4XB2A

Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with nadph
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
b'MKVNISIFGFGTVGRALAEIIAEKSRIFGVELNVISITDRSGTIWGDFDLLEAKEVAESTGKLSNIGDYEVYNFSPQELVEEVKPNILVDVSSWDEAHEMYKVALGEGISVVTSNKPPIANYYDELMNLAKENNAGIFFESTVMAGTPIIGVLRENLLGENIKRIDAVVNASTTFILTKMSEGKTLDDAIEEAKSLGILEEDPSKDIDGIDAYYKAKILHWVSYGEPPEEEERLGIREVRDARNVRLVAQVSKGKISVKPRKLSSDNPLLVEGVQNAAVIRTNNLGEVILKGPGGGGRVTASGVFTDIIKATLKFPNLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of a Hyperthermophilic Archaeal Homoserine Dehydrogenase Suggest a Novel Cofactor Binding Mode for Oxidoreductases
doi rcsb
molecule keywords 319aa long hypothetical homoserine dehydrogenase
source organism Pyrococcus horikoshii ot3
molecule tags Oxidoreductase
total genus 108
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4xb2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xb2A01
1J6UA 3RCBA 1LDMA 2XXBA 3AY3A 3EUWA 1W4ZA 4FJ1A 3L4BA 3P5SA 3VZRA 4XEHA 3D3EA 3ULKA 2C7GA 3H65A 4YAEA 2CVQA 1LDBA 4MVJI 4OO3A 5FF9A 1GCUA 3S2EA 2J5QA 1YGYA 4R41A 3WB9A 1T26A 1A4UA 1E0DA 4J1SA 4WCFB 3ZU5A 5BSHA 4GL4A 2DBZA 3QW2A 1LSJA 3V5NA 1JWBB 3FF4A 3WIDA 2C5EA 4CLRA 3MJVA 2UAGA 4O63O 1HDRA 2E49A 2DC1A 1EBFA 3WYBA 1BWSA 1K6XA 3NUGA 2TMDA 3EMKA 2JCVA 5G0WA 1EVIA 1MGOA 4YJGA 5DCUA 1L1FA 1U3VA 3GNTA 4XD2A 5BT9A 1E1MA 3F4LA 4R5HA 3H2ZA 4XYBA 3HDYA 3OJ0A 2JD2A 3GFBA 4A2CA 1R4MB 4N54A 4CMEA 3RROA 2O4UX 2EKPA 4BO0A 3COSA 1NQOA 1PZFA 4L73A 3TRIA 4YB8A 5G0SA 2NACA 4J0FA 1V3VA 1LDNA 1G6KA 4C7KA 3QA9A 5DP1A 4IGFA 2X22A 1I3MA 1LI4A 2UDPA 4N5MA 1PJLA 2VOEA 2GN8A 3K6JA 4W99A 2HMUA 3L6DA 3FNFA 3O8QA 2F00A 3VAZA 3PJEA 5K6AC 4P4LA 3WOHA 4JXKA 3R1IA 1I2BA 3KZVA 3VPSA 3D3WA 5LDHA 2YFQA 3JD4A 1KVUA 5I7FA 5EQDA 4JJIA 3KV3O 5B4UA 3JQFA 2ZCVA 1B14A 4FGSA 2PA3A 2O3RA 1ADGA 1ZMOA 3K30A 5TSDA 4LSMA 3KHUA 3GVPA 5DBGA 4GWKA 3ABIA 4RQUA 4JBIA 5I7SA 1SB9A 4I08A 4HP8A 4W7HA 3BTOA 3FWZA 3QY9A 3DEYX 4CM8B 3DTTA 1NXQA 2C2XA 3ETDA 6LDHA 4NFYA 3BMOB 3RASA 2AG8A 