4XB1A

Hyperthermophilic archaeal homoserine dehydrogenase in complex with nadph
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
319
structure length
319
Chain Sequence
MKVNISIFGFGTVGRALAEIIAEKSRIFGVELNVISITDRSGTIWGDFDLLEAKEVKESTGKLSNIGDYEVYNFSPQELVEEVKPNILVDVSSWDEAHEMYKVALGEGISVVTSNKPPIANYYDELMNLAKENNAGIFFESTVMAGTPIIGVLRENLLGENIKRIDAVVNASTTFILTKMSEGKTLDDAIEEAKSLGILEEDPSKDIDGIDAYYKAKILHWVSYGEPPEEEERLGIREVRDARNVRLVAQVSKGKISVKPRKLSSDNPLLVEGVQNAAVIRTNNLGEVILKGPGGGGRVTASGVFTDIIKATLKFPNLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of a Hyperthermophilic Archaeal Homoserine Dehydrogenase Suggest a Novel Cofactor Binding Mode for Oxidoreductases
doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Oxidoreductase
molecule keywords 319aa long hypothetical homoserine dehydrogenase
total genus 107
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4xb1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xb1A01
4RPJA 1FJHA 2X58A 2ZCUA 4HV4A 3ZNPA 1RPNA 3QWFA 5IF3A 4XYGA 4M1QA 5T6BA 4DPKA 3JQAD 3P7MA 3DZIA 5IFLA 3GY0A 1XQ6A 3PP8A 1ARZA 3ZNQA 2TMDA 4CMAA 1KVTA 3PK0A 1UXHA 1HETA 3ZN2A 3MJTA 4FCCA 2SCUA 3AK4A 2DBRA 3ZHZA 2Y0EA 4BO4A 2ZJ1A 2WE7A 2LDXA 2NVUB 1NPTO 4BO6A 3H5AA 5I8WA 1EBUA 3H5RA 3VZSA 2GO1A 4Z0HO 3NTRA 3MJEA 4WNIA 1LLUA 5I7EA 3IC5A 4NDNE 1GZ4A 4YXFA 4R4JA 2AA3A 3DDNA 3GMDA 4XQGA 1DIAA 1M67A 1EVJA 1V3UA 2V65A 1MG5A 2OMEA 3LZ6A 4P4NA 3RJ9A 1X13A 4BMVA 2EGHA 3DXFA 1I2ZA 1UZNA 3RWBA 1NFQA 5EQFA 4JBHA 2VNAA 3WIDA 4NBWA 1EMDA 4UVIA 3JQ8B 2HRBA 1B0AA 3H6KA 5ICSA 1B7GO 2HMUA 3WGYA 1K89A 4XR4A 3CKYA 1PJ3A 2O2YA 4IGEA 1F0YA 3LYLA 1NHGA 3BXXA 1DAPA 1BWSA 2XAAA 3ZV4A 4OYRA 5KVVA 3GGPA 2R6JA 4HFNA 2DC1A 4GI2A 4WPGA 4LRTB 5COAA 4ALNA 5B4VA 1UZLA 4U6SA 3H9UA 5MDHA 2X5JO 3QVTA 4B4OA 1P3DA 3LK7A 1M75A 2VWGA 4E5PA 5DCUA 1TA4A 3D64A 3ASVA 4A73A 3L77A 3AFNA 4BQRA 1JVBA 1E3IA 1U2GA 3LSYA 1CETA 1MLDA 2GCGA 2JAHA 1TT5B 3PWKA 2BRUA 4XGKA 3PEFA 5JAIA 2RHRA 2CSUA 5AYVA 1FDWA 4ND1A 3FBTA 4BKPA 4NJOA 1LI4A 1KC3A 2ZB8A 2QRLA 4M86A 3WXBA 4E31A 1HDZA 4PFJA 3VH1A 3MZ0A 1H0KA 3DOJA 4BGUA 1NPDA 3AY3A 3U49A 1HE3A 4MP6A 4K9DA 2F1KA 4EGFA 5THQA 2AQHA 2C07A 3FWNA 2X23A 1I10A 1MG0A 2VYVD 1U2DA 2NNLD 4GLLA 3W4JA 5L7YA 1WWKA 4DMMA 4NJMB 4TQGA 3E9MA 1DC3A 2DVMA 1WLYA 2PZMA 3SJ7A 3H2ZA 2BHLA 1GZ6A 2D5CA 3HHPA 1F17A 4ND2A 3RD5A 4YT5A 3FN4A 4GKBA 1PS9A 4CQMD 4BO2A 4QEDA 4G2NA 1YRLA 2CY0A 2NWQA 4KWIA 2VRCA 1DC6A 1HE2A 4CM5A 3BTVA 4R9SA 1XLTA 2OP0A 3FPCA 4LCJA 1KEUA 1T25A 4J7UA 2X9NA 5TJHA 1BW9A 4FDAA 1MGOA 2JJYA 4BNGA 2JCVA 1QLJA 1EQ2A 2G0TA 4II2A 3VDQA 1N7GA 2FWMX 2JAPA 1YDWA 1LDEA 3NJ8A 3WGIA 2Q49A 1JN0A 3D1LA 3RKUA 5EIOA 2X9VA 4XB1A 5L40A 2ZTLA 3RQSA 1PJ2A 4RV9A 3S55A 3BMCA 2O4CA 1ZZEA 2FR1A 5L51A 2Z5LA 1WZEA 3FI9A 3P19A 5A03A 2PFGA 5JYAA 4WEOA 4L9RA 3JQGA 3WGQA 1U3WA 4M89A 3GN2A 4U0JA 3H4VA 1I3LA 2A4KA 2RH8A 3JQ6A 2QG4A 1P1JA 3EAGA 3WSVA 4BKOA 5T57A 2VOEA 2E49A 3GMSA 3V1TC 4D7AA 1H2BA 1U4OA 3O8QB 3GQVA 3T7CA 3LVFO 3I9OA 1I3NA 4YAGA 1GCUA 2QX7A 1M2WA 3RC1A 4YTEA 5J9GA 4OGWA 5LCXA 5THKA 4PGFA 3HNPA 4YJHA 4I5DA 5JFOA 4EJ6A 3STHA 1G0OA 3KEOA 3RCBA 2OP1A 4J2OA 4RL6A 1Y5RA 1RYDA 5IZCA 4J16A 4HNHA 1HDRA 4G65A 3IUSA 1ENPA 2FZWA 5G4LA 2B4RO 4INAA 1GYRA 2B83A 4J1SA 4PLPA 5FWNA 2HAEA 4KTTE 3OF2A 3RC2A 1LSSA 1K5HA 1ADBA 2C7VA 1PX0A 4HP8A 4P38A 4I9NA 1Z7EA 3E03A 3M2TA 4RPHA 3DMTC 3JYNA 4AJOA 4DBZA 2YQ4A 2P9CA 4FQ8A 3E82A 4BGVA 1N1GA 4M8SA 4AJ2A 4WLUA 4MJLA 4QFCA 1IHYA 1NWHA 1OMOA 1Y7TA 3BMOA 5AXDA 3ZH2A 4PRLA 4PG8A 1B15A 1PU2A 3SXPA 2FR0A 1GAEO 1WXDA 4BIIA 4OSOA 3C1AA 1P1IA 4A2CA 1YJQA 4ILKA 2VRCD 4Z9XA 4GWGA 5HS4A 3AJRA 1YO6A 4PLTA 3BA1A 1SAYA 4YJGA 1SEPA 3LC1O 1WDKA 3D3WA 3G17A 1XU7A 1NAHA 2Y1DA 3DZGA 1HWYA 2DTEA 4PLVA 3DHNA 3I6QA 4Q39A 2PGLA 1VL0A 2CVQA 2YW9A 5KVQA 1NAIA 2CDCA 2O7QA 2QYSA 2VRBA 3AI1A 2D1YA 1O9BA 3A1NA 3DO5A 3ONEA 3LDHA 4JROA 5IAAA 4QO8A 3W4KA 5DF1A 1U5AA 3R1IA 2D0IA 4M87A 2WSBA 3MOIA 4BKQA 2Y1GA 3OIDA 1P74A 1WVGA 2ZTUA 4BKRA 3Q11A 1PGPA 5IDWA 1OC4A 1BSVA 3W8EA 3KTDA 3FF4A 5G2OA 3BHMA 3KSUA 4E4YA 3UCEA 1YH3A 5IN5A 4QSMA 3JQFA 5B12A 1VSVA 3K96A 4W99A 3DZFA 1R12A 3H7AA 1DBVO 3LF1A 2VUSA 3ONFA 1H5QA 3HADA 1MC4A 1PQUA 2WE8A 4BNHA 1DLIA 2PZKA 4NR0A 1LSOA 1X15A 4ONEA 2BMAA 1NP3A 2X6TA 4BO7A 3IL2A 1T1RA 3OJFA 4R3WA 1XCBA 3HZZA 1NVGA 4D0SA 4YPOA 2YV2A 1ADCA 4QT0A 4RDHA 3GZNB 4JJGA 2FHSA 3GPDG 1CJCA 3SLGA 3S2FA 4B7XA 1AXEA 2PWZA 3V5NA 2WWRA 4C7KA 5JNLA 5BNTA 1C14A 5JY1A 4M49A 4E21A 1PSDA 4R3NA 4AJIA 2VUUA 4XD2A 5CDTA 1KIFA 4NBUA 2W90A 4Q3EA 2UUOA 1LC0A 4FGSA 3UFXA 2HMVA 4Q3NA 1Q0QA 2W4QA 4J91A 2Z1NA 8ADHA 1YE3A 2CF6A 1EDZA 2HK7A 4PLCA 4J6FA 2Y67A 2FSVA 4N5MA 3DR3A 1AHHA 5ITVA 1O89A 2X4GA 1F8GA 3VHRA 1DFHA 2GF2A 4GSLA 4YCAA 4FFOA 5A5EA 4FS3A 4XJSA 1YOVA 4BV9A 1I3KA 3I9LA 1PGOA 4CM4A 2YV3A 4WOJA 4DBVO 1X14A 2HK9A 2O48X 3UOGA 1HDCA 5JS6A 1H9AA 2AXQA 5KWEA 1A9ZA 1LLQA 4J9UE 4HFRA 4PG4A 2HO5A 2Z1MA 3GVPA 4DPLA 3E48A 3DBLB 4I1IA 1WZIA 2NTNA 2VTEA 3IKVA 5TRTA 3QA9A 3WMXA 3EZLA 2YFHA 1SC6A 1EFLA 3D4PA 4DREA 1TB4A 4LVCA 4UVDA 2C5AA 1IOLA 1MFZA 2LDBA 4L4SA 2DTDA 4WCFA 1E7WA 4PLYA 2GN4A 1KYQA 4JP3A 3ZI0A 3KM0A 