4XAKD

Crystal structure of potent neutralizing antibody m336 in complex with mers co-v rbd
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
226
structure length
218
Chain Sequence
b'QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTASYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCARVGYCSSTSCNRGAFDIWGQGTMVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike glycoprotein
publication title Junctional and allele-specific residues are critical for MERS-CoV neutralization by an exceptionally potent germline-like antibody.
pubmed doi rcsb
source organism Human coronavirus emc
molecule tags Immune system
total genus 35
structure length 218
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xakD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xakD01
1VFAB 1C8PA 3C6LC 2NY4D 1NC4B 4J4PA 4MA3A 3DETC 3NCJL 3TN0D 2B0SH 1NCBL 1NANI 1SMOA 4XVSH 4PTTB 3UTSE 5DJYA 1XGPB 4JE4B 3GSWB 1XR9A 2PYFA 5D2LE 5FO9B 5IJKC 5I9QC 3U0WL 4LVHC 4DKFH 4OD3L 1IQDA 1X3DA 4BZ2L 4UTAL 4FQIH 3QIWA 4FFWD 2O5XL 1TZGH 1Y6MR 1FNHA 3MJ9L 3GK8H 1OL0A 3Q6FB 1YNKH 1Q0YH 1XF5A 2HN7A 2ITDA 3RWIB 3LPWA 1I8IB 4W4OA 5I1LA 5DWUH 3S97C 1BBJA 4WO4B 1FFOB 1UXWB 3ARSA 4NC1E 3G5ZB 4Y0GA 3MCLH 3D0LA 4FQ1H 4PRAB 4QRPA 5LWYH 2QSVA 3BYYA 3C6SA 4F7TB 1TJHH 1OLLA 3IXTB 1H3UA 1IM9B 3GZKA 3TYGL 2MQCA 1I1YB 2Y36L 4XCYA 4PGEB 4CDHA 4OLVH 5D1XB 3NFSL 1FCCA 3DPBA 5EZIL 5EPMA 2AK4D 4ELMA 3G6JE 2CKBA 2EDYA 1J0KA 1FIGL 2P46B 4JFFB 4P4KD 4Y89A 1OW0C 4HC1L 3V5HB 3EHBC 5JW5A 2UYLB 4PLJC 3FRPG 2FX9H 1Z6JT 4MQTB 3I6LE 4XWOD 1IAKB 5IT2L 1ROWA 1RSFA 4BK4A 1U3HD 4GKSA 1I8MA 2FEEL 1N3NA 3OG6B 3PGDA 2FHFA 3BFOA 3WHE0 1A5FL 1NL0H 2DQUL 4UZGA 1NCCH 5IVZB 4X5XB 1WFOA 3B9KA 5ESAA 1EHLH 1NLBH 4YDKH 3Q2CA 3WSQH 3SBWA 3MUJA 4YJZL 4RIRA 3MYZA 4G8FA 4NKDA 3ARBB 5C0BA 4M7LH 4C83A 3OHXA 3GGWB 2B1HH 4H8WL 3G6AB 5AZ2L 1TFHA 2DLEA 2X1OA 3A6BH 3QFJD 4G8IB 3BRGC 1X44A 3TO2B 3BGMA 2B4CH 1HHGB 1LEIA 2DDQH 2H8PB 3GSRA 1PLGL 4ZXBD 5IEKA 1BBDH 3MJ7A 4R8WH 4G8EB 2PUQT 2FBOJ 4NKQB 4X7SL 5LGHL 3BRDA 3NIGF 5CHNA 1UB5A 1QSFA 2AABH 4ETQB 1FHGA 4HUNB 2DQHH 3NN8A 4TPRH 5T3ZL 4Y88A 1VB9A 1Y0LB 3L3KA 3A6OA 4DCQA 4NYLB 4FQ2L 1YZZA 5GGRA 3G08B 4PJ7B 4U6XB 5LGKA 4L3EB 2NXYC 4KRPD 4GT7A 1QYGL 5H2BA 1FFPB 4ZPTB 2MOVA 3GO1H 4NBXB 2NY2D 5LG1A 3NCYP 1CD8A 4XBGA 4XMKH 1WBYB 4YBLB 4OV5B 4IRJB 3AB0C 4UT7H 1MLBA 4X6CB 3HI5L 2R0KL 2C3VA 4K8RL 3I3EA 5EA0H 4ONHA 4OZGA 4ODVH 4F7CB 4KK5C 3OAYK 1B0RB 2HKFH 3EFDH 5GS1C 1SJVA 4OLUL 4OD1H 4LCCB 2I60H 3U79A 4RA3A 3FQUB 3G9AB 5D9SB 2FD6L 3P77A 1PBYA 5DURD 5IFAL 3CSPA 5EZOH 2WBWB 2X4OB 3PV6A 2V9QA 2OTWB 2IADB 5IW3A 5CD5D 5IF0A 4HULB 2JJWA 4UIMA 1TPXC 1AXSA 5FOBB 2ZUYA 4H1LG 4X6DF 5I74B 1OAXH 1W0WB 3CXHK 5D93C 1S7RA 2Y06H 1NFDE 3ROOA 1KLGA 2P5WA 4GBXD 3DX7A 5ID0B 3F6IA 2VLLA 1M7DA 1JRHL 1QSVA 4LLVB 3QDGA 1YN6B 1HXYB 5DUPL 4XPTL 2VXUL 8FABA 3MFFB 1JHLL 3DIFA 4QHKJ 3QUZD 4LDLB 4PJGE 4XBPB 4M5ZL 4M00A 4H5SA 4OB5H 4P2OC 4N8CL 5ESVA 4JO2L 3QQNA 1IGJA 5C6TH 1G1CA 2OSLA 4R96A 2VIRA 3RPIA 4OFYA 2A77L 2A6JA 1U8JA 5T5NF 2VR5A 2XRAH 4CRPA 4HS8H 1U6AH 3VRIA 2WWMD 2OR8A 4MAYC 4E41E 4F7MA 5E8EA 2VDNL 1C5DA 1QEWB 4HXBL 4U1KB 1KTLB 2CGRL 3BH9B 4XNYH 2KBGA 1G0YR 3CJJA 1IAIH 1T20A 4OCSL 4Y5YA 2DKMA 3NIFE 5ICXB 1AFVL 3BKMH 3GSVA 4CU6A 3O2WH 2NTFB 4MNGA 1WJ3A 3WMSA 3BIKA 2NY0B 2VSDA 3GEWB 1AE6L 3SDXB 1ORQA 1A7RH 2BNQB 1IFHL 3QG7L 1CWVA 2P8PA 4A6YH 4D0BA 5J1AA 3LVEA 3TIDA 1KNOA 4KKLD 3HG1D 2VQ1B 4PJBA 2BHYA 3UJIH 1KC5L 1TNNA 1U2HA 2LU7A 4H0GA 3L7FA 2XKUA 4LCWA 4OQTH 4FXKA 1OT1A 3IFLL 5EZJB 1P84J 2JB6A 4PGDB 4NBYB 1LNUB 5F8QC 2OQJB 1KJ2A 2VKWA 5F96H 4KTDH 4X98A 1R3HA 2PR4H 3GBNH 1QBMH 3V6FB 4OSUL 4RAVB 2A9MH 1DDHA 4LLYA 3O2DA 4LNRA 4X80H 3QUYC 5BS0E 5IB4B 1MY7A 4JAMB 5ETUA 3MV8E 1X5ZA 1V7ML 2NW2A 3MJ8A 5FYJU 4HK0A 3LMJL 2FJGA 1IEHA 2V5MA 4ZPVB 1KTKE 2EIZB 4RX4A 4LASH 4KAQL 1K85A 1MJUL 3L1OL 2LTQC 4HS3A 3EZJB 2YKLH 4NKMA 3VGBA 4QHLB 3G6DH 4S1DC 3WO4B 1A7QH 4Q9QH 3D18A 1RFDL 3L3OA 3H9SA 2HJKA 4PV8A 1Q9WB 1DQLH 1T2XA 3D39D 3HZKB 5TF1H 3KJ6H 3P9MA 4AEFA 5MEOB 1G9NL 2P49B 4LSSL 4MS8C 5CJ5A 1BQSA 4NZJA 5ICYB 3N0PB 4NO0D 5BV7B 4OI7A 3UBXG 3RGVA 1HKFA 2R2HB 5H37H 3P0YH 1J1PL 2V9TA 3WKML 2P44B 1HHKB 3UTSA 4U0RB 2YRPA 4NZRH 5EU5B 3QJFA 4U0QB 3ULUD 1LE9B 3LN9A 1F00I 5DVOA 4LCYA 3OKNB 3S96A 3ULVC 1GAFH 1IGCL 4KKAD 3IS1X 3MV9B 3SO5A 3BE1H 1MCSA 3RTQD 3B9EA 1AD9B 2AJ3B 1CICB 4ZAKC 5F1SA 1AQDA 1YEIH 2PO6B 1JMXA 4R90H 2YA0A 4I9WD 1BAFH 4Q0XH 5DMGD 1P69B 2GK2A 3VXOA 2QBWA 5I1JH 1XF1A 3VXPA 3ZT7A 4L3AA 5DHVB 4X9IA 2HKHL 4XI5D 4MNQA 3SGKC 4F7EA 3OB0K 4YDIH 4LNVA 3SDDA 1TXKA 1K8IB 1VFBB 1BQLH 4XVTL 3QZWG 5DEFA 2XT1B 1QOKA 4N0CD 4HMEA 1T04A 2NY3C 1X5YA 4HJGA 3VFVA 1BD2D 4BSWB 3G6JA 3HI1B 4NHCL 2IFFH 4P23B 1GXEA 4U6YB 5D7SH 4P5TD 1Q1JL 4FHBD 5DEGA 1DUZB 5B38A 2D0FA 4MQXC 4NRYA 4ZD3H 5JXEC 4GUPA 3KPPB 4I5BB 4B7IA 5D6DA 5EN2A 5DFTA 1GIGH 5HHXL 3L3HA 3S88L 5EC2A 5BVPH 4ZO6A 3EYOA 2VUYA 4XPHL 2GIYA 3FMGL 3WDIA 2JIXD 5MEND 4JLRA 4OCNC 4N8VB 4YHNA 1I1FB 4NKIH 4PGBB 4DN3H 4PS4L 3GBLA 4GW1B 4P9MH 4XGZA 2N7AA 3GM8A 4JZJB 3ZDXE 1UM5H 2DLHA 1LWRA 4NUJB 2JE8A 4LLDA 