2NLOA 4BNKA 1N1EA 1ZUD1 2VZ9A 5G2OA 3WGIA 4HX5A 1GUFA 4W4TA 1H0KA 1IPFA 3NJ8A 5EJ2A 2IEBA 1YJ8A 2VOJA 2J8ZA 4CM3A 1C0PA 3AOEC 3LDHA 1YB1A 5ICSA 3H4VA 2PFGA 5BNTA 1PL7A 4AJOA 3U4HA 5I7VA 3QE3A 3ADPA 2JJYA 3HDQA 4CJXA 3FTPA 3NGLA 1YOVA 2Q1TA 4NDNE 4Q39A 4UVEA 3VTFA 1HL3A 1HSZA 4EI2A 2O3SA 1YB4A 4IDEA 3O26A 4W7IA 3H5RA 4QT0A 5ENDA 2CNBA 1A7AA 3FNEA 4E6PA 5EL0A 1PR9A 3EYWA 1ZSNA 2PK3A 1UJMA 3M1LA 3KTDA 3ZZNA 5KVCA 4Z6KA 1WAMA 4Z0TA 3D5QA 4KWIA 4U8GA 4TZTA 2J3HA 3GHHA 2O2YA 1EFKA 4CMGA 3NDJA 4L76A 4RVDA 6ADHA 1B8PA 2EG9A 5EN4A 1SAYA 3ETEA 3VC7A 3QP9A 4BMSA 1GZ6A 4U0JA 4G5HA 3DBHB 1VJ0A 2Q2VA 5JXWA 5JYFA 4ESOA 3U4DA 4WNCA 1DC3A 5I7EA 5K0ZA 4CM9A 2CMDA 3KSZO 4OXNA 3T7EA 4B4UA 3IJPA 1LSOA 2B5WA 4TROA 5DZSA 3UW3A 1DO8A 3PZRA 3ZV4A 3AI2A 2ZIZA 1IY8A 4BNXA 1GUZA 4CUJA 3CUKA 4XYMA 1NWHA 2VHZA 1B8VA 4MPDA 4U6SA 3BTVA 1DRWA 4IQ0A 4Z0HO 3U9LA 2OP1A 1A4IA 2NNLD 4PRKA 4G81A 1NR7A 1NVTA 4D3FA 4CR8A 1Z6ZA 3RUCA 5LC1A 3VH3A 3H7AA 4E5NA 3NX4A 4Z9YA 3WYCA 4LMRA 3NV9A 2Z1MA 1PJ4A 1NQAO 1R0LA 3WTCA 2XAAA 3QVXA 3FSRA 3PP8A 4TVOA 3RC2A 3E18A 1VRWA 1B26A 3KEOA 1PGJA 2WEKA 2I3GA 3GC6A 3AI3A 5LCXA 2FMUA 3RAJA 1PZHA 2VNSA 3PLRA 4BNJA 1LRKA 4HXYA 5L51A 1XHLA 4Y98A 4Y9DA 1U3WA 1YVEI 4HY3A 5U1PA 1K89A 3NTRA 5JS6A 4A27A 4AJEA 5IZ4A 4GQAA 4OOFA 3OA0A 2HSDA 4B79A 3TFOA 4WLVA 1NASA 2NU7A 3EAGA 4M8SA 3JYLA 4Z9FA 2W2KA 1DOHA 3U4IA 2W98A 1FMCA 4WCDA 4HADA 3ZWPA 1SOVA 1U7HA 1PL6A 1M6WA 1NFFA 4MOWA 1I32A 4YJFA 3K8ZA 3JSAA 1AXGA 3NDRA 1N9GB 5JCJD 4KOAA 1CQIA 9LDTA 4WK6A 4FFRA 1GADO 2VYNA 3HWRA 4UVHA 4DVJA 3G3EA 7ADHA 2WJPA 3STHA 2FR0A 3F46A 4TRMA 3W8EA 3BHIA 1MB4A 5TLSA 1U7TA 2GSDA 3GRPA 4ZRNA 4BNLA 3NT4A 3INTA 4PIVA 2IZ1A 3AY7A 2C59A 3EZYA 1Q7GA 5COAA 4WLNA 2BF7A 2EIHA 3EHEA 1SCUA 1DJQA 1U3TA 2CF5A 1N8KA 4DMLA 5IN4A 2Q1SA 1DLJA 4Y6RA 4BNZA 1ZK1A 5FI3A 1Q0HA 5KVQA 4DYVA 3CZRA 1ZZEA 5ES3A 1PGQA 2QHXA 3HHPA 4A0SA 1QYVA 1V9LA 5CFZA 2GERA 1A27A 2GASA 1A72A 3TZ6A 3HZZA 1BXGA 2VRCD 3AWDA 3S2GA 1QYDA 1K3TA 2Q45A 1NWCA 5I8WA 4ALMA 1RM5A 1SNYA 4XDYA 4EUHA 