2Q2QA 2BFAA 3OP4A 3ANLA 2A35A 3NDJA 4L4RA 2E4AA 3PYXA 2W2KB 5I7VA 2AHRA 4TVOA 5T8KA 1C0LA 2C59A 4LK3A 4U5QA 3VPGA 1H93A 3KSZO 4MVJP 4IMRA 4ZQBA 4HY3A 3U62A 4CLEA 1TVEA 5C3MA 3L6DA 3VTFA 3VKVA 1X1EA 1QV7A 4IS3A 4KQXA 4BV8A 3WWYA 4MVJM 3V1YA 5M6DA 3I4CA 5TJ9A 1MB4A 1YBVA 3KBOA 2Q3EA 4FJ1A 4F3YA 2FPIA 1K2WA 1AXGA 3OA0A 2CMDA 1BVUA 1ENOA 1LQTA 3BMOB 3DONA 3ZWAA 1YJ8A 3EC7A 2RCYA 4FC6A 3L07A 4CQLA 3VH4A 1S6YA 2HK8A 1VJTA 1P1FA 1PZFA 3WGGA 1N1EA 4NFSA 5EJ2A 3F1LA 1ZSVA 1P1HA 4MIOA 3H65A 4HWKA 3D7LA 3QVOA 1TI7A 2B5VA 2P9GA 3GDFA 2CDAA 1E3WB 4FC7A 3GNQA 3GNSA 4YQYA 3FNFA 3OSUA 3VDRA 4ITUA 3HN2A 3JD1A 5FFFA 3TZHA 4E5KA 4DPMA 1F12A 2JD0A 1YBMA 4CM1A 3MJCA 3ROQA 5T5QA 3WJ7A 3AI3A 3ZNOA 2HJSA 1P0CA 4CMEC 2I65A 1LDYA 1ZEMA 2O3TA 1E5QA 3HJAA 3TZQA 1T26A 2GD1O 1U8FO 4XQEA 2OFPA 4WLEA 1YQXA 3RUEA 1IULA 2FMUA 4HXYA 4OAQA 1B2LA 3JQ8A 4JLWA 4RO0A 3LQFA 1KC1A 2WYUA 5F5LA 2EWMA 2NTJA 4IM7A 3K31A 4KMSA 1M6HA 4E6PA 2O4UX 5CEJA 3DTTA 2P5YA 5BNFA 1J5PA 4WEQA 4WLVA 1M76A 3KVOA 4Y67A 2ZJ0A 3O38A 1ZK4A 2Y99A 4RF5A 4XDYA 3RFXA 1FK8A 2GSDA 3K9QO 2I5PO 1O6ZA 4B3HA 1GEGA 2I3AA 3ENKA 4OH1A 4CM9D 3I23A 4RVHA 4A5OA 1ZSYA 5I7FA 1YBAA 3GNTA 2P2SA 2BKAA 2O50A 4XRGA 3WDSA 4YR9A 1E3LA 5KKAA 4GMFA 3QW2A 1ENZA 3IUPA 3PGXA 4Q9NA 2YYYA 3C8MA 4LRSB 1VL6A 4IJVA 4OXNA 4L75A 4IQ0A 1FDSA 2O7SA 5GZ1A 3DMTA 1D4FA 3ENNA 2I76A 1VI2A 3KYDA 1GZ3A 3GVCA 2FPGA 2FRDA 1HDYA 1WDLA 1GEEA 2VWQA 3PFFA 4Q3DA 5BSHA 1FDUA 3IOYA 4HNGA 3JD0A 4YBZA 5TX7A 1HZZA 1GPJA 2PZLA 3GPIA 3B6ZA 2C82A 4WKGA 3WBBA 1PR3A 1Y8RB 2NTVA 3H9EO 4EEZA 2Q1UA 4A26A 3BMNA 4RJTA 3LT0A 4LCEA 2OOSA 4JGBA 4RPGA 5I9LA 4DA9A 1KY4A 2WDZA 2PKQP 4ZU3A 3GAFA 4YJGB 4AG3A 1PS8A 3Q9UA 2CUKA 4WLFA 1T2CA 2Q1TA 3BAZA 2UVDA 3GHYA 1W8DA 4GPD1 1PGNA 3VPFA 5G4KA 4GVLA 2JD2A 4DLLA 5CFZA 2Y0CA 4Y9DA 3VVCA 4AJKA 4XRRA 1KERA 3S1LA 3DBHA 3G3EA 3W8DA 5TF4A 4W6ZA 1XR3A 1T2FA 3Q0EA 1PJBA 3F6YA 4N18A 4RGBA 3EYWA 5DBGA 4DL9A 4KP7A 2R2GA 1HSOA 2VYVA 2FZEA 4WLNA 4AJJA 1HRDA 3JQEA 5G4KB 4OO3A 4CR6A 1HL3A 3RAJA 5H81A 1E1NA 2HDHA 3C7DB 3CMCO 2PY6A 1B14A 4IDFA 4JN6B 4XIJA 4IZIA 1PTJA 3PHJA 4BHTA 5A3JA 3QVSA 1LQUA 2C29D 2ZIZA 3GFGA 3I9MA 3CEAA 1Z74A 4ROSA 1XDWA 5F5NA 5AXCA 1BG6A 1OFGA 3WYCA 1UR5A 5DBIA 3O9ZA 2GRAA 3AUAA 1E6EA 5CG2A 1QYWA 4UUPA 5KJEA 2XF8A 4D44A 2Q4BA 3VPHA 1ZVMA 1WPQA 1ZKMA 3P2OA 4II3A 4MP3A 3CPSA 4NBVA 3MWDB 3PGJA 2C5EA 2DAPA 4PVDA 2H63A 4IDBA 3HN7A 4P8RA 4B3IA 1ZK3A 3H9GA 3L9XA 4Y98A 1WNTA 2VHXA 3F9IA 1KETA 3AOGA 3WLFA 3W8FA 2I6TA 3R3JA 5TQVA 3PHIA 3GK3A 3PHLA 4FOSA 4BNMA 5IDXA 4MKRA 4J0FA 3JQGB 4YJDA 2DKNA 2ZQZA 3SEFA 3GF4A 3IKTA 3NDIA 3EVTA 4W9NA 3WNQA 4O0LA 3BMCB 3I1JA 4DTIA 3GFBA 4NI5A 1CQIA 1C3VA 1GU7A 2B4QA 2DLDA 1I8TA 2VWHA 4PLZA 2NM0A 3KLPX 5TLSA 1ISHA 1H2HA 2FOIA 2PD4A 5CHEA 3SC6A 3ZWWA 4S3MA 1UAYA 2VHZA 2NVBA 3LU1A 4QUKA 3PPIA 1JKIA 4Q3AA 2Q46A 2VTDA 4KDEA 5U9CA 3NJ4A 2HCTA 1LJ8A 2RAFA 3GOHA 1XIVA 4U6QA 1EFKA 3PFWO 3ANNA 3ZWVA 1Y9AA 5EERA 5CDUA 1QP8A 4W7IA 3FBGA 5JSFA 2GNAA 3I52A 2D5AA 3S2GA 1PJTA 1Y81A 3GAZA 2IZ0A 3OH8A 1YQDA 3I9JA 4ZHSA 5DOZA 1R4NA 1YGYA 3FTPA 2D2IA 3BMQA 3JQ7A 3NT2A 3TZKA 1BXGA 3SBOA 4OXKA 4NJMA 3GA0A 3Q2KA 3GGOA 3K2BA 3ZV5A 1PEDA 2O3RA 4CV2A 1GYQA 4MVJD 3IQDB 3KV3O 2ET6A 1L7DA 1ADGA 3TZ6A 3BHJA 3F3SA 3PLRA 2V6FA 3QWBA 1U3UA 4XDZA 4EITA 2HMTA 4XQCA 3AI2A 2Y0DA 3DZHA 3CZMA 2NU7A 4OMUA 4XCVA 3RSHA 3L4SO 1E1LA 1HTBA 4FOOA 1I3MA 3OJEA 1OZAA 2BFOA 3OJ0A 3E5RA 4AFNA 4BUCA 3ZWBA 2GGSA 3KO8A 4YEDA 4OOFA 1ISMA 4CR8A 2DQ4A 3ZWMA 2EW2A 1NYTA 4FIZA 1HDGO 3KLMX 1KVQA 1U3VA 3ZV6A 1WAMA 2YHUA 1EVYA 1M6WA 1EK6A 2CNBA 4DMLA 1JKJA 3GZ4A 2BFMA 3M2PA 4IJWA 1I0ZA 5A04A 1N92A 1KEVA 1LSUA 3HDQA 4IIVA 1I36A 3ABIA 2H6EA 2WJPA 1R0LA 4W4TA 4J0EA 1RM4A 4RQTA 1SEVA 5FF9A 5L7TA 1YVEI 4IQ8A 1XGKA 3RC7A 1YXMA 3KETA 3ASUA 4DQUA 5I9NA 4ZN6A 1HXHA 1I2CA 3IDSA 1H6CA 3OMLA 1O94A 3RFTA 4B8ZA 3CE6A 3E8XA 3GDGA 5G0VA 1JKFA 5DNAA 4A7PA 4XA8A 3GC6A 4G5HA 4CM3A 4IQGA 1KEWA 4WASA 4OKIA 4UEJA 1ISFA 1TEHA 2YY7A 4ZRMA 4ZD6A 2EKLA 2XXJA 5TT0A 1DFGA 1CQJA 3VPXA 2GN8A 2X9GA 4XJTA 3C1TA 4J7XA 4TKMA 3ZGYA 4A10A 4DUPA 3RUFA 1NQ5A 1V35A 2IRWA 1LU9A 1YOVB 2VZ0A 2Y93A 4OHUA 4YB8A 1EVIA 3WQQA 1E7YA 1VKOA 3ETEA 1UH5A 2EP5A 1ADFA 2IXBA 5KVSA 3PIDA 4K28A 4E5MA 3DBRA 1Q1NA 1Y8QA 5ER9A 3X2EA 1OBFO 1I2BA 1A4IA 1E77A 4YQZA 2ZB7A 3ZU2A 5AVOA 3U3XA 3R0IA 1DLJA 2YQ5A 5CPBA 5BSFA 2BF7A 3VH3A 2QW8A 4LMPA 2W2LD 2FP4A 5DULA 5JMPA 1EVZA 4UVHA 5T67A 3GVXA 5ER6A 1CDOA 1C1DA 1PJ4A 4PRKA 3UN1A 1I30A 4HBGA 3RKRA 2Y1EA 1LDBA 1BDMA 2CVZA 1O8CA 1U7HA 2Q45A 2YHIA 1EUDA 1H6DA 3I83A 1IL0A 4EI2A 3OIFA 2PK3A 4GKVA 3UGKA 3U5TA 5L3ZA 1NFRA 3K73O 4E12A 1OOEA 2EGGA 4G81A 4YYZA 5IDYA 2QRJA 3ON5A 2ZK7A 4WECA 4TRMA 1NQTA 1GQYA 2IEDA 4J49A 4YVFA 1Q2XA 3HDYA 1ENYA 1LA2A 1T4DA 1I01A 3L9WA 5HS6A 4IDAA 3WQSB 4E32A 4FFNA 5DOVA 1V0JA 5ILOA 3F47A 1N2SA 3NYWA 2ZATA 5K6AC 2GZ2A 1SB8A 3AUUA 3PWZA 4D41A 3QJ5A 1T1SA 2HJRA 4IPTA 2R00A 3AM3A 3NV9A 3RFVA 2OBYA 3LLVA 2G1UA 3MJ4A 4FR5A 5A4DA 1NX6A 1T4BA 1PL8A 4BL5A 4HFJA 5KJ6A 3MWEB 1U3TA 1LRKA 1HE4A 2D3TA 2JFGA 2P68A 3F4LA 4RQUA 4XYBA 3LT4A 3NRCA 4QX6A 4J1NA 4NU6A 3ZV3A 4J7CA 7ADHA 1N5DA 4EW6A 4YA6A 2PH3A 