4XAKA

Crystal structure of potent neutralizing antibody m336 in complex with mers co-v rbd
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
b'VECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRFLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike glycoprotein
molecule tags Immune system
source organism Human coronavirus emc
publication title Junctional and allele-specific residues are critical for MERS-CoV neutralization by an exceptionally potent germline-like antibody.
pubmed doi rcsb
total genus 49
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09408 Spike_rec_bind Spike receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.70 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4xakA02
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4xakA01
3D0HE 5DO2A 2GHWA 4ZPVR 3SCIE 2AJFE 4ZS6A 2DD8S 4L3NA 4ZPTR 3SCLE 3SCJE 4XAKA 4L72B 4ZPWR 3BGFA 4KQZA 2GHVC 4QZVB 3D0GE 3D0IE 3SCKE 4KR0B
chains in the Genus database with same CATH superfamily
3MR2A 3AODA 3D4JA 3M1VB 3O8WA 3GIMA 1NCLA 2HVIA 2O5DA 5JVHQ 5KFZA 5DLGA 1CSJA 4WYLA 5BXIA 1RTIB 3CC4S 4F0MA 2JVRA 2DD8S 4QJVA 2ZQSA 2XEXA 3GLJA 4MTVA 1VOMA 2PI4A 2FHKA 2W01A 2HHXA 3UO0A 4PAAA 3CCUS 3DLEB 3N5BA 1WF1A 4Y0FA 2RUQA 2JX2A 3HF5A 3G9CA 2JEFA 3ULHA 1MMLA 5HQMA 1L3UA 4PWDA 5IM0B 1YIJS 1UWBB 2BE2B 3OL8A 1HR0J 2UP1A 1E6PA 2C2MB 2JC1A 5T14A 2C3PA 2HBZB 3N5FA 4H4KA 3ELHA 5KG0A 4RNOA 3T5HA 1NK6A 3RW6A 1HD0A 1CULA 3VAKA 1L1PA 3MEGA 4Z2IA 3UR0A 1KHVA 2EK6A 2R2TA 1KNZA 4IG0B 4WKAA 1S79A 2F21A 4KHRA 1HBMB 3POTB 1PC5A 3IR6B 1OGGA 2HHUA 3V5RA 2MQNA 3L9ZA 2Q5AA 3B6BA 3FVYA 3M2VA 5JMNA 1FWLA 3H8YA 4ED2A 4B9SA 3H9RB 4K4YA 1U1KA 1TL1A 1NHUA 2R7UA 4IDKB 4URSA 3FQLA 1JB0C 3M8PA 3P8BB 3FEYB 4GO5X 3HD2A 5C24A 2FDNA 3ZXWA 7AT1B 4X64J 1NSGA 4OHVA 4M5JA 3M1VA 1F9FA 1U6FA 3M6WA 4Q43A 4EFAC 2O92A 1VK8A 4ANDA 1HXVA 1ZAVA 1DTQA 2WVDA 3IO1A 2J8AA 1RAAB 3MGJA 1MNEA 5KG3A 4DX7A 2KXFA 2PI6A 1FKHA 3BXWA 1C4CA 2CADA 2JDJA 1OGBA 3BF4A 3D0HE 1JIHA 1XQIA 1WC6A 4PUOA 4OZ0A 1UMJA 1JXVA 4FN2A 3FEXB 3PEJA 3SCIE 5C2GA 2XMTA 2HGLA 4OIXA 2F23A 1UA1A 3WQPA 2R8IA 3UFCX 2ROEA 2RE1A 4BBYA 1TKXA 3AROA 1DHMA 1LWFA 1ZAXA 2YNIB 3GYNA 3HI9A 1CULB 4HT5A 3ARTA 2MYFA 1MW7A 4ZVHA 5I42B 2GS8A 3AS1A 1TR0A 2WM0A 3IR5B 3CDEA 5JVGQ 4LR9A 4CO4A 3G6MA 2W9BB 2B4OA 1KKHA 5EWFA 2FTRA 1HBMA 4HYKA 4N77A 3O5OA 4C9DA 4WZMA 2IPOB 4DSJA 2LECA 3DOLB 3DRPB 3IRXB 2HWHA 1Q0NA 2RRBA 3GZ7A 4GVBA 4I6WA 5A8WA 4P2SA 1UWAA 1VRTA 3JAMU 2EK1A 3RAQA 4DFJA 1EYMA 4FNIA 5CZXA 4ZVRB 3K89A 3ARQA 4JFMA 2E7VA 5IV3A 1J27A 2KR7A 3L7OA 3NBPA 3QMQA 5LMUF 1JLGB 3ITHA 2AQ4A 4YR3A 5C24B 3JYJA 3PZPA 4IQ2A 4DL0C 3LUYA 5GAGU 3W9IA 3JSMA 2E29A 1JJHA 2B43A 4Z7YA 3CD5A 4W92B 2ABYA 2E7XA 1JLAB 1S76D 3BGUA 2VH7A 5KG2A 3GPKA 2BBEA 2W4DA 4PPDA 3ZNJ1 4Y3CA 4NCGB 4DH0A 2IVFB 2MZ1A 4Q2MA 5HVFA 2V8HA 4ZPBA 2HK3A 4E0DA 2KRRA 1UA0A 1SYTA 2M70A 2XZWA 2PMWA 2UXBJ 3ENVA 1E6YB 1J4IA 1WELA 2HZAA 1U26A 2GIFA 2UV8A 4NA3A 3IG1A 2BJ1A 3NXZA 4WK3A 1VBXA 1T7PA 3KLHB 2XLIA 2GJIA 2N82B 4FBUA 4I2QB 3NGTA 3M8WA 3TW0A 3W61A 4E98A 5HQLA 2XO7A 2LJ4A 1PIEA 3IN5A 2DG3A 5HLFB 4PKDB 2XSFA 5ETKA 4UOGA 5LM7E 4B9LA 2B7CB 2IJRA 5E41A 1K73T 5ETTA 1ZYQA 5D6GA 3F73A 2R8JA 1HL6A 4URIA 1X9MA 2ZEJA 2UXCF 3UCZP 2FVSA 5I3PA 1M1HA 4LF5J 1LKZA 3PDNA 4UY85 2I1RA 4KH1B 1KVKA 4NZCA 2B6AA 2DIUA 1FI4A 4USVA 4IOBA 2WONB 5K14B 4LVNP 2GQQA 2OHDA 2UV8G 3UI3A 1SKWA 4I6AA 1RE1B 1IN0A 3C8YA 4PABA 2W25A 5KFDA 4DV4F 4QW9A 3GU0A 3SV4A 1RTIA 3PM9A 2ATLA 4RNMA 3HLUA 3DYAA 1FKKA 2HFNA 3OVSA 4EEYA 3A8KA 2QMWA 1N5TA 2XMVA 2IDEA 3A4TA 2EFVA 4C98A 4NI2B 3IRWP 4DSFA 1WEYA 2C3UA 2U1AA 4QT3A 2OFNA 1TMMA 2P9GA 3BYPA 3NGKA 1JLFB 3ET6B 1OSDA 2C3MA 5KOXA 1R0AA 1H38A 1AROP 1KOOA 4M5DB 2MQ8A 2ILZA 2V8DA 3FCHA 4Q8FA 1NJWA 1CJVB 3P5BP 1FX2A 4F0KA 4ZPAA 2AWGA 3CCES 4ES2A 1CVJA 2BE7D 3CCTA 4DRHA 3CWJA 2K2PA 4G1QA 2UU9J 2FD2A 4K4UA 3LWLA 1Q4RA 3E01B 3PO5A 1VR6A 2MEWA 4D3GA 2FJWA 2JEIA 3BBBA 5DGAA 2VOPA 4OV1A 4QW8A 1CJTB 3PRAA 1UVKA 1DZ5A 2XNRA 4JV5J 3I4HX 2P8IA 3LQVA 2KXNB 5CYQB 4U7UD 5JH8A 1FNOA 4HI1A 4WJXA 3NWGA 3K5LA 2FHMA 4YB7A 1K0VA 4N8NA 5M2RA 2V34A 4KJIA 3MM8B 2BJ8A 3VAIA 2JNJA 2AP6A 3W9JA 2H54B 1S48A 3EXYA 1TFVA 3CDAA 4JI4F 2ERRA 1N6QA 4IQMA 1R0CB 3EDQB 4B3OA 1FKSA 4IT4A 1E15A 2H4WB 2YNGA 5DO2A 1HNXJ 1TP7A 4GKKJ 2RNEA 5E2QA 5FD1A 5HROB 4ECRA 4MYUA 4RW7B 2JLGA 4C8KA 2BE9B 4P7VA 1N54B 4PG4A 4UQTA 3KLEA 5H9FJ 4TKTA 3ARVA 2JEJA 1RHQB 1OYDA 3VV2B 2EFPA 5A0YB 1ULRA 1QAJA 1NDCA 1NZ8A 4O3NA 1GQEA 4CLKA 4Z2XA 5DLFA 2XMUA 2MGZA 2IF4A 1WKJA 3PX4A 5A6PA 2VJVA 3MOJB 3BKFA 1FFRA 4J4OA 2E9RX 4WKFA 2ZE2A 1SBRA 4ZOSA 5HP1B 1NPRA 3QO9A 4USUA 4ZP6A 4X4TA 4DR1F 1WOSA 2HBQB 3N9UC 3DFEA 3TVYA 4Y2CA 1JLEB 2B0GA 1IX5A 2DPIA 2DR5A 2HURA 4DV3J 4GC7A 5DQHA 1FFWB 2MKJA 3QSIA 4J90A 2F63A 2F1FA 4LRAA 1ZZFA 4G1IA 4NEZA 4A48A 3T5JA 2IRXA 2LVWA 1D7JA 4IRKA 1FKRA 2DY1A 2JZ5A 4ZIVA 4ED3A 1XWLA 2OSQA 1CJTA 5KFHA 4OZNA 1QSYA 2KN4A 2GZOA 5IC6B 4X4UA 1FJGF 3M05A 4W98A 2KYZA 3I0RA 2XULA 4UOFA 4XDDA 4JV0A 2XP5A 3L7UA 4UZBA 3A3OB 4Q44A 1OY6A 4QR0A 4J9LA 1KFDA 2DGTA 1VC0A 2DPJA 2DY9A 2GO9A 2YKMB 3KYLA 1MN9A 