2FZEA 1T4DA 1QYCA 3T4XA 3F5SA 1PS9A 4GX1A 3ZN2A 5HRUA 2E6UX 3DAPA 3JYNA 2B35A 2XPCA 5JSFA 4CR7A 3WX0A 2O7SA 5L4NA 2IRWA 1VL8A 3I9OA 5L4LA 3PWSA 1A7KA 3DZHA 2Y1DA 1CRWG 5J23A 1KVQA 4XQEA 5IN5A 1T24A 3ORFA 3AUUA 2EP5A 4BMVA 4CMEC 3ZI0A 1H2BA 4ZQGA 3RUHA 1XKQA 5TJ9A 1T25A 2GUGA 3DBRB 4CL8A 1LDEA 1CIVA 2EJWA 4UVIA 4XGIA 3LZ6A 1K6IA 2DU8A 5TF4A 5L95A 3PPIA 4L4SA 5L7WA 1BXZA 1DIGA 4CMIA 1ML3A 4EGFA 1E7SA 4OQZA 5A9TA 4GPD1 1JKJA 4O1MA 1UZNA 1ISMA 1R4NA 3BMCB 3JQ8A 3KYCB 3ZNNA 4NJMA 4NI5A 3IJRA 2PY6A 5BSFA 4LMPA 1NVMB 2ZATA 3GFGA 3E5RA 4ZJUA 3JQFC 1GTMA 1LDYA 1Z75A 1C1XB 4F45A 3JD2A 3WGTA 1V35A 3DAFA 3PDJA 1D1SA 2OOSA 3V8BA 3VDQA 1Y5MA 4D3SA 3ZWCA 1DFGA 4EYEA 4L4XA 2J3JA 4FFLA 4XZ3A 4IDGA 1W73A 1GEGA 4J2HA 4I5GA 3IDSA 1NTOA 3RJ5A 1LTHR 3V1UA 1CYDA 3LT0A 3RWBA 2YUTA 4BB6A 4FOOA 3MJTA 5G4KA 5JDCC 4EJ0A 1UXKA 1AHHA 3VVCA 4J1TA 3IOYA 2X58A 5KKAA 1HF3A 4BGEA 4J4TA 3DBVO 1MG0A 1JWAB 2BGLA 3TSCA 2VUUA 4RQTA 4E5KA 1NHGA 4KUEA 4WOKA 4ZD6A 3RFVA 1ZVMA 1ZW1A 1E3IA 1P0FA 5F1OA 1ISFA 2C54A 1IHYA 3WTBA 3KO8A 4F6CA 4NU5A 4NPCA 2BFAA 3HSKA 3JQ7B 1UXHA 3G1UA 3B1KA 4I5FA 4DQVA 3V2GA 1U3UA 1PQWA 2FPPA 1X0XA 4O0LA 5A06A 3BMQA 4HV4A 1DAPA 1JKFA 2G17A 1DFIA 2Q2QA 3FD8A 4KZPA 4JROA 4GKVA 4A26A 4QEDA 5IXYA 3HB4X 1PU2A 5L7YA 3BTUA 3MTGA 2DPGA 4NG5A 4IZHA 3H8VA 1E3SA 3GNSA 4W9NC 1UR5A 4OKNA 1YQGA 3LSYA 3VVBA 5AXAA 1EUCA 4N5LA 1HYGA 5CDSA 4NK4A 1Y9AA 3M1AA 4BS9A 4IXWA 3NYWA 5TRTA 3ZNOA 2Q4BA 4QFDA 4D3DA 2WE8A 1A9ZA 4AJLA 2H63A 2FSVA 1W8DA 3N58A 4RGBA 1KVTA 2RH8A 4MVJE 2ET6A 4D41A 4AJ1A 4DGSA 1EEHA 3H9JA 2HMSA 2W90A 2B4TO 1HXHA 3DHYA 4NBRA 4ND3A 4XKJA 2HK8A 4IBOA 4RPLA 3RUFA 2X0JA 1KYQA 3L77A 3AW9A 4YAGA 3C7CB 1EUZA 1DFHA 1IE3A 2QZZA 4L75A 4RJTA 5A5FA 2WD7B 1VJ1A 4QECA 4OAQA 1RYEA 1E7WA 3F47A 4WE3A 4OQYA 4MP6A 4CMAA 3GUYA 4B4VA 1QRRA 2O7QA 4HFMA 2DFVA 3N7UA 4WCFA 3GGGA 3CEAA 4D45A 4GSKA 2XF8A 3LYLA 4IQGA 5DBIA 3PTZA 3KYBA 5I8ZA 3NKLA 3RKRA 1RM4A 2VZ0A 3MZ0A 4NK5A 3ZWXA 2WM3A 3PVZA 4YRDA 3CZMA 5ICMA 5IXSA 4TQGA 2G82A 2EGHA 1I2CA 1ZNQO 