2BGMA 3DOCA 3SC4A 3GEMA 3ZZNA 3NDRA 2OUIA 2HU2A 4UUOA 4CM6A 4KZPA 1SMKA 1NXQA 3QY9A 2Y66A 4UEOA 4YT4A 1J6UA 2C7GA 3ZWPA 2GPTA 2JHFA 3ST7A 3KYBA 1HDOA 2O2SA 4DYVA 1VE9A 2GN6A 3PQDA 4ND5A 3ROKA 2CVOA 1KBZA 4PZDA 1NR1A 3KRTA 4RVUA 3DTYA 1GPDG 3ZCXA 4L74A 2UUPA 2W8ZA 1E3SA 1L1FA 5JMWA 1EK5A 2J5RA 5U4QA 3NTOA 4WUVA 5HBRA 5A06A 1DHRA 1F14A 4E13A 4KWHA 2X0IA 1XYGA 3WWZA 1U7TA 1R66A 5F21A 1LLCA 4DQXA 5A9SA 2NVWA 1NQAO 3ICCA 4CM8B 5K6AA 3IP1A 1ISIA 3FNEA 1GUYA 4H16A 4UEKA 5CAEA 3WSWA 1XQ1A 2J5QA 3RUCA 4WCFC 3CH6A 4DWVA 4FGWA 1J4AA 1ZJZA 4XGIA 1BHSA 3H2SA 5IXYA 2WD7A 3TN7A 3H9QA 1V8BA 3ANMA 2X5OA 2AE1A 2EKQA 3ZWOA 3TDKA 1GD1O 3H5NA 5GZ6A 4W9NC 5H83A 3HG7A 4PVCA 1UDAA 1E6UA 3L6OO 2IEBA 1SB9A 3B1FA 4CL8A 5TIIA 2NACA 3FCOA 2HLPA 5F1KA 1GY8A 4XB2A 1FMCA 3TFOA 1EBFA 3PJDA 1DAOA 5JW6A 1A72A 1R0KA 1EE2A 1UDCA 4JXKA 1JTVA 5KJCA 2YZ7A 4CLHA 3TRIA 5CDSA 3QE3A 3VC7A 3E1KA 2ZQYA 5L53A 1SZJG 3K8ZA 5C37A 1RM3A 3D5QA 5IXSA 3GG9A 1UJMA 4R54A 3RUDA 3U9LA 3O4RA 3B70A 3WGHA 3JTMA 4TWRA 1ZK1A 3TNLA 3V2GA 5AXBA 5ENVA 1D8AA 2ZTMA 5A9TA 1ZIDA 1X7DA 2ZYDA 1C0IA 4BO0A 1PZHA 3HSKA 3WX0A 2B36A 4WOKA 1F8FA 2I9PA 3B1KA 3R6DA 3VAZA 6ADHA 1LRLA 3DAFA 4LN1A 4BO8A 1BW9B 1GQ2A 2G76A 4CODB 4ID9A 3PQFA 4GVXA 1P31A 1DC4A 4D3DA 2AEMA 1OI7A 2NU6A 4RVGA 4GQAA 5DN9A 5LC1A 5ICMA 1KS9A 5T64A 1B16A 4PLFA 4DIOA 4TRJA 1JWBB 4R51A 1UZMA 4IS2A 4W82A 5EMHA 4GX0A 3KEQA 4E2WA 5BSEA 1NR7A 4IXWA 1GFSA 2ZYGA 1DIHA 2GN9A 2WEKA 3E9QA 2YV1A 5F3RA 5LDHA 1PL7A 1A71A 4BO3A 3S2IA 2ZTVA 1QYVA 4TSKA 4IZHA 1LUAA 1FDTA 4CMCA 3HDHA 4R1TA 4I5FA 5EESA 4I9HA 2J5KA 3HFGA 2BFPA 3Q6IA 4F45A 4CQMA 1N8KA 4HUJA 3KUXA 3FPLA 1YB5A 3C85A 3SVTA 3UCFA 4MINA 1XG5A 1Z75A 4MVJE 4EUFA 4NPCA 1DEHA 3EDMA 1CYDA 2QIOA 1U5CA 3KOUA 4JQCA 1AUPA 1PWZA 3WQRA 4CMJA 1BXGB 4CMKA 1YL7A 4IDDA 4KOAA 1F06A 4K1LA 1Q7BA 2PKRA 3JQ7B 3AUSA 3DFZA 1XKQA 4L76A 2C0CA 2CZCA 3C1OA 4NHEA 2X1HA 4FJ2A 1WMAA 2VOJA 4F6CA 3GH3A 4CMIA 3PDJA 3LF2A 2OO5A 3VZQA 1ZW1A 4QO7A 2VWPA 1HF3A 5ADHA 2A94A 3VZRA 1GQQA 2AW5A 3HDJA 4S1VA 4WK6A 3WIEA 1V3VA 4DGSA 3FSRA 4BNYA 1X7GA 3F4BA 2Q22A 1T2DA 4CUKA 3QVWA 2O3QA 4DVJA 3PIIA 4UREA 4NMHA 4CLOA 3HQ4O 3FD8A 3K92A 1EQUA 3VKUA 3U4DA 1UUFA 5JYFA 4BGEA 4YWJA 2G82A 1CERA 1G0NA 3D4OA 4MVJF 4CLXA 3M1AA 3QVXA 4Z3KA 2DM6A 4R9RA 4ALIA 3FR8A 1YL5A 5JO9A 5C7IO 4K6CA 1B8UA 1HDXA 2PD6A 1A5ZA 4MKXA 4E30A 2DTXA 3TPCA 2D8AA 4MO2A 4XYEA 5JAQA 3UXYA 5CEFA 4D0RA 4EBFA 2QYTA 1VLLA 1UP4A 2E37A 2NU8A 2OZPA 4BNZA 4E2YA 3GT0A 4XYLA 3MJVA 1E0DA 4A03A 1ONNA 4ALLA 4CLRB 2Q1WA 1DHTA 1GUZA 3EY4A 1U8XX 4GGOA 3NX4A 3TF5A 4FB5A 4OKNA 4CM8A 1QORA 2PR2A 1NNUA 2HMSA 1HYEA 3UCXA 1IPEA 1ZEJA 3BHIA 4MVJH 1B3BA 3RBZA 4JJIA 2VHVA 2RH4A 5K0ZA 1ZCJA 4DRYA 1NASA 3M6IA 3NEPX 4GSKA 4GLOA 5HRUA 1B8PA 5DCWA 1HEUA 3NKLA 5JCXA 1D1SA 1MP0A 1O0SA 1MX3A 1TT7A 3GEDA 4RVDA 2V6BA 2X0RA 3ZHYA 4E2ZA 1YDEA 3ZWCA 4WLOA 4M55A 3DWFA 3UF0A 2G17A 4P22A 4O59O 3D4NA 3PZBA 4D3FA 3MOGA 4IUYA 4B8WA 4JP2A 1DDOA 1DRUA 5L95A 2XPCA 3D3WB 1ZBQA 1VRWA 1D1TA 3G0OA 4FJ0A 5A9RA 2YDXA 1BMDA 3COSA 2O23A 1P1KA 4BNIA 1T2AA 3OBBA 3PYLA 2PGJA 1E3JA 2FY8A 4B4UA 2IYPA 2O3SA 1JWAB 3D5TA 4MVJI 5HWSA 3WYEA 4ZGWA 4J4BA 2DBVO 5DZSA 3RJ5A 2NQTA 3V8BA 4OL9A 1UP7A 6LDHA 4O5OA 3LLSA 3K6JA 4J90A 3JYLA 4IDGA 1SPXA 4M54A 3C7AA 1WMBA 3B1JA 3N7UA 9LDBA 3E6AA 4OQZA 1PZGA 3JQAA 4LSWA 5MGBA 1C1XA 4U0KA 4L8VA 3H8VA 2QHXA 5B4TA 1ISJA 3A9WA 1K3TA 1R4NB 5ITWA 3JV7A 4BS9A 3U0BA 4KTVE 4URFA 1U4SA 3TSCA 1IYZA 1HZJA 1VPDA 3SJUA 2HKIA 2RBEA 4IJUA 1Z7BA 2EKPA 4WE3A 1LTHR 4CV1A 3ONDA 1RM0A 2V7PA 1JDJA 4J3FA 1Q7GA 1EDOA 3CMMA 3UHAA 1IZ0A 2E48A 4D43A 1PL6A 4AJNA 4FW8A 1B3RA 3F1KA 3H3FA 3KYDB 4J4HA 4JK3A 3KYCB 3AU8A 4OOEA 3ZDFA 2XOXA 2Y68A 4NZ9A 5JPIA 5BT9A 5L45A 1ZXBA 3A06A 1GADO 5FI5A 3WOHA 2IZ1A 1FF9A 5I8ZA 3O03A 1ONPA 4CPDA 5I7SA 4BNKA 4BMSA 1WW8A 1U9JA 4N5NA 5JDIA 2IDZA 4ALKA 1JU9A 4UVEA 1QV6A 4ZA2A 3G1UA 4YRDA 4BNXA 4CMGA 3Q1LA 1IUKA 4CMHA 4I8XA 3JSAA 1E7QA 3LT1A 2YFQA 4DIBA 1IY8A 1ZSNA 3C7CB 1DJQA 1Q7CA 4J43A 3I4FA 5K9ZA 2OGUA 5JDIC 3AWDA 1LDGA 1UAGA 3PQEA 5CDGA 3OEYA 4TROA 2BGKA 4RLSA 4Z6KA 3HE3A 5A1TA 1P77A 3Q3CA 3CIFA 4J1TA 2P4QA 3C3XA 3WFIA 3DBVO 3RBVA 3NTQA 3IMFA 3F46A 4NIMA 4TRRA 1VJ1A 4UAGA 4XZ3A 2JL1A 4RZHA 2EG9A 3CXRA 4ZQFA 4MKZA 4QXMA 2O3UA 2BGLA 3VOSA 3QIVA 3QWAA 5DBFA 3U4CA 1SOVA 4R1SA 4ZQGA 1NHWA 2PLAA 4FBGA 1ZJYA 1WDMA 3GDOA 1KY5A 2OL4A 2FR8A 5C7OO 2PKQO 2FPPA 5CG1A 1QYDA 5KCZA 4KUHA 5JLAA 1QG6A 3F5SA 1LDMA 4J1QA 4R1NA 4BNTA 5A5FA 1OAAA 4R1UA 1NPYA 1ID1A 4U8GA 1JVSA 2FN7A 3AFMA 5A05A 2FSSA 1C1XB 1OC2A 1LDNA 4I5EA 4KDFA 3ROMA 1BTOA 3M1LA 4RF3A 2QZZA 1DPGA 4RLHA 2H9IA 2Q2WA 3WG9A 4WNCA 1PJQA 4OIMA 5HA5A 2OHXA 5JYDA 3F5QA 3DBHB 1N7HA 3OJOA 3TL3A 4K26A 3GN1A 4CQLB 1N9GB 1BXZA 3DL2A 2X22A 1Y6JA 3FHLA 3ZNNA 3ITKA 2EJWA 4D45A 4DC0A 5JE8A 1CF2O 1XEAA 5G0UA 1YONA 2EJVA 3BZUA 4ND3A 1NWCA 2VUTA 1PJLA 3TOZA 3FNGA 3W6ZA 1NBOA 3UAGA 4RORA 1PJCA 3E5MA 4RF2A 2EW8A 2HRZA 1EUZA 3GRKA 3NUGA 3W4IA 1ORRA 4L0QA 4E3ZA 3MTJA 3VH2A 3E9NA 1KOLA 1XWFA 1Y8RA 3TQHA 2VYND 1R15A 5EL0A 3IP3A 3S2EA 1YQGA 4ZQEA 2POQX 1HT0A 3T7EA 4A27A 3QQPA 2VN8A 4N54A 4BQPA 3EGOA 4WCFB 4IIUA 4I5GA 2Z95A 4BNJA 