1PY4A 2HMID 1MFDL 4HPOH 1GGIL 5CINH 4XNUL 1A6AB 5D5MF 5FYLD 4JANA 5I30H 3VE0B 2H2SC 1H8NA 1T66D 3BEVA 5KAQF 5IB3A 1J5OL 1RURL 5I1DA 3UPRB 5KANG 3EOAB 4LPXA 5CJXC 1DUYA 3O8XB 1OT2A 4GMTL 5IIEB 3ILQC 3GHEH 1X4ZA 4Z78B 3BD5A 3UAJD 3AMKA 5HYJB 1KN4H 3HS0B 3O6FC 5CS7A 1HDMA 3DX6A 3MRJB 1OCWH 4KROD 3VDBA 3K4DA 4LLUB 4MX7B 1IGYB 5EWIH 4Q6IC 1WZKA 3VCLA 2CK0L 4KV5E 3V4VH 1DL7H 3MO1B 3QNZA 2HLFD 4KK8D 3GRWA 3O3UN 2DQDH 4TUKH 1ACYL 3K1KC 4M9OA 4JN2A 4LDOB 1BQHB 4UILL 3U9UA 4EOWL 4EN3D 1I8LA 5GS0L 3D25B 1DEEB 3OXRA 3VFNA 1KEML 2AJSL 3TO4D 1XT5A 4P2YA 1YEHL 3KPTA 4WHTA 1QFPA 4TUJB 5E70A 3MRFB 1HILA 1WZLA 2G5BB 2PYED 2WP3T 4ZQKA 2QQKH 5BW7C 4ORZC 1I3RB 4LAQL 2F8VA 4Y5XB 2D7PA 3OKKA 3ZZ1A 3EYVA 2FECI 1ZV5A 1IC4H 3LKQB 4NPYB 4WCYL 4ODUA 3BP7A 1X5JA 3ZSTA 4BM7A 1NGYB 1D5ZB 3EYFB 4ZFFA 2AXHA 3K2MC 4P49A 4PRNB 5T1MA 1BFOB 4PREA 3JWDH 3QUKB 4HKJA 4S0TD 5C3TA 3X3FH 3BEWB 3QO1A 2Q87A 2QQLH 4UI2A 5C0GA 1YN7A 1PY9A 2CIKB 2HT4C 1NKRA 2IEPA 4Y19E 4S11A 3EYSL 1F3DJ 3T0BA 1KB5A 2ERJB 3CFJB 3H0TA 4XPGL 5DQJB 2IBGA 4QHNB 5F9WB 3QRGH 4ODHH 4HLJA 4PJGA 4QEGA 1DCLA 2CXGA 1WITA 3OBAA 4IS6A 4AM0A 4BJLA 4HUMB 1WCBB 5B21A 4UAOB 3FZUC 12E8L 4L4TD 4ODXA 1L7TL 3NCEB 4ZNCD 1J10A 3HC0A 3C2SA 2ICEA 5GGSA 2QHRL 1VFAA 2JF1A 3RWFA 3V4PL 1GPOH 2Y72A 4U1HB 3OZ9L 2NZIA 3G5VA 3IAGC 1TNMA 3AC0A 1SYVB 1F3DH 25C8H 3OV6A 1MCKA 5DRXB 2QL1A 5HD8D 1OM3L 2BRRL 5I1IL 4RRPA 1GGCL 3U0TB 3PDOB 4E41A 3AY4A 1MJ8H 5DLMH 4F57L 1K4DB 3NTCH 3C6LA 5L0QC 5DJDB 1FN4A 2H2PD 4ONFL 2P43B 3FB7A 4UINL 3TT3H 2DI9A 2V17L 5JW4M 3QUMB 1CZ8H 4HKBB 3T65A 3MA7A 3NFNB 3I50L 2YRLA 1AQKH 3ULVE 3CMOH 5JIPA 5IJKA 5C08D 5I1EH 1FPTL 2DBLH 3LRSB 3QO0B 1A02N 1GGYA 2XNAA 2JJSC 2W0FB 5IB1B 4PJXF 2FWOA 3BO8B 3C8DA 4M8QA 1GVIA 1AO7D 1HCVA 3PGFL 4AL8H 1C1EH 2BVPB 1RIUH 3I75A 3UC0L 1ADQL 3RY6C 5IJVB 4OIIH 3C2AH 4FTVD 4HAGA 5D1XA 1PFCA 3AFLA 5CKGA 3F65A 1I9EA 2BY3A 1BJ1H 1QRNA 4MD0A 5D2NC 1NCAL 2VLRA 3IFNL 4LU5L 2YPLB 2F58L 4DN4L 1MIML 1MFEH 4B0MM 3C8KB 1U8KA 3DOSA 4M1DL 2ZCHH 3BESR 2Y5EA 1FCGA 2BSED 2N7BA 1ZVHA 5C0AA 5E7FA 5C0FB 4S1QL 5I1HH 3H6JA 2ZUXA 3V7MA 1VCAA 4U4BA 2APBA 5DJ8B 1G9MH 3Q1SL 3MBEB 1MCBA 1OARL 1AIFA 1OGAB 4MMZC 4DAGL 3VWKC 4WV1B 1A7NL 3T0EC 3VFPB 3MUY1 5D71H 5KVGH 2CLRA 4YHLH 4YIQA 4WEUD 1TCRA 5FGBC 3SDAC 1ZVSA 5C9JB 1ETZA 5E94A 1Z3GH 3KPSB 1EJ6A 2BVYA 2QLVB 1FG2B 4X6BB 4KRMB 5KVFL 4N8PA 4LHJB 4EI6A 1HHGA 4OCRH 1AGBB 4E0RA 4JQVC 3GMOB 3QEUA 1TDQA 3CZFA 3RA7H 4M7ZB 5D7KE 1JI2A 1RV6X 2BOBB 3FO2B 4ZO9A 1RIVH 4G8EA 2J2ZA 3PQYE 1F90L 4AH2B 1D5BB 4DK3A 2HVKB 3ARDA 2FSEA 4TSAL 5J11B 4JKPL 1JUFB 4F2MB 3ZKNC 1NUDA 3FCTB 1FP5A 3IJYB 5JR1L 5FFLA 1JN6A 2VISA 4X7TB 5EU4A 2R1YB 1P5UA 1IEAA 3H8NA 1LEKB 1YDPB 4LHUB 4BKLB 4KZDL 1QBAA 1MHEB 2BNRB 3MNZB 4U6XA 3GSNH 2FGZA 1YMHB 3K8MA 4KJQC 3C60D 3O3EA 2WLZA 5T1DL 1BZ9B 1K2DA 4PGCA 5E99H 4N90E 3NBNA 3W9DB 3ZT5A 4HPYH 4OTXH 1JWSB 2WIIB 2ICWA 2B0SL 4XVSL 1D3CA 4Z7WA 2ZOKA 1TQBC 1DQJB 4IRJA 5DZOA 3WNOA 1DJSA 1FYTB 1TQCC 2FJHA 3V6ZB 5C0NC 2FYYB 5HDQH 4DKFL 1JTOA 4RNRB 3WDJA 5CGMA 4L1HA 4XCCH 1FZKB 2BSTB 3R0NA 4FQIL 2DM4A 2VB5A 1P7QB 1T7WA 1TZGL 2BNUB 43CAA 2X10A 3GK8L 5L88L 2AGJH 1ZHNB 3MACH 4FQCL 4CDGC 4LCCA 4ENEC 4HIHB 1H8OA 4M1CC 5CIPA 1UGNA 5DWUL 3P0GB 1LEGB 1YQVH 1YY9C 2GT9B 2X7LB 1EGJH 3MCLL 4FQ1L 3BKCL 5LWYL 3DUSB 4PY8J 5GRWA 3KXFA 4RDQG 1K4CB 2VXVH 4XPBH 4OLVL 2DJSA 1M7IA 3AM8C 3DX8B 4PGZA 4PJDE 2CO7B 4JFDD 4V1DE 4JO3L 5DJAA 1JWUB 4ZO8A 1PKQB 1YYLH 1LK2A 5C09E 3O0RL 5IWLC 3DTXB 2FX9L 5I15H 1U92B 4LSRH 4M02A 4XVJH 3M17A 4APQD 3KDMA 4NUGL 4G6FB 3QEQA 4G80B 2APVA 2Y6SC 4AT6B 2EDWA 3IAQA 1NCCL 1CR9H 4FXGA 5GSRB 5SWZE 2LAGB 1Y18A 3TA3C 4PJ7F 3WSQL 4LF3B 1IL1A 2C1OB 3CU7A 3L5HA 3BP6A 2VZ1A 1YEDA 1KTLA 2W38A 2DIAA 3VFOB 1HNFA 1LO2H 4WTZA 5MERA 3QI9B 3JTTA 2B1HL 4PJCE 4DFHA 3FQNA 4GRMA 2EEDA 2H26B 3L7EA 3LEVH 3WNLA 2X40A 1T6WA 1A21A 2B4CL 3O11A 4LSPL 1Q72H 2XZQH 2G9HB 4G9FE 1TTUA 1DN0B 4FQJL 1MI5A 3IFPA 2P8LB 1BBDL 5D2LB 3MLPA 3QDME 5KSBE 1J05A 1RULH 3QIBA 4JM2B 1A4JA 2Y7QB 4F9PC 3LQZB 2ZUQC 5HHME 1XIWD 2R0LH 3ARPA 4R8WL 4Z7VB 3PIQA 5F9JB 5IBTL 3OKOB 2HTLD 1ONQB 3F7QA 1KJVA 5F6HI 3BXNB 4XB7A 2AABL 2XV6B 4PGDA 5LKNA 5K9QI 4K3EH 5E8PA 3VXQB 2DQHL 3QHTC 4TPRL 2NR6D 3L5WB 1IAOB 1BVLB 5C0JA 1N5AA 2VL5A 3TVMD 4RAVA 1XGTA 3S3PA 1KIQB 3K46A 4KDWA 5D2NE 5EUKA 5FO8A 1KIPA 2NY4C 5CBEB 3MRRB 3TN0C 2GJZA 6CGTA 2E27H 4YHIA 4Z76B 1NBVL 1MEXH 2DLIA 3QULB 3GO1L 3CFDB 1QP1A 4UT7L 2OJZL 2V5RA 2YA2A 2I25N 5EA0L 5E5MB 4KK9D 4TUOB 4Y4HD 4HUUB 2R29H 4FFWC 1T0NB 3KYAA 4OFKA 2XY1A 2ESVA 3VRJA 1RIHH 4HCRA 1IE5A 3EFDL 3T0EE 4PV9A 1VGKA 2IALB 3HR5A 2ARJA 1U8NA 2I60L 4KZEH 2DM3A 3E2HC 5MEOA 1P6AB 1G7QB 2HWZH 4IRZH 5EZOL 5IBUB 4WWKB 4QYOA 1H15A 3G5XA 3HB3D 1ZA6A 3W11D 5ICYA 4WNQB 2NY5C 5E2UH 2IAMB 4DZ8B 2C3GA 5EU5A 1QSZA 2Y06L 3JV5A 3SDXF 3VXSE 2CD0A 3T09A 1GC1C 1UM6H 3DMMA 5K59F 5F7MC 3MV9A 4U3XA 3IRZA 4RFEA 2IQ9L 1CBVH 2VKXA 4P4KC 2NLJA 3SGEH 5INDA 2PO6A 4RMSA 3HZYA 5T1LD 2D4FA 1CIDA 3H9HB 4LMQI 2EYTB 3QNYA 4M1GH 4XWOC 1OAUH 4OB5L 4EDXB 3ZLQC 4HBQA 1DLFL 3MV7A 5FYJD 3C5ZD 3F7PC 5E8DH 4JN1H 1JNNH 3E6FA 1U3HC 2DAVA 4M6OH 4IBLT 4KTEL 