1N6QB 2XS2A 3E3XA 4IFVB 4ODLA 2DR6A 4CO1A 5DG8A 3DKDA 1QY7A 4DPYA 2D3O1 4HHHA 3PW2A 3EVWA 4YOEA 1R9HA 1YG0A 2M2BA 3FEZA 3AD8C 4X4OA 1QUVA 4UUWA 5L1KA 3KLEB 4JI6J 4JI2F 2KHDA 3A12A 1M5KC 2PV3A 1HYSB 3KNAA 3EWGA 4QIWD 2XS5A 1RABB 1WC0A 1YRUA 5IS2A 2RF2B 4A8MP 1NJIT 4HBOA 3R27A 1HQUB 3VGUA 4I69A 3UI5A 1QPLA 2J6TA 2JWNA 2LQJA 2ZR6A 4Z2LA 4IO1A 5KT3A 3CULA 1AFIA 4OJ1A 4HTIA 1GH8A 2H51B 4GKJJ 4Y28C 3KJVB 1C0UA 2UUBJ 2R8GA 5H9FK 4UTGA 1K47A 1YSJA 2I5JA 2HG4A 3W62A 3H5SA 4ZA1A 1CQNA 4TW6A 2DITA 2J7KA 2DH8A 2EULA 1N5QA 2BUNA 3MM9B 3NGUA 2M3DA 4N19A 2GVDA 4LRFA 3CCRS 2AW0A 1EKSA 5FLXY 1HNIA 1DLOB 1P27B 2VG7A 2XS7A 1X7VA 3W60A 4DSIA 2LEAA 3BN4A 4ECSA 5HJYA 3QRQA 1EP4B 2NXNA 5HN0A 3HXMA 1VQ9S 4H4MA 4RBTA 4I6YA 3L7PA 2BYCA 3ILIA 1PBUA 4NYZA 5HL7Q 2UUCJ 2OTJS 3I87A 4NXMF 1VQ7S 3DGVA 4ATNA 4RU2A 5B0AA 1PJ7A 2YKNB 4YY3J 3LPEA 3D6TB 1KOHA 4M5DA 3SYZA 1F8AB 3P4UB 1S9EA 3MMBB 2GIQA 4ZVTB 3RJMB 4CO5A 1S7IA 2PA8D 4ECWA 3RGIA 3M2RA 3P3DA 2OKQA 1R8HA 3HULA 4F4AA 4TY8B 3IKDA 3QJLA 2KJVA 3DGPB 1F6TA 4OYAA 2RF2A 1S1XB 3OTCA 4CTAA 4P8VA 2FZKB 3WD1A 2VZ9A 1V6HA 4NLVA 3BKUA 1SV5A 4DRKA 1HNVA 3G82A 3J7Z5 2LMIA 1NXIA 1EETA 1FRXA 3HVWA 1RCOB 1SJ4P 1NRKA 3VCDA 1NLKL 4ILLA 3TUIC 3R1LA 4TU7A 4LF8J 2L48A 2YNFB 3EGNA 1H0HB 8RUCA 3V6DA 1UZDA 2NCKL 3CJSA 3D1QA 3RG6A 1KLNA 1W1VA 1JNEA 2RRNA 4YR2A 4UW2A 1IR1A 2L08A 4B9NA 4AXIA 5C42A 3BGRB 2ATCB 2LU1A 4YN3B 4F26A 2EVZA 3TQ1A 3BPDA 2F4EA 2A3AA 1S1VB 1VLOA 4X65F 5CQGA 4B3OB 1IWAA 2ILYA 2DG4A 3FMBA 3TI0A 1NB7A 4P2MA 5CYMB 5H1SV 1HI1A 2DSVA 3NGSA 3H2VE 2XZTB 3WC2A 1V5VA 4UZCA 2CPDA 4JI6F 2VOOA 2KI3A 3T1YF 4CLFA 1HHQA 3RGCA 1S4FA 2HFOA 4X4PA 3GFYA 4C4WA 3KMSA 2C2EA 3WX8A 4OZ3A 4OYWA 3MR6A 4UF4A 3LF0A 4U96A 2OAUA 1R8AA 1TKZB 4IH7A 4O3PA 2MXYA 3NNAA 3BGOP 2XY6A 3O5TB 1S9EB 3JS9A 1LW0A 1KT1A 1PYTA 2LGOA 1T9WA 3QATA 3QRRA 5BR8F 1FKPB 4F4WA 5GVQA 1S99A 3QIPA 2MSSA 3B82A 4HTJA 5IT0A 3HPOA 4MNKA 1G3OA 1S1XA 4ZP8A 4CTAB 4LF5F 1BWEA 3F41A 1IJEB 4IYQA 4H4OB 2FUG9 5IQQA 2LQ5A 3OUYA 4CDIA 3QJJA 2CQ3A 2C1EB 2HNZB 4ML4A 2U2FA 4LAWA 2YY3A 3GSIA 1YKWA 3LOUA 3PYDA 1R89A 4OYBA 4WBFA 2VQFF 3T3FA 4LF9J 5KFBA 3I0RB 3ISZA 2XMAA 3MURP 3CUNA 2VN1A 4AL5A 1BD6A 2CWXA 1TQLA 1JLCB 1P9QC 1YATA 2BV3A 2QA2A 4RBUA 3BGRA 4BCAA 1TUVA 3TA0A 1UJ4A 2O1PA 5H9EJ 4LF9F 1TUWA 3UN5A 5DJBA 3LP2B 4F2RA 3ARXA 5LOQA 2WW8A 4NMXA 4DS5A 1C4AA 3JTNA 1FDAA 1Q86T 4DR7F 1Q8BA 4CRJA 3ZZOA 2DNOA 4M8LA 5ADZA 1QM9A 4NXNJ 1CJUA 2OO4A 1XNQF 4RW6B 5BR8J 2CQ1A 1VQPS 4EUVA 3UQIA 1YRTA 1U8WA 2CQGA 2XSJB 2ZHOA 3MPDA 4P52A 1RTHB 2MMYA 3T5LA 4AT1B 2BRLA 1EJ7L 1UJ5A 3CO0P 1WG1A 1S1UA 2BR0A 1RB0A 3OQ2A 5HW6A 3K5PA 1IR2A 3IHZA 1FKPA 1PG5B 1FE0A 2HK2A 3HCXA 4ZPCA 5KAKA 2CDQA 4K4WA 1OQ6A 4OI1A 1UR8A 2VKZG 2RSEA 3EZ5A 1RP5A 2F4VF 2DGXA 2YNHB 2X1AA 3M6UA 2Q6CA 3HJFA 3N79A 3UE2A 2LDYA 5D8HB 4DQQA 5KFVA 3EGWB 4JV5F 4OX9J 4IT6A 2FJXA 4G3IA 2V2ZA 3IA0A 4DBQA 4MK9A 4QBUA 3QSYB 2Y0SD 4Y6IA 1OWQA 2C2ZB 2QG9B 4LF6J 1U6ZA 3E2EA 3H5YA 2VDHA 4USIA 3WH0A 4KC5A 5F9NA 3OBIA 2QT7A 2B4VA 3ZZUA 1ZM9A 1YI2S 3DM2B 1SJQA 1HBUA 2BKOA 2D1CA 2AZ1A 3KCEA 4H4MB 1RAGB 2DNYA 2BABA 3PW4A 1I94J 2NXUA 5L1JA 2R3VA 3RB3A 3CJQA 1PINA 2IC3B 2ASYA 4PZVA 4RUBA 4DR3J 2LKNA 3C16A 2CIMA 4ID5B 4FVCA 9ATCB 4ECUA 1FKLA 1SJFA 5IC4B 2P6SA 1XRVA 3L4BC 1AT1B 1HBNA 3Q83A 1SQFA 4RW6A 3H7HB 4G65A 2JH3A 3GMGA 1Z4UA 3J7YU 1T3NA 2VC0A 2BJEA 4CM0A 3H90A 2CPXA 2IMOA 2K06A 4EMDA 4O4RA 3J81Y 4P73A 3CSKA 1X6NA 3BMBA 5GPRA 4B17A 5KG5A 3HHKA 4QCLA 4IQCA 4BF8A 1WHVA 5K9FA 4C8ZA 4OMFG 4OLPA 4TNSA 2CQBA 2VA2A 4ED0A 1BC6A 1KVIA 3K17A 3ALGA 3TVZA 2MSTA 1NJZA 5ETSA 1KBRA 3Q8UA 2I0XA 3Q8RB 4JI7F 3DCAA 4JI1J 4P72A 1IUJA 3AS0A 4WK1A 2NXEA 4CO0A 1GPFA 2K8GA 4GMKA 4PWUA 1S9GA 4DUYF 3CT9A 1FJGJ 4W9QA 2V50A 2FAPA 3B8HA 4ODKA 3RM9A 3JXOA 4PR6A 4CI0B 4K2XA 3M32B 2MQQA 1M5OC 2IVYA 1QAIA 2UZ5A 5A2QU 4NLRA 3B4MA 4NWBA 3BDPA 5CYMA 3PFOA 4BWMA 3TJAA 2IBOA 3OLBA 1G2EA 2GHPA 1TK5A 3DLKA 4ZITA 2DNRA 3IS9B 4B3SJ 3R5CA 4C02B 1N88A 1X0PA 3MECA 1UPMB 2FJBB 3D3CJ 3R5GA 2JFDA 3QGHA 2F9DA 2V67A 4LSNA 4JBCA 3HFZB 4RW9A 4Y2AA 1E6RA 2CPHA 3J80U 3D6FB 4KPCA 3C16B 2UU9F 3CJ5A 4OI3A 5I42A 2CNLB 3PG9A 4S3KA 1HPZA 3LW5C 2FJEB 3MR3A 2GV1A 4EGLA 2F65A 2QYCA 2Z2MA 4J9NA 1OQ3A 2KTQA 3DRSB 4ODMA 4HARA 2VFTA 1OYEA 4P2XA 4QOTA 5GAGI 2DHHA 4YQWA 2BM1A 2OFGX 1RACB 1TV6B 3EJMA 3IRXA 5GMEA 5A8WB 4TVAB 2VG6A 4AUKA 2FGCA 3RM4A 1BQNA 2LP4A 4FNHA 3QT6A 3M2UA 4DV0J 2CJYB 2G1DA 1CJKA 1ZAWA 3DDKA 4HH1A 5G0RB 4DL3A 3KUHA 1JWWA 4RUHA 2M88A 3RB6A 1DARA 5E5NA 4KGMA 4LREA 3IK8A 2R4FA 4DUZJ 1L3TA 2DRBA 1RT7B 2EPIA 5GMDA 4C48A 2E9TA 5FJ4A 4J5OA 1JLCA 1RAHB 3KG0A 3TEHB 4UDMA 3ZTSA 5DETA 2QA4G 4LBPA 4FPIA 1S9GB 4NCGA 4Q7AA 3CJKA 4MYTA 3FFIA 1RWUA 2P6TA 1O6XA 3D68A 1A7XA 3SBMA 4CLPA 3CE8A 4GGQA 1UP1A 1YHQS 2BMBA 4FF4A 3SCJE 2ZH2A 3EX7B 2A18A 2VKRA 1NK4A 4QR2A 1VMBA 4ITSA 3H5XA 3IS9A 1N32J 2X7IA 4LF6F 1RWXB 3C14B 3IBFB 3T1AA 3OA5A 4C0BA 4LSNB 4I2QA 1X5PA 3KACA 1RWNB 3FY1A 4RBVA 5L9XA 3CCJS 2ESCA 3CCSS 1IXKA 2R9LA 1IKWB 3PHEA 1JLQA 3NP5A 3SMZA 2N7CA 4DFMA 5HUAA 4FP9A 1T9YA 2W4PA 4MNLA 4ZIWA 2ZH8A 3NCQA 4TW7A 1S1TB 5C25A 1FFQA 1QJHA 1T9UA 2Y78A 1REGX 3BO3A 