2YUTA 4UULA 3PZRA 1GTMA 1I32A 4Z0PA 3A14A 3PVZA 1PR9A 1A27A 1J0XO 3ETDA 5FEUA 4Y6RA 4YAKA 2WYWA 1O5IA 4P4LA 4GL4A 5C7LO 2BI8A 3DBLA 1PWXA 2BI7A 4CLRA 3QRWA 3UKOA 3HWRA 4OSPA 2GUGA 1BXKA 3SLKA 5G0TA 3JQ9C 2AEJA 3IS3A 4UUMA 3DB2A 3ROPA 4BKUA 3LC7O 5L4SA 2I99A 4YRAA 4Y8VA 2VHWA 3OM9A 1AE1A 3RUHA 2Y1FA 3PTZA 4XIYA 1CRWG 3EHEA 5KKCA 2WYVA 4CV3A 1ZO8A 2IE0A 3L4BC 3I3OA 3IJPA 2OBNA 4X54A 1LRJA 1ML3A 4FSHA 4FPXA 3GR6A 5GMOA 3A28A 4NQZA 2JD1A 4DIFA 1H6BA 3WGOA 5LDGA 3H9JA 4XGNA 2P5UA 2X0JA 3K30A 3JQCA 5C5IA 2IODA 4CMIB 1K6XA 4XKJA 1GYPA 4AL4A 2J6IA 1A4UA 5L4LA 1IHXA 1TXGA 1PQPA 4LGVA 4HKTA 3HFSA 3U4IA 1NFFA 1A7KA 4XWYA 2NU9A 1JAYA 4XEHA 1XSEA 1S7CA 4AVYA 2H5LA 1IPFA 4D46A 3BYZA 2RIRA 4YT8A 1ZH8A 3IIEA 4GBJA 2HMWA 3GRPA 3HUDA 1DB3A 3A4VA 5HTOA 4JCOA 1LC3A 1GUFA 1X7HA 3WICA 4PG6A 5IJZA 3PJFA 4GH5A 2AMFA 2PNFA 5G0WA 4EJ0A 2CD9A 3EW7A 4PLGA 4RVSA 1K6JA 1EE9A 4JJFA 4KUGA 1YKFA 2BD0A 1R6DA 1M66A 1DO8A 3I5MA 4YAIA 5JAMA 4TKLA 1DRWA 1N9GA 3B20A 3EVNA 5T73A 1P1RA 1W4ZA 1XELA 1T24A 1IB6A 1Y5MA 3CZRA 3OQ1A 4JNKA 5CPFA 3WNVA 5IZ4A 3PI7A 5L4NA 5B37A 2P9EA 3FTNA 2WTBA 2QRKA 4FFLA 1A9YA 4YJFA 1BDBA 1VC2A 3LC2O 5HM8A 3AUTA 4H15A 3WS7A 3ZU3A 5F1PA 7MDHA 3V2UA 3CINA 2VZ8A 1QXSA 1Z45A 1ISGA 1PQWA 3RIHA 5JCJA 1GR0A 2JFFA 2DBZA 4BOYA 5IN4A 1ZXLA 2DPHA 2J3HA 2P91A 3JD2A 4OJNA 1SCUA 4ESOA 2C2YA 3DAPA 4D42A 4EUHA 3DMYA 3GGGA 4JX8A 1P33A 4WGGA 4MDHA 1UXJA 3JD3A 3INGA 1A7AA 3JQFC 2UYYA 1MFPA 1V3TA 2P4HX 2JHGA 3T4EA 4DQVA 4B4WA 2JKVA 2WM3A 3RU9A 3ETGA 3KXDA 4F6LA 4R41A 4NU5A 4YT2A 1DRVA 2JFHA 5AOVA 4QECA 4PN3A 1BGVA 4F46A 5GY7A 2PH5A 1ULUA 4FFPA 3UICA 3ZU4A 4DXHA 4RPKA 3OEWA 3QSGA 5I9MA 1NTOA 1AHIA 4CM4B 5DP2A 4PIVA 1D7OA 2DBQA 2C20A 4ZRNA 4BGIA 4OM8A 3SX2A 4FFRA 5EPOA 2BELA 3WB9A 1UXIA 1PJSA 4RZIA 3L0DA 3ZW9A 3DHEA 3UVEA 2PTGA 5B1YA 1PGQA 4FFMA 1E7SA 2AE2A 5TSDA 4ZICA 3C24A 4AJHA 5F1OA 3OJLA 4E33A 1E3EA 4B4VA 2GDZA 4NG5A 2B35A 1SNYA 1R4MA 1ZNQO 3ITDA 1EZ4A 3KYCA 4CLDA 3OIGA 1LX6A 3PRJA 2WD7B 3AW9A 3W1VA 1RYEA 1QMGA 3U4HA 1JLLA 4CLOB 2EV9A 2V6MA 3ADPA 1PIWA 2Q99A 1P44A 4R68A 1IZ9A 3GZNA 1YWGO 4YACA 1HYGA 3JQ9A 4EDFA 4JIGA 2AQ8A 1VL8A 4LISA 1VM6A 1R0SA 4PZEA 1MV8A 3VPSA 4D79A 2BH9A 2TMGA 3O8QA 3OFSA 4H7PA 5BR7A 1Z6ZA 3PWSA 1T2EA 2DFDA 2ZB4A 1HKUA 1X1TA 1CWUA 3DHYA 3ZU5A 3AM4A 5ENDA 2DUUA 1KEPA 4MIEA 3U09A 1UP6A 3JD4A 5A9SB 3KZVA 1V6AA 5BNIA 5CEEA 3AOEC 4TZKA 3ZWYA 2DFVA 2YDYA 4O1MA 3WR5A 3UW3A 3GEGA 4CR7A 1C0PA 4TMFA 4BMNA 5J23A 1FXSA 4BNVA 1DFIA 2ILTA 4B3JA 1MXFA 4R5HA 1E3WA 1EUCA 2I66A 1D3AA 4OXYA 5IZCC 1ZMOA 2ZB3A 3VZPA 5IG2A 2EERA 2UAGA 4J2HA 4NFHA 3PYMA 4Y6SA 1R16A 3KHUA 4IINA 2IXAA 2X0NA 2X7HA 5ILGA 1DOHA 1EEHA 1XU9A 3V1UA 1ZK2A 4Z3DA 4EYEA 1U28A 3H3JA 1NVTA 5TC4A 4W7HA 1QYCA 4QFDA 4BNWA 1E1KA 3OECA 4GX5A 4MVJA 1YS4A 4OQYA 4XX0A 2PD3A 3GHHA 4FD3A 2V6GA 2ZKLA 4ZJUA 2AQIA 1BRMA 4WJZA 2EP7A 2EXXA 1GDHA 3JQBC 4E0BA 1G1AA 4Z9YA 3NGXA 3PHGA 3JYQA 1H94A 2R00C 4UVGA 3GLQA 2W2KA 4R01A 4AJEA 4R16A 3FNHA 4GMGA 4HX5A 3PJEA 4JBGA 3DZKA 1X0XA 3EUWA 3WTBA 4PLWA 5ES3A 4Q3CA 2AEFA 4KUEA 5COBA 2GASA 3K5PA 4YAEA 3P2YA 1DIGA 3FWZA 2CFCA 1ONOA 1V9LA 3JYOA 1IE3A 4XYMA 1H6AA 3ZWNA 4YRBA 4QQRA 5DCYA 3EK2A 4PCVA 3DC2A 5JDCC 4CJXA 4DLBA 1B26A 4IGFA 4JBIA 3RBXA 3BTSA 1LNQA 3JQBA 1DJNA 4LVUA 1RJWA 4ALJA 3OA2A 3WJAA 1YB4A 2H1SA 3DOOA 5AQ1A 1QYXA 3X2FA 3OHSX 1XHLA 1TLTA 2NV6A 2WD8A 3PDUA 3Q9NA 3PJGA 1W6UA 5DT9A 4E5NA 1PGJA 2GZ3A 1RKXA 5JO0A 1LXCA 1VSUA 4BNNA 4BNLA 4MVJG 1P45A 3DZJA 5A02A 3KSDO 5JY6A 3HB4X 4KQWA 1Y8QB 1I5RA 1HSZA 3AM5A 2OXIA 1Q0LA 4AJPA 2B0JA 2F00A 3OETA 1CIVA 2AG8A 3I9NA 5IDQA 4DC1A 3NAQA 4L73A 3G1TA 5TS3A 2UV8A 4ZQHA 1KVSA 4TVBA 3PXXA 4CL3A 1ULSA 5U1PA 4C7JA 3DQPA 3QWHA 2GR9A 3D0OA 3L6EA 4I9UA 3TFQA 3RASA 3BIOA 4TRNA 4WCDA 5TT1A 4GX2A 4RDIA 4N7RA 4J9VA 1LEHA 2NLOA 2HSDA 3QLJA 1MC5A 3OQBA 2GLXA 2IZZA 3TOXA 4IY1A 3UH1A 3CUKA 4LMRA 3WGTA 4EEXA 4EUEA 1X0VA 5JAZA 1LSJA 4CM9A 5TGDA 1HE5A 3S8MA 3LT2A 1GCOA 5EINA 3I9KA 3E18A 4U7WA 1Z82A 1H9BA 4PZCA 3INRA 2PA3A 4YDRA 3GUYA 3WTCA 4TZTA 4CQMB 5BQFA 3TJRA 5JC8A 4CUJA 3JQDA 3QV1A 2B37A 4ZVVA 1E7MA 1MA0A 3BTOA 3EZYA 4PG5A 3AOEA 2HUNA 2C54A 3DZBA 1SO8A 1SOWA 2NADA 3W6UA 2A92A 2WMDA 3ZHXA 4NK4A 1PZEA 2PGDA 2Q4EA 3GUCA 5BSGA 4NFYA 3IAHA 2J3KA 4HADA 1LLDA 2J3JA 1NM5A 2JCYA 1U1IA 5KOIA 3WGZA 2GYYA 1UXKA 2D59A 1DC5A 4B7CA 2VT2A 1NVMB 2EEZA 3PLNA 1JQBA 4E5YA 1UDBA 1VJ0A 5KNLA 3ZWXA 5COQA 4BNUA 2Q1SA 1E92A 2B69A 4BVAA 1I33A 1QLHA 3UUWA 2I67A 4BNFA 3IJRA 4R5MA 2VQ3A 4B79A 2B4TO 2EF1A 4GGPA 4LSMA 4NK5A 1P9LA 5JXWA 3QWIA 5GZ3A 2J3IA 3QHAA 4BO5A 3ULKA 1DXYA 3G79A 4IXTA 3JYPA 2DU8A 1UXGA 3RUIA 5AXAA 4H3VA 4BO1A 3OQ6A 1ZUD1 1K6IA 4GWKA 5CP8A 3BMQB 4Q3BA 2GZ1A 5FI3A 8LDHA 3N74A 3P5SA 4IMPA 2B5WA 3MJSA 2Y05A 2NSDA 2XXBA 2NQ8A 1TT5A 4IJKA 1DIBA 2RHCA 4RVFA 2CDBA 1I24A 4XR9A 4CM7A 3K2EA 1MUUA 2X5KO 5EN4A 5T8KC 3TWOA 4D3SA 1GV0A 1ZFNA 3VVBA 4NBTA 2VNSA 2VZ9A 4Z0TA 1QSGA 5JDCA 3T4XA 3GVHA 3INTA 2VYNA 1YB1A 3V2HA 3N58A 1DIRA 4MPDA 5CDYA 2VCYA 2YJZA 2Y1CA 1C1DB 1RM5A 4AICA 1E1MA 4MOWA 1Y1PA 2ZYAA 5JYEA 4LW8A 9LDTA 2DUWA 2X86A 3BTUA 2DPGA 1R4MB 3FRJA 1JA9A 2PZJA 4J4TA 4YJHB 5KJFA 1B8VA 1JAXA 4EZBA 