1EFXA 3DBXA 2HT2C 3K8KA 1J7VR 1RJZA 4LDEB 4QCIA 1MF2H 2O61A 1FO0H 1FV1A 1T1XA 2XRAL 2VITB 1NLDH 3MJ9A 2UWEB 4HS8L 4N0FB 2RFXA 4MCYA 4UTBH 3SO3C 1TZIB 4BSWA 1IAIL 4U6YA 5HVGB 2HRLA 2CQVA 1WGOA 4XMLH 4RBPK 1EO7A 3TJEH 3BKML 1TJIL 3VXRE 3V79C 1CD1B 2CH8A 3O2WL 2A73A 4AEEA 3IU3A 4GG6A 2Y5TB 4BSVB 4YXHL 3W0WE 2D31A 4QHMB 3V5DA 4R97C 5F7EL 2BXZA 5F6IB 3SJVE 3GMRA 4Z9KB 4ZXBC 1J1OH 3HKFA 2BDNH 4OCWL 1YC8A 4R3SA 1BF2A 3BKYH 4OF7A 1TITA 4Z0XB 3AXLB 2HFTA 2DI8A 2NX5D 4E5XA 2ED8A 1OPGL 1WIPA 1CVSC 4PG9A 3P4NA 1W2KT 4YDJA 5GGSY 1AXIB 4X8XA 1HH6B 4EUPB 2Y23A 5F96L 4NQCB 4KTDL 4MJ2A 1HQ4B 2R2BA 4H25B 3WJJA 4GW5A 1IT9H 4AQ1B 3MC0A 3OX8A 1CFNA 1MRFL 1UZ8B 1T03H 1H5BB 1JE6A 4BQ9A 4X80L 4PRBA 4PJ5E 5LQBH 3EOAA 4WW2C 3JXAA 5D1ZB 3O8XA 3REVA 3WS3A 4TVPH 4KVNH 2NY2C 4I18C 2P24B 3KYOA 2DQFA 3OAYH 1JNHA 4EXPX 4MJID 5CJXA 2M8XA 2DJUA 3BHBB 3LKRB 5FA4B 1PZ5A 3MNWA 4XXCC 4U1GC 4ZYKB 4KQ4H 3G6DL 4X8JB 2D7MA 5BJTA 1FVCB 3WIFB 2P7TB 2VABB 1QR1B 2GUOB 3MO1A 5I8OH 5E08H 4ZDHB 4AENB 5EOQL 1DQLL 5TF1L 1G6VK 3KJ6L 1IGFL 4WI2A 3SEPA 2FLBT 5CD5C 4Q6IA 1QLFA 4G8GE 4NSKA 2R9HD 3VFSB 2UY6A 2FX7L 4LSTL 3EO9H 5D7IE 4LEXL 4PP2B 6FABL 2L4OA 3U30B 4I4WA 1ED3B 4GBXC 4P46C 4UU9B 5BVJB 3OKMA 1E4WH 5GGVY 4TUJA 4QOKA 1AY1H 5I9QB 1EUUA 3ZTNL 4X7EC 3FO1B 3BOVA 1AI1H 5CWSA 1YEIL 5E2JA 5FO7B 3OR7A 4R90L 2Q6WB 1BP3B 4Q0XL 2XN9B 3X12A 1G7IB 4LPYA 2GJ6E 5I1JL 4NT6B 1WCQA 1YEEL 4NIKB 4Z6AT 3EYFA 3U7WL 1IGMH 2RGSA 3SGDI 3QXVA 1AR2A 2UV3A 5CP7B 3JV4A 5ANME 3HAEG 4Z0BH 5HHQB 2WWMC 2ATKB 5E2VL 1FZJA 3KHQA 5K9OB 2CIKA 1T1ZA 1N8ZB 1U93A 3SCMD 5INCB 3OMZA 3CFJA 5A2LH 3SDCB 5I8EA 1NAMH 1NCDH 1KJMA 3VWJA 2A1WH 2LVCA 1JZ4A 2J8UE 2OZ4L 5BS0B 1MHHB 3RX7A 1A22B 3FHAA 3V6BR 3LQAH 3MV8B 4KMQA 1RHFA 4UV7H 1VHPA 4KVCL 3F7YB 4IOFD 2WV3A 2YD2A 4KKLC 1MUJB 1RUPL 3WS6C 4NKIL 1L0YA 5FDWB 5IV2A 2Q3ZA 5HHVH 4P9ML 4OM0L 2C3WA 2XQBL 4UB0H 2YC1A 4JO4H 3JVGA 5BRZA 1UM5L 1RJLA 3S5LA 2Z9TA 3J7HA 4JPKH 2ADFH 5JTWA 1DQML 1HZHH 2BOCA 1SBSH 2GTWB 1JP5A 4YHKH 3QUXD 3ARGD 1B90A 3NFNA 2Z31A 4HPOL 5CINL 3AS1A 2HVJA 5CILH 2A0LD 3GHBL 2AK4E 4F58H 2QKIB 5I30L 1UG9A 1OTUD 5C1MB 4GLRH 4FQPA 5IB1A 4GG8B 1OVZA 2B2XH 3EJJX 3BH8A 3EFFA 3MLRH 3BVNB 4UQ2B 3U0PA 5D7JD 1KSRA 5KSBA 1XCQB 3RIAK 2DYPB 3NCYS 3IB4A 3GHEL 3LV3B 3O45B 2JJSA 1N59A 4MJ4A 3D2UD 1A9BB 3LKNB 1KN4L 5D7LD 1E27A 3RDTA 1EHAA 5EWIL 2PTUA 3BAEH 1LP9A 3V4VL 3ULUH 3RJDA 4G3YH 1AGCB 3Q6GH 3V0VA 3LHPH 3PHSA 3BUYB 5C0FA 3QFJE 4LLWA 4RZCA 1EEZB 1XGRB 3BDBA 4J4PD 1WQVT 5ESQA 1DLHA 3L3IA 2DL2A 3O6LH 2EDEA 4PJ8A 3MBEA 2NXYB 4YH6A 3WLBB 4WV1A 3ULUC 1OAQH 3B5HA 5DJ2B 3VFPA 4OLWH 3NOIA 4X9FA 4KKAC 4Y2DB 1K3IA 2MKWA 5F3HB 3RTQC 1T89C 5DUML 2DM2A 1KB9K 3ARVA 4NM8H 2HFGH 2PN5A 3QIWD 5F8RC 3VWKA 1RU9L 4CVXB 3P9LB 1FG2A 2EDBA 3CFBB 5DMGC 3N1GC 5CJOL 5GS1B 1R24A 4MWFB 1IC4L 1J0HA 3OB0H 3VGHA 1FH5L 1TVHB 3BP5B 4UDUA 5IFHL 2XWJA 1GCFA 4YE4H 3C5JB 3L3DA 1UACH 4JFHD 4AZ8A 4QRPD 3JWDL 3FQTB 4LARL 5GXBB 1TPXB 1KCVL 4O2FA 4N0CC 2XFXA 1ORSB 3VXSA 4JQVA 5JLZB 2QQLL 5D93B 5EU6B 3BSZL 2YN3A 4YPJA 5CSZB 1RK1B 5DRZA 2W65B 1P4BL 3BX7C 3GB7A 4OZFA 4P5TC 3UTQB 2MMXA 1UWGH 1KENH 4A2LA 4ODHL 3C09B 4BKLA 4LVOB 1GYAA 3FONA 4UNTA 4P2OB 2VDQH 5GZOC 4Q2ZB 4U1MA 5IHZA 1QVOB 2OR9H 4LPVA 1Q9KA 3GIZH 1AP2B 1GPOL 2AI0L 1SVCP 5IEHB 1XFPA 2IBBA 5JZ7D 2QSTA 1JWSA 4MDIA 3BW9A 5FYLH 5GSVB 4GRWH 25C8L 1DQJA 1WVZA 5C0IB 1YPZE 1MJJB 4QRSB 5DLML 5HYFA 1LMKA 4I0PB 4OI9A 5C0BD 4WDIB 1JFQH 3TT3L 3MRNA 4HD9A 2ADGA 3MRCB 1QLRB 1NEZA 2GK0A 3VXRA 2CRZA 3K1DA 2EH8L 1IBGL 2X4NB 1XCTA 5DSCB 3CMOL 1T66C 3PWJB 2FHBA 4HIHA 4XH2B 1A6TA 5I1EL 2NY1D 1S5IH 4HDIA 4IDJH 5HYQB 4Z7QF 1LEGA 4N8VG 3SJVA 1TJGL 4Y1AA 5I1AA 3AAZB 4Y16C 1A6VH 4NJ9H 1NANH 1RIUL 3ES6A 1KOAA 4JRXB 3QBTB 3MYJB 4BZ1H 4MQ7B 3RWJA 2J5LB 4RGMC 4ZUVA 1NMBH 3HPJA 3LKPA 1OP9A 5GGUA 1PX3A 1QSFD 4KROC 3E6HA 4QRTB 2D7QA 5EU3B 5ISZA 2EDRA 2Q3AA 1S5HA 1JWUA 1E28B 4A6YB 3UEZA 1E0OB 1MFEL 2HLFC 4KK8C 3BKJL 3AM8A 3MR9A 2ZCHL 2EDTA 3BGFB 1WFTA 5JNYB 5JXAL 5I1HL 3RUGE 3QUYB 1VACB 1NUGA 1FDLH 4EN3C 4LRNH 3EZ8A 1G9ML 5GSRA 3I85A 2CRMA 4M6MH 4CL7A 1HSBA 4CBPA 5JORB 3TO4C 4U1SA 4O4YL 1BEYH 3HG1E 3KLHD 2CIIB 5E2WH 4RQQA 3BJ91 1S7SB 1A7OL 1EV2E 2R69H 3MGAA 4J3XA 1FGNH 3S4SB 1CTNA 1JPFA 1Z3GL 3FB8A 5D1QD 2X41A 4NWTL 1BIHA 4KUZH 4GMSH 5CD3A 3J8F7 5CAYB 2HAZA 4EQ3A 3T3ME 3AROA 1R3JA 1BQHG 5F3BB 1UVQB 4UT6H 1HH9A 4G8GA 5GRJH 4E42A 3MZGB 4XWGH 3RA7L 4Y5VB 1NPUA 4ZFOB 3MMEB 3DO7A 4JZOB 1RQ5A 1D6VH 5T5FL 3GMNA 4D9RD 1GOGA 4MCZB 4Z7VA 3OGCA 5DVNA 1EIBA 2P5WD 1CCZA 3MRLA 4R7DB 2W60A 2VSCA 1HOCB 3HC4H 4DUWA 1EHNA 5ADPH 4HIXH 3BZDA 4CNIA 2XTJD 3EO0B 1MFNA 4ZAKB 3O6KH 3SPVB 1UWEH 1YEJH 3O4OB 4GRLD 3TGXA 5E9DD 3HZMB 5BXFB 2E8YA 5EU7C 4HW6A 1T7YA 3L3GB 4HIIB 4XHQA 5E99L 2V7HB 4ODSH 4OFYD 5A2FA 3BPLC 1SEBB 4OTXL 1KG0B 3D39E 1K3ZA 5A40E 3ILPA 5HD8C 2EH7L 2YD5A 4FNLH 2XWBA 2UVFA 5C0EA 3U6RA 3VXNA 3DVNA 2R0ZH 5HDQL 2NY3B 1OSZB 3CDGB 5HVHC 2H2PC 4KWUA 4HSQA 3WNMA 1A3LL 1S7VB 2D0GA 1C7TA 4P4RB 1MCDA 2ICWI 3F12B 3UTTD 2QTEA 3ULUE 5DQ9B 2CKNA 2BY1A 1F4XH 1HEZA 4C59B 4XP1L 1YMMA 5F89B 3W9EA 3TZVA 1UCBH 1F6AB 4M93B 1IC7H 2Q86A 4BQ8A 3QDJD 