1F8FA 3ITKA 1NQTA 1EFLA 1ZSVA 4AG3A 3NT5A 3UHAA 4ND1A 3HE3A 1R4MA 5B12A 3KOUA 3JQEA 1E7QA 1Z73A 1EDOA 1ZJYA 2YDXA 3QV1A 1UH5A 4YACA 3WMXA 2DTEA 1GFSA 1HDOA 3E82A 4LN1A 3PFFA 2NSDA 3D4PA 3E8XA 3U4CA 3ANLA 4IDFA 4J9UE 4ZQHA 4EEZA 3JTMA 1B15A 4YQZA 4YAKA 3BMNB 3V2HA 5HBRA 4YT5A 2Y66A 3LT1A 2AQHA 4ND2A 4QO8A 4TVBA 5AXCA 2RHRA 3Q0EA 2VWGA 1E3WB 1YRLA 4BHTA 4EUEA 3C85A 3CH6A 3A28A 5CG2A 2IXAA 1WPQA 1CDOA 4R9RA 4P4GA 3UN1A 2D5CA 4DPKA 4JIGA 3UH1A 1NAHA 1UZMA 3GMSA 3ROMA 5KOIA 3LQFA 2PKQO 4LK3A 3A1NA 4MP3A 3GOHA 2P5YA 1PJ3A 2BRUA 3LU1A 4D79A 1YBMA 1X7GA 1XDWA 4HBGA 2GN9A 4J16A 3K92A 1Q7BA 4R1UA 3U09A 3I9NA 2PGLA 1P33A 4CQMB 1GQ2A 2BD0A 1SEVA 2UYYA 5TNXA 5CEJA 2IDZA 4ALLA 4CM8A 3C1OA 5JCJA 2CY0A 1S7CA 1QSGA 5FI5A 3BMOA 1LX6A 2D3TA 4RZHA 3WBFA 2OUIA 2OORA 2RAFA 3AOGA 3GY0A 4OJNA 3T7CA 5C7LO 3QWFA 1KY4A 3U62A 5JAIA 2PKQP 4RZIA 4R1SA 4ZGWA 1WDMA 4BO5A 1NM5A 1U4SA 2JCYA 1HLPA 4YXFA 4Y8VA 1M6HA 3ZHXA 1Q0LA 1O94A 2JAPA 1EBUA 3E9QA 1E6EA 4RPGA 1TXGA 5JW6A 1FDSA 1G1AA 3JD3A 3SEFA 2BGKA 3KVOA 4Z3DA 4EITA 1I0ZA 1LUAA 1SOWA 4TRJA 1HZZA 5ADHA 3G1TA 2I65A 2G1UA 3RC1A 2YYYA 3JQGB 2YW9A 4RO0A 2X5JO 1IPEA 2VRCA 4I9HA 4OKIA 3UVEA 1XEAA 4KTTE 4Q3EA 4J7UA 1OFGA 1I3LA 4DQXA 4IINA 1R0KA 3WWZA 4PN3A 3DZBA 1QORA 3LF1A 4OSPA 3ONDA 4PLHA 5DCWA 5KJ1A 2DUWA 2PGDA 3I9JA 3L4SO 4FC6A 3DBHA 2E82A 2X5OA 1OI7A 2HKIA 3GA0A 3TPCA 4OL9A 3JQAD 2A94A 5KIAA 3CSDA 3PGXA 1QLHA 3VZSA 1PIWA 4MKXA 2FP4A 3FCOA 3PWZA 3E03A 4NR0A 1DHTA 4UUPA 1KEWA 2ZB7A 2R00A 1QLJA 4R16A 3S2FA 2ZTUA 3MJCA 4DC0A 3GAZA 1VC2A 3AUSA 4DBZA 4DLAA 3LC1O 1A5ZA 2E4AA 1HYHA 2EWMA 1YDEA 2D59A 2FPIA 4OMUA 1EMDA 4Q3NA 3FNGA 4YYZA 5ENVA 1ZEMA 4NFHA 3IP1A 2EHDA 2B36A 1KETA 2P9GA 3VH1A 4MIYA 3BHMA 3QVTA 3MWEB 4BQPA 3WMWA 3LK7A 2C07A 2CD9A 3H3JA 2DTXA 4DMMA 3B70A 4XJSA 5CAEA 3ZWOA 1LEHA 3FWNA 1E6WA 5MDHA 3EVNA 4E33A 2OGUA 4MP8A 5A04A 1NFQA 4R69A 4BV8A 5CG1A 3DFZA 1DLIA 2EW2A 4B7CA 3GLQA 1G0OA 1BDMA 5JLAA 1UXJA 5TT0A 1XCBA 2IZZA 3EGOA 4BNYA 3QWBA 1TB4A 1AN9A 4FFMA 4GX5A 4YVFA 4E2YA 5A4DA 3SVTA 