2CKWA 2ZOGA 1M0SA 3DRSA 3OSNA 1U48A 1N5YA 4B9TA 1EHWA 4P8XA 2PMHA 1ZM4A 2ZBPA 3BR9A 1TV6A 2ZITA 3PEHA 1YJTA 4WIIA 4USWA 3GONA 3KNGA 5D0RA 4ZVUB 3PR5B 3GV8B 2YXLA 1SJ3P 2ITKA 1BLUA 2MY7A 1CPZA 2F8MA 1NH7A 1K9MT 1FKOB 2HHTA 4CIOA 1QUPA 4C0OC 2XP4A 3EPGA 3LP0B 2OTLS 2O66A 3U1LA 2DSWA 1WC1A 1YGYA 2ZOFA 1N5VA 3GPAA 1Q16B 4J9VA 2DIVA 2Q1LA 3NRKA 3D7SB 3JQKA 4MH8A 3BO2A 5D3GA 4DWSB 1CBKA 3DU5A 3CZ8A 4FPRA 3VVUA 2ZJRQ 3WDOA 1Y3KA 3MD3A 4F0HA 2KG1A 1LL7A 1E6VA 1UEVA 4TLQA 3PVXA 3HT0A 2R2UA 3KLIB 4Y34A 3Q8QB 3ZZZA 1T94A 1RWPB 4PPZA 4ECVA 3QRPA 3NS5A 1B0TA 1U02A 2HIYA 3A3NB 3GYGA 1FTRA 4ID5A 3Q8VA 1HNWJ 1YJ9S 3DLHA 3QFHA 1REVA 2WSCC 1U1NA 3T6BA 3PIOQ 4LMZA 4DPUA 3M9MB 3RBEA 4KB7A 2YWWA 2QYGA 1GMVA 2XMWA 3FRYA 1FF2A 3PIPQ 1AA1B 2V69A 3CCVS 4U85A 1JXLA 2LDIA 3KK3A 4R25A 3O5DA 1GMWA 1H98A 4J4NA 2AJ4A 1ZA2B 3FZ2A 5KFQA 4UY8T 2E5JA 6AT1B 1V5IB 2AYMA 1N5YB 1H7XA 1V3SA 2MZQA 3BM7A 2YKPA 3EZOA 1RCXB 5J1EB 4FS1A 1FXDA 4BS2A 1HKIA 4UOCA 1SC3B 2MQPA 3OHBA 4WFZA 1VK3A 2YBVA 3BB5A 5J2QB 1O8BA 2W2MP 4DXLA 2VBWA 3T41A 1U45A 2E5LF 2HYIB 2AJQA 4DV6J 5F8NA 1FKIA 2HNYB 1FKOA 4UOHA 2OLHA 1IBKJ 4ELVA 3TA1A 5IWAF 2MQOA 3DLEA 1X4AA 5GMKa 4NA2A 2YWGA 4RNHA 3H98A 2HHHJ 4ZCKA 1HNXF 4IO9Q 1TKDA 1VQSA 3V6KA 4IH6A 5HBFA 3R5DA 2PEBA 3UNYA 1C1CA 5LXYA 4MTPA 4KV8B 2JLEA 4ICLA 5DIUA 4EBCA 5BYSA 2J8SA 2XP9A 5E33A 1HLWA 2UVRA 4OI0A 1BY9A 3WQWA 2H1YA 1TK8A 1JJ4A 1WKKA 3VALA 4M1KA 1PCAA 1RWMB 5E7OB 2FJAB 2D9PA 1U2FA 2DYAA 2DO4A 3DRRA 4ED4A 5B0DA 2DNHA 3M8SA 2AF6A 5D78A 2PV2A 4LF8F 5EWGA 1U1MA 3G6XA 4M94A 3BO4A 2IHR1 4V19X 3WD4A 3VAMA 1HBOB 2OI2A 4C2MA 3H20A 1VDHA 3N6NA 1D9DA 4F8RA 2PPPA 1U49A 2HQGA 4FYXB 3W1YC 1SR0A 3GIIA 1E6NA 1SJRA 2R42A 1YZ6A 4IDKA 4EO8A 2HAFA 5FIIA 2HIQA 2EG1A 2R2RA 2R7SA 2Q66A 3GFXA 3CGMA 2M2AA 4DV5J 2NQPA 3CNQP 2HBRB 3KJFB 2ZM6F 1KFWA 1SPBP 1SJ1A 2NSBA 4N76A 2ACMA 5AXNA 4JI0J 3O6QA 1FKJA 2LXFA 3AJ2A 4ETZA 1DTQB 4GIVA 2GA7A 3JQMA 2HNYA 2HZVA 3MM5A 1LFWA 4CNYA 3SI8A 1F1BB 4YB5A 1Q82T 2DK2A 1D7IA 5KFUA 2ZFHA 2VIHA 4ES3A 4WCEQ 3I6CA 2HFUA 4CYUB 3O5PA 1URRA 2C22A 5A8KA 5SZTA 3WD0A 1RTJA 2BXJA 2JJ4D 1RT6A 2HNDB 2HPUA 2GIRA 2M7SA 2OMLA 4KV8A 3R7NB 4CH7A 2HRTA 4J9KA 3HKWA 1R27B 3FC9A 3UD5A 3W4RA 5D4LA 3I0SB 3JSMB 4WXWA 3R8YA 3PX0A 2W8LA 1Y5IB 4R5EA 1C0UB 2YNIA 2AU0A 4JI3F 2D74B 2FLNA 1X4HA 1RT2A 4ZCLA 1NUEA 1T05B 3BPSP 4M5HA 1U1QA 2P9EA 3KUGA 4DU7A 2H9ZA 1RTZA 2W2QP 1NMEB 1X4EA 1O0PA 5HVGA 4FYVB 4ITZA 3NWRA 1UEKA 4RUCA 1HFEL 1KQGB 3IFEA 1ZH5A 2MZTA 3V4IA 1HBOA 3DOLA 4CLZA 2FHJD 1HNIB 3H5UA 1H0GA 2QV6A 3W2WB 2YH1A 2CZ4A 4O4GB 1E6YA 1Y4ZB 4ZDNA 2I2YA 2PEHA 3I55S 3AAWB 4RW4A 4LFCJ 1FKFA 2DNLA 3RU0A 5KG7A 5J2MA 3AQOA 3G87A 4W9OA 3VAFA 4XTTA 1HR0F 4K5SA 1NWTA 3CD7A 1CC8A 5B09A 3K5OA 3I56S 3C2PA 4Q0BA 1WSRA 1SCJB 3VTIA 4DRPA 1YZ7A 2ZH3A 4RNNA 2Y1IA 1SL0A 4U8VA 1CC7A 4JI5J 2GAHC 2MQMA 1LWEB 4WFBQ 1X31C 3QZ8A 1B7FA 1LWXA 2CNKB 4ODNA 2AWZA 5G4DA 1HKJA 5HI7A 4LFBF 1BKFA 1W1YA 2KL8A 1ZBWA 2ZD1B 2J6UA 3MM5B 5L8RC 3M2RB 4GKKF 4N7TA 3DLJA 4EBEA 1DFDA 4AYBD 3CIZA 2XLKA 2KZMA 3RBZA 3M30B 1XEZA 2FZCB 3AB4B 1CTNA 4KSEB 1NSAA 4L72B 2PFDA 1GFWB 1X4BA 2JC0A 3EE3A 1YBTA 3NS6A 4E2FB 1QVFR 1MN7A 1YVFA 1RKIA 2QMXA 4USJC 3IG1B 2CJXB 2Y1RI 4L74A 1KQFB 2QJ3A 3Q86A 3QT5A 2CQDA 5F0WA 2QF8A 3MEEA 3I6PA 4CNZA 2DR7A 3KK3B 1FXRA 2YNFA 3Q89A 2FVCA 5EUHA 3H4BA 4DLGA 4P74A 4IRCA 2L3MA 2V5HG 1RISA 3A8EA 4K0KF 5A8RA 4MNJA 2MJUA 3CJRA 5M2UA 4DFPA 1NH6A 5HKGA 2ROPA 3OR1B 2AJFE 3T1HF 2ASJA 2QLWA 1I6JA 2JEGA 5F8GA 4B9UA 2OPSA 4F3OA 4DWSD 2MF9A 3AOAA 1NSQA 4F4ZA 2XMMA 5CH7B 3E01A 2P2CB 2R7VA 4DV1J 1AW0A 2OD6A 3NG8A 4Y2KA 3H40A 3MR7A 3MFIA 3PYGA 3KXDA 3GQCA 1VGYA 4WJBA 4JP8A 1ZBKA 2DSZA 1G4CA 2GJFA 1FNMA 3BSNA 3PYFA 1BQMB 4OYXA 2B5UB 1SUQA 4NXNF 3IXQA 1LK7A 2UXCJ 1WC5A 2WVEA 2E1PA 2V6AA 1R6YA 1YJUA 1F9HA 3TNVA 1M5PC 4J9OA 3DMJB 4RW8A 1CJVA 5JJBA 2WB1D 2HQDA 3JTPA 4DV4J 5HW7A 1JKHA 2BQRA 3EY6A 3AA8A 4F4KA 2YNGB 2RQSA 4ZPVR 1HJXA 1WHYA 1H7WA 3RRKA 2AEFA 4AD6A 4CM2A 4CWBA 3UPFA 2OIHA 1Z2ZA 3FDSA 4ZS6A 1TTHB 4C0HA 3O2IA 3NNCA 4LVOP 1HHSA 2A0FB 4DQPA 5AE3A 3CJ8A 3QYYA 3T1HJ 2I38A 2HNZA 3AQUA 2F7VA 2VF3A 1UL3A 3LALA 4ER8A 2AZ3A 1RBLA 3O5MA 2Z0GA 3RZAA 1AUSL 3TAQA 1I51B 1UZHA 3MWBA 3W5ZA 2BW7A 4OHWA 4DUTA 5HMYA 2OEKA 2B31A 1T0TV 2HGNA 2PV1A 1NK9A 2I9SA 4ZN3A 1N33J 3UQBA 2B3TB 5DZ7A 1YJRA 1VISA 1S49A 5I3QA 4KAIA 4DQSA 3HSDA 2M0GB 2KO7A 5B08A 3IM9A 1SKUB 1NH8A 4EO6A 3CPWR 3SXLA 2DNNA 3AD9C 3HMJG 1KLMA 1Q8LA 2ZH9A 2ZBQA 1WHXA 1KS2A 1WJ9A 3HHDA 1EKRA 3PACA 1P5QA 4P9SA 4C8NA 3PV8A 1XN9A 1HJWA 4Y65A 4K2JA 4ECTA 1NBEB 3Q24A 1GT8A 1SUQB 5A0YA 4Y2IA 3MEKA 1FRLA 1GXTA 1R8PA 3C6TB 3HVTB 2HS3A 1ZZNA 4CLSA 1NM2A 3FAPA 3AY0A 3UDEA 1N32F 4HEA9 5KFJA 4QYZJ 2VA3A 3CD0A 2E1AA 1S5ZA 3IWXA 1U24A 3D6MB 4MT1A 1FJDA 2W9CB 3GWCA 4ED1A 1XMQJ 1TUGB 1DQ9A 2XQCA 1LQ9A 1RLDA 1N0VC 1VIXA 3FRZA 2GAGC 1L3KA 5I98A 2A3JA 1FDNA 1L3VA 5KFSA 3J7A1 1YJWS 3ILOA 3KK2A 5DITA 3UI4A 1K8AT 4W90B 2YWKA 2B5JB 4ELUA 2MZSA 4OLOA 2YTCA 1A6LA 4PWDB 3V4IB 2IJFA 3ISND 1KFSA 2F4VJ 2X3DA 2XO6A 1AFJA 4URGA 4O4GA 4NL5A 5CXTA 2E1MC 1PC4A 1NPPA 3RRHA 1QVGR 4DR4F 4DR6J 2CJBA 3A13A 3QOKA 1F9EB 3MXHP 