4CMEA 3DBRB 1LBEA 1HYHA 3MTGA 3PHHA 1ZK0A 4NH4A 4ALMA 4FN4A 1SBYA 5KJ1A 1DSSG 1E6WA 2QQ5A 4ND4A 5TNXA 4MP8A 1NQOA 2I3GA 1Q0HA 3TL2A 4AJLA 4B7UA 1KVRA 2JCXA 3JCZA 5DP1A 3MEQA 2GERA 2BLLA 2PV7A 3DAGA 2X8LA 1R37A 3FR7A 4EJMA 3AY6A 2QZ9A 3Q2IA 3DEYX 4RPLA 3WFJA 3WMWA 5JC1A 3KB6A 4IDEA 1HLPA 2C2XA 2Q2VA 3HB5X 1O95A 3DFUA 3OICA 5G0SA 1Y9EA 3CSDA 5L9AA 2Y1OA 4BB6A 2NVUA 3GVIA 2CF5A 2E6UX 3NT4A 4QTZA 1L7EA 5L7WA 3WBFA 4HFMA 1HLDA 3G49A 3CTMA 4RCVA 3WYBA 4DLAA 1XA0A 4L4XA 1GL3A 3I6IA 3O26A 3RUAA 4GX1A 4XQ9A 4R69A 2Q50A 4BO9A 1J49A 4BB5A 5KTKA 1ZMTA 4O63O 4PG7A 5H82A 3GG2A 1FDVA 4O6VA 1QKIA 5DDIP 4E2XA 2G5CA 1CEQA 3RU7A 4GAEA 3D3EA 2DT5A 3NGLA 1WP4A 4YJFB 1W0CA 4DYDA 5B4UA 4NBRA 1P0FA 4Z9FA 5EQDA 5JCJD 3ADOA 4Y6PA 4PLHA 4AJ4A 2W2LA 1JW9B 4C4OA 2AQKA 4P4GA 4A0SA 3EMKA 1RWBA 4YAJA 3ICPA 1PS0A 1E5LA 1E7RA 2VT3A 3R3SA 4UUNA 1KVUA 1YL6A 4MIYA 3VTZA 3RC9A 4RF4A 5A3VA 2VHYA 1AGNA 2HQ1A 3JQAB 2E82A 1BVRA 1Z73A 2ZCVA 3AU9A 2O3JA 1C0KA 4CMBA 3L4BA 3ZHBA 3AY7A 2J8ZA 3TZCA 1VKNA 3MCVA 3ORFA 4I08A 3RROA 5KVCA 5JBIA 4AJ1A 4K6FA 1GV1A 4IDCA 1QR6A 3ZW8A 3QP9A 2EHDA 5FYDA 3NT5A 4N5LA 2AG5A 3RVDA 2D4AA 5KIAA 1AN9A 2UDPA 1QRRA 3RI3A 4NNJA 1MXHA 4CV0A 1G6KA 3WLEA 2EIHA 2A9FA 3BMNB 2OORA 2W98A 2IYOA 4CUZA 4IBOA 2YHIB 1K0UA 2NUAA 1W73A
chains in the Genus database with same CATH superfamily
2WTMA 2SHKA 3QKSB 5TPZD 1DS6A 3OZCA 2ZCUA 3JWIA 5LA6F 1BNCA 4HV4A 1V5EA 5CYGA 1RPNA 4P08A 3UT5A 5CFOA 3ECSA 4URZR 1DKPA 2HHAA 4M1QA 5IF3A 3FWHA 5T6BA 1JHAA 4PTLA 2C9ZA 1ORHA 1ND6A 2A1UB 3ASYA 4OI0A 1BAPA 1D2GA 2OHVA 2P6PA 1SULA 4V0SA 3T5MA 3MVEA 4BIMA 1JHZA 4CMAA 1C2YA 1K8ZB 3G2LA 4QNNA 4X9XA 2H11A 4LXQA 3WGKA 4QGSA 5B2FA 4DY4A 5B57C 5JAUA 4TXNA 1ACMA 1NGSA 4G0NA 3TVYA 1QKKA 1ZN2A 3I2IA 5GONA 5HKKA 2WI8A 4UE6A 1R0BA 1EU1A 4TZ0A 2R7AA 2QF7A 4GUDA 3OLZA 1PEAA 1FP7A 4HB4A 3P9SA 2VK1A 1E5TA 1YSCA 1MO2A 2GO1A 1MO5A 1O4WA 3BWBA 3NTRA 4WNIA 2IFTA 4EJ2A 4R2WA 2YXPX 3UB2A 5BPHA 1DQNA 3QYAA 4R4JA 1KEEB 2AA3A 4YXFA 4BFTA 1OA1A 2P3QA 3GMDA 1R74A 4MYTA 3MB8A 3I5AA 4BATA 5IFKA 3JS5A 2V65A 3JALB 1U0JA 3DEJA 3GLHB 1UKZA 1T6YA 4GOJA 2QZJA 4BMVA 4XCXA 3FHOA 2Y6UA 1TX4B 3MA0A 2W48A 1SU8A 3T1QA 2MJLA 1S2DA 1NFQA 4C4ZA 3R7LA 2RB5A 4FDMA 4RFSB 4UZEA 4YP0A 3JQ8B 4PPGA 3DUFB 2Q21A 2CYBA 3OY2A 5LOVB 4KO3S 1QIMA 4R1QA 1NQVA 2GEKA 5F1YA 5FUVA 3CKYA 2H57A 4R8RA 1TW2A 1Z2PX 3E7PA 4OAPA 3DKRA 3ER8A 4H17A 3KQUA 1QRAA 2P77A 4G5OA 3ZWKA 3ZV4A 1W35A 4ER6A 1EWQA 4HDNB 2QP9X 3QFSA 1KYZA 1EZZA 3D3QA 3UOWA 3X2SA 2EC5A 2XYRA 1E2EA 2PZ8A 3EIQA 1KP2A 4I19A 1XXHB 7YASA 2E4UA 4KQMA 2XCSB 4ALNA 3D8TA 2FK8A 3M4JA 1UZLA 2QNIA 4FE7A 4HNQA 4OU4A 2X5JO 3TTVA 4JUBA 1KJZA 1ZOOA 2VWGA 2VQ6A 3F8TA 2BHNA 3CLRC 3GFFA 3D64A 5DCLA 1TKBA 5EXXA 4A73A 4BDSA 4F92B 5FWYB 1CUFA 4LWOA 2IS1A 1QG4A 4Q6WA 4M36A 4BQRA 4BP9A 2XCLA 3OQVA 4FYVA 1K9VF 3RTGA 3VR6H 2IOYA 2LGJA 3DDHA 2O8NA 1EDBA 1G17A 3K35A 4EL0A 3PWKA 4O2BA 2JAQA 4MR8A 4XGKA 2P35A 3ACCA 3AGQA 4CIYA 2A5YB 5IRCD 1M83A 2H4JA 2H5EA 5JAIA 3FBWA 3TLCA 4C14A 3BGVA 1K7SN 3ZEIA 4KPFC 3HFRA 5JH7A 1LI4A 4OGKA 2V5UA 3WADA 3O8LA 4U1RA 2XKKA 1HDZA 1A96A 2FN3A 1PR5A 3LY7A 5ALOA 2QR2A 2XTZA 4FNAA 4HDOB 2QTMA 3TI9A 3MZ0A 3FI0A 3NBZC 2CHQA 1XDUA 4BGUA 5KTPA 1HFWA 4G0VA 1FYWA 3AHIA 3BF7A 3E9YA 4MP6A 1TLLA 2LKCA 4EGFA 1WXQA 5THQA 1BRTA 4RVCA 2QGNA 3HYTA 4YCLA 2J5BA 1PSZA 4ND8A 1Q0PA 1UMKA 1ZHHA 2Q3DA 3OF5A 1MG0A 2VT6A 3RVQA 2NNLD 2WVJA 4B09A 3KPVA 2LD4A 1YHZA 1Z2DA 2R68A 2DVMA 1JIIA 3HVJA 3K4PA 4MRMA 1FL9A 3BD7A 2ATXA 3L8CA 4IL5A 2QLMA 3G68A 4LXXA 4C43A 3IV9A 1GZ6A 2ZBEA 4C1NA 2AKYA 1F17A 3R6TA 4NCJA 3VR6A 3ZLTA 3CV3A 3IHKA 4AKSA 1VTKA 2RK6A 4CQMD 3PX7A 3KE8A 3ZHQA 4TN1A 1GT91 3GH1A 4MW4A 2YVLA 2FUKA 1YRLA 3O7MA 2R7MA 4WK4B 1GPH1 4A8TA 3G85A 4EFDA 2QL9A 4DRXA 3I01M 5EWJB 4YJ2B 4B2IA 5EAIA 2FKAA 4EY3A 1DC6A 4MI9A 1WTCA 2QU7A 4YCNA 4NMXB 3BE4A 3TX6A 3CBGA 4X3OA 1QV9A 3U60B 1JXAA 3L7IA 3F8SA 1V1MA 4Q1FA 1SUSA 3OZUA 3RNLA 4XFKA 1QUEA 3GLVA 5CA0F 2W9XA 4Q7EA 4O4IF 4PR3A 4DW8A 2JJYA 1E8DA 4RUKA 5FFNA 1LD3A 3GLFA 3L4EA 4BE7B 5ULLA 1XJQA 3HR8A 1LDEA 5B1EA 1WP9A 2DUMA 1JXOA 5BN1A 3D1LA 4XB1A 2IP1A 2ZIAA 3PQ5A 2AYZA 3RQSA 4RV9A 5EHNA 3ZZ1A 2HXYA 4YRKA 3QVGB 2GMWA 3WB0A 2JLQA 4DMCA 5CFMA 2Z5LA 4A8JC 2WU1A 5A03A 4IIGA 3W7AA 1M6NA 2GZRA 1WKBA 3ZGNA 1UZAA 1IQRA 3FFBA 5L3VA 1NBAA 5I8PA 1QHIA 3PVCA 4RTKA 4RE5A 2AFHB 1QRDA 2VVTA 3BS4A 3MJDA 5E3JA 4EABA 1IRXA 3JPWA 3EZGA 1P1JA 1J39A 5AJXA 3EAGA 4X60A 4BKOA 2WT9A 2VOEA 1ECLA 1U2PA 2E49A 2WW8A 4JLBA 3V1TC 1H2BA 1DINA 4FOLA 9MHTA 4Y2UA 1U4OA 1SUDA 3O8QB 1C1YA 4PTZA 4M88A 3SHFA 4FFDA 3SEZA 1TMGE 4IHQA 2W2PA 4UM9D 2IBMA 4PC7A 3DE6X 3MT7A 1YU6A 1P19A 3PI6A 2AOVA 3I9OA 2OWDA 4ZCTA 1PDWA 1GCUA 5F52A 1M2WA 2PMCA 3RC1A 1VSBA 2A5LA 5J9GA 3DOHA 3QFTA 1GPUA 2JW5A 3UWKA 2FMTA 3BSSA 7AT1A 3WGLA 2CJFA 4EHDA 5CA0B 4FHZA 2HWUA 2FSFA 3LL4A 1QKJA 4EJ6A 4B2YA 1YFLA 4YLYA 2RGRA 2OWEA 3PNBA 2CUTA 4LJSA 4LJLA 3RCBA 1BH2A 1NRIA 2OP1A 2PT6A 2RGGA 5AI5A 1KWGA 4JI7B 1ZKDA 2C8LA 1Y5RA 1PJZA 2REXB 2XE6A 1XX6A 4IXDA 1J0AA 2ENWA 3OTGA 4EGAA 3E8SA 2DRIA 2FZWA 4OXXA 2B4RO 1GYRA 4PLPA 2B83A 3AL2A 3DE3X 4N8EA 1V8FA 1EK2A 4O4LA 1K5HA 1ADBA 1PT8A 