 2MLZA 2RQMA 3CHFA 1M1KT 2E5HA 4JFMA 2MDAA 3N6NA 2CG4A 4B08A 3DHXA 3OXFA 1W1PA 3CCVS 5B0GA 4LF7F 3CCSS 4MIWA 3UCGA 3I0RB 1YBAA 1TVRA 1NKBA 3CCES 3RBEA 2BV3A 1BKFA 4AL6A 2RRAA 3D1QA 1SBRA 4K4ZA 1DTTA 1FKHA 2W9BA 4USIA 5E3CA 2RRNA 3PRBA 4FAPA 4NLPA 2DNOA 4O4GA 1D1UA 4ED5A 3UW1A 4K5RA 4NA2A 1HBUA 1N0UA 2RDIA 1BL4A 4U84A 1C4AA 3DRPB 4CNYA 1IKYB 5CA5A 3HVTB 4ICLB 1S6QB 2HMIA 4I64A 3MMCA 2DNGA 2J9EA 1NZAA 5AE2A 4PQUB 1FKOA 2XMMA 2JLGA 3KLGA 5KG6A 4H4OA 1FKAF 4C9DA 1JJ4A 3FVYA 4XAKA 4O3QA 2ZJQQ 3G6LA 4DLEA 2XMWA 3DRRA 2P6TA 3DCAA 1L3KA 2YQ3A 3LP1B 1J2VA 4LQ3A 4WCEQ 2QSFA 2CYYA 1CC7A 2MY7A 5DQIA 4Y2MA 1WF0A 3O5FA 5DLFA 2JZVA 2X3GA 5EX0A 3BJYA 2FPHX 3VWSA 2BDPA 1MW7A 2O3DA 3CSKA 3CF5Q 1NK5A 2XMVA 5DEZA 1LK7A 2W8KA 1VQ6S 5IFMA 2O1PA 4OL8A 2PC6A 3MMAB 2H5EA 1QZ2A 4HH1A 2K1RB 3GR1A 3MOJB 2ZR4A 4MSPA 3ETOA 1HNXF 1C0UB 4JYAF 4JV1A 1R8HA 1S1UB 3CH9A 1VRTB 4Q2LA 1TAQA 2FVSA 5GAHU 1RT1A 3V6KA 3PW2A 4CIOA 3PXGa 3PR5B 2YKQA 5F9LA 4DL3A 2UUBF 4F2RA 4M5DA 1HJWA 3GPKA 4DUYF 2KJWA 2UZ5A 5DS7A 5KFFA 1HHTP 5D8HB 3SFGA 5EDWA 3JYTB 1VQ8S 2CJ9A 1F40A 1RK8A 1DBDA 2RS8A 2XG8A 4RNNA 5DF0A 1N33F 1MMLA 4CZCA 2KI3A 3W7BA 5HLFB 3O5GA 2IJFA 1Z2ZA 5LT5A 2PPOA 4QU6A 5DJBA 3FXYA 1K9TA 2DPEA 3LAMA 1UW4A 2V8GA 4Q8FA 1JNSA 2WW8A 1R7IA 3MM7B 4NA1A 4A8FA 2R8KA 3CD0A 4X4RA 1TP7A 3G96A 5LMUF 2HS4A 5E2QA 3KCEA 4C4WA 1JWWA 3JYJA 2XS7A 1Y4ZB 2VASA 3QO9B 3R5BA 1N8RT 2OJ3A 3CT9A 1HBNA 2ZR6A 2CFXA 2VD3A 1TKZA 2I1RA 4QQBA 2YNHA 3G9CA 5HQ8A 1VI7A 4HDGA 4LJMA 4GC7A 3PZPA 3KK3B 1JNRB 2XO7A 2FY1A 5J6EA 1TL1B 5B08A 2JWNA