4AXJA 4HDHA 2H65B 2C2NA 5B0FA 3J7YI 3MD1A 1ZPVA 1AUDA 4WIWA 1F0XA 1R7IA 1RYRA 1MROB 2Y8WA 2YKQA 4HR2A 3THTA 2OPQB 3UQSA 4DX5A 4QPTA 1LWEA 2N7YA 4YY3F 3PO4A 1QTNB 4DV2J 2CQ2A 4A8FA 3MM9A 3TDBA 1WNOA 1KLMB 3ADAC 1N36J 1HWLA 3CB4A 1VQYA 4TNOA 2VONA 3TO8A 2MLZA 2F2DA 2G41A 3KLFB 4A8QA 3FXYA 5KFFA 4P2FA 2PE8A 4IG3A 4IOAQ 3TJ9A 4CO2A 4ELTA 4I1TA 4PCQA 2VL1A 2W4CA 3RB0A 2XI2A 2Z4PA 1S12A 1HQUA 2KI2A 1NK7A 3THPA 2V2VA 1Q1KA 3V4MA 3Q8SB 4QIGA 1CLFA 2FKEA 5D4NA 2W9CA 2F8EX 1T9XA 1X9WA 3EM1A 2IM0A 3THVA 1WDDA 2XZDB 2D9OA 3KJVA 3OSPA 3OXLA 4F4YA 3QAUA 2HFZA 2X1GA 4BDPA 1PILA 4JI5F 2IY5B 3RMEA 5AJ3F 1IQTA 4DT4A 2QL5B 3WHIA 4CT8A 4KO0A 2VC1A 2CDRB 4F2SA 4C97A 2J0QD 3RFWA 4OI6A 3S6EA 3US5A 2R7QA 1P8GA 2DR9A 2E5GA 3M32A 2IFXA 3C46A 1P1TA 3TQEA 3FCVA 5EX3A 5LMNJ 2PBCA 1LG1A 2QEXS 4OX9F 4C3LA 2IAJB 3CMQA 4OZJA 4I64A 1LWFB 1MG7A 1F60B 3GG0A 2HVDA 2L9DA 2CNNB 5LSOA 4R5PA 2C2OB 2V4JB 3X3UA 1W1TA 4WP8A 2XPAA 3MECB 1BQMA 1TELA 1MROA 3OXGA 3MZIA 2XP6A 2K1RA 1XMOF 4LFAF 4P7TA 1FKGA 2H3EB 3IBWA 3DOKB 4ENOA 2EW9A 3EGZA 4GVBB 3SEOA 4A8SA 5K14A 1VRTB 4OHZA 3CHFA 1DURA 3V81A 1FKAF 3CGNA 3U1MA 2OFHX 2HHPA 3KLGB 1LW2B 3WD3A 3MTKA 1WI8A 1F2GA 2C28A 3NAIA 3HHLB 2R7TA 3DXBA 1JLGA 1IKVB 5SUHA 2NZ4A 2UUCF 5EWEA 1OJ4A 1TVRB 3BQ2A 4USTA 2DHGA 5L9NA 4YFUA 3J7ZT 2XY5A 1CJKB 5DZ6A 3LGHA 5G0RA 5D77A 1DAXA 3VAJA 1R0AB 1UCNA 4CCHA 1AYEA 4PYDA 4U84A 1TKZA 3ISNC 3SCKE 2WVBA 2AX0A 3GJTB 4ZLNA 5KT6A 2VODA 1VC5A 2XG8A 4A4JA 2IBKA 4ZHRA 1YK9A 2Z58B 2AGPA 3HK2A 4V1Ak 2XWXA 2M8DB 4TQSA 2HHSA 1QZ2A 3FK4A 4W5UA 3CJKB 4OYIA 3G2XA 3QIPB 4MMOA 2WK2A 4YHHJ 3FSYA 4HACB 4LSLB 1N34J 4ZLLA 2CYYA 2G1HA 2V2KA 3N6LA 3JAMY 1NJXA 1LV5A 1D1UA 3C15A 1WSVA 1GK8A 2VBZA 2NXJA 2DKOB 2AYGA 2RAQA 3ARPA 3CHCA 1LXJA 2M9KA 3DN9A 3LTOA 4OI2A 1H3DA 1H74A 2YX7A 2A3EA 3CH9A 4LF1A 4J9MA 5I3UB 2LEBA 4LBHA 3QAEA 2BJ3A 5CYQA 1LK5A 3ZZRA 4ECZA 2A6OA 4JV2A 4KQZA 2DB1A 2DHXA 1SL2A 3FKBA 3NOGA 4Z37A 2VASA 5K8OA 3WQVA 2GCFA 3DOKA 1WC4A 4WU3A 2PMZD 1EQMA 5KFAA 5CYJA 1Q7YT 2HZCA 2MY8A 5C2CA 4DV7F 3K5MA 3QPIA 4B9MA 2HLUA 1NDKA 2W7AA 2WSEC 1GMUA 1RAEB 2F4FA 3PRBA 2XCAA 3AA9A 1QPFA 1KONA 3OV7A 2BKPA 4KT0C 1UVLA 5F8IA 3BV8A 1Q78A 2C2KB 4DZ3A 3HSGA 3OJUA 4KHPF 4L73A 3W8PA 1DY3A 2ACYA 5KFGA 2JOQA 1WACA 4MIAA 1B3TA 1NMWA 1DBDA 2RURA 1LQ0A 2HQIA 2XSJA 2E5LJ 4L75A 1XK8A 4U67Q 4DR2J 1UVJA 1SKRA 4CH0S 3OL9A 4C8YA 2ZNZA 4DQIA 2CQCA 3WC0A 2RD5C 5DRKA 5K8MA 1S1UB 5LJ3Y 1U09A 5KFCA 1E9LA 1FRMA 3CCWA 2B9YA 1J5OA 2YQ1A 3W8GA 2WBMA 1P9YA 2GGPB 1Q7LB 1TL4A 4KHMA 1S1WA 2EWHA 4G6VB 4X84A 2FVRA 4MAVA 1GOIA 2EKYA 4DMZA 3EICA 2CVIA 1YJNS 4N56A 5KFKA 4AFFA 2HHVA 1PYSB 3EDRB 3H2LA 3CIMA 4Y2MA 2WCXA 4ZVSB 1TKTB 4IQXA 5J2PA 3TZWA 3KZ7A 2VFRA 4IG3B 1FDBA 3OD2A 2KH9A 2E9ZA 5F8LA 4QYRA 5EHHA 2MZJA 3TX8A 2CJAA 4LIRA 4XK8C 2KT3A 4QR1A 1NHVA 2WBRA 1FO1A 3JYTA 1U0HB 2DT0A 1R8CA 5GADI 5LJ5Y 3U27A 1H73A 1VQ8S 2MHNA 5K8PA 2HMIA 2A10A 5J1EA 4TY9A 2O3DA 2DHSA 2WB4A 4NMLA 2CPEA 1JXEA 1IKXA 3GILA 2ZH6A 2C2RA 1D9FA 2GMJA 3UF8A 1RTDB 4DG1B 2FZGB 1VHIA 1NK5A 3KHLA 3I5AA 5IZHA 2DGOA 2EBGA 2GHWA 2BE2A 5HANA 4NLPA 5FDLB 1KC8T 4U6PA 1WDTA 3QO9B 2NUUG 3I96A 1S10A 1HJVA 2CQPA 4X2BA 2DT1A 2DPEA 2HLTA 4J7CA 1T9TA 2JRSA 4HDGA 2ZDPA 2HSEB 3TEGA 1J5OB 3NMRA 1U6BA 4CP5A 1L3SA 3KWMA 3MMAA 3ALFA 3D3BJ 2DHAA 2WLYA 4DCOB 1TFYA 1DJ0A 4X4VA 5KFRA 2CZVC 2K1RB 1EQ3A 2RUSA 3UDVA 4DX6A 3ZZYA 2DNKA 2KG0A 4J9SA 2ZKTA 4JFKA 1W2BR 3ARWA 2CWKA 1F5AA 2M08A 1SIWB 2IRUA 2XGPA 3TANA 2GVDB 4WFNQ 2HWTA 1OS5A 2JVOA 3BSAA 5ETQA 2VG7B 4RWWA 2QA4S 1Y5NB 3HHLA 4LF4J 1D6OA 3CMAS 3M8PB 1XMQF 1LJYA 2GJ2A 3BH6B 2Y1LB 3WZ0A 2FHOB 4C7QA 1CG2A 3MHYA 1NSKL 4IFVA 4LQ9A 2ROGA 2YBUA 2WLZA 3MMCA 5A76A 4DL5A 2PI5A 1RA7A 1P1LA 2NLWA 4NLWA 1MWYA 1V3ZA 2XYGB 1AXQA 1KR4A 3B4DA 3HVAA 2HMIB 1Z2LA 3TUJC 3LPYA 4F3MA 1R8BA 1X0FA 1W9VA 4OFZA 5BYQA 4X65J 4ZHRB 2K7KA 2QZ8A 1VBZA 4HL9A 1N56A 1S57A 1I5OB 3FBCA 4KYZA 4DG1A 4M95A 1XJWB 5L1IA 2CQIA 1GMWD 3RBDA 4PUOB 3DGPA 2B8PA 3RUBL 3BSCA 1GX5A 3U02A 4RKUC 3CCMS 1XIQA 2QC3A 2ASDA 2AV5A 2WVFA 3MFHA 4CLWA 1BMQB 3S7RA 4IRDA 2A6MA 1S6QA 2AT1B 1SV5B 1PBKA 2QLBB 2Z8QA 1TL1B 3GCWP 5E3AA 4DPWA 1Q1CA 1HI8A 2UUTA 2XNQA 4TYOA 2X1BA 5KG4A 4HT7A 4QWCA 1YQHA 2EBEA 2I5JB 4ZN1A 3K58A 2V4RA 1QSLA 1NDPA 3MMAB 2ZVSA 3QGIA 4ED7A 3KMQA 3SQGA 1RT7A 4AY1A 1DRZA 1IR0A 2EFQA 4DWSC 2V2QA 3M8ZA 2KB2A 2FVQA 2V8VA 4DF4A 2HVZA 2WSFC 4QIEA 1DLOA 5ETPA 1U0SA 1UFKA 1FWKA 5CD4A 2AGOA 2UUWA 2N3LA 4PXCA 3PX6A 4YP3A 4EZ6A 3VVTA 2FLLA 1B70B 3CHEA 5EDWA 2HHQA 3ITHB 5LXRA 1RUSA 1K44A 3JSBA 3MUTP 2QLFB 3NMAA 3TX0A 1XC9A 5GAHU 1R31A 4CLUA 3W5YA 5KFNA 4DZ6A 1CS4B 3O5RA 4ZCMA 3OTOJ 2E44A 4KGKA 4ZJLA 3BBFA 4B3TF 3IWLA 1JCHB 1X4FA 2RUDA 2RILA 2RDDA 1NSPA 2HRYA 2VICA 3VAWA 1LW0B 4PXBA 3W63A 3QGGA 3ODKA 4AE5A 3GIJA 2B9XA 3NI6A 2AIRB 4G1PA 1D0EA 4DDFA 1S59A 5LMNF 4KPYA 2K3KA 1SQGA 1ZS6A 1RGVA 3ONQA 3B9EA 3LAKA 2XY7A 4MJKA 3AXMA 1TK0A 2MNTA 2IVMA 4I2PA 5L46A 1FFSB 4DV6F 2D3OR 4FF3A 1RD6A 2VPZB 2OGUA 2W2PP 5KFWA 3EPIA 3O5KA 3CVKA 5LL6d 1M1KT 4ANEA 1VQNS 1GXLA 1HWUA 1RU1A 4LT6A 1HWIA 1SIZA 1U25A 5CAAA 3V81B 1UFLA 4YMEA 4PEOA 2ZWOA 2PGCA 1Q8KA 1FAPA 3AOBA 1JLQB 3G4SS 