1DR9A 4HKXB 1YNLH 5CGYD 1LK3H 4CAGA 4YFLI 4WNQA 4I9WE 1KCLA 2VXSL 4PLOB 4YX2L 1MOEA 4CVZB 3BWUC 4YWGH 2VXVL 4AEIL 5AZEH 5IW1B 1HYRC 1RK0B 3KYKH 2EEBA 1JGEB 1R5WA 1VKXA 2Q7YB 4YC2C 4M7JH 4LCUB 5JQHC 4MA7H 1JV5B 3BQUA 3K8LA 1T7ZA 5D2LF 2X70A 5C71A 3B3IA 1OP3K 2IANB 1YYLL 4JM2F 3LEXB 5L8LB 3RVUD 2I26N 3OB8A 3TJHD 3RL1A 3T77B 1M1SA 1X6LA 4P0DA 1BD2E 4Z7VF 3X11A 2BK8A 4LSRL 1JYXA 5J6HA 4XVJL 3PXJA 2K3TA 4RISH 3QWOA 4P4KA 1MELA 1HHHA 1M05B 1HHJA 1LHZA 3PQYB 3BJLA 1SEQH 5DJCB 1BFVL 3IDNB 4K71B 4O5LL 4ZSOA 5J89A 4ZMAT 4JPVH 1F4YL 4K2UH 3DGGA 5IHUH 4EJ1C 4TNVF 3GMMA 3UZQA 1CLYH 5MENE 5IVOA 1CDJA 3OR6B 3EAKA 1C5BH 1FL6B 4RX4D 4TSCH 2DQCH 2CMRH 1PX4A 5JO5A 5JOFA 4WGWB 4L8CB 3PHQB 3RU8H 3O6FB 5IUSA 2XWTA 3RHWK 1CD1A 4XZUB 1P7KA 4IMKC 4MNHA 3QWQB 1RZIB 5IP4A 4LCIH 4IOIA 1MPAL 2BCKB 2W0KA 2BFVH 4YDLB 5I19H 3EO1B 1RZFH 1OAYH 1XGYH 3QFJA 1ZWIB 4PJAE 5FYLE 3RGVD 4Z0XA 2X4PB 1RULL 2R0LL 3CLEL 3MA9H 5T33L 3RWGB 4JHAL 2GSIB 1QPPA 1H3PH 1SYSA 4KXZH 5DJ6B 4YXKL 1WK0A 5DD0L 5ERWB 5JA9A 2OJEB 3MLWL 5H94B 1B0GB 1HQ4A 2YSSB 3QA3A 5IFJA 2QSCL 3QG6B 1J8HE 3C60C 1LGVA 5L2KA 4K07A 5IB2A 1INQB 3VXUA 5FA3A 4Z8FH 5DHYB 5KVEH 1XF4A 4MNQD 3S36H 3K74B 2E27L 4TQEH 5M94B 4RMWA 4PJDB 1TZHB 4V1DB 1MEXL 4HWEH 3SDDD 2UZIL 2I9TB 1D5IH 1MHCA 2R23A 4Q58C 4HJ0D 5C09B 2K9UA 1YEFH 5JIKA 3OAUH 4WW2A 1AGFB 3Q5YA 5H35B 3MREB 4K7PH 4PRPA 4NZUH 5DK3A 1PG7X 1FORH 1KCUH 1JGUH 3D69B 2R29L 4I18A 4X8JA 3TPKA 2P7TA 2X9XA 2UWEF 3IJHA 3W5MA 4KZEL 1LE5B 1FG9C 3X14A 4OZHE 4LSDA 1JPGB 5DFVD 3FQRB 3QCTH 3DV4B 2FIKA 5HDLA 5SWZB 2HWZL 4IRZL 4Y4KD 2ID5A 2I24N 3MRDB 5EUOB 4PUBH 1ZA3A 2A9NL 4NDMA 5F70A 3C9NA 4NNXA 4PJCB 4FFZH 4QY8B 1X5IA 4M5YH 4UU9A 5EZLA 5C6WH 3NH7H 4O51B 1FNEB 2BVOA 2XG4A 1G7PB 2VAAB 3EW3B 4MHHI 4PG2C 2V2XA 5TDPA 5FO7A 4G9FB 1ZT1A 4R4ND 1JGLH 1SJEB 3OJDA 1KLUB 4P46A 4M1GL 1JHKH 1VFUA 4JZNB 3EGSA 4APQC 2AXGB 4QRQA 1RVFH 3QDMB 1HQRB 4JN1L 4QNPF 4W68A 2CLVA 3CX5K 3MJ6A 2ZSVA 3ZYOA 5HHMB 5C8JA 3HMXH 3P2TA 4YHZH 4D3CH 2BRQA 2OTUA 4L4TE 3EDDA 1E6OL 3N9GL 5FM5O 4M62L 2WQRA 5IOPB 3STLA 3HE6A 5SWQB 5AG8A 5K9OA 4UTBL 1PJ9A 3EYUH 3S35L 5FYKL 2DQIH 2DWDB 5IM7B 3VI4E 1DVFB 1ULVA 1R5VA 5D2NB 3TJEL 5TFSH 4JQXA 1C12B 5DJXB 3MGTB 4JJ5A 3PHOA 4GAGL 1QSEB 4EEEA 5D6CB 1H8SA 3RI5F 4Q9RL 4JDZA 4HS6B 2FJFB 4JQIL 4IDLA 4LKCB 3MCG1 3IDUA 3RUGA 1J1OL 3GUTB 5HHNB 3BKYL 1N0LA 5C08E 4G43A 5F7DA 2AJZA 1SJXA 3VXTA 1XIWC 1RY7B 1VFMA 2Z92A 4RMQA 4KI1A 3KPNB 1AO7E 3GSXA 2BY0A 3T0EB 5D70L 3HG1A 3NCCB 4NO5A 4U33A 1MAJA 3WS6A 4DVBA 5I2IB 4LEOA 1CD9B 2NR6C 1I7TA 1U8OA 2FEDD 4NJAH 3SDAB 2PCPA 4FTVE 4OZIE 3NIFF 4HAFA 1BOYA 2QKIA 4ODWB 3MRMB 3ZTJG 2FCBA 3DNKA 3WD5H 3LOWA 1T22B 2FEEI 1FZMA 3BVNA 5C0CA 3O4LA 4BQBA 4PB9L 1CFSB 4L29A 1JYNA 4TVPL 2Z91B 5AUMB 3MXVH 2NXZD 4DZBB 3LV3A 4GXVH 5HYSB 2B1AH 5BZDA 2AKRA 3LKNA 3P4LA 4QXGL 4KK9C 4Y4HC 4JFQA 1CFQA 5FB8B 5FECB 3O3AA 1ZK9A 2BMKA 2EO1A 2FZ3A 1BHGA 3M07A 1A14H 4MXVE 1DN2A 2DQTH 4TTDC 4PB0H 3IAPA 5B39A 5I8OL 2APXA 3W81A 2YN5A 3RJQB 2EDFA 5ICZB 4H88H 3WNPA 3W11C 4OCYH 1TVBB 2ZOLA 5T1KA 3IU4L 1NC4D 2NY7L 3DYPA 4L4VA 3HCVB 3D39A 3EO9L 3VFTA 3WN5B 5B38G 4X4YA 5I71C 1NGPH 2ZUVA 3N1QC 5GGTH 1QTYT 3K2UH 1Z0MA 1OWRM 1TQBB 5DVKA 4PBWD 2YMXH 1E4WL 1SJHA 4YBHA 3BZFB 3GSNB 4LIQL 1DQDH 2YZ8A 4ODTL 1BVZA 2HRPH 3DV6B 3MNVA 3W0WB 5HGAA 3TNNB 4OBRA 1QRKA 1S7WA 2OX5A 1OD7A 3C5ZC 4U6HB 2AJXH 1MNUH 1PW3A 3NPSC 3QHFL 4XP9H 5TPWL 2R4RH 2IG2H 3WXWH 1JNLH 5BZWA 3L6FB 5FK9A 4NN5C 4WO4D 3REWB 1GOFA 3QCUH 2EE6A 3CU1A 5JW3H 3B83A 3FQTA 1B0WA 1N5YH 2YBRA 1YYML 4H0HB 1ORSA 3ARZA 1LO0H 5EU6A 5D1XD 1ZT7B 3R06B 4NM4L 4GS7C 2A6KB 3EYQD 5DRWA 2Z4QB 2RBLA 1NCDL 1QRND 1MCEA 4PBXA 2VLRD 4ZG1A 2A1WL 4BH8B 5AG9A 1MHPH 4K94H 4UUJA 3BPOC 2H32H 4PJ5B 4XP5H 1BD2A 3KYNA 4UV7L 5IB5B 4XCNA 1B88A 1M4KA 5C0AD 2K7PA 3QPQD 4U6VL 5DUBA 1LD9B 5BQ7A 4KK6D 1AXTH 4PLJD 4OM1H 1MJ7H 3V8OA 3CVHL 4CMHC 2ITCB 3BIAX 4K94C 4NQSB 1OF2B 1ES0B 5DD3H 3CXDH 1EZVX 5KBNC 1G7MA 1MJJA 5IVXB 5JHDB 3AREA 4UB0L 3BT2L 4UT9H 4KH2A 4I0PA 4HBCH 2ADFL 3LD8B 1HZHL 4PGJA 1JRHI 4G42B 4OUUB 4HUVA 1H9VA 1S78D 5CILL 3O9WA 1EO8H 2ADJB 4JFDE 3BISA 3KLSA 3RZCC 2ORBH 3KS0H 4WUUB 3TLRA 5D7IB 4K55A 3V4UH 3UO1L 5L8KB 2B2XL 3SE8H 3BI9X 5J6GB 5DXWA 3MSPA 5DMJB 3WV0A 3RWDB 4BFIA 4OKDA 1BX2A 2XI9A 4JRXA 1XF3B 1N26A 4LSVH 4ONOA 5ITFB 5DGRA 3VFGH 2MTPA 4I1NB 4JKKA 3T8XB 2X4RB 3ARDD 3DX9A 1OAKL 4Y16A 1UKQA 2E7LA 3MODH 3PJSA 2ADIA 2C3HA 4Y4FC 3ZDXF 2GJ6B 1PG7W 5F1NA 2V6HA 4UNUA 2YUWA 1M6OA 3KLDA 4CN4A 5MEQA 1KXTB 2GFBB 3S37X 5F7NC 1MWAH 1P2CA 3Q6GL 3VFRA 4JGJA 1B4JH 4XAKD 5ANMB 3T04D 3LHPL 1X4XA 1J8HA 2NNAA 3KNBB 2R9HC 2DIJA 2VNCA 3MLYH 4HZLA 4QHUA 4LOUC 4K3DH 2YZ1A 4XPFH 3TN0B 3RNKA 4X6EB 5J13C 4S1RH 3FT3A 5MHSD 1S9WB 2FR4A 3LH2L 4IRJD 4OLWL 4NQUA 4PR5A 1XR8A 4PD4J 1D5MB 3QCVH 7CGTA 5EO0B 1ZS8B 3Q5TA 3BWAA 4NM8L 1KIRA 4I13B 1A6ZB 3TO4A 4Z7OF 4YFEA 5C0DA 1FC1A 4KV5F 4GKZA 4NQEB 5K93A 1AGEB 3L9RA 1WEJH 1UACL 3MRKB 4WRLA 4B7LA 2DLGA 1YUHB 2CDEA 3KXFD 2Z8SA 2XXMB 4MCZA 1S9XB 1RJYB 4YAQB 4PJHB 5HJ3B 1FQ9C 3PG2A 4N9GB 4WFED 5E8NB 3SCMC 4L9LC 4R7DA 2AK4B 3MLXL 1NBYB 1WBZB 2FLRT 3BGAA 4O2EA 2F8OA 3A6CH 