4DPMA 2I5PO 3O4RA 3L6EA 3WBBA 2J6IA 5F1KA 3WSVA 2G5CA 1GPJA 1I24A 2VNAA 3L0DA 1R0SA 4DL9A 4PLCA 4UUOA 3RBZA 3G49A 4JX8A 4OSOA 1I3KA 2OO5A 3ICPA 4PCVA 3DHEA 4RF5A 4C4OA 5ILOA 2VN8A 2PNFA 1O8CA 3UCXA 1PSDA 4CQMD 4I8XA 4AJKA 5COQA 1YS4A 3ZU3A 5EQFA 1N9GA 2VT3A 3WQRA 4CV0A 2ZK7A 4I5DA 2GRAA 4RL6A 2UV8A 1U2DA 2C2YA 3GPIA 1LRLA 1H93A 4WLEA 3RD5A 3C1AA 2P5UA 1VSVA 1YJQA 2CDCA 2O3TA 1LRJA 4ALJA 1Z82A 2J5KA 2WYWA 2X8LA 1B2LA 1MA0A 3E9MA 1TI7A 4D46A 4JP3A 1SB8A 2Y1OA 5L3ZA 4HFRA 3I23A 2X23A 3KEQA 1ZK3A 4EW6A 4CMHA 3R3SA 4M89A 5ER6A 4PRLA 5IG2A 1ONOA 4J90A 2HMVA 1GEEA 4I1IA 2DLDA 4R5MA 2Z1NA 3KYDB 3TZHA 3M2TA 1T2EA 3PWKA 3PRJA 5DULA 2J3KA 3GDOA 3KETA 4OM8A 4GI2A 3I3OA 4YDRA 5T8KA 4NZ9A 2AW5A 1ENOA 1IZ9A 3BXXA 3GZ4A 2PZJA 4GWGA 4AJ2A 1Y81A 3TNLA 1X15A 1JLLA 1HE2A 3I6IA 1NAIA 3B6ZA 2Q22A 1Y9EA 2VWQA 2RBEA 1Y7TA 2AHRA 1U1IA 4FD3A 3ZCXA 1PJQA 4L0QA 2D8AA 2GCGA 1Z45A 3DBRA 5A3VA 5JC1A 2PD6A 3MWDB 3LC2O 1GZ4A 4R54A 1IULA 2AG5A 1TA4A 2O48X 2OZPA 1G0NA 1ZIDA 4WLUA 7MDHA 3KUXA 5H82A 1B8UA 4RF3A 5T6BA 2PLAA 1MLDA 1GQQA 2Q99A 3PLNA 1HRDA 3ENNA 4CLHA 4Z0PA 3GZNB 3LT2A 4EBFA 1GV1A 2Q49A 5KKCA 4BIIA 3BMCA 3KYCA 4ILKA 4UEOA 5CEEA 5T5QA 4BO7A 1SBYA 3FHLA 4RVSA 3MOIA 4YJHB 4YT4A 1YL6A 2W2LD 4P22A 3D4OA 4KP7A 1C1XA 4J4HA 1DRVA 1P45A 3L9WA 3OJLA 5BQFA 4H3VA 4FW8A 4INAA 3GEMA 4N7RA 2ZQYA 4XQGA 3R3JA 5B1YA 1ZO8A 2FSSA 2Q46A 4EEXA 5IFLA 3I6QA 1GDHA 3KRTA 3P2OA 3ZH2A 4CLEA 3PI7A 4E3ZA 2GN6A 4CM7A 4AJJA 4WPGA 4WKGA 1O5IA 4XYLA 4ZHSA 4PGFA 4PVDA 1V6AA 2HJRA 2AE1A 5DNAA 4UEJA 4XRRA 2TMGA 1ZMTA 2Y68A 4R1NA 1CERA 3VZQA 3WNVA 2OL4A 3FBTA 4GVXA 1NYTA 2D5AA 2NTNA 3I4FA 3Q6IA 1DBVO 2JCXA 3AFNA 3C1TA 3TZKA 3AM4A 1M66A 4DIBA 4BO8A 1YH3A 1AE1A 3HQ4O 3AM5A 3B20A 1HDCA 3JQ7A 1PGNA 4Q3DA 3FR7A 2PR2A 4BNIA 2Q1WA 3DMTC 2Y1GA 5KJ6A 3PHHA 4LSWA 2QRKA 5AXBA 3R6DA 3HDJA 5ER9A 4II3A 1D3AA 2O50A 4AJNA 1YKFA 3KLMX 4I9NA 2DT5A 4GSLA 2P4QA 4JGBA 2B5VA 2HLPA 1HEUA 4XYEA 2DVMA 4OGWA 5KVVA 1KEPA 1BMDA 3AK4A 3HUDA 3WGGA 4J49A 4BNTA 5JFOA 4B3IA 4IJKA 4BKPA 1YQDA 3OFSA 