4FF2A 2ALYB 3LGMA 1JLAA 4DROA 1LOUA 1ROFA 4DWSA 3NRBA 5GAEU 4G50A 3SZ2A 1K0TA 4Q8EA 3QWPA 3PRDA 1RHMB 2P5VA 3GJSB 4KR0B 3KFWX 4LUBA 1KD1T 1FD8A 3I9V9 2PIIA 2FY1A 1Q95G 3OR1A 1SC1B 1TZ0A 3M4XA 3OTOF 4M5NA 2ADBA 1GAOA 1IKXB 1G7CB 5D75A 4K8RA 1S0OA 2GFFA 4NI2A 4KE5A 4WKYA 2WAQD 2P9CA 1DTTA 3BS9A 4ZK7M 3RAXA 2JLFA 4IUFA 2NPIA 4DEZA 2C2DA 3IGVA 4X62F 3MCOA 5KTQA 3LANA 1RT5A 1BXNA 2V63A 2YPZA 4DN9A 1RKJA 4U9RA 4A8XA 3D9BA 1T05A 4I67A 3EGVA 1WD6A 1Y11A 5CCLA 4XO0A 4HI2A 1J5EF 1AZSA 1KSPA 2OLWA 4DSEA 2A3BA 1SH2A 2DEJA 4WIQA 2D41A 2VUGA 3D66A 3CJ4A 1OPZA 3DMJA 2DO0A 4NX9A 4RW8B 5KG1A 3CCQS 4LR7A 1NB2A 2HS4A 3KLIA 2CXEA 4PTMA 2R8KA 4ZJOA 3GYXB 5A6WA 3TJ8A 3MAQA 5J2QA 1F5BA 5CABA 2RU9A 2HVHA 3W2VA 3V6JA 1HW8A 3G8SA 1XBWA 3HHLC 4ED6A 4DN0A 1Y3JA 4DFKA 3CJ0A 4ILRA 5K8NA 1SB6A 5B7WA 3PW0A 4R0JA 1ZM3A 4OJGA 3NTPA 4NPOA 4U86A 1JLFA 3ET6A 4NLGA 4PG5A 4LGXA 3S8SA 3H4DA 2APOA 4RWXA 4ZVEA 4R8UA 2J0XA 4JI3J 3ICLA 1KHWA 2RKIB 4TXSA 3V6HA 2KE0A 4JFJA 2A2CA 1F40A 2EFOA 2OUGA 3QT7A 3CW2C 1H2VZ 2RB7A 3UWTA 3U7JA 3EIPA 3CC2S 2Z57B 1T95A 3PJXA 4IH5A 3FNNA 2CJ9A 5DGBA 2XP3A 3DRXA 1C1BB 3EZUA 1NZAA 3KKFA 3NLCA 3R97A 1N48A 1JX4A 4K4XA 3A1YG 3D54A 3MPWA 3W9HA 1FKBA 4DSLA 1S0MA 1NKEA 1E44A 4GRSA 2HVEA 2XPBA 2ZZMA 3WX4A 3ZC4A 3OFGA 1UFWA 3ILLA 4QWDA 4OI4A 2WZ1A 2CZ9A 2DT9A 1JJ2R 2C3YA 1U47A 1SXLA 1AZSB 4E8UA 2WOMB 3AQPA 1YRXA 4DIPA 1TL3B 1XR5A 3LH2S 4L76A 5DDQC 5A2QY 2ZH1A 4DPXA 5FLXU 4LRDA 3ZTRA 2MKYA 3MPYA 2HKEA 2L2SA 1N52B 2RH3A 4P8WA 1EB0A 2COLA 4FKYA 3VQSA 3FGVA 4WZQA 1VC6A 2R7OA 2LQ9A 3U1NA 3HHEA 2W7PA 1X60A 2GMLA 4MPKA 3HSZA 3IBCB 3FMWA 4ZLJA 1Q81T 2R2SA 2DCLA 2KT5A 3I82A 5B8IC 4O23A 4OYPA 5DDOC 3KK2B 3N0VA 3R6LB 4USKA 1EARA 3TVKA 2QLJB 5ITHA 4NSBA 2SXLA 2RQ4A 3H0PA 3FCWA 1F3VA 4F7VA 3VGVA 1CEZA 4ZLPA 2UUAJ 2QL9B 5F41A 3UN3A 2DRDA 5F3ZA 3SSRA 5DDPC 3J81U 3JYMA 2BACA 3R2DJ 4Z2JA 1UWBA 4B3MF 2XP7A 2RUCA 4J37A 3C19A 3ENAA 3R6GB 3BGLA 3GFHA 2OEMA 1WG5A 4LF2A 3WIUA 4X4RA 5KFYA 3TR5A 3FSXA 1WF2A 5KT4A 5LSRA 1M5YA 3KK1B 2GW8A 2OEJA 1JLEA 3Q8PB 1VQLS 3FBBA 2BJ9A 4NLUA 1QAYA 2RQCA 1WF0A 2H5EA 4IG0A 3O5FA 4I7FB 4DUZF 5J2NA 2VDIA 4RLEA 1FJEB 2YQ0A 1WAWA 4FYYB 3KOAA 4IOCQ 1W1PA 2ZHBA 1RK8A 2AJ1A 3P5TL 2EFGA 3KLFA 4CLYA 3BKTA 1IKYA 2DGVA 2V8GA 3M8RA 3QWUA 4NLXA 1VCTA 1JK9B 1D9AA 3A3PB 2ZJPQ 1VRUB 2EFNA 5A8KB 3ZTPA 1S97A 2IMWP 5KT5A 3HHLD 1N36F 4RZRA 3DLBA 2MKHA 2Q43A 1A9NB 2VD3A 5CD4H 4MKYA 2G0IA 4OX6A 4K59A 3O5LA 2HHWA 3WL0A 4ZVGA 1FA0A 3QLHB 3EVMA 4RX6A 3W65A 5B0CA 3OVBA 3QZ7A 2OH2A 4M5IA 4L3KA 3FFIB 4K0KJ 4HKQA 2QN6B 4KO0B 2DGSA 3KLVA 4CO3A 4B3MJ 1R3NA 4QIBA 2ZUAA 4FXWA 2ZH7A 1YX2A 1ZBTA 1V3RA 3ETOA 5HBMA 1NK0A 1FJCA 1Q5VA 2NREA 4AL7A 2J6SA 1DTTB 1WOPA 3DDNA 3NOCA 4NYOA 4QZVB 4RW4B 3S1TA 4CQ1A 1GTEA 5GQBA 5HMWA 3Q22A 3GCXP 3I4PA 3VWSA 2RS2A 3NNHA 2X1FA 3D0GE 3B9AA 2ZBRA 1S72S 4Q22A 1TKXB 3OT9A 4WE1B 1BQXA 3PXGa 3PR4A 3E8OA 4OL8A 1UR9A 2LXIA 4R0EA 2KM8C 4DF8A 2Z30B 3BZQA 3GE9A 2DT2A 2CNOB 5KFEA 1RHRB 5J2NB 1A7GE 5HVHA 4DCJB 4NXMJ 2VG6B 3KG1A 3QJPA 1EZZB 3CJ2A 3O5IA 4EU0A 2MKIA 3PTWA 3SV3A 1BHNA 1TL5A 4F25A 1IWGA 4C3KA 4F3QA 3TZXA 4HLBA 1HKKA 3M30A 2UVUA 4ED8A 3SFGA 4DPTA 4S3JA 3SIPB 2PA3A 2HS0A 4UT4A 3M6XA 4X4SA 1TVRA 2W8KA 4BHQA 2G0JA 2ZR5A 2QLXA 1XNQJ 3JSYA 1PJ6A 1URNA 3PNIA 3LO3A 3J80Y 2CG4A 3RBXA 4KRWA 4X66F 1D2KA 2V0NA 2XHWA 4OJ3A 2DGUA 5D3GB 3LUOA 4KKOB 1FDDA 3MCSA 1NKBA 5MAOA 2ZZTA 2R7WA 3K0JA 3W3SA 4ALZA 1HWKA 2I6WA 3SSQA 1ROTA 2Y0BB 1KT0A 2OD4A 1NEEA 2OPSB 3MEDA 4N41A 5L1LA 4YDXA 5D0GA 3TCZA 1UVIA 2F3JA 2RU3A 3M8QB 3RAMA 3C15B 4EZ9A 1M5HA 1KP6A 1KVJA 2D7SA 2KFYA 4LFAJ 1IKWA 3O5GA 2XTJP 3N4WA 2HFSA 2Y8YA 4ZPTR 5E3QA 2NXCA 1B99A 2DNQA 2UUAF 5HLFA 4WKRA 3ENQA 1KTQA 3HZEA 5ETMA 2BEFA 3HFVA 1F3FA 3UCUP 2NR0A 2KJWA 3BGFA 4DV3F 1S9FA 4DS4A 1X9SA 2LQ8A 5KFOA 3QFWA 2WOMA 3DU6A 4YB6A 5IWAJ 2J9DE 2VQEF 1U1LA 2F40A 5HO4A 4FXDA 5KFPA 3PW7A 2C3OA 2V4QA 3HJVA 1OY9A 1B4SA 1Q6IA 4H4OA 4WFAQ 5L39A 1QDUB 2RT3A 3T19A 1ROUA 1C0TB 1FVQA 2VCDA 1CQMA 2XHCA 3LGNA 4DRJA 2IDLA 7FD1A 1IBLF 2FPHX 3OFFA 2CVEA 1JMTA 3NBPB 3LP0A 4P6QA 4F67A 1S0VA 4MFBA 1PSDA 3IMQJ 1QSSA 2MB0B 4PWWA 2CQHA 2PPOA 2G8ZA 3MM6B 4DL2A 3EYZA 2QE5A 4KH0B 1WI6A 4WKHA 1RHKB 1AB8A 4TYAA 1X5TA 4UQGA 3IR7B 3G6ES 4KKOA 5BJRA 3M9NB 2M4MA 2XWYA 3CO9A 2IJNA 3CCLS 1SKSA 2W2NP 2VFUA 3FQKA 2V8PA 4A8WA 1X4CA 4PQUA 3M8YA 1U1PA 2BA9A 2KU7A 3C6UB 1OPIA 4QIVA 2B9EA 3IKGA 1WEXA 2NYHA 5U47A 6FD1A 1T03B 1FKTA 4Z2KA 1T8EA 3M8QA 1HIYA 2XBPA 4ETXA 3TZYA 4B02A 1RHJB 2E5IA 1LFPA 1HW9A 5GADU 4Z7CA 1X5SA 2VPWB 3KAGA 1RBOB 4KFBA 4DL7A 1PAEX 5KOWA 1W25A 3PRVA 2B4PA 3SDEA 1XMBA 4JI0F 2UUBF 3CJ3A 4KGZB 4RPFA 2GX8A 3UW1A 4CT9A 2KFWA 4LRBA 2H5JB 5IV4A 2ALZA 2OJ3A 4MK7A 2YH0A 2B6AB 3UN2A 4BLGA 2AOSA 2BJ7A 3NGDA 2DXFA 3PHTA 3OLAA 1U0HA 4NLDA 2RSQA 3RB4A 3PJWA 1RJJA 3CDBA 2AJ2A 4M63A 3VAGA 4JV1A 4OHYA 2AD9A 4XPCA 2K3IA 2ZJQQ 1NO8A 2UXDF 2Y9HA 2WVCA 2O01C 3IAS9 3MDFA 2J0SD 1M5SA 4A46A 2LU2A 1ELOA 1HMVB 1VHFA 1UW9A 2KVIA 2UZAA 2J9DA 5E3CA 3TWZA 1RT4B 2W9AA 3BQ1A 2R7RA 3V2UC 4ES1A 1ICEB 4PRFA 1RA6A 1RTHA 2PN0A 1ZBVA 3EMTA 3LP1A 4NZ7A 2J5AA 4OYZA 2CPYA 4ZCIA 5IXUA 3PW5A 1EAYC 3FBFA 