2P4AB 3U4EA 1RZGA 1OGTB 1GSMA 4XP6H 3M1BB 1AD0A 3MRBB 4JY4A 4IOFC 5B3JE 3T3PE 4F9LC 3AU1B 2OL3L 4FQHA 4MSWB 2DQGH 4OIAA 3RWCA 1U3HB 3PF2A 3QEQD 3LKSB 3NA9L 4K7FA 3L3JA 3GIZL 2WMPA 2JCCE 3GNML 4EI5B 3S35X 2BY2A 3T0DA 3L5JA 4G7VH 4RWYH 3DUUA 3HUJB 2D3VA 5J9PB 2MCPL 3ZKXB 4ZUTB 5DRNA 3SO3B 1JFQL 2PXYA 3QUXC 3ARGC 3F5WA 4U1LB 4XNXH 2OP4L 1OTTD 2Z35A 1L0XA 1OTUC 2PF6A 3FRUB 5DK2B 4G9DB 1DEDA 4HKXA 4R97B 1NGXA 1MI5D 2OCFD 5EOTB 1EEYB 5IMOB 5FKAA 4ZXBB 5D8JH 1XGQA 3IDIA 5FYJE 3RRQA 3Q48A 5C08A 3QIBD 1ZXQA 4R2GB 3DURB 1R5IB 2OZ4A 4NZTH 1CLOH 3HNSH 1AO7A 1U8PB 3MRPB 4MA8H 3CLFH 1G6RH 5EO9A 1ZHLA 2LVEA 1II4E 1JWMB 1U36A 5EC1A 4Y2OA 3R0MA 2HLAA 4KHTH 2QQNH 4PJIE 1QO3B 2V5TA 3GJEA 1DBJH 5A16A 5K9JH 2IPTH 1J1XH 5JQ6H 2B5IC 3T1FA 1I75A 4NGHL 3T0WA 4J4PC 5KTEL 1UQSB 1IGTB 2OI9B 1X5KA 4LRNL 4HGMA 1QA9A 5MEPA 4KRPB 4LP4A 3QR2A 3TM6A 4OGXH 4DJMA 5M95B 5TQ2L 2VLJA 2NY2B 2HH0H 1R3LA 5I6XB 1BEYL 1FL6A 1IMHC 1EVTC 3WEXA 3O2VH 2NX5E 4WFHD 3QIWC 3UBXB 3FTGA 2ESVD 4U1GB 3HNVH 4GMSL 1NGZA 3KPRA 3X17A 1RZKH 3JTSA 2BCKA 3BP4B 1P84K 4W4OC 1T21A 3MLZL 4TULH 2N56A 2CKBH 1FFNB 5DURB 5AD0B 4UT6L 1YPZB 1Q94A 5E03A 4N5UA 1ZWIA 5GRJL 4IMKA 4F3FA 2Q76A 5CUSH 4GAJL 5FKPA 1D6VL 1YECH 3ZDYF 2W9DH 4R9HA 1OTSD 1A8JH 3DMMD 1IEBB 2H45A 4GBXB 5HHOB 1NAKH 1VERA 3MV9D 4OZ4B 4XXDA 3SN6N 3HC4L 1T5WA 4R4BA 1CXFA 1FE8H 4HIXL 5ADPL 5C2BH 3DHMA 2IH3B 2PO6D 3QUZB 2XKNB 1UWEL 2Y9RT 2ILLA 4MJIE 1YEJL 3MV7D 2CXKA 3O6MH 4YO0B 4I3SH 5ACMA 5ENWB 4XVUD 1E6JH 1EFXD 3LIZH 3BZ4B 1C08A 5JZ7C 3VJ6B 4ODSL 3QXAB 1CL7L 1S9VB 2AEPH 3HR6A 2I9TA 4OLYH 3DXAA 2VDOH 2VTFA 3VGEA 2A74B 3SBWC 4CVUA 4ZUUA 3V5KB 32C2A 4ZTOH 1Q9OA 1CDUA 4KDVA 5GRVL 2R0ZL 1JGVH 1BECA 1UB6A 4P23D 4K23H 4U2YA 3ZMRA 1HI6A 4YLQT 2ZKHH 3GSUA 2YD6A 1F4XL 2IPKA 5KW9H 2NY1C 1QBLL 2Q8AL 2F15A 3ARUA 1FLTX 2VH5L 4JFXA 4JHWH 2VYRE 4YDVB 3JWOL 4KMTL 1UJ3B 1YNLL 4YZFE 5DA0B 5EUOA 5MP6H 4WTZG 3QDHA 3WLWD 1NGWB 1NAMB 4P9HC 1JPSL 1OWWA 3VG0H 3ZHDA 1FZOA 4NHUB 3FT2B 3KYKL 1OHQA 2FX8H 1VGEH 1ND0B 4MA7L 2XACC 2VAAA 4QXTA 1I7RB 4HIJA 3PABA 1G7HA 1OAZH 2NY6C 3QFDA 2CLZA 2NPLX 1KYOJ 1KLUA 1Z9MA 2AEQH 4JFDA 4JZNA 2FATH 2ZWLT 1U58B 4GKNB 1CN4A 1JPTH 5EIQA 1D9KB 1X5AA 4OKVB 4OLZL 1PQZA 2RCSL 4PG2A 4NRXB 2X1XR 4KJYB 3DLQR 2Z8WC 1U91A 4HFWB 4JY5H 3O8XD 1YJDH 3WUWA 1QFUH 1U8IB 4JPVL 4QRUA 4K2UL 2BERA 2V5SA 5IHUL 5FUZH 1CLYL 1XAUA 4MB3A 4N0YH 2VXTH 4Z5RA 3EIFA 1C5BL 4TSCL 1EX0A 2IPUG 1J0JA 2B8OT 5D1QC 5I1CH 4PJDF 4PJEE 3JWNC 5DJXA 1C12A 3U7YH 1YJDC 3U1SL 4QRRB 1D6EB 3NCBB 3QH3A 1QSEA 4P57A 2CO6B 4K3HA 2ZG1A 3UTZA 5DVLA 3U46A 1B2WH 4J12A 5FHAH 1RZFL 2VJXA 3QNXA 4NO0B 5DK0A 4OD2B 1K6QH 1ZGLP 5HBBA 1EAPA 4D0CB 4ETYA 3MA9L 4CGTA 5JPMA 3OKYA 3DVGA 1H3PL 5CCKH 4P2QB 3S4SG 2HFEB 4X5LA 1WIUA 4QOKD 5CEXB 4YGVB 5EUOF 3RTQB 5F7KC 4MB4A 1B4RA 2XTJC 4E9LA 3DSFH 4MHHG 1Z0NA 5D7LE 4QTHA 4PJCF 4GRLC 1LO3H 1RUKH 4EVNA 5AYQA 4GKOA 4AK1A 3P4MB 4O9HH 4NO3A 3HNTH 1JGDB 1ZEAL 2SEBA 3ZKQD 1R3KB 2E9IA 5EULV 4K8RD 3S36L 2GJJA 3DRTA 5AUMA 1U8QA 5EIIB 4HWEL 3QB7C 5F9DC 3RVVC 5IG7A 4JRWA 5IHLB 1IKNA 1YEFL 1I9IH 4KFZC 3OAUL 4K7PL 1INEH 2YRZA 3GKWL 4Y5YC 5ELIA 1FORL 1FNSH 2A6IB 1KCUL 4PYHA 1NUNB 4NO2B 3VWJD 1EBAA 4YK4B 3HZVA 3FT4A 3KYMB 4P5TB 2V7NA 4DKAA 5L2JA 1UM4H 2I07B 4HFUL 4JRYB 5SX5K 5EFIA 5L7XL 1D5XB 2HT4D 5GRZA 3JV6B 4K9EH 5DI8B 5HGBB 4O58H 2CDFB 4LBEB 5CGYC 1KJ2H 2CDGA 3ECBB 5HVWA 4LLQA 5DTFB 4OT1L 5MENB 2JIXB 4KC3B 4L9DA 3ZE1E 4ZUSB 3NIGE 3WE6B 1CK0H 5IMKB 4XRCA 3O2DH 4JFHE 4M5YL 4QRPE 4AQOA 4TSBL 5BRZD 1ZHBA 3HRZB 3NH7L 2A6DA 3GI9H 3PL6B 3DV6A 3RVUC 1N7MH 2XZAL 3GMQA 3JUYA 2Z31D 5IK3A 5GISH 2PKDA 1BJMA 1P9MA 4YHPA 3MFGB 4ELME 4PJAB 1RVFL 3QWRA 4GRWB 4OF0A 5C07B 4NFBA 5E6IB 5I8CB 3EKCA 1WUNT 4WEMB 3LQMA 4YHZL 1V7NL 3C5ZA 4RWHA 1W0VA 3OXSB 2LV4A 3FRPA 3VFWA 4YUEL 2FGWH 2DWEA 1Q9LA 5FUCE 3N50A 4M4PA 1ZT7A 2QEJA 3R8QA 5HTSA 4RGMB 3N85H 3FOMB 1FGVH 3RDTD 4HUXB 1G7JB 4P3DB 3NGBC 1O0VA 5HGHB 1A4KB 5TFSL 4HV8B 3ZTJH 3QPXH 3WIHA 1N6UA 1XEDA 2EDJA 3TIEB 5C0BE 3WFHB 4HKZB 2M26A 1E4XL 3SE4C 3TBWB 4X99B 3T2NH 2VQUA 3RBSA 3HPLA 4P2RB 3MROB 1TTGA 4K3JH 4PJ8D 4EN3B 3MBED 1NDMB 3WFBH 1DSFH 1IM3B 2VR9A 1OGAD 4FMFA 4M48L 5JHDA 3O3DA 4JY6B 1JF1A 5DEZA 1NSNH 1NGQH 5F72S 3LS5L 4X4XA 5KSAC 3SOBL 3IETB 4ORGB 1Q0XH 2PYEB 3IXAA 4OZHB 2GW5A 4NKOA 3E0GA 4IJ3C 3NAAH 3VWKD 2WINB 2V2WA 3KPLA 5ILTH 3H3PL 2IQAA 1QSFE 3QP3A 1X7QB 2AQ1A 5IVNA 2GI7A 3V52L 5FHBL 3V9FA 3MLTA 5JDJA 1NKOA 2Z93A 3SDDC 5HGDA 3RZCA 1B3JA 5CBAA 5KSVA 3ZL4H 2WUCH 1TENA 3G5YA 5LVEA 3I2CH 4HJ0C 2B1AL 5KS9A 2J8OA 2DRUA 2P5EA 1RUML 1A1NA 1YEKL 4LPCA 4FZ8H 3BN9C 1MCOH 3GBMH 3NZHL 4ODBD 5EO1A 3VH8B 3C08L 4LHUD 4C56A 3EOBB 4HQQH 3QHZH 4YFDB 5JW4N 2BNRD 4L4TB 2LAAA 4OZGE 1QBBA 4TNWK 4Y4FA 4Y4KC 3TBVA 1GH7A 3GIVA 3HMWL 3UYRL 4OCYL 5IW6A 2BSRB 5SWSE 4PJ9C 5CEYA 3VRLF 3TNMA 1S9YB 1CE6B 1CFVL 1NGPL 5GGTL 1F11B 2IH1B 4KJWD 5DVMA 1GGTA 1FYTD 1UYWL 2R0WH 3P0VH 2W0PA 1IAMA 5I17B 4B41A 3U2SA 5HVHB 1IGIL 1DQDL 5EO0A 2HRPL 4D9RE 4LMQE 4R4NC 3AS3A 1MCIA 1A6ZA 2P5WE 4H1LA 1X5LA 5IVXF 2AJXL 1MNUL 3RL2B 3G04B 4XP9L 2R4RL 1ZT4B 3D0VA 3NZ8B 1NC2B 2XTJE 4HGWA 3ZE0E 3S5LG 2JJUA 1OQXA 4HHAB 