5FWNA 3A9WA 5CP8A 2WMDA 1DC6A 3W6UA 1KBZA 4DYDA 1VPDA 1VKOA 2H5LA 3A4VA 2YV1A 4OHUA 4FCCA 4MKRA 4O6VA 1NX6A 4GGOA 5JDIC 4KQWA 4NBTA 4FGWA 2Y99A 1LLDA 1LSSA 1LLQA 1ULSA 2VYVD 2P9CA 5EESA 4MIEA 5DN9A 1JAYA 1LC3A 3UICA 1HE4A 2WD7A 3L4BC 3GF4A 3GUCA 1YQXA 1ISIA 3SBOA 5CDUA 3RQSA 5GZ3A 1T2AA 4PLTA 3PQEA 4KMSA 1MFZA 3H9UA 4WECA 5I9MA 4FPXA 4MDHA 3K96A 1KC1A 1PJCA 2QW8A 1YL5A 4GLOA 1BDBA 5KVSA 5L4SA 2D0IA 5DCYA 4E13A 4UVDA 2HRBA 2E48A 4QTZA 1H6DA 2BI8A 1HKUA 1HWYA 1PTJA 3DOJA 2NU6A 3MEQA 1MP0A 1FXSA 2B4RO 1AXEA 1PJ2A 1OMOA 3HJAA 3UOGA 3DB2A 4D42A 4E32A 2NVBA 1T4BA 1A71A 1C0LA 4GKBA 4NBVA 4NH4A 2FN7A 2QRJA 2X5KO 4XCVA 4IZIA 4FDAA 3WGYA 2LDXA 4YTEA 4E2WA 2P2SA 3AI1A 4JLWA 1DSSG 3IIEA 5L9AA 3NGXA 1BTOA 5EIOA 1D7OA 4Z3KA 3SLGA 4BGVA 3BMNA 2EEZA 3JQ9A 5A03A 3P7MA 3PQDA 3JD1A 3VOSA 1WXDA 2FRDA 1RWBA 2VHVA 4J2OA 4ZQEA 1E3WA 4HKTA 5HWSA 4FS3A 1I30A 3F1LA 2Y05A 5A1TA 2QYTA 4E21A 4OIMA 2VTEA 1EQUA 4B8WA 3GG9A 4M87A 4D7AA 4CLXA 2EKQA 4IJWA 1GPDG 3GEGA 3TL3A 3K73O 5GZ1A 2RCYA 3ICCA 4URFA 1D4FA 1NVGA 2EF1A 1XG5A 4QQRA 1X0VA 3DBLB 5LDGA 4E2XA 2SCUA 3NEPX 4EJ6A 4IDBA 4YPOA 4CMCA 4JQCA 2EW8A 3OEYA 2NVWA 1QR6A 2ZB4A 1SEPA 1WZIA 4J0EA 4BNVA 1PZEA 3NT2A 4CQMA 2O2SA 3QRWA 4IDCA 4J1QA 3PJGA 1WW8A 4GMFA 3CXRA 1VJTA 1RYDA 2V7PA 4ALNA 5IF3A 3PYXA 3X2EA 4J91A 4DLLA 3S1LA 3QHAA 3ZU4A 3X2FA 1O0SA 4RCVA 4MVJM 5IAAA 1PWXA 1XGKA 4DIOA 5TT1A 1FJHA 3I83A 1KIFA 1PWZA 2GN4A 3DZIA 4GMGA 3CPSA 2ZCUA 3CE6A 1B3RA 2PV7A 1WLYA 1ZBQA 4IMRA 1YL7A 4JCOA 1OAAA 3WLEA 4CQLA 5I9LA 1EVYA 2DBRA 3RIHA 3QQPA 1WWKA 3E6AA 1TT5B 5JE8A 4MO2A 5COBA 4D0RA 1P1RA 3OQ6A 4WASA 4CV1A 1VL0A 3WJAA 5F5LA 4YRAA 3K2BA 2R2GA 5BSGA 5G0VA 3U3XA 2A9FA 3GGPA 3JQGA 1E77A 3ZU2A 3FN4A 4KTVE 2I66A 4MVJD 1TEHA 2YY7A 3OP4A 1PGPA 2F1KA 4DUPA 2GR9A 2X6TA 1QP8A 4J9VA 1D8AA 2DTDA 4ZVVA 4RVUA 1BVUA 4J7XA 1J49A 2GD1O 4BQRA 5BNFA 4XRGA 4GLLA 3ZV3A 1EE2A 2Y67A 2P4HX 4NBWA 4DTIA 2Q1UA 3HFGA 3MJEA 2YHIB 4ZRMA 2NUAA 3LVFO 2X0RA 1DIAA 4F6LA 1DIHA 2POQX 4PG6A 4DA9A 2YZ7A 3F4BA 1H94A 4BOYA 5ILGA 