2HNDA 3P45B 1A0OB 2BRKA 3UVJB 2ZQUA 3VZIA 3B9DA 4C8OA 5HP1A 4EWTA 2IM3A 3HHNB 1D3WA 4LRCA 3I0SA 5ETNA 3ZFVA 2KFZA 4EYHB 3Q23A 2OPQA 2UVVA 2L9WA 3MAHA 4FKXA 1WC3A 2RMLA 1BUXA 5JUMA 5T41A 4LF7F 1PKUA 4FN5A 3PKMA 3UDCA 3J81j 5D15A 5D0EA 4ODOA 3HD1A 3ARUA 1WEZA 5IM0A 3PJ9A 4A8YA 3CMES 2DBBA 5EN1A 3DOMA 4TN2A 2O9OA 4MGVA 2W2OP 2ZKUA 3UCGA 3HZGA 3K57A 2CFXA 2M52A 1N4LA 4JYSA 2XYHB 5J2MB 1VJQA 3BDEA 4M5GA 1NWRA 3MMCB 1Q8IA 1JJCB 2RQKA 2RS8A 4NASA 3MTJA 2X3GA 4D3HA 5F8HA 3R2CJ 4KGVB 3GV5B 1D09B 3CD6S 1B0VA 1VS3A 1R0BG 2HQ3A 2IA0A 3DXSX 4K4VA 1R43A 3AS3A 5KFXA 4OQJA 2LXUA 3AB2B 2Y3YA 4X4NA 2MZRA 4Q45A 3ARYA 1HMVA 2IRYA 4P10A 3KLGA 3S01A 3DLKB 5HTGA 1Q79A 2NS1B 4K4TA 3ARSA 1S0NA 3MEDB 1IBMJ 4NYPA 4DRQA 4MSPA 4XPEA 1N34F 4J9PA 4B3RJ 2Z2YB 3OFEA 1LWCA 2DNZA 2DISA 2QO3A 3LP1B 3OXFA 1BWVA 1RI7A 1D8YA 1UJ6A 2BKNA 2KT2A 1I3OB 2LEPA 3AJDA 3UVJA 4RUAA 1J4HA 2PT0A 4B3SF 2OPPB 1ZK6A 2YWEA 4TX0A 2VB6A 3MEGB 3MMJA 5CZVA 3ARZA 5BXJA 2ZZNA 3OPKA 1PGZA 4DI6A 4BWJA 2DR8A 4J9RA 3NCPA 5GAHI 2ZC3A 2J76E 2V68A 2KDOA 3MI7X 1IVZA 1QTMA 1N5SA 4QU6A 4RR5A 1SQEA 4WP9A 4JI8F 4N5SA 1VBKA 3ZZTA 3SSSA 2VQFJ 1VYAA 4FS2A 1K1SA 1SH0A 2H5IB 3Q8YA 4PG8A 4QPXA 5DQGA 4V19J 5E3PA 4ANCA 1PJ5A 4DR4J 4OX8A 4N8OA 3UD4P 4F02A 4KY3A 2ZC4A 4Q0BB 9RUBA 1Q6HA 3CHDA 2PDAA 1UAWA 1UTAA 5DG9A 3KJQB 3W5XA 2XLJA 3JTOA 2CG8A 3IGNA 1XMOJ 2W9BA 4MNMA 4RW9B 4TLRA 2BANA 1UKUA 2G2OA 3KUEA 1IBCB 2EKNA 2G0CA 2QTWA 1PAUB 2BVZA 2O67A 3TYTA 2VQEJ 2NYIA 1B0PA 4LAXA 3EXCX 4HH0A 5AXLA 4JI4J 1BE4A 3F44A 4TW8A 2G9OA 1LG2A 1DQAA 3BEGB 3RR7A 4PQUB 1L5UA 4OZ5A 3K7RA 4YUDA 5C7PA 1RWOB 4HACA 2GC8A 4LSLA 4USHA 5GAEI 3KJNB 4MKAA 5IFMA 1S77D 1LWCB 3CDWA 2VG5A 5B0EA 2LKZA 1Q53A 2FJVA 4L3NA 4LF7J 2DNMA 4A47A 1FFGB 1OSCA 4DSKA 4YS2A 2ZH4A 1C9HA 5CA5A 3FZBA 4ECXA 1W7WA 2ZQTA 1R6VA 2ZH5A 5HK4A 3I31A 2XGQA 2CPJA 1HA1A 4PQAA 3MAAA 4ZVFA 2GVZA 4XDCA 1APSA 4I0WA 3CJTA 4JYAF 3MCMA 5KT7A 2LPVA 5C5JA 4DR1J 3TUPA 4URQU 2Z2ZA 1KN6A 3JXVA 2QL7B 3OTEA 4BC9A 3BYRA 3KAHA 2H4YB 4OYOA 5EGYA 2OP5A 2GNKA 3AOCA 4DV0F 4DRNA 3T9NA 1Y0HA 3G86A 1QE1A 2KZZA 2KO1A 1ZETA 2OMOA 5J2PB 4GVLA 1JNSA 1UETA 1K9TA 1RAOA 1W9PA 1LNQA 1RT4A 1S6UA 4KBIA 5LT5A 3ARRA 3JSRA 3ZZPA 1RAFB 4OYMA 3TC5A 3HP6A 2PO4A 1JKHB 1S6PA 5ETLA 2MKSA 4MKBA 4C6AA 4QWEA 2AJ0A 4ERDA 3B8SA 1Y9OA 1FD9A 4JB8B 4TY8A 3Q0AA 5DEZA 1FRJA 2H48B 4DR6F 4XIUA 3G8TA 1VF8A 1REVB 5D0HA 3BN7A 1E6ZA 3K8WA 1KQSR 1FHTA 2CPFA 3WKZA 1HNVB 3G82B 3O3LA 3R5JB 4OZLA 3GR1A 3VHQA 3KLHA 4WWSA 1FD2A 1UVNA 3GIRA 1QLNA 2M5YA 5B0BA 1X4DA 1Y0OA 1HQEA 3D1OA 2XCPA 3HDSA 2RIJA 3OFHA 3JB9k 5HSPA 3PKYA 4IKAA 3DC2A 4C3MA 1G6BA 1SC4B 3SFUA 3UNGC 2LYVA 5KFIA 4C11B 5ETOA 1RT1B 3R5BA 4JI1F 4S0MA 4N47A 1UVMA 2CQ0A 3BBCA 4R8UB 2CPIA 4A8KA 1VI7A 3K2YA 1H2TZ 1RT3B 2FDMA 2I8EA 1DQ8A 2XB2D 2XI3A 4WTYA 2XC9A 2PFFB 3LA0A 1RBAA 4AQYF 1RU2A 3RR8A 3VR1A 4ZPWR 4NE9C 1MWZA 3AFGA 1NKCA 2FLOA 1HD1A 2CRLA 3DYAB 5E0OA 1VRQC 2R8HA 3AS2A 2ZNYA 3GR0A 1WHWA 3DRYA 2R7XA 4B3TJ 1QE1B 4U8YA 1C1BA 1PBAA 1RZMA 3EVOA 4ZP9A 4Y00A 5IT4A 2YVSA 2MLYA 4KIAA 3L95X 4ZVPB 2QSWA 3MM8A 5DM6Q 3B7XA 3IP0A 2LCWA 1NNDA 1HNZJ 2RDIA 1VIOA 1KWMA 2J7WA 4IPXA 1KEKA 2VFVA 1UW4A 3KADA 5KFTA 4DQRA 1MSWD 2PSZA 3H42A 1MU2B 1D8ZA 1YTYA 1TL3A 3R9LA 1Y00A 4RO0A 1RLCL 2W7OA 1G1XA 1H0IA 2KHCA 2RHQB 5HROA 1HWJA 2YQ3A 2V94A 2DJWA 3PYEA 4RW7A 2ZVIA 2QMUB 2QIFA 1HKMA 5CCMA 2QFIA 1W26A 2Z56B 1VJWA 2VFSA 4OJHA 3WL1A 4NA1A 2CPZA 3HT3A 1YDLA 4DOZA 4H54A 2KXHA 2N4DA 2RQMA 3BH7B 3VGTA 4Z2HA 2MGZB 2M8HA 3BJYA 4I68A 5IOLA 3TAPA 2W1BA 4NZ6A 4JUZA 2FGOA 1LL4A 4CLLA 2BQ3A 3ZNUA 1TCOC 2IAJA 4DRIA 5M2PA 1H72C 2DXDA 1B7YB 4HHUA 3KDNA 2A3CA 1SVDA 5HAOA 2QGFB 4ZMMA 3RRGA 1RT3A 4R0XA 1TAQA 5B0GA 4TQRA 3UI6A 2PN6A 5F8MA 2UXDJ 4MAKA 4ZVQB 1FERA 3GJQB 1N8RT 3N01A 3M2VB 4FXVA 2ZM6J 2N4CA 1JNRB 3K5NA 2DEIA 1FT8A 4I7FA 8ATCB 3ZZ0A 3W66A 1M1GA 1X6LA 4LR8A 4QYZK 3TOQA 4X4QA 2KVQE 4MK8A 2HGMA 3KG4A 1RT6B 4EI2A 3L3CA 1J4RA 2ADCA 1Y5LB 4LSZB 3OTDA 2YKOA 1N0UA 3A8JA 4PG6A 4MIBA 4F36A 3T1YJ 2XYPB 1MU2A 1OWXA 1VRUA 1HNWF 2BQUA 3BQ0A 1RT2B 3TP2A 4BC7A 2FVPA 5KFMA 4PG7A 3AXKA 1RDRA 2AYBA 2B7BB 2XM3A 3SQGB 2MTLA 3MAAB 2LLZA 4NOHA 4DHVA 1FKDA 2POKA 4KHPJ 2FYXA 1TL7B 3HVRA 2A1BA 3KDOA 4QQBA 1WTBA 5IQ6A 1ACMB 1XERA 2NUHA 4ECYA 3WD2A 1GXUA 2HRUA 4I2PB 8AT1B 5L38A 3OOBA 1HBUB 1ZB5A 5DG7A 2V4JA 1T11A 1IJFB 5JXSA 2KFNA 1I1GA 4CYUA 1C2PA 2IC3A 2ZUGA 4TU9A 1ZM2A 5BYRA 1TMJA 3AHPA 2IYIA 2HBYB 1CS4A 1YJVA 1ITXA 4WFYA 4EK2A 2Q79A 4IR1A 4NLQA 4NLOA 5DM7Q 2CUYA 1VBYA 3TA2A 1GNKA 2UVWA 1HBNB 1HYSA 3GSDA 1FESA 3R3TA 1TU0B 3RW7A 3DRPA 5F0UA 1J5EJ 1KRPA 3GIKA 4DR2F 1FRHA 2W24A 1X5OA 2UXBF 4WP3A 1HHTP 3OTBA 2QFJA 3DI6B 4LFCF 2BOAA 3CEDA 1EP4A 1NWUA 2BM0A 3H2UB 1U2CA 4DR3F 3W2WA 4B9VA 2J9CA 5HT1A 3G96A 2F5GA 3GJRB 1NDLA 1MWQA 1TAUA 5HJXA 3GFZA 2YWFA 1HQEB 2KGJA 2ASLA 3MDYB 1RSCA 5HW8A 1RT5B 1Z1ZA 3AJ1A 4A8OA 1I94F 3O5EA 1IM4A 3MMBA 5A8RB 1NWSA 3RM8A 2GQCA 2KKHA 3O5QA 1U2RA 5J1NA 4C11A 2MJNA 1FXLA 1U7LA 1RYSA 2RUGA 5IT9Y 1TL7A 1WKLA 4GC6A 4YEAA 1FE4A 2G13A 4DPOA 4ECQA 4NCBA 3CC7S 2C42A 3NEKA 1S1WB 3G6LA 4WXOA 2XMJA 2WHOA 2YWHA 4LBIA 5AE2A 4WYWA 3D2WA 5I3UA 1OY8A 2AGQA 