5DA4A 4Y1AD 5JW3L 2X4QA 4ZODA 3FO9B 2NW3A 5E9DE 1GZQB 5FCUL 2ZJSL 2VC2H 2R56L 4XNQB 2GITB 1O7VA 4LQFH 4XAWL 2EXYC 2OR7A 1LO0L 5D7IF 1H3VA 4FTVB 3FFCB 4OZIB 4ZFGL 4WENB 4YC2B 5ISZD 1NBYA 1XMWA 1OP5K 3LZFL 2X4UA 2HYMA 2X1PA 4HGKC 1ZLSH 5JUEL 4O2CB 3CGTA 2EXWD 4PRHB 4DVRH 2GSGA 4XP5L 3SCMA 3DRQB 3IKCB 3I3BA 2IBZY 4L9LA 5ID1B 1WBXA 3TBTB 2EDLA 4PY7A 4G6FD 5TGBB 3UTTE 4ZS6D 2D03H 3SY0B 3LKOA 3LN5B 2ZUTA 5IR1A 3H3BC 5I75B 4D8PB 1AXTL 1XZ0A 4EI5A 4OM1L 3KR3H 5L8JB 1I8LC 2X89D 3QDJE 5TE6L 3PWUB 2XZCH 2EIDA 3CXDL 5DD3L 4UT9L 2VZTA 5EBMB 1BFSA 1X5FA 4PJBE 4HBCL 4DUXA 5DYOA 4RFNC 2FEDC 3QI9D 4JR9H 1PYWA 4XBEH 4WU5A 2C7UB 3PGCB 5DMKA 2ORBL 1PDKA 2GTZA 2OBGA 1KB5H 4UIKH 4NNYA 3HI6H 3V4UL 4FQLH 4KMLB 2JB5H 3JV0A 5IMOA 1K8DB 5B22A 3IF1A 2NXZC 1BOGA 3OTTA 5IKCB 4LSVL 3DURA 1U8MB 5HHPB 3H2WA 2R1WB 3NFPB 1JWMA 1K5NA 3CPLA 4J1UA 1UEYA 3MODL 1FRGH 1IAII 5FGRA 1QHOA 1DFBL 1GHFH 1NFIB 3QIUA 1MY5A 4PJHF 5BV7L 4D9LH 5GS0D 3MXWH 2WK2A 2ZCLH 1B4JL 4DEPB 1OB1B 4JCLA 4KKCD 3T4AB 1S9KC 7FABH 4PRDA 2R8SH 3KPQB 3C60B 4LKXB 4OZFG 3C87A 5E5UB 4K3DL 4S2SA 4XPFL 4ZFZA 4K7PX 4S1RL 4Z7UB 3AY4C 2E6PA 5DMYA 1JHTA 4JFOA 4HWZB 3W5NA 4HUWB 5DC0A 1F2QA 4P5MB 4F7EB 4GW4B 4NQDB 5JOEA 4WWID 1MAML 4LLMB 1A6PA 3V6OC 3UBXA 3ISWA 3QJHB 4R4FH 5E00A 1AGDA 2X9WA 4ELKB 2UVEA 1J88A 4Z95H 4HIEB 1YMMD 3HUJF 5DGQA 1ZKAA 5D72L 1WSST 5IESH 3TZVD 2VE6B 4MZ3A 2DTMH 4WO4C 4Q97A 4G6JH 3BPCA 3RAJH 2EYRB 1WEJL 1ZGLB 2C4FT 4PIRF 4NRZA 1M7XA 1UZ6F 2R1XB 1QQDB 2PW1A 1W72A 3D9AH 3ARFB 1T4KB 5A3ID 3H7BA 5GGVH 5D1XC 2VZ3A 2FO4A 3VXMB 4MNQE 4GSDH 5HHOA 1NCWH 1NMAH 3EYQC 4DW2L 3OJ2C 3BQUD 2B7DT 1SM3L 1A1OA 3CH1B 3MUGB 2A83B 2IH3A 2V2TB 3UROR 3GMPA 5AEAA 3A6CL 1S3KL 1WWWX 3QZWA 1KT2A 1UA6H 4LSUH 3QPQC 4KU1A 1PKOA 4CJ0A 4MXQD 3TV3L 4KK6C 1EK3A 4WHYH 2HJFA 4C55A 3DVIA 2EKSA 4AMKH 2X4TB 3I3DA 4BH7A 2F54A 4RGND 4G7VL 1PEWA 4ZNEA 1HN1A 1CF8H 5DJ0B 1DTUA 1CG9A 2HT2D 4NQXA 1WC7B 5HI3D 3MX0A 5ADOH 1J8KA 1QFWI 1S78C 2W9EL 4XNXL 4LQ1A 3TWCL 3EJZD 4I3GA 3I84A 2BVQA 1U95B 3RWHB 2RAMA 4UDTB 2ICWJ 2Q8BH 4R7NB 3PXHA 3K0WA 3MGOB 4WI8A 5E8OB 5I18L 4Z7NE 3F58H 4HG4J 3UX9B 4X6DA 1BZQK 3AUVA 1XGUB 1RUAL 4OV6F 1BGXL 1XH3B 3H42H 4I2XA 1XIWB 4QF1B 1CLOL 2GHWB 3ARDC 3HNSL 1AHWA 4HLZH 2YD9A 1ZTXH 1YPZF 1EHXA 2J6EH 2F74A 3KPOB 2R39A 4Y7MA 2GAZA 2ATPB 1MRDL 4QO1A 3HLAB 4L5FH 3IJSA 3CVHA 1A1MA 1DBJL 2QQQA 5EBLB 1G7LB 2AXFA 3TVMB 1J1XL 5JQ6L 4JM4H 5L2KD 2ZG2A 3VXUD 1ZHKA 4X5WB 4UQ3B 1ZSDB 1T1WA 2H9GB 4OGXL 2XA8H 1S7XB 4OFPA 1U8IA 4HX1B 4YBLC 4IRJC 5BMFL 1FL3B 5JHLL 4MAUL 5CIPH 3IDJA 1MLCB 2J1KA 2HH0L 3T4YB 3HRPA 1RHHA 3HHRB 2XKSA 4XCEB 1KCSH 4PRPD 1CXIA 3MLUH 5KVDL 2X4SB 4Y4HB 1AKJA 4I3RL 2KQMA 2AXJA 1S7UB 2QHLA 1FIEA 4V2CB 2YXMA 4QRRA 5DR5L 5F7HA 4LCCC 1A6UL 1RZKL 1RZJC 1H0DA 2JCCB 5EOCJ 3P73B 3SKNB 3WFDL 4OF6A 3Q3GB 5D1QA 5HPMA 1I7UA 4JPIA 2EYSB 1HYSD 4KY1H 5SWSA 1HXMA 2AS5M 43C9A 1N6QH 1LO4H 2NMSA 4HJJL 3INUH 2BC4B 1WAAA 1VADA 1JZ3A 1T5XA 1CQYA 1YECL 4KQ3H 3SKOB 4NN7C 1GGBL 2XTLA 2UY7A 4P2QA 5J4MA 4P59H 5I1GL 4YGVA 4U7SA 1V3KA 4HZAA 1FE8L 1W8NA 5C2BL 2D7TH 1I7ZB 1I1AB 5EOCH 1QFHA 1G0XA 5T1LB 3HAEB 2YPKB 3EDFA 5TH2A 4P46D 3ROLA 1F13A 3TESA 2XN9D 1UH3A 4L8SA 1C5CH 5C70A 1MH5A 1SMAA 5A43C 3GSOB 1LO5A 3NPSB 1S7QA 3P4MA 1E6JL 3LIZL 5FDYA 5LGJB 1F6LL 4KGLA 1DQQA 3I6GB 5CEZD 4PRIA 1T1YB 2DLFH 2AEPL 4J6RH 4GRLA 4JFEA 4OLYL 5E9DA 2A2QT 3HE6D 3QUML 4JREC 4YQXL 3I6KB 3CVIH 4PJIB 1R0AL 4JFPA 1MFCH 5A2JH 3SDCD 4GS7B 4X0KB 2A6IA 2XG5A 4K23L 1OTTC 3CFIC 4NO2A 5FUOH 3DROB 5TDOB 4U1IB 5KSUB 2ZKHL 3I9GH 2I9LA 2I07A 4L4JA 2FB4L 2NY0C 4GJTB 3S34H 3X3GL 3BPOB 5KW9L 1A0QL 1U8HA 2VLKB 4JHWL 5I73B 1I8KB 4M9PA 5GJSL 2FBJH 3BYTA 3UTTA 2N4IA 4R0LB 1T0MB 5LAXB 4FZEH 4MA1B 5DD5H 3QIBC 2H6PB 3KWWB 2UUDK 4G7YH 3MLSL 3QDJA 1N2RA 2NX5B 3C5SB 3ZYIA 1FYHB 4FQQB 2H32B 1CE1H 3ZO0A 2WBJB 5BCAA 5HPOA 3FN0L 2OL3A 4XPAH 2VLMD 1WAAF 2P8MB 4MJ5A 4L8BB 5ACZB 4WEBH 3ULUF 1FL5A 4EBQH 2WW8A 5IHBA 3KLAB 2JK5B 3WFEH 1QRNE 4J8RA 1KPVB 2VLRE 4FMKA 1FVEB 3MRQA 5GRUH 1ZLUK 3L5XH 4HCRH 5LCVH 5C0CD 1P4LA 3O4LD 5K33A 4JY5L 3ULSB 2AV7B 3N1PC 4F80A 1QFUL 3TYFB 1EXUA 4IRSB 4IIQA 5C0AE 2YWZA 2GCYB 2HJLB 5CJ8A 2FL5B 3VFUA 3TBSB 1MIEL 5FUZL 1F58H 1KEGH 3IFOB 4N0YL 4HT1H 1KJ3H 4MJIB 4ZTPH 2G2RB 3QEHB 4WJ5A 3BDYH 3CFCL 2ZPKL 5GRYA 3B2VL 3OPZH 3U7YL 3FOLA 4N0UA 4ERSH 1CFTB 1P1ZA 3JZ7A 2XPGB 5B8CA 2E6QA 4WFGD 1B2WL 4ZOEA 3TBWA 5GZND 1QNZH 1BMGA 5T1KD 3WHXB 5BV7C 4L4VD 4MVBD 2IF7A 5K9KA 3B6SB 3NCJH 5EBWB 4U0RC 1EMTH 1NCBH 3LRGA 3ULVH 1CU4H 1J9CT 2PW2B 3DARA 2UZYB 1OTSC 5J13B 1IRAY 3SE4A 3DMMC 4L1DA 3CUPA 5FAAA 1MWAB 3PWNB 4OD3H 1U8LB 4BZ2H 5CMAA 4UTAH 2PO6C 5D5MA 4M7KH 1CI5A 3MJ9H 1CDBA 3FFDA 3BZEA 3O41A 5KSAA 1RUKL 2WWKO 3OKDB 3LY6A 4XVUC 4LGRB 3FKUS 4WW1A 3LPGA 1MVUB 3HNTL 4J3WA 1KELL 3TPUB 1EBPA 4XNMA 1I85C 5JPNA 4YPGB 4XAKE 4PJAF 3PWVB 1GGUA 2Y36H 4GRWF 1UXSB 1EEQA 5EU6D 1I9IL 5F9OL 3HE7A 3NFSH 4YNYB 4P23C 3VA6A 1S8DB 3I02B 1INEL 5B4MD 5MHSE 1FIGH 1QHPA 4Z7WE 3IDGB 5GS2D 4OIBA 2WM0A 3D3VA 2G75B 3QQ3B 4K9EL 5DD6B 1FFRA 4BA8A 2BSSB 5IT2H 3AVEA 2ENYA 1KJ2L 4C4KO 1PSKH 5E4EB 3LN4B 4GQPH 2X2YA 3WLWC 4GAYB 3GMLB 2IFGA 