3UAZA 2ASVA 4KQ1A 3ZJXA 4HPWA 4IICA 2P78A 3P45A 5DK4A 1OZHA 3AJEA 3IO5A 4BP8A 4F12A 1OIVA 3DZ2B 2FNAA 5K0CA 2HPVA 3E03A 3M2TA 3KFLA 2UVPB 4DBZA 2P9CA 2L82A 1CVIA 2W6PA 3MTEA 1LX7A 3I6ZA 1N1GA 3MFYA 1IJFA 4GNRA 4AJ2A 4BGVA 2EFEB 4MJLA 2PX4A 1T3ZA 2PXHA 4JYCA 3F74A 1R7RA 1PFYA 3MYYA 1H3EA 1M6VB 1QFJA 1Y7TA 1ORDA 4Y2VA 4ENSA 4PG8A 5A0FA 1JYEA 1ZLYA 4YRTA 1JA1A 4MV0A 2JLUA 4BIIA 3C1AA 1IC6A 1AT1A 2XUOA 5FOUA 4UCFA 4PZAA 3WK7A 4PS1A 3AJRA 3OZWA 5EXEA 4S1TA 1QIFA 2FEKA 4H27A 5J2UB 5EQJB 1SAYA 3Q7TA 1SEPA 3D8HA 3UT6A 2OY0A 3D3WA 1WDKA 5AIAA 4PFSA 1ZGAA 3W5HA 4DAOA 4ND7A 4D9CA 4DFDA 1JH9A 2Y1DA 3WZ2A 2BM9A 1UL1X 1JSLA 3KHSA 4NYMQ 1HWYA 4PLVA 3I6QA 1D6SA 1L7PA 1VL0A 3PD7A 2YW9A 2BFBB 4MV4A 5TB5A 3G0HA 5JNWA 3PXGA 1K98A 4MVYA 1KFBB 3B52X 3MJRA 3A1NA 3BJMA 2BZ0A 3H11B 3T3OA 4NEHB 1XU4A 4JROA 2PJRA 4M0KA 3V55A 4QO8A 5KYWB 1OFVA 1PE0A 1QHGA 1U5AA 3R1IA 4AKGA 4M87A 4B6JA 4HLNA 2ZJAA 4J0QA 2ZJYA 4QUBA 4BKQA 2WF5A 4RD4A 4PX9A 4LXTA 1P74A 1WVGA 2ZTUA 4BFXA 3Q11A 4BKRA 3T5PA 1PGPA 2EX1A 3HLKA 3M49A 3NEJA 4Z51A 2H5IA 4HDCA 4YIKA 3SCZA 3BRWD 2GFHA 3K70B 2G83A 4FLFA 4MGYR 1M5TA 4BC1A 5B36A 3FF4A 1QH8A 2C04A 3CLKA 4H2DA 1JQKA 3KOWA 3SHOA 3ZGOA 1NF3A 2FEXA 3H1AA 4QSMA 2C88A 4CFZA 1VSVA 1YIOA 3X1KA 3DZFA 2FXIA 5HX7A 3A0RB 2HT1A 1NW3A 2I1LA 5AWFC 2VUSA 2TSYB 5C1IA 4ZXPA 2YWFA 1L4LA 1K1EA 1UK8A 3CF4A 1MC4A 4RY8A 4AO7A 2PZKA 4OY3A 1P5RA 4NR0A 4ONEA 4MGIR 4WJLA 1NP3A 3IL2A 4MYRA 1G21B 5JJLA 4DWJA 3OJFA 4FVTA 2JIMA 3IHTA 4UU0A 2B9VA 5KAPA 4WBNF 1CUSA 5FTKA 4IEEA 4MUBA 1G8JA 7MHTA 1AS2A 4L72A 4C2AA 1VYTA 3RHZA 4JYMA 1E4VA 1FVFA 1NQUA 1KTVA 2FW1A 1UCFA 3L8MA 4JJGA 1J21A 2FHSA 3TKAA 1I1HA 3GPDG 4RBNA 1BA2A 3SLGA 1F1JA 1TZKA 4B7XA 1AXEA 1QF7A 3LQRA 3KOXA 3BL5A 2FCRA 4C0AC 3UMBA 2XUFA 2NVOA 3HXLA 3H2BA 5AKEA 1G66A 2BY4A 1B0ZA 3IQGX 3OF3A 4NARA 4QHTA 4NBUA 4BQIA 2ROQA 4X6XA 2Z2IA 4NEQA 2F48A 4BBPA 4EMBA 4R0MA 3D6UA 3WRWA 3E7FA 3K9NA 4FGSA 1Q0QA 2W4QA 4J91A 4ZO7A 5NLLA 5EJ6A 1ZQ1A 4JI0B 2WWTA 3LBHA 3OSZA 1OKKD 3NHBA 4KC0A 5CDFE 4DKJA 2JLWA 4PLCA 1FYDA 1GLNA 2Y67A 3UWSA 2ZP1A 4X85A 3KL2A 4LGMA 1V37A 1K3FA 2D7CA 2HU7A 3TTXA 4QRHA 3VHRA 4RD3A 3N86A 4GSLA 4LHZA 5E2IA 3TLGA 3CZPA 2UYOA 1TFRA 2AD5A 3I09A 4FFOA 3SS9X 4DCOA 3VTAA 2CW5A 3LCJA 4FS3A 4S35A 3FUVA 5EMLA 4F9EA 4WACA 1U8AA 2GPBA 4A4DA 3I9LA 4Z1MA 3R8FA 2AOTB 1TD9A 4H31A 1DI0A 1LBQA 1YRAA 2O05A 3DDCA 3BE6A 5LMUB 3TUTA 2MMGA 2OHJA 4KQHA 2VA8A 5CA1F 2OYCA 3QM1A 1V7PC 2C8KA 4HGZA 4HFRA 1B0UA 5DTMA 1P73A 1U0LA 3G2QA 5AW0A 4GNKA 3E48A 3KOZA 3F6CA 4GRIA 4ISCA 2WA2A 2CXSA 2VTEA 4HGOA 4D4LA 1XN1A 4WFIA 3IKVA 3P20A 2AZTA 1WMEA 3PSAA 1M2FA 3WMXA 5FL3A 1NLMA 1VLHA 2YFHA 3PG5A 5KSOA 3TBKA 2YTZA 2COKA 1RYZA 5C4IA 1I7CB 4CTKA 2CEKA 4BJ1A 2EJUA 2JC3A 2LDBA 4L4SA 4FMDF 4H0NA 4BVKA 5ISMA 4Y18A 2CLKB 2BMFA 1GG8A 2GN4A 1KYQA 2Q2QA 5FWDA 1HV8A 3O3CA 4X41A 4N47A 3W34A 4LE2A 1R00A 3ANLA 4D0NA 2PT7A 3Q1KA 3JWEA 2BFCA 3JASA 2W2KB 1HC7A 3P32A 1C0LA 3W06A 1VSTA 1H93A 2WJ6A 3C43A 4H60A 4TV9A 3GJ8A 4ZQBA 4CVNA 4HY3A 4LG1A 4MS1A 4PHTA 3U62A 4M46A 3JZDA 5EIAA 2XMGA 5C3MA 3L6DA 1U7OA 1OX4A 4CI0B 2XBUA 2B6HA 1X1EA 4RANA 4WKNA 2D2EA 2QXUA 3QW4B 1QHEA 5BN5B 4LNHA 2L0XA 4BV8A 2R1TB 3U7QB 5BSTA 4R1PA 1VMEA 5J9FA 2Q3EA 1E20A 1Z3IX 4FJ1A 2VTBB 5ETJA 2FPIA 4YV7A 2FUEA 3OA0A 2O52A 3L7KA 3CO0S 2HIHA 1LQTA 3TRDA 1KQGA 3EC7A 3REFA 1K9SA 3IDOA 4KLCA 2Z9CA 1XEXB 5HJ7A 4Y6QA 3WAJA 3M4ZA 3GFSA 4LZJA 3UWPA 1QBGA 1YCGA 4F3TA 2HK8A 3O4GA 2PCJA 3NO4A 3DAYA 3TQSA 3UT0A 3WGGA 3COZA 2WU3A 2ACKA 3JU3A 4C2UA 1MA3A 1P1HA 2DBYA 1DWPA 3HZRA 4F72A 4HWKA 1YMVA 3D7LA 1TI7A 2B5VA 3GDFA 1JJIA 4MWEA 2RHGB 5ALFA 2PBRA 1E3WB 3FMGA 1S8FA 3GNQA 3GNSA 1VDZA 2BE9A 3E22A 4AX4A 4CEHA 2CVPA 3L5KA 5CNJA 4ITUA 4WXPA 3VDRA 5LOVF 2C4TA 5TVGA 5K3EA 4LBZA 3JD1A 3TZHA 1OIXA 2WJHA 1C29B 2IEYA 5EVCA 4CM1A 4D9KA 1WETA 3OCXA 2IDMA 2W2OA 2OC4A 3WJ7A 3ZNOA 1XT6A 2A0XA 1Q1BA 4K87A 3TZQA 3AO0B 1N5MA 2NSLA 1OBCA 2FAXA 4PC3A 5IVDA 4Q16A 3RF6A 3RYIB 2VBFA 2GD1O 4EM6A 3KXIA 3EVZA 1M2OA 2OFPA 3F7MA 1YQXA 3AYXB 4KMRA 4WLEA 2HR1A 3SXUB 4CU5A 4CCYB 3LUKA 5AOAA 1MTOA 2JJ1A 4JLWA 4RO0A 2W2VA 5LZ7A 1BHO1 1RQRA 2MIIA 2R5WA 3KZOA 5F7JA 3LQFA 1KC1A 4B33A 1OZGA 4PYMA 5F5LA 4CG1A 3K9GA 1P18A 2NV0A 3OX4A 1K0FA 3UJ6A 3ZBTA 2RHTA 5DB4A 4D3ZA 4E6PA 3PB3A 5CEJA 3DTTA 5BNFA 2TS1A 2GCOB 2QRUA 2B20A 2Z58A 4N7JA 4WLVA 1M76A 4G2TA 3SF8A 2YHBA 4EX7A 2HJWA 1I6WA 2ZJ0A 3EJWA 4LDRA 2BV3A 1CG6A 2A9VA 2AFHA 1N9ZA 1QCDA 2I5PO 1XZPA 1NMYA 2GSDA 3ZLUA 2HRQA 4BV2A 4PR0A 3KQKA 3LNCA 4B3HA 5C2JB 1Y33E 2I3AA 1NUUA 3H6GA 3ZNNA 1H05A 1G7SA 4DNXA 4NNOA 3IBYA 4OH1A 4ALLA 4L27A 4CM9D 1YVUA 1UBLS 3DVLA 4KN6A 1ZH4A 4L8WB 3TD2A 1AY0A 3L2OB 2W37A 5A4IS 2QQEA 2O50A 3ML1A 1GPAA 2MT9A 1GNPA 2QVGA 2FMXA 1Y98A 5AI6A 4KVGA 4KXXA 1ENZA 4NZPA 1CW2B 2ECKA 4TL6A 3PGXA 4Q9NA 4WZBB 5GADl 1Y7LA 1WOYA 4DCMA 4KXWA 4DCJA 3DMTA 3DH0A 4I55A 2BBSA 5A6SA 4N0PA 3IVCA 3KSBC 1UKCA 4E7PA 1T5BA 5KUTA 1GZ3A 2VCEA 3B53X 4CIBA 4P0QB 4BN0A 1WDLA 1GEEA 2VWQA 3IVRA 1QE3A 2JGEA 3W1EA 2UYGA 2YWJA 5I7WA 1V1MB 1O96A 5E7IA 1HZZA 1Y9ZA 4IH9A 3PV0A 1GPJA 3GPIA 1RZRD 3PEEA 4DZTA 2FPSA 3G0CA 3GWZA 1UDRA 1DKOA 1Y8RB 3IDAA 1ONSA 