5CPBA 5A05A 5CDGA 3AUTA 3OJOA 1H9BA 1H6CA 5MGBA 3ROPA 4IMPA 3FBGA 4ZU3A 2ZTLA 3RUEA 4B7XA 1HE5A 4A10A 1Y8RB 2B69A 5JMPA 3VHRA 4H15A 4BO3A 2JL1A 3JQCA 2AEFA 3OJFA 1NPTO 4JP2A 2VUTA 5TIIA 1HT0A 2X0NA 3Q3CA 3GGOA 3KSUA 1WZEA 4ZQBA 3OMLA 5A02A 2W2LA 3GT0A 1I8TA 4DXHA 2ZTMA 3LC7O 4OOEA 3DL2A 3C7DB 1HDXA 1WVGA 2UVDA 2HJSA 3JQAB 4FJ0A 4FR5A 4IPTA 3PFWO 4CL3A 2G0TA 2W4QA 4CV2A 1LQUA 3WLFA 5BNIA 2A92A 1XU7A 2I76A 2ILTA 3EY4A 3JQBA 4BL5A 3INGA 2AA3A 1I01A 2JD1A 4HUJA 3WDSA 2HU2A 1E7MA 5AOVA 3RBVA 3KSDO 1PJSA 4R3WA 1HZJA 4RDHA 4BGUA 4BNFA 3WR5A 3WQQA 1C14A 4MJLA 1I10A 1LDGA 4LGVA 4FFPA 1C0KA 1EK5A 1J4AA 3JYOA 3PGJA 5JMWA 3TN7A 4CM4B 1ZK2A 5TJHA 1FK8A 4NU6A 4BNMA 4E31A 5A9SB 1U5CA 3VKUA 2O3QA 1LA2A 2C7VA 4D44A 1UZLA 3K31A 1M2WA 1P3DA 1VL6A 1NNUA 4J6FA 3Q2KA 3VKVA 1UDBA 5CDTA 2I3AA 4JN6B 3MCVA 4QSMA 3RUAA 2CVZA 2B0JA 2FWMX 3Q2IA 4ZQFA 1U4OA 2GDZA 3UUWA 3DAGA 3HN7A 4XX0A 2QQ5A 1GAEO 2Y0DA 1GQYA 3AOEA 2FZWA 2X0IA 3QLJA 2NTVA 3H6KA 5HTOA 1X14A 4A73A 3WIEA 5EINA 3ASUA 4BVAA 1T2FA 5CDYA 2PZLA 3HFSA 3ENKA 4J1NA 4KWHA 4FJ2A 3DC2A 3UAGA 3N74A 4H16A 4PG4A 5GY7A 2WWRA 4XDZA 2CVOA 1Q7CA 3GDGA 4PLFA 5KNLA 3ZV6A 3H3FA 1PJBA 1Y8QB 3IUSA 4R1TA 4Z9XA 4BKQA 5CPFA 5AXDA 3D5TA 5DOZA 3KYDA 3MOGA 1ORRA 1BHSA 3SLKA 3FTNA 3WICA 3ZWBA 1UXIA 5L45A 4J3FA 5KJCA 5CEFA 3G79A 4CM1A 1V8BA 1IHXA 2GZ2A 3DZJA 4OXYA 1V0JA 1X1TA 3C8MA 4JJGA 2AEMA 3IP3A 1ZJZA 4MVJF 3MJSA 2VYVA 4TRRA 4DRYA 3FI9A 3WGZA 1KERA 1A9YA 4NMHA 2OHXA 2RIRA 3GVHA 4IIUA 4S1VA 2HO5A 4D0SA 4AL4A 4CUKA 2VT2A 2E37A 1DB3A 3UXYA 1DPGA 4LRTB 1YDWA 4JJFA 4DQUA 3HG7A 3W4JA 2X7HA 2Y1FA 4IGEA 3ZNPA 1VM6A 2FHSA 1LC0A 4RLHA 4WGGA 4R3NA 2VQ3A 2XXJA 4U5QA 5TGDA 3JQ9C 5JCXA 1TLTA 4BB5A 4TKMA 1ENZA 3SXPA 1MXHA 2FR1A 4FC7A 1W0CA 3B1JA 4CMBA 5T67A 1JQBA 3QJ5A 3HN2A 2YDYA 4FSHA 2HAEA 2HUNA 2LDBA 4XA8A 1HLDA 3RI3A 3GZNA 1MX3A 3CTMA 1CF2O 1ISGA 2IE0A 3LF2A 3OIDA 5AVOA 5KTKA 4LRSB 3OEWA 1M75A 2V6MA 4YJHA 3VH2A 5F21A 5IJZA 4KDFA 3SJ7A 2RHCA 1O95A 1B3BA 1MFPA 3ON5A 3GDFA 4GH5A 4JK3A 4CLOB 1LNQA 1KEVA 4UREA 