3D85A 1A5FH 4JG0H 2DQUH 4MXWH 2YK1L 1CXLA 5DDHB 1KTDB 1KCRH 3KG5A 1DE4A 1CK0L 1KPUA 3CC5B 5GZOD 4Y4KA 4PJEB 3O2DL 4JZJC 3ARED 3TCLB 2VOTA 4I0PD 4Z77A 5I66A 2XOTA 4PJ9A 3KXFE 2PTTB 4M6NH 4W6WB 1A9EB 3QUXB 3ARGB 4NP4L 1P6FA 1BVKB 5AZ2H 3W39B 3WJJC 4WFEE 3SE9H 3SGJC 4ISVB 4D0DA 3O9WD 3GSQB 4N68A 2OXGA 2DQJL 2ZSWA 1NC2A 2F53B 3T08A 3BDXA 4MJ6B 3QQ4B 4OZHF 5HY9A 3O8XC 3TBYB 4HK3N 5D7JB 3K3QA 4JDTL 3VGAB 2HG5A 4H8WC 4HF5H 4JCMA 4JRXD 2GITA 5IQ7H 3QEQE 4MD4B 3U4BL 5LGHH 4U1NA 3FFCA 5D7LB 2F5AL 1JK8B 1WZ1L 3N85L 4Y16D 3FB5B 3QXDB 4YR6A 1MRCH 3IKKA 2DLTA 4P5KB 4PRHA 3OKEA 1Z5LB 3QPXL 4R26H 1T7VA 5GIRB 1HSAB 4J7RA 5KN5B 5GPRA 1KPRB 2QR0A 3TBTA 5EBGA 1J8HD 1I3UA 3MRIA 2B5IB 4CW1B 1G6RB 2R2EB 1BM3H 3JBG7 4D8PA 3T2NL 1S7TA 4MA3B 2EZ0D 2JJTA 4F33A 4KHXL 2BVTA 2DQEH 2MHAA 5DJYB 1LDPL 4NCC1 1MI5E 1JZ5A 1NSNL 1NGQL 1T80A 1XR9B 2PYFB 1NEUA 1A2YB 2AV1A 3HI5H 2E9WA 3NPZB 2R0KH 5SV3A 4WHDA 4K8RH 5E6YA 4AYFA 2YEZA 4FQXB 1IQDB 4JO1H 4MB5A 3NAAL 3QIWB 1A7PL 1U3YA 4OLUH 3VI4F 5ILTL 4PJXA 1XF5B 2HN7B 2FD6H 5I1LB 2OTPA 4L3CA 2V9RA 2BVEA 2I5YH 2AJUL 2KDGA 4K8RC 5TJWK 3D0LB 4QRPB 2Z8RA 5SX4I 3C6SB 4RDQF 1BZ7A 1DANU 1I4FA 3I2CL 3STZA 4NC2B 4XCYB 2R1WA 4HWBA 5TDNB 2EDOA 4JGMA 3MLVH 1YNTA 4DFIA 3PUCA 4JVWA 5SX5H 2Z0BA 4FZ8L 5JDSB 1V8HA 3FQXA 4PTUA 5EPMB 4ELMB 2WIMA 1JRHH 5F9WC 4M61A 1KFAL 2CKBB 4YBQD 3VWJC 4XPTH 5FYKU 5J0BA 1CGSH 1CGXA 1NFIA 1DBMH 4M5ZH 5JW5B 3QHZL 3GJFA 4N8CH 4JO2H 4OZIF 4WFHE 1B6DA 2MNUA 1I8MB 4OJFH 2ESVE 1N3NB 2KUTA 3KPQA 4BFGA 2QADB 3PGDB 1L7IH 4AIZA 2O93L 1U3ZA 2A77H 4N9OB 3B9VA 1IJ9A 1F5WA 3B9KB 4Z7UA 2KL6A 5ESAB 3JVGC 3NIDF 2XXCB 1NC4A 4YHMH 3DECA 4RIRB 3WUZA 4UNVA 4G8FB 2CGRH 1JL8A 4NQDA 4NKDB 5C0BB 4PTTA 4LLMA 4OCSH 1XGPA 2PXYD 3OHXB 2Z31C 5GGRY 5FXCH 3GSWA 4ELKA 1P5VA 5FO9A 4OUOA 3RKPA 4HIEA 4PJFB 5I8KH 2BHUA 3MV9E 5L6YH 2VE6A 2F9BT 1AE6H 1JBJA 2DKUA 1MCJA 1LEIB 4MXVF 3V6OA 4K3GA 3BMWA 1WZMA 4KKBD 1IFHH 3QG7H 2E7BA 4OCXL 3GSRB 3U36B 3Q6FA 5IEKB 2O5ZH 3MV7E 1B9ZA 4RA0C 4NOFA 4XHJD 3RWIA 1I8IA 1PEZA 2EC9U 2N1KA 5CP3A 2VC2L 4HXAH 1MSPA 3MOBH 4LQFL 4WO4A 3MJ7B 1FFOA 1UXWA 1QACA 3G5ZA 4PRAA 1PZUB 5CHNB 5DD1H 3IFLH 4F7TA 3MOAH 3LS4H 3IXTA 3RDTC 1QSFB 1CGTA 1IM9A 1I1YA 3NN8B 2IAND 2V2TA 4PGEA 1ZLSL 2BVUA 3L3KB 3QYCA 4DCQB 4DVRL 2J88L 4JHZA 3CDCA 2C3XA 5GGRB 4JFFA 2EC9T 4BQCA 5FM4A 2YD1A 3RIFK 3V5HA 4S1SH 2UYLA 4GG6E 4PJ8C 3MBEC 1ACZA 2NYYD 1IAKA 3HC3L 5H2BB 4WV1C 2VLJD 3RVWD 4XBGB 5DJ0A 1ZLWK 3LMJH 1R6VA 1MLBB 4GXUM 4LVNB 1NCTA 4KAQH 2C3VB 2J12B 1MJUH 5IVZA 4X5XA 4ONHB 5GJTL 4JR9L 4OZGB 3UJJH 4MQSB 4Z7UF 2AK1H 3PWPB 1RUQH 3KPRD 3ARBA 3P4OB 2WANA 2D0HA 1YC7A 2P1YA 3GGWA 4LFHD 5EB9A 4OZFH 1JZ6A 1Z2KA 3P77B 1G9NH 3G6AA 4LSSH 4EIZC 4G8IA 4F8QA 1HHIB 2JB5L 2Y07H 3PV6B 4M7ZC 5IF0B 3TO2A 4UIMB 4NOBA 1AXSB 1J1PH 4X83A 1S7RB 5J11C 3T2OA 2H8PA 3ROOB 1KLGB 2P5WB 1N64H 3DX7B 3EOTH 1IGCH 1G9NC 2VLLB 4A2MA 1M7DB 3QDGB 5ABDE 5D96B 8FABB 5J57B 3DIFB 2XTJB 3IGAB 1WIOA 5FOJA 3LAFA 3O81A 3DO3A 4H5SB 4D9LL 4ETQA 1WF5A 2ZCLL 1IGJB 2WLYA 1Y0LA 3V7AE 4NYLA 2AQ3A 2OSLB 4R96B 2VIRB 5FGCE 3RPIB 1DBKL 2K7QA 5DFWH 3G08A 2A6JB 4PJ7A 4YGAB 1U8JB 1S7XA 2VXQH 3DXAD 4HX1A 4KJWC 4L3EA 4XVTH 3FB6B 3VRIB 3OQ3B 4FFYL 4F7MB 5E8EB 1JZ8A 1C5DB 1I9JH 5J1SC 2YUVA 1FFPA 3N1FC 4ZPTA 3VH8G 1T20B 4FABH 4Y5YB 1WBYA 3WFCH 4OV5A 1Q1JH 4R4FL 4X6CA 3GSVB 4TN9A 4MNGB 4Z95L 4QOKE 3BIKB 5IGXH 5HHXH 2DTML 3S88H 1SY6A 4G6JL 4F7CA 4MLIA 3RAJL 1ORQB 1B0RA 5CZXC 5HYIA 3UBXI 4XPHH 3N1MC 2P8PB 5J1AB 3TIDB 1YNKL 1KNOB 1Q0YL 4PJBB 3FQUA 2Q20A 4PS4H 5D9SA 5E2TH 5DT1H 1OP5H 2X44D 1C7SA 3L7FB 4LCWB 3EJYD 5GGVL 2X4OA 3U4AA 2OTWA 2IADA 4IMLB 4FXKB 3VGDA 1F3JB 1TJHL 4HH9B 5FOBA 2JB6B 3OL2A 1W0WA 1KJ2B 1I7ZA 4LRIA 2VL4A 2EXWC 3CDYA 1MFDH 3HAEA 5ID0A 4X98B 2WSKA 1R3HB 1UA6L 4LLVA 1YN6A 1HXYA 4LSUL 2E7HA 4ZS6C 3MFFA 1DDHB 4LLYB 4YEFA 4LNRB 3WL9B 4XBPA 5ETUB 3UZVB 2H41A 5F1KC 2NW2B 3WO3B 3ESUF 3MJ8B 4HK0B 2FJGB 5ADOL 1NL0L 3QI9C 4X0KA 4HS3B 1EHLL 1NLBL 4YDKL 4NKMB 5KOVC 1HE7A 2CK0H 1QEWA 4U1KA 5BRZE 1BLNB 3D18B 3RVXD 1QSED 1AJ7H 3V0WH 3BH9A 2J4WH 3L3OB 3H9SB 2HJKB 9CGTA 4M7LL 1KCKA 2Q8BL 1WV7T 3CD4A 5ICXA 3P9MB 3A67H 5T3XD 3A6BL 2NTFA 3F58L 2RR3A 2C9AA 1CD0A 3RGVB 4X6CF 3SDXA 1V05A 2VDKH 5GS0H 4JGUA 4U31A 3UTSB 3H42L 2BNQA 2JCCF 3C5SA 2DDQL 3QJFB 5KJRH 1KEMH 2AJSH 3RNQB 4PLNC 2CJUH 4LCYB 2WBJA 2VQ1A 3S96B 1ZTXL 4XX1E 2J8HA 2J6EL 1ODAA 3ZDZF 3RPKA 2QJDA 1AQDB 2EDQA 5DC9B 4L5FL 2C4XA 5EZJA 5GS0C 4WCYH 1LNUA 4KKCC 2OQJA 3VXOB 2DN7A 2JK5A 1YA5A 3ARTA 5KANI 3VXPB 1YEGH 1LP9E 4MNQB 5TE7H 3V6FA 4DUVA 2XA8L 5F93C 3SDDB 4Q9BA 5IB4A 2HJLA 5DEFB 1LILA 4QGYA 4DOHE 4JAMA 1T04B 1JNJA 3IFOA 4HJGB 5GHWH 3VFVB 2R15A 1KCSL 3EYSH 3MLUL 2G2RA 3G6JB 1OGAE 1T83A 4WUKH 4XMKL 5DEGB 4ZPVA 5B38B 2NQCA 2APFA 2EIZA 1MCCA 4NRYB 4Z7QE 3TZVC 3B8SA 2NY5H 4PJIF 5EN2B 1L7TH 4GLRI 4ODVL 3L3HB 4QHLA 4QTIH 2HKFL 5EC2B 5JW4R 5F7FA 2VWEC 3EYOB 3V4PH 4OD1L 2IAMC 2IMMA 3OZ9H 4JLRB 1IC5H 1NBZB 3UDWC 4YHNB 1Q9WA 3HZKA 1GC1H 4TTDD 1E4JA 1VEOA 5A3IC 1OM3H 2BRRH 1GGCH 4XGZB 1PD6A 2R2HA 3BQUC 4U6TA 5F44A 4P59L 1HHKA 4CW1A 4LLDB 1OAXL 2D7TL 2V17H 5EOCL 4U05A 1LE9A 5F88B 3I50H 2HTKD 