4X66J 1XNRF 4GKJF 4LFBJ 1HI0P 4DRMA 4NLSA 3C14A 2QA1A 5CHCB 3CGIA 4YHHF 3FJ2A 3SQOP 4FZVA 4YR0A 3G6VA 1LL6A 2M1IA 1NJYA 2FC8A 4RJVA 2AYEA 3EUNA 3PCOB 3BR8A 2WONA 3BREA 2PD1A 4QWBA 3CDUA 3VAHA 4YDDB 1XTZA 2AKWB 4J9UE 3NCRA 3DI6A 1J2VA 2Q3PA 3NGRA 4OV6A 3M9OB 2GHVC 2YX1A 4WK9A 5F9LA 3K8VA 2EC0A 3TRGA 2MPUA 2JSXA 1NHKL 3HSJA 3M2UB 4K4ZA 2OSRA 3P6YC 1RWWB 3ETMA 3HO1A 1RTDA 4LF4F 3D6HB 2D69A 2MHEA 5ETRA 2J9EA 4MFBB 3AD7C 3ILJA 4NCAA 1D7HA 1NK8A 3CF5Q 3I5BA 1TFWA 2FQQB 5C42B 2CJQA 2VBYA 2LA4A 2Q6BA 3VF0B 1N1AA 1JLBB 1UEUA 1YBAA 1F2HA 3W64A 4B08A 4DJBA 2DXEA 3OHAA 1WOOA 4G1QB 5AXKA 2DG9A 4H4KC 1U1RA 1ZU8A 1XNRJ 4W9PA 3OJSA 4XAKA 2QSFA 3OUYB 4NNRA 3TARA 1FK9A 4ILMA 4QU7A 3WIJA 3TAMB 4YB1P 3UR3C 2FB0A 3O1LA 2IA6A 3E51A 2HQFA 4RU9A 3OL7A 1VFJA 2E5HA 2RJZA 3K59A 3D5MA 2B4UA 4HVZA 5K5MA 3QT8A 1GRJA 1RQ0A 3NL0A 1P6TA 3ZTOA 1VQMS 3NKYA 2HEKA 1EQ0A 4FAPA 2OELA 3MPUB 3MCNA 2LQBA 1XR6A 4GO7X 3WBZA 1U1OA 3F56A 2YKAA 1YWXA 4WPAA 1WTFA 3H25A 2HWIA 2AEJA 4DR5J 1ZPWX 4C8MA 2DTJA 2WTFA 2K7JA 3B54A 3IM8A 5T7LB 4U7UK 1VQ4S 4U7CA 2JFKA 1BL4A 2LFVA 2DGWA 4M5MA 1IQZA 1S6OA 2EC2A 3T5KA 3O44A 3SCLE 2ZHAA 1ZBCA 2CJKA 1M90T 4QIFA 3MUVP 4PXEA 1JQGA 3OVAA 3KTQA 3G6YA 2CA9A 2ZWPA 1PYOB 2Z2LA 3H59A 4QT2A 4CZCA 4MIWA 1GTHA 3CTRA 1SH3A 1IKYB 1HQ2A 2ZE2B 5D4OA 2NZCA 5KT2A 4O0IA 4RNFA 1S6QB 5EX0A 4F04B 1FJ7A 2YBTA 2B8QA 3C6TA 2MQLA 3HVTA 3N6MA 1JLBA 1E6VB 4KGXB 4OZ2A 5AT1B 3TUZC 3HFKA 5THWA 2YNHA 1C1CB 1MMNA 4WTOB 4AQYJ 2RHSB 2D3ZA 3D67A 2BZ2A 2GO8A 5KFLA 4CH1A 4DV1F 3CCZA 1RAIB 2J0WA 5GPGA 3M6VA 2VHGA 1LEOA 2QRRA 4O3QA 3KK1A 2JHEA 3A8IA 3QNWB 3RYLA 2G4BA 3TAMA 3MPVA 3QLHA 1T9VA 3AH6A 5DF0A 4O44A 4LJMA 4QWAA 4LQ3A 2NPFA 3TZZA 3DRRB 3QQCD 2IIHA 1XHGA 3AT1B 4NEYA 4O0NA 3VQTA 1Q5YA 1RWKB 1QD1A 1ZOTA 1YW5A 2B5JA 2YPYA 3DM2A 1FX4A 1RWVB 2DNPA 4WF9Q 1EDQA 1ZL1A 1FVSA 2YKMA 1GX6A 2OPRA 3DHXA 1FEHA 1S4EA 2WRMA 4J9QA 4L6V3 1FNXH 3D28A 3G71S 2B56A 4ZKAA 1RADB 4KTQA 1KQKA 2D9FA 4DCPB 2DH9A 3MR5A 3Q2SC 5HWCA 3OW2R 1UPPA 7FDRA 2EEYA 4PXDA 3KHHA 2E66A 1EIYB 4Q2LA 5LSLA 4O2TA 4JI7J 5MLCV 1YITS 3HM9A 1F5CA 3O5JA 3QBCA 2G2YA 4ID8A 2VBXA 3VGSA 2E7WA 6FDRA 2NSCA 3C3LA 1Y10A 4K4SA 3R7BB 2IM1A 1X4GA 2EI5A 1V9OA 2G2ZA 4FDFA 1LXNA 2YX4A 3T6JA 4RL1A 1VQKS 3I9ZA 4J91A 4ZJQA 5HWBA 4NLYA 3BSOA 2HW3A 1EX8A 4IFYA 5HBMB 3M7VA 2FJDB 1NPKA 1ITPA 3IAM9 4Z2GA 2CQ4A 3OR2A 4ICLB 1VQOS 1VLYA 4JOUA 2KM8B 1JNDA 3ZO7A 5RUBA 4OX7A 3DLLQ 4K50A 1WG4A 3DNCA 4O3OA 3Q2TC 2B51A 1T3OA 2LA6A 2OPPA 2MKKA 1RXOB 1WB0A 1O6IA 3UQAA 2AEMA 3F0NA 3G8QA 3L09A 4WE1A 2EXUA 3W7BA 1ZA1B 3X1LB 4JYAJ 1MMDA 2ZBIA 3WIVA 4DV2F 2BDPA 3PA7A 1SI9A 3LWMA 3OL6A 3FBEA 1U4BA 1IBMF 1LW2A 2A2DA 2ZR4A 3KAFA 4Q7NA 1O5JA 2F8HA 2F9JA 4M5LA 4USMA 2K8IA 1FTCA 4DU8A 1B6CA 1OO0B 1FRKA 2BW2A 2ZQVA 1T03A 2VPYB 1JNTA 2XP8A 4P75A 1XR7A 4X64F 2RDJA 2L41A 2ZOMA 4TYBA 4TU8A 4G2PA 2YKNA 2RRAA 4FYDA 4R5PB 3GV7B 1IBKF 1N33F 3UD3P 4JI8J 2WK4A 2PC6A 4I4BA 2DT3A 3I32A 2HFVA 3GP9A 3LAMA 1O51A 2BANB 2GMHA 2X51A 3POTA 4M5KA 4UUXA 2AX1A 4F4XA 2DVIA 2BX6A 2FHJA 3FUYA 4P71A 4ZVOB 1H2UX 3DLGB 3P96A 3NS7B 2IUZA 2FIUA 5IT9U 2BJDA 1JVWA 1BQNB 3MUMP 1OIAA 1FK9B 2ETNA 4K5RA 5HMZA 4EYIB 5DIVA 1C0TA 2N87A 1BGXT 1EETB 3C66A 4DV5F 3RTVA 1H6KX 1RTJB 4LIWA 2GQ2A 4DZ2A 2AHOB 2VU5A 1IKVA 3W2VB 1SC6A 4DZDA 4EBDA 3OR2B 2VG5B 2FY8A 3KHGA 3GB0A 3ZTQA 3V6DB 3D1HA 1MLAA 3UDLA 3GTYX 4Q5VA 1YLXA 2VPXB 3KHRA 3NAHA 2L9NA 1HPZB 3MM6A 1ZTTA 1NMVA 3KAIA 3HKZD 1PO6A 4DR7J 5DDRC 5ETVA 4AL6A 4NZ0A 4JFIA 1FWPA 2KRBA 3GG1A 3B78A 1S1VA 2ZBCA 1SL1A 2GVZB 2RKIA 1Y7PA 5E3RA 1KDNA 1T02A 4DLEA 3N28A 1GUVA 2MDAA 5T7LA 2DRAA 3R5AA 4NRTA 2P4VA 5DQIA 4ODRA 2WW4A 3C6UA 1IM6A 1EIBA 1KTVA 2XMKA 1K1QA 4CLTA 1FRIA 4FYWB 5LMUJ 1M5VC 4ZP7A 2RVJA 3DHWC 2HQCA 2QX0A 5AE1A 2FC9A 3MOZA 3J7AN 3MM7A 4JI2J 1HARA 4U95A 1X8DA 2DGQA 1FEEA 4FBTA 1RAJA 2V9KA 1RHUB 2HHHF 1S1TA 4KFBB 5C25B 2MPHA 4O3SA 4ED5A 3PY8A 1S7HA 1VQ6S 2JL9A 3KABA 3ENWA 4LAVA 1EHNA 5D4PA 1W9UA 2ZD1A 2CAJA 2JZVA 4DWIA 1NAQA 3R7SB 1S6PB 4DR5F 2MLXA 1U8SA 2ZDOA 3DLGA 5F3TA 4X62J 5H9EK 4DX8H 2D3UA 1HNZF 4DL6A 2FLPA 1IBLJ 2J7UA 4LAYA 5I4MA 1B64A 2DCUB 4DL4A 1U79A 3P49B 4K7QA 1GEHA 3JQJA 1YJ7A 4O44B 2VJUA 2V9WA 4WFXA 1HKAA 5HATA 4MKVA 4ODPA 1WORA 1YBUA 2DH7A 3QGPA 4W4MA 4F50A 2B9WA 4ODQA 2DSUA 3MEEB 1WUUA 3MF5A 3R1HA 1WNEA 4ZPDA 4JFLA 3PFEA 2AMCB 5DS7A 3JYTB 4HBEA 1OMSA 3QIDA 2OPRB 2E1RA 3SDEB 2PPNA 3I5CA 2Y1JA 3T9ZA 3DDIA 5AJ3J 3LP2A 1RT1A 4HHJA 1VQ5S 2IM2A 4DV7J 1FCAA 5HQ8A 3VZHA 2GGPA 3IWNC 5J6EA 4OHXA 1CJUB 1JNZB 5K20B 3PR9A 3FSIA 1J6YA 5AXMA 2BOPA 4P8UA 2KYXA 4IR9A 2DNGA 5J1PA 4O3RA 3MM7B 4FVMA 5KG6A 4PYAA 5FDLA 4FF1A 1QAXA 3IC1A 2N3OA 5F8JA 1NU4A 2HAIA 3CXCR 2MKCA 4C8LA 1WWHA 2EG2A 1TKTA 4NRUA 3DOMB 5HMXA 2IYGA 1ZCNA 4IFYB 1Q6UA 4OZ1A 3D0IE 4I56A 4NLTA 4DUYJ 4B3RF 3NY0A 2E1CA 1W2IA 4WU2A 3HX9A 2VV5A 1ZTWA
chains in the Genus database with same CATH topology