2Q1UA 1S9DA 2Y27A 2ZGVA 3L8EA 4A26A 2GVDC 4YNBA 2GILA 1M1NA 1SVOA 3WNCA 3UYLA 3COVA 4DUZB 2YZMA 2WDZA 2PKQP 4OJMX 4ZU3A 1HNWB 1U9IC 4NMMA 5BOVA 1AZWA 1O6BA 3GAFA 5CDHA 4AG3A 4LDAA 4XIFA 1PS8A 3BGDA 1SELA 1QB8A 1PR0A 1PUJA 2PQ0A 1AGRA 3ID6C 3PNSA 1VBFA 4WLFA 4AZTA 3OTHA 1KE2A 3ZQUA 1KI8A 1O87A 1PGNA 1RC1A 4H7KA 3VPFA 4BBZA 5CFZA 4EFLA 1KJJA 2YKGA 1W5TA 1E9SA 1VPEA 2VUIB 3W5UA 3DG9A 3VVCA 4AJKA 1CFJA 3S1LA 5IAKA 5I7HA 1R9MA 3OZEA 2V7UA 1ZZGA 2GD6A 4LYAA 5EKTA 5JTTA 3AONB 5DBGA 1U28C 5ALXA 4QQNA 1DCFA 3OFVA 3P52A 2R2GA 2YJNA 2OZLB 4AJJA 1A82A 1HRDA 4LXIA 5CT6A 3PL1A 5TGTA 2FRXA 3LBNA 5EZ5A 5FA6A 4BX2A 1MABB 1S2IA 4IAOA 3I5UA 5AVRA 5AKLA 5L3QB 2JASA 3C7DB 3CC8A 3PUJA 3IDQA 4HRYA 4M53A 3T5CA 2C97A 3SK0A 1U0NA 3V3TA 4JN6B 4LA4A 4XIJA 2A9QA 4ZGBA 5B3KA 5HQ3B 2X40A 4TLEA 1WKCA 2IS6A 1LQUA 3OPVA 3JVVA 4HAXA 1TM3E 1Z74A 2BDEA 3OG9A 1XDWA 1Z37A 4ROSA 1BG6A 2AVNA 5F5NA 3VFDA 3WDKA 3ZE1B 1E9VA 2PUJA 2GRAA 4B1FA 3E5NA 4WGFA 2WNHA 3O83A 4MGZR 4PAMA 5I7OA 1CR2A 2WKSA 4KFTA 3GGCA 3LV8A 5KJEA 2XVYA 2Q4BA 3VPHA 4PAGA 3ZX5A 4D44A 4DOMA 4EVSA 5KHLB 1ZVMA 1N3LA 1ZKMA 2HCBA 2IHTA 2ZANA 3CWQA 2CXRA 3MWDB 4II3A 4MMXB 4MP3A 1FTWA 2DAPA 2BP7A 1YR8A 4PVDA 2H63A 3H5VA 2V3WA 2C9DA 4IDBA 1C2TA 1CJVC 2GVNA 2QE7A 2XMZA 3HBLA 3SIXA 4UPDA 1IXZA 3H9GA 1E1DA 4PZ0A 4Y98A 3HCCA 4D9HA 3F9IA 4KQ2A 2HA2A 4U5XA 2ZIXB 1K66A 1QOZA 3AOGA 1RHRA 1EX1A 3WLFA 1IWOA 5K3FA 3EGXB 3KR0A 3EXFB 3Q88A 3BK7A 3LCRA 1F20A 4KXVA 4UAJA 3AVYA 1LBSA 4BNMA 5KMGB 4J0FA 1T5LA 1BGWA 2FFJA 4OBWA 5CCEA 1ZRSA 3GGJA 3QK7A 1WB6A 4XOIA 5BVHA 3EVTA 4FQ5A 1W4CA 4LF4B 1QGYA 1ND5A 2Q5LA 4XPZA 3BMCB 1DAHA 3QU7A 2QE7D 3E3MA 4QGGA 3BZBA 1C3VA 3FZQA 3MWYW 2CLFB 4D74A 5FUMA 2G04A 5HF6A 4R40A 4FZJA 3ZBPA 3VR4D 1MVOA 1JT9A 4AZVA 1H2HA 2PD4A 3IUBA 1P2SA 3IVMA 3ZWWA 4QUDA 1M74A 2P62A 4ZU6X 1UAYA 3P9NA 3BWXA 2AS0A 5EKXA 4AKEA 4KBYA 3O93A 3ZXSA 1JKIA 4Q3AA 4KDEA 5U9CA 3U5ZB 2OO5C 3EFBA 2HCTA 1P6XA 3GWGA 4R71A 1GDTA 4RIGA 4AB1A 5H80A 1Y9AA 4G8DA 1YHYA 5JS1A 3WISA 1QZXA 5BN3A 5CDUA 4POOA 5JSFA 2GNAA 2D5AA 4TV8B 1FP2A 3GP3A 4CKWB 1PJTA 1Y81A 1Z56C 1G41A 1TJNA 2RKBA 3GJ3A 3R75A 5F2OA 1YQDA 3UT5B 3L41A 1H8HD 3LLCA 3SQMA 4UPEA 4DMHA 5HKOA 3UMJA 3GUHA 1YB7A 3I9JA 3NNNA 4XD7A 1YC2A 1REQA 3FTPA 5DASA 4UTPA 2AHOA 3PUKA 2OFOA 3NT2A 4MW5A 4ZO8A 5TDHA 2PNJA 3SBOA 3VJMA 3FG9A 4NJMA 3B3JA 4OBXA 4OXKA 3THXA 5KSWB 3Q2KA 7REQB 1PEDA 3QYJA 4MVJD 2CVHA 2XTAA 4JBXA 3OLWA 5CGQB 4Y1RB 2WT4A 1L7DA 1FLVA 2OPHA 3ZDBA 3PGMA 2O5EA 3BHJA 1NONA 3KPJA 1U02A 4RM3A 1XTRA 3PLRA 3Q85A 2NSJA 4WD3A 4ER0A 4M1OA 1I7LA 4MW6A 3ZR4B 2NU7A 3FWYA 3B78A 1NIPA 5LJIA 1I3MA 2A7QA 2QUHA 1RAHA 2PT9A 4OUDB 2VDJA 2WDPA 3E5RA 3OJ0A 4IEFB 3ZWBA 4UHFA 4DDUA 1HQKA 3KO8A 4I2NA 1U7WA 5KX5F 4KQKA 4QKQA 1IRIA 3I37X 3H9CA 4O2LA 4YP1A 1HDGO 3GEBA 4MA4A 1RYYA 2E89A 2KLHA 1RI1A 3QOFA 3QUCA 3RIEA 1NJ6A 5I7UA 3FGNA 5K0FA 1L3BA 3HRIA 1U3VA 3H4IA 1F6WA 3NOXA 1WAMA 1M6WA 1EK6A 2QN3A 2DJ5A 3CE9A 1JKJA 5AKJA 5EHZA 5ARDA 1QTRA 3M2PA 5HKAA 2ZETA 5A04A 2BBTA 5EPUA 4IX1A 1XNHA 1PR6A 4K05A 1L4MA 5TEVA 2H6EA 1J1IA 4W4TA 3CEHA 5LP6A 1RHJA 5FF9A 1BD3A 1XGKA 2XRYA 3EPPA 1YXMA 1MQSA 2YMPA 3PA6A 5IABA 1KY2A 5I9NA 2ZB2A 5BRNA 5CB6A 2H4HA 2J4DA 3AZQA 3IDSA 3DYVA 2BKUA 5IBRA 3RFTA 1BEZA 1YR3A 2G0AA 2HA6A 3CE6A 4XXHA 4DMRA 1CJKC 1JKFA 5DNAA 4LXGA 2C99A 5F12A 3FMPB 2X1VA 1STOA 3GC6A 1KAMA 3LHFA 4XA8A 1H65A 4G41A 5D00A 4CM3A 1U6IA 4N6OA 4TS3A 3ENZA 1G8GA 3SMVA 2NSYA 1GHTA 1QK4A 1TDJA 3EBPA 4ZRMA 4LHEA 3VISA 1OVMA 2XXJA 1ZRNA 5DN6A 5LPNA 3ADDA 3ZHUA 1TYCA 1FNMA 3QMPA 4MI3A 4XQ0A 3LKVA 4WBSA 4CKZA 2J31A 4WXEA 5H8WA 5F2KA 3N6VA 1SH7A 3TCXB 2VZ0A 1YT5A 1LZLA 3FMIA 2J41A 2UVQA 1AV7A 3EFOA 5JQGA 2GBLC 3RS8A 3AKYA 4OJQA 1EUYA 2IV2X 4AY2A 3RHFA 4WXHA 3UATA 2IXBA 1E2IA 3JARA 3F7OA 1Q1NA 1Y8QA 1KORA 2YS6A 4L16A 3RSCA 1DGQA 2OFXA 1OBFO 1BDHA 1WUIS 1A4IA 3R3WA 2FOLA 2MTBA 2ZB7A 3U3XA 4Q4AA 1OBHA 3TQFA 2BF7A 3TQRA 2QE6A 3DDOA 2H0AA 3BIJA 2RHOA 3AVQA 4RPIA 5K3BA 5DULA 5FI0B 4A6EA 5AESA 1Z8FA 4NOLA 1DO2A 1IBLB 3T3PB 4LJRA 3V7WA 1C1DA 5DWVA 3UN1A 1OWNA 2WQ6A 2QJOA 5ITZB 2IKQA 4AYTA 3T3MB 1USGA 2AI1A 5FLXA 1O8CA 1S89A 2GM5A 1E2HA 2Q45A 2VTVA 3TW8B 1OB5A 3CEJA 4LOJA 1MABA 3GJYA 1PK8A 2LR0A 1H6DA 2PH1A 2VUHB 2GAIA 1QVRA 2YS7A 4B6FA 3LOQA 3O95A 3IEVA 3OTIA 4IG9A 1M6YA 4G9GA 2J9GA 4XX1A 4G81A 5CH3A 4JFRA 4ZC1A 4EY7A 5SY6A 2ZK7A 4POAA 4B6RA 3EPBB 1KZ6A 4TRMA 4KV7A 4BCCA 1X80B 1ENYA 3NKFA 1Y1QA 3R6WA 2SKCA 2O2ZA 3KTFA 3L9WA 1DAIA 4RU1A 2C2OA 4FFNA 1TGVA 5TS2A 4RY2A 1I5EA 3EDRA 4JJ7A 5E1OA 2GZ2A 1B8OA 4OLBA 2HJRA 3UW1A 1PLJA 2KM1A 2C1EA 3G8AA 3K1ZA 3NV9A 3LLVA 1LY1A 2NYAA 3D8SA 1NX6A 5K8CA 4HPXB 3D7NA 2VATA 3OAAD 3B6JA 2AD1A 3T7TA 2WOJA 3MWEB 2XUGA 4KH1A 3KKKA 3QX9A 1HE4A 1EXNA 4NBLA 4PYLA 4D57A 1M1NB 2P68A 3F4LA 1CS0A 5HQTA 3F90A 2CZGA 4J7CA 4OHBA 4TUYF 1FSZA 4V3BA 4KR9A 2IBSA 4EW6A 2PH3A 3VC2A 4GI5A 3OY7A 4GZ6A 1B6GA 1F38A 1YVRA 2YY6A 3IALA 3UJNA 2OUIA 3QKWA 1XZAA 4N5DA 5FPYA 1I6LA 2AMYA 1APBA 3ROTA 2RMKA 1E2MA 1SMKA 3LDUA 1S2MA 1UK6A 4MWOA 4A82A 2Y66A 1ZGGA 2HV8A 4LTDA 4UEOA 4BQOA 1C9JA 1UJ4A 3ZWPA 1J8FA 1HG0A 5SYMA 1CR1A 1HDOA 1VE9A 2FJUA 4LV8B 3PQDA 5GJVC 4WN3A 4KX5A 