3U5TA 1PS8A 1U9JA 2C0CA 3O03A 2FY8A 2BGMA 1JVSA 5ITVA 3VDRA 3H9EO 1F0YA 1UP4A 3CIFA 3C3XA 3VH4A 4Y67A 4P8RA 4AFNA 1F12A 2GZ1A 3PYLA 3L07A 4YR9A 1DAOA 4IIVA 1DXYA 1KC3A 2H1SA 4C7JA 1BGVA 1KVRA 3D1LA 2IYPA 3ZW9A 1QV7A 1U5AA 2V6BA 4BNHA 3GN1A 4XIYA 1JAXA 2PH5A 4XQCA 5A3JA 5IDWA 3RU9A 1V3UA 4H7PA 1PGOA 1F17A 3OIGA 2C82A 4NBUA 3UKOA 2AEJA 3ST7A 3GVIA 5DP2A 1IL0A 3WFIA 3ASVA 3ONEA 2CUKA 2D4AA 3ADOA 3DWFA 2HMWA 2C5AA 1MUUA 2AE2A 2G76A 1C1DB 5FEUA 2EERA 1C0IA 1RKXA 2PGJA 3WSWA 1F14A 1WDKA 3PJFA 4IXTA 4HFJA 2ZKLA 3RU7A 1KEUA 4R01A 4KDEA 1H6AA 1SC6A 2VCYA 3NTOA 2BH9A 1E3LA 4WEQA 4BMNA 2C20A 2PH3A 1X7HA 3D0OA 2Z95A 1N2SA 2H6EA 4D43A 4OXKA 1OC2A 2DQ4A 4BUCA 3VPXA 4GGPA 2NVUB 4CMJA 1UAYA 1ZEJA 3E48A 1Q0QA 3FPCA 2EV9A 3I9MA 3ZNQA 3WGQA 3R0IA 4AJHA 3TDKA 4PG8A 4XQ9A 4UULA 3H2SA 1NBOA 4QO7A 1K6JA 3S2IA 3HB5X 3I52A 1H6BA 1GZ3A 5JYAA 3H5NA 4RVGA 1GUYA 3ZWNA 5C3MA 5EMHA 1E1LA 4MVJA 1NPDA 1LBEA 3RBXA 3PZBA 4UVGA 1TT7A 5F1PA 3OM9A 1NHWA 5TC4A 1ENYA 1ID1A 1N5DA 3PXXA 1R15A 4JBGA 2GYYA 1HDYA 4LCJA 4B7UA 4CMKA 1JW9B 1YBVA 2EXXA 4TZKA 1MXFA 4U6QA 1PL8A 4GVLA 4J43A 5G4LA 1EE9A 1XYGA 1UP7A 4I5EA 2X9GA 1B16A 1OC4A 1XA0A 2BELA 3G17A 1EVJA 4WCFC 4AJPA 3AFMA 1UAGA 3NAQA 2C29D 5L40A 2JFGA 1JDJA 3JQBC 2I99A 5AYVA 2YJZA 5A5EA 2WSBA 2W8ZA 4L4RA 4JNKA 3RC7A 4WJZA 3I1JA 4YCAA 4YEDA 3IUPA 4BO6A 1U28A 3AM3A 5G0UA 1JN0A 3I9LA 4YRBA 5L7TA 4PZEA 1K0UA 1X1EA 4HFNA 3CMCO 4G2NA 3DZKA 4IQ8A 2FPGA 3WS7A 2R6JA 3OJEA 1QKIA 1UDCA 1Z74A 3S8MA 3DOCA 2CF6A 3IMFA 1ADCA 3DR3A 3O9ZA 2Y0CA 3OBBA 4XR9A 3DQPA 1EQ2A 5F5NA 5TQVA 2FOIA 4PVCA 4E5MA 3BAZA 4IJVA 2IEDA 4NQZA 1ZFNA 3KM0A 5JDCA 1W6UA 3GEDA 2ZYGA 4IS2A 4N18A 4CQLB 1DIRA 5DT9A 3EZLA 3BHJA 4HWKA 1P74A 4B8ZA 1JTVA 3PIIA 3GNQA 4PG5A 4Y6PA 3GQVA 4P38A 2BFMA 3WG9A 3W4KA 2P68A 1NFRA 2HDHA 3DBLA 3M6IA 4QUKA 1GU7A 4RV9A 1XR3A 3IC5A 3CMMA 3ETGA 4GBJA 4NIMA 4CPDA 3PHGA 1K2WA 1LQTA 2AXQA 2CSUA 1E1NA 5C5IA 2VHYA 1XIVA 4IS3A 3O38A 2NQTA 3TF5A 1BW9B 4WNIA 3QSGA 3E1KA 2NV6A 4FIZA 4B3JA 5EERA 1DJNA 4MVJH 4CR6A 3RFXA 1QXSA