3MR2A 3O8WA 3M1VB 3GIMA 2HVIA 2O5DA 5JVHQ 5KFZA 5DLGA 1CSJA 4WYLA 3CC4S 1RTIB 2JVRA 2DD8S 4QJVA 2ZQSA 2XEXA 4MTVA 1VOMA 2PI4A 2FHKA 2HHXA 3CCUS 3DLEB 3N5BA 1WF1A 4Y0FA 2RUQA 2JX2A 3HF5A 3G9CA 2JEFA 3ULHA 1MMLA 1L3UA 4PWDA 5IM0B 1YIJS 1UWBB 2BE2B 3OL8A 2UP1A 1E6PA 5T14A 2JC1A 2C3PA 3N5FA 4H4KA 5KG0A 4RNOA 3T5HA 1NK6A 3RW6A 1HD0A 3VAKA 1L1PA 3MEGA 4Z2IA 3UR0A 1KHVA 2EK6A 2R2TA 1KNZA 4IG0B 4WKAA 1S79A 2F21A 4KHRA 1HBMB 3POTB 1PC5A 3IR6B 1OGGA 2HHUA 3V5RA 2MQNA 2Q5AA 3FVYA 3M2VA 3H8YA 4ED2A 4B9SA 3H9RB 4K4YA 1U1KA 1TL1A 1NHUA 2R7UA 4IDKB 4URSA 3FQLA 1JB0C 3M8PA 4GO5X 3FEYB 5C24A 2FDNA 1NSGA 4OHVA 3M1VA 1F9FA 1U6FA 3M6WA 4Q43A 4EFAC 2O92A 1VK8A 1HXVA 1ZAVA 1DTQA 3IO1A 2J8AA 3MGJA 1MNEA 5KG3A 2KXFA 2PI6A 1FKHA 3BXWA 1C4CA 2JDJA 1OGBA 3BF4A 3D0HE 1JIHA 4PUOA 4OZ0A 1UMJA 3FEXB 4FN2A 3PEJA 3SCIE 5KFCA 1UA1A 2XMTA 2HGLA 4OIXA 2R8IA 3UFCX 2ROEA 2RE1A 4BBYA 1TKXA 3AROA 1DHMA 1LWFA 1ZAXA 2YNIB 3GYNA 3HI9A 4HT5A 4ZVHA 3ARTA 2MYFA 1MW7A 5I42B 4KHPF 3AS1A 1TR0A 2WM0A 3IR5B 3CDEA 5JVGQ 4CO4A 3G6MA 2W9BB 2B4OA 5EWFA 2FTRA 1HBMA 4HYKA 4N77A 3O5OA 4C9DA 4WZMA 4DSJA 2LECA 3DOLB 3DRPB 3IRXB 2HWHA 5A8WA 2RRBA 3GZ7A 4I6WA 3RAQA 1K73T 4P2SA 1VRTA 2EK1A 4DFJA 1EYMA 4FNIA 5CZXA 3ARQA 4JFMA 2KR7A 3L7OA 3NBPA 3QMQA 5LMUF 1JLGB 3ITHA 2AQ4A 4YR3A 5C24B 3JYJA 3PZPA 4IQ2A 4DL0C 3LUYA 5GAGU 3JSMA 2E29A 1JJHA 2B43A 3CD5A 4W92B 2E7XA 2ABYA 1JLAB 1S76D 3BGUA 2VH7A 5KG2A 3GPKA 2BBEA 2W4DA 4PPDA 2MZ1A 4Y3CA 4NCGB 4DH0A 2IVFB 4Q2MA 2V8HA 4ZPBA 4E0DA 2KRRA 1UA0A 1SYTA 2M70A 2XZWA 3ENVA 1E6YB 1J4IA 1WELA 2UV8A 1U26A 4NA3A 1VBXA 4WK3A 3IG1A 3KLHB 2XLIA 2GJIA 2N82B 4FBUA 4I2QB 2XO7A 3IN5A 3TW0A 4E98A 2LJ4A 2DG3A 5HLFB 4PKDB 2XSFA 4B9LA 2B7CB 5E41A 1ZYQA 5D6GA 3F73A 1HL6A 4URIA 1X9MA 2UXCF 3UCZP 2FVSA 5I3PA 1LKZA 3PDNA 4UY85 2I1RA 4NZCA 2B6AA 2DIUA 5K14B 4IOBA 2WONB 3UI3A 4LVNP 2GQQA 1SKWA 2UV8G 4I6AA 3SV4A 1IN0A 3C8YA 5KFDA 2W25A 4DV4F 4QW9A 1RTIA 3PM9A 2ATLA 4RNMA 3HLUA 3DYAA 1FKKA 2HFNA 3OVSA 4EEYA 2QMWA 1N5TA 2XMVA 2EFVA 4C98A 3IRWP 4DSFA 1WEYA 2C3UA 2U1AA 4QT3A 2OFNA 2P9GA 3NGKA 4RX6A 3PIOQ 1JLFB 1R0AA 1OSDA 2C3MA 5KOXA 1H38A 1AROP 1KOOA 4M5DB 2V8DA 2ILZA 3FCHA 4Q8FA 1NJWA 4ZPAA 2AWGA 3CCES 4ES2A 1CVJA 3CCTA 4DRHA 3CWJA 2K2PA 4G1QA 2FD2A 3LWLA 1Q4RA 3E01B 3PO5A 4D3GA 2FJWA 2JEIA 2VOPA 5DGAA 4OV1A 4QW8A 3PRAA 1UVKA 1DZ5A 2XNRA 3I4HX 2KXNB 3LQVA 5CYQB 5JH8A 1FNOA 4HI1A 4WJXA 3NWGA 3K5LA 2FHMA 4YB7A 1K0VA 4N8NA 5M2RA 4KJIA 3MM8B 3VAIA 2AP6A 3EXYA 1S48A 1TFVA 3CDAA 4JI4F 2ERRA 1N6QA 4IQMA 4B3OA 1FKSA 4IT4A 1E15A 2YNGA 5DO2A 1TP7A 2RNEA 5E2QA 5FD1A 5HROB 4ECRA 4MYUA 4RW7B 2JLGA 4C8KA 4P7VA 4UQTA 1N54B 4PG4A 3KLEA 5H9FJ 4TKTA 3ARVA 2JEJA 2EFPA 5A0YB 1ULRA 1QAJA 4O3NA 4Z2XA 1GQEA 2XMUA 2MGZA 2IF4A 3PX4A 3MOJB 5A6PA 2E9RX 1FFRA 4J4OA 4WKFA 2ZE2A 1SBRA 4ZOSA 5HP1B 3QO9A 4ZP6A 4X4TA 4DR1F 3N9UC 2DPIA 3RRGA 3DFEA 3TVYA 4Y2CA 1JLEB 2B0GA 1IX5A 2DR5A 4GC7A 5DQHA 2MKJA 4A48A 2F1FA 3T5JA 1ZZFA 4G1IA 2IRXA 2LVWA 1D7JA 4IRKA 1FKRA 2JZ5A 4ED3A 1XWLA 2OSQA 5KFHA 4OZNA 1QSYA 2KN4A 4X4UA 1FJGF 3M05A 2KYZA 3I0RA 2XULA 4XDDA 4JV0A 2XP5A 4Q44A 4QR0A 4J9LA 1KFDA 2DGTA 1VC0A 2DPJA 2GO9A 2YKMB 3KYLA 1N6QB 2XS2A 3E3XA 4IFVB 4ODLA 4CO1A 5DG8A 1QY7A 3PW2A 4YOEA 1R9HA 1YG0A 2M2BA 3FEZA 4X4OA 1QUVA 4UUWA 5L1KA 3KLEB 1M5KC 4JI2F 2KHDA 1HYSB 2PV3A 4QIWD 2XS5A 5IS2A 1YRUA 2RF2B 4A8MP 1NJIT 4HBOA 3R27A 1HQUB 4I69A 3UI5A 1QPLA 2J6TA 2JWNA 2LQJA 2ZR6A 4Z2LA 4IO1A 5KT3A 3CULA 1AFIA 4OJ1A 4HTIA 1GH8A 4Y28C 3KJVB 1C0UA 2R8GA 1YSJA 2I5JA 2HG4A 3H5SA 4ZA1A 1CQNA 4TW6A 2DITA 2J7KA 2DH8A 2BUNA 1N5QA 3MM9B 2M3DA 4N19A 3CCRS 2AW0A 5FLXY 1HNIA 1DLOB 1P27B 2VG7A 2XS7A 1X7VA 4DSIA 2LEAA 3BN4A 4ECSA 1EP4B 5HN0A 1VQ9S 3HXMA 4H4MA 4RBTA 4I6YA 3L7PA 2BYCA 4NYZA 5HL7Q 2OTJS 3I87A 1VQ7S 4ATNA 4RU2A 2YKNB 4M5DA 1KOHA 3SYZA 1F8AB 1S9EA 3MMBB 2GIQA 4CO5A 4ECWA 2PA8D 3M2RA 3P3DA 2OKQA 1R8HA 4TY8B 3IKDA 2KJVA 2RF2A 1S1XB 3OTCA 4CTAA 4P8VA 3WD1A 2VZ9A 1V6HA 4NLVA 1SV5A 4DRKA 1HNVA 3J7Z5 2LMIA 1EETA 1FRXA 3HVWA 1SJ4P 1NRKA 3VCDA 4ILLA 3TUIC 3R1LA 4TU7A 2L48A 2YNFB 3EGNA 1H0HB 3V6DA 1KLNA 3D1QA 1W1VA 1JNEA 2RRNA 4YR2A 4UW2A 2L08A 4B9NA 4AXIA 5C42A 3BGRB 2LU1A 4F26A 2EVZA 3TQ1A 2F4EA 2A3AA 1S1VB 4X65F 4B3OB 5CQGA 3FMBA 2ILYA 2DG4A 3TI0A 1NB7A 5CYMB 5H1SV 1HI1A 2DSVA 3H2VE 3WC2A 2CPDA 4JI6F 2KI3A 3T1YF 3RGCA 1S4FA 2HFOA 4X4PA 3GFYA 4C4WA 3KMSA 2C2EA 3MR6A 3LF0A 2MXYA 2OAUA 1R8AA 1TKZB 4IH7A 4O3PA 2XY6A 3O5TB 1S9EB 1LW0A 1KT1A 2LGOA 5BR8F 1FKPB 4F4WA 5GVQA 1S99A 3QIPA 2MSSA 3B82A 4HTJA 5IT0A 3HPOA 4MNKA 1G3OA 1S1XA 4ZP8A 4CTAB 4LF5F 1BWEA 3F41A 1IJEB 4IYQA 4H4OB 2FUG9 5IQQA 2LQ5A 3OUYA 3QJJA 2CQ3A 2U2FA 2HNZB 4ML4A 2YY3A 4LAWA 3LOUA 2VQFF 3KNAA 3W3SA 1R89A 3T3FA 5KFBA 3I0RB 3ISZA 3MURP 3CUNA 2VN1A 4AL5A 1BD6A 1TQLA 1JLCB 1P9QC 1YATA 2BV3A 2QA2A 4RBUA 3BGRA 4BCAA 1TUVA 3TA0A 1UJ4A 2O1PA 5H9EJ 5DJBA 3LP2B 4F2RA 3ARXA 2WW8A 1Q86T 1C4AA 3JTNA 1FDAA 4DR7F 1Q8BA 3ZZOA 2DNOA 4M8LA 5ADZA 1QM9A 2OO4A 1XNQF 4RW6B 1VQPS 2CQ1A 4EUVA 3UQIA 1YRTA 2CQGA 2XSJB 2ZHOA 1RTHB 2MMYA 3T5LA 2BRLA 1UJ5A 1WG1A 1S1UA 2BR0A 3OQ2A 5HW6A 3K5PA 3IHZA 1FKPA 4ZPCA 1FE0A 2R8JA 5KAKA 1FKAF 2CDQA 4K4WA 1OQ6A 4OI1A 1UR8A 2VKZG 2RSEA 3EZ5A 1RP5A 2F4VF 2DGXA 2YNHB 2X1AA 3M6UA 2Q6CA 3HJFA 3N79A 3UE2A 2LDYA 5D8HB 4DQQA 5KFVA 3EGWB 4JV5F 4IT6A 2FJXA 4G3IA 3IA0A 4DBQA 4MK9A 4QBUA 2Y0SD 4Y6IA 1OWQA 3E2EA 1U6ZA 3H5YA 4USIA 3WH0A 4KC5A 5F9NA