3L0BA 1N34B 4NCBA 1TRKA 1AQYA 4PZDA 1HDEA 1NR1A 1O03A 4G5GA 3RUPA 4INZA 3DTYA 3ZCXA 3TRHA 1K7YA 3CGWA 1EUCB 3GLRA 5FWXB 5U4QA 1W34A 1CT9A 4KWTA 1E5VA 2Q41A 4WUVA 2YUIA 5IKOA 5HBRA 2W6QA 5ALRA 4E13A 2BPOA 3ONWA 2X0IA 1JSRA 3HXKA 5D3KA 2F43B 3N0VA 1HOXA 1VCNA 4A9AA 1LLCA 4GHWA 4DR1B 4Z8XA 5F9FA 1N2IA 1TW3A 3IRUA 1SR8A 1PO7A 1PNRA 2OESA 1RU3A 5ERXA 4P93A 2B8NA 4DNOA 4PO9A 1BCSA 2ZIUB 3NHFA 2YXNA 4UEKA 4E07A 4NDZA 3CISA 5FDFA 1JR3A 3OE5A 3NHAA 4LHWA 4PGHA 1NUPA 1TIKA 1KKMA 4EA6A 4FGWA 4NY1A 3OT1B 2HA3A 3QFCA 1MAUA 3LXRA 3RABA 5ALDA 1BHSA 4P5DA 2I2FA 2VF2A 2C9OA 3UO8B 4Q7MB 4OMDA 2PS9A 3DL0A 3H04A 3K1AA 3KJIA 2AE1A 4U9UA 4MYDA 5DIZA 3RYIA 1DXOA 3ZTTA 3ZWOA 5DNEA 4ZVTA 4HAOA 2Y92A 2FWIA 4N0QA 1QGAA 5HBGA 3EZFA 4EFMA 1PEKE 4QVGA 2H54A 3OD5A 2UYHA 1Y3IA 5JXGA 4RACA 4UBIA 4EMSA 1GG5A 1SB9A 1NF9A 5K0NA 3RSFA 4CL8A 1JPNA 5I6DA 2OKGA 1FMCA 2JPDA 1U8UA 3N8GA 1DAOA 5JMTA 4CF6A 1R0KA 4JXKA 1IM8A 1MT3A 1XRRA 3TRIA 5A4FS 3HDTA 5AKKA 2VNJA 3QE3A 3OI7A 2PO7A 3E1KA 3JVDA 5E0OA 1G4UR 3FPKA 2BRUC 2L42A 1RRKA 5L53A 1FP4B 3K8ZA 5FPPA 2I6FA 5C37A 1RM3A 1E61A 2NT4A 3D5QA 1ECCA 3GG9A 4KAXA 4LHXA 2Z9DA 5IF9A 4JJZA 5L8VA 1PT6A 3RUDA 1L5MA 2H29A 1ZHFA 4JUDX 1IIBA 3UJ8A 2HJHA 4YRJA 5JCZA 4RD2A 3IDFA 3G6WA 3LD9A 3JVUA 2NZJA 5FA8A 1ZK1A 2ZEJA 3N2GB 3CLHA 5KQSA 2EFCB 2ZTMA 1EZ1A 1ZIDA 4N3NA 2ZYDA 1T4MA 1ZC3A 1FFWA 4BO0A 2CV2A 2EQBA 2WAYA 2C61A 2B36A 4X3PA 2HTEA 4G26A 4WOKA 1F8FA 1KFKB 2ZUVA 2I9PA 1M33A 3KC2A 3NVAA 3TD9A 3E9RA 1KKLA 3TLZA 3B12A 1AKVA 1QMPA 5LP6B 4HDRB 1BW9B 1GQ2A 2NG1A 4XVCA 1O95D 2G76A 1UFKA 2XT0A 1ZM7A 3SXJA 1B8NA 3T1HB 2QD4A 3MPUA 4GVXA 2YMMA 4XDHA 4JENA 3LGSA 4C76A 1IAVA 4D3DA 1OI7A 1F5NA 1FQOA 1H5NA 4ME6A 2V7EA 4LDZA 4QDKA 5DN9A 3RLFA 2GRUA 2RHDA 4ENQA 3UAVA 5T64A 4PLFA 4QAJA 1II9A 3KUCA 1UDXA 3KWJA 4KXYA 4E14A 1AGXA 4R51A 3L7YA 1UZMA 1GDDA 4GX0A 3KEQA 4E2WA 3FOBA 3C15C 4WKCA 1Y3DE 1RACA 2WWYA 1FZTA 4KQGA 1ZGZA 4TSRA 5JOQA 5LDHA 3OJWA 4M0LA 1A71A 1OYYA 2N0SA 3S6JA 4IZHA 2OQRA 4LJ4A 3NVKI 1GPBA 3HKDB 3QNUA 4R1TA 5CXXA 5TMEA 5JJCA 4NCIA 3OPYI 4G4GA 1I14A 1RKQA 2BFPA 4LSZA 4Q1CA 4EB6B 2WUDA 3KUXA 2DR3A 3M82A 5IHXA 3FFTA 3D6MA 3I1IA 4ML3A 3UCFA 2A30A 2EWWA 5JWOA 2E87A 3CQ9A 3QKUA 1GGJA 1T1GA 1XJ0A 2C78A 1A98A 2P27A 3EDMA 2HWYA 4LHSA 1L5HB 3AR3A 1I4OA 1U5CA 2WZCA 1VIMA 1AUPA 1T0UA 5BT8A 3WQRA 3EASA 1FS6A 2AOUB 4CMKA 1YL7A 4QDUA 1QHFA 2Q0HA 4K1LA 1NMEA 2YASA 5AOCA 2ZOSA 1FPQA 3AF4A 4R2JA 1XKQA 4KFRA 2XRFA 4QBFA 2G25A 5DKFA 4RY9A 4B4OA 5JZMA 4FJ2A 1MOPA 2WVHA 2JGKA 3I12A 3PDHA 2GK4A 1FMJA 4FZ5A 3H0CA 3LF2A 3SPXA 4X8OA 2XYVA 1IBMB 1SZCA 1ZW1A 1IH8A 1DKLA 3G13A 2RCNA 1ECFA 1HF3A 4LZLA 3VYUB 4ER3A 4NPAA 1ICIA 2XRZA 1Y6ZA 3G7SA 2AW5A 3HDJA 1E6LA 4BUJA 3ZTYA 1T1EA 4MEBA 4DGSA 2F90A 2VSYA 4TMZA 4MQMA 3RAGA 1T2DA 1UIRA 2XB4A 3QVWA 3BA6A 4M9SA 3ESXA 3EGEA 1C3EA 2O59A 1P2UA 1RYNA 2JAWA 2PPLA 1EX7A 1SVKA 4KI0A 3K92A 1EQUA 2YXEA 3CRZA 4UD2A 2OUKA 1UUFA 3BQ9A 1QC5B 5JLJA 1CDEA 3T15A 2G82A 3T41A 3D4OA 4TL9A 4AXXA 5CYOA 1B73A 1CQZA 3M1AA 3GLFB 4KQCA 4R9RA 4ALIA 2XCRB 1JHQA 1MJ5A 1YL5A 1NUSA 2HN9A 3PD1A 4F3NA 2OXCA 1L2TA 1TPYA 3OWHA 3EDOA 5C51B 1E63A 2QVBA 1JH8A 3QH4A 3R5TA 3UENA 4E30A 1Y8ZA 1BE8A 3RYTC 5CEFA 1P62B 3FKSD 1AUXA 1NDHA 2I0FA 2E37A 1SUFA 2QYTA 3CLVA 2BFDA 1Q92A 5FHQA 3GT0A 4E2YA 1E0DA 1LWOA 2WPDD 3IIKA 5B1SA 1ONNA 3MBKA 4GPTA 1AKMA 2OSBA 1KFJB 2WTXA 3NM5A 4TQ9A 3ZE7A 3FYUB 4F2WA 1RRVA 3EY4A 1KQOA 1U8XX 2GI4A 5K3FB 4C04A 1Z47A 3PT9A 3PGVA 4BVEA 5EJ9A 1RVDA 2PR2A 1PT9A 4EAAA 2HMSA 3NIGB 3M6VA 5IP5A 1FFBA 3BHIA 3K0HA 2GBFA 3EC2A 3Q5DA 2F43A 2RH4A 1ZCJA 1HRKA 5HXAA 5BVGB 5BSWA 4DRYA 1NASA 2G67A 3FKJA 3MWDA 4GGMX 4UJ5A 1B8PA 2B1IA 1VB5A 3G5UA 2ZRLA 2WQZA 4GZMA 4KSBA 2FX5A 1YDEA 5D5HA 2B4YA 3JZMA 3UF0A 4DN6A 4EVIA 4UZSA 4LY6A 1YI8A 3LG2A 2R60A 1BKSB 1E58A 4FOPA 5BNZA 1YCFA 3MSCA 2FLWA 2YBEA 3IE0A 3NHRA 5TQ0A 5DLEA 5BV8A 2QVYX 1S2LA 3W05A 2XPCA 4X8LA 5EJ7A 3D3WB 3KTOA 3HKEA 2QI9F 3DEAA 5KSPA 3G9ZA 4MUKA 1N2CB 3DOEA 1E18A 1D1TA 2HLNA 4FJ0A 4QPJC 1XEFA 1PN3A 1FNCA 5A9RA 5TVKA 2YDXA 4N12A 3AIIA 3COSA 5LBTA 3H86A 4W8GA 2ODTX 2QNBA 2FZKA 5DM0A 1AMUA 1T2AA 2IU6A 2XUJA 3ETCA 1RXCA 4ZTUB 4JOBA 1E3JA 4M8LA 5TF0A 3KVNA 2JIZA 2O3SA 3D5TA 2ADOA 2SBTA 3DZ4B 2WG1A 3MMXA 4OI4A 3IESA 4J4BA 2OFFA 1MOZA 2VAVA 4R9NA 1AQ6A 3CT6A 4KQEA 1YKGA 4K40A 3HCPA 3R9XA 3K6JA 1IVNA 4IDGA 3W5VA 4YDQA 5EEGA 1IOZA 5FYQA 3S5JA 2PX8A 1ZJWA 4QOGA 3D7KA 2OCAA 4U0KA 5AK6A 3ZH9B 1F1BA 4FI3F 3IR6A 2QM8A 2BMEA 3GFRA 3F5MA 1K3TA 5IJWA 1P9RA 1R4NB 4D96A 4H3KB 3FX2A 4RLQA 1TCCA 3LQ1A 5IU6A 3CG4A 2FPXA 3E4DA 1JIQA 3OOYA 1KI3A 1N33B 3TUJC 4RS3A 1GRNA 4UBLA 4XAQA 4B85A 1BOFA 1C81A 1Z4OA 2OKCA 4PZPA 4PHCA 2F8MA 1L9XA 1LTHR 3KKEA 4L0CA 4OEHA 3NTVA 1FS4A 3ONDA 3WL5A 5AH0A 1HA3A 2PMWB 3LHKA 4CIXA 3AM1A 3L7MA 2ACWA 3LX8A 3MT8A 2PUWA 2DLCX 3H2HA 4LX8A 5ITZA 1ZD2P 2C4HA 2DX7A 2R7LA 2ZBPA 2ZTSA 1DCKA 3CMMA 2V98A 3IXMA 2E48A 1WIWA 1NL3A 1LNZA 2VK4A 1ORVA 3KYJB 1I2DA 3PVSA 4L6CA 4D43A 3F1KA 4E11A 2Y71A 4HCJA 4MZXA 4J4HA 2JCGA 3NRBA 2HZBA 4OOEA 2Y68A 5JPIA 2ONYA 3A06A 2XWBF 4G4IA 1MU0A 1FF9A 1RVV1 3O03A 4K0RA 2V4MA 3ENQA 2VTKA 2TMYA 2WICA 4INPA 1WW8A 3N8KA