3OKNA 2J7LA 4JANB 1C5CL 5E0QA 3QWRD 1AD9A 2AJ3A 3BEVB 1CICA 2W9LA 4MXQC 4IHOB 5IB3B 2P45B 4KUCF 5I1DB 5JIHA 3MQIA 2XQYK 1DUYB 5F7UA 4RGNC 2BNRE 1T7XA 1QZ1A 2H1PH 5DHVA 5C6TL 1KGCE 5HI3C 1BPVA 3S3JA 4GOSA 1HDMB 1I85A 3DX6B 1K8IA 1VFBA 3EJZC 5MI0C 1NCAH 4LU5H 1U6AL 3PWLB 1FYTE 3I9GL 3K80A 3VCLB 2JELH 4XNYL 3S34L 3GI8H 3QNZB 5E6ZA 3HI1A 1KN2H 4P23A 3PE9A 3F7RA 2FBJL 2YUXA 2YXFA 1DUZA 3DJ9A 4S1QH 3R1GH 3Q0HA 3KGRA 4JN2B 3KPPA 4I5BA 3U9UB 3LCYA 1OARH 2DB8A 3OXRB 5GGQH 1A7RL 1J0YA 3VFNB 2OK0H 5JHDD 4A6YL 4Y1AE 1CE1L 4KKNA 1RAMA 1F3RB 4N8VA 1I1FA 4PGBA 4WHTB 3UJIL 4XPAL 3TFKD 4GW1A 1HILB 4ZQKB 5E95B 4HC1A 4RFNB 5CJQH 1REIA 1BVKA 4OQTL 3OKKB 4JZJA 3F8UB 4OF5A 3EYVB 4NUJA 4WEBL 5KVFH 4J3OC 5ISZE 4WUUD 4ODUB 3BP7B 4PLKD 2F53A 1PKQE 1CYGA 5GRUL 2F19H 1A6AA 3L5XL 4HCRL 5D1ZC 4PREB 5FIEA 5LCVL 5T1MB 3SGJA 2PR4L 1NMCC 3VE0A 3GBNL 1QBML 4HKJB 4KI5F 4YZFF 3RZCD 2A9ML 2NXZB 4X4ZA 4Y8AA 3QO1B 3UPRA 2VRAA 1NFDB 5C0GB 1F58L 1KEGL 2P5ED 1YN7B 4G6KH 4HT1L 1BFTA 4ZTPL 2COQA 3GDBA 5IIEA 1KB5B 3H0TB 4HMDA 4IOSD 5JR1H 4Z78A 1MVFA 5HYJA 4PJGB 3HS0A 4IS6B 4AM0B 4ERSL 4LASL 4C56D 4YHYB 4KZDH 3MRJA 5DHXB 4ZFOL 4LLUA 4MX7A 4ODXB 4Q9CA 1FC2D 1IGYA 2YKLL 4Y4FD 3HC0B 1HYSC 5C3LD 5AYUH 2ICEB 5GGSB 1A7QL 4Q9QL 3RWFB 2EE3A 3MCKB 3G5VB 4J2XA 1EMTL 3ULVL 4WI6A 1CU4L 1A3QA 4U7KA 3U30C 1Z9SA 4CVWA 5C86A 5CJBA 4E41B 1A2YA 1BQHA 5CEZH 4LOUD 1HINH 2ZNWA 3C6LB 5GRXG 3P0YL 3QDAA 4FQXA 1FN4B 3D25A 1DEEA 3FB7B 4NZRL 4C58B 4Z7VE 3ARRA 4M7KL 2EC8A 3T65B 1UENA 3MA7B 4AIOA 3VD3A 1U2CA 5DF0A 5L88H 3AS2A 4M6AA 1GAFL 1KTRL 3MRFA 4FQCH 4PJEF 2G5BA 3BE1L 4LVHB 4NQED 1I3RA 2XNAB 4Y5XA 1UWXK 2FWOB 3CX2A 4M8QB 1JPST 4PP1C 3NCFB 3BKCH 1BAFL 3LKQA 3CFEB 4NPYA 3I75B 4PYGA 4C57C 3HE6C 1NGYA 1D5ZA 2ZCKH 5TDNA 4PRNA 3TH2T 1BFOA 3RX5A 3QUKA 2Y1VA 5JDSA 4LL9A 3SDCC 35C8H 4YDIL 4JO3H 3BEWA 1BQLL 1QRNB 4MD0B 2VLRB 4JQXC 4LP5A 3O0RH 3U83A 4PD4K 3VD9A 1U8KB 2UUDH 2IFFL 5D7SL 5DQJA 2XQYG 4QHNA 4NUGH 3RIAF 4HEME 1ZVYA 4HMCA 5C0AB 1IILE 1PSKL 4ZD3L 1WCBA 2ZG3A 1YMME 4EI5D 2Y25A 4JG0L 4MXWL 3AMLA 1KCRL 1GIGL 5EIVA 1AIFB 3VW3H 5BVPL 1CDYA 1JMZA 4U1HA 2DOCA 2VWEE 1NQBA 4DN3L 2CLRB 1SYVA 4YIQB 3CFKB 1TCRB 5DRXA 1ZVSB 4M6NL 1ETZB 3U0TA 3PDOA 5E94B 4LVEA 3SE9L 1K4DA 1ZLUH 4PJFA 1KV3A 5DJDA 4BUHA 2BJMH 4LSPH 4EI6B 1Z9LA 3QUMA 4HKBA 1R3IH 1QFWM 4E0RB 4WTWA 4FQJH 4MD5B 2ARJQ 4KTYA 3QEUB 3U36A 5FYKD 1UT9A 4M03A 3VI3E 3CZFB 4HF5L 1CL7I 3LRSA 3QO0A 4R2GD 3MUZ1 5IQ7L 2W0FA 3ZE1F 3AS0A 3BO8A 1F4WH 5IBTH 1I1CA 2VO5A 3ARDB 2FSEB 5A2IH 15C8H 2B4CC 2BVPA 4ZSOE 4RGNE 2JKXA 1MRCL 2UWEE 2MWCA 1JN6B 5IJVA 2VISB 1UKTA 3RWEB 5EU4B 3QIUD 4R26L 3CSYB 1IEAB 5IMLB 1OCWL 2I27N 1TMCB 4KGJA 5GZNC 2YPLA 4ELMF 1X9QA 4PFEA 3O3EB 4MVBC 1K2DB 1BM3L 4PGCB 2E9BA 1DL7L 3C8KA 1NBVH 1MREH 2ICWB 4BFBD 2DQDL 2DQEL 3MV01 2GQHA 4TUKL 4Z7WB 2ZOKB 4Y2DC 2FJHB 2OJZH 3T0VA 3NABH 5DJ8A 3NCMA 3RBGA 4JO1L 1RPQA 1OGAA 2YD4A 1F8TH 3VA2C 43CAB 4POUB 3PWPA 4QNPE 3AB0B 4WI7A 4TVPD 3P4OA 1NH6A 3FQWB 3V95A 5C9JA 3NA4A 3EUUA 2QQKL 5DS8B 3H9YA 3IDXH 4NQCE 5CIPB 3KPSA 2I5YL 1HHIA 4X6BA 5GS2H 4OCMC 3KXFB 4JJHA 4PJFF 1AGBA 5L2KE 5E5RB 3GMOA 3QAZC 3VXUE 5KG9B 3MLVL 5HHOD 4NN7B 1M7IB 3LDBC 2VN7A 5B4MC 2E7MA 4UMGA 2BOBA 3T0XA 2IQ9H 3X3FL 5DJAB 3FO2A 1FLRH 4JDVB 1J0IA 3C09C 1D5BA 1LK2B 1CGSL 2HVKA 3IGAA 4AH2A 1DBML 4LVOC 1JUFA 1CS6A 4F2MA 4PRPE 1DLFH 5E1AB 3B9AA 3FCTA 3M17B 3IJYA 3KDMB 4KTEH 3QRGL 2YD8A 4OJFL 3QEQB 4NBZB 4X7TA 2R1YA 1L7IL 4CKVX 1LEKA 1YDPA 4LHUA 1MHEA 2BNRA 3MNZA 2F54D 2D7NA 1YMHA 4FXGB 5F97E 4CN1A 1Y18B 3AREC 3B9DA 3FB6A 1BZ9A 4I0PC 5JA8B 1IL1B 4YHML 3BP6B 4JREB 3W9DA 1YEDB 2WIIA 3OAZK 1JZ2A 4KXZI 5MERB 1FNLA 3JTTB 1FYTA 3FQNB 1TJIH 3V6ZA 3O9WC 1MJ8L 4GRMB 2FYYA 3NTCL 4MAYB 3L7EB 1KLFA 4RNRA 5I8KL 5IBLD 5L6YL 5C92A 4YXHH 1FZKA 2BSTA 3O11B 5F7EH 1CZ8L 1P7QA 2BNUA 1MI5B 4OZGF 3IFPB 4OCWH 1AQKL 1ZHNA 5GQBA 2X1QA 2XN9E 2O5ZL 1J05B 2DBLL 3QIBB 3ABZA 3L5IA 5CLWA 2L7UA 1A4JB 1J87A 4HXAL 2J5LC 3MOBL 3TH4T 2GT9A 2X7LA 3PIQB 5CEZE 2YWYA 1OPGH 4IMLA 5GS3A 1F3JA 5DD1L 4AL8L 3DUSA 1C1EL 3LS4L 1KJVB 3MOAL 2E7LC 4HH9A 1G1YA 1K4CA 5I76B 1D7FA 4DTGH 5E8PB 2MSPA 4OIIL 3C2AL 3DX8A 5C0JB 1N5AB 3BGFC 1MRFH 3UTOA 2VL5B 3DWTA 4NWUH 1D9KD 2CRIA 5HSFA 2EDNA 1XGTB 1PKQA 3WL9A 3DI2B 4S1SL 5EUKB 5FO8B 2NY6D 1KIPB 4ONGH 1V3JA 3DTXA 2EZ0C 3TT1H 4OBSA 1U92A 2GJZB 3ZE0F 1ZGLM 4YHIB 4BK5A 4D9QD 4G80A 4AT6A 4X7DC 4QXUH 4U7MA 4Y19B 2X89A 1AKJD 3UJJL 1INDH 4LF3A 2ESVB 2C1OA 3VRJB 5D71L 5KOMC 3UCRA 4QRRD 3UZEA 3B43A 4PV9B 1BLNA 2AK1L 1VGKB 3CSGA 1RUQL 3HR5B 5EORH 2ARJB 3VFOA 5KVGL 1U8NB 4YHLL 4X4MA 5EOQH 2VLME 3QI9A 2LTQB 1IGFH 4QYOB 1H15B 3G5XB 2H26A 4GH7B 2Y07L 3S6CA 1ZA6B 4Y5VC 5SWSD 1KYOK 4QXWA 2FX7H 4LSTH 4PBVC 2G9HA 4OCRL 1DN0A 4LEXH 1MFAH 6FABH 3RNQA 2P8LA 5C0CE 3O4LE 5D2LA 4P2QD 3DMMB 1N64L 3EOTL 4JM2A 4YBQC 2Y7QA 4RFEB 3ZTNH 1QFWH 3LQZA 1RIVL 2NLJB 2D9QB 4PJBF 1KXVC 5F9JA 3OKOA 5INDB 1ONQA 3HZYB 3D87B 3O4OC 4JFZH 2WUBH 3QNYB 1VFOA 3BXNA 4J3UA 1Y6KR 3MV7B 4B53A 3MTRA 2IGFH 3E6FB 1IARB 3VXQA 1FBIH 1YEEH 1EFXB 1E4XI 3L5WA 3DBXB 1IAOA 3U7WH 1BVLA 4PRID 4RFOH 1RJZB 2DMCA 1MCFA 5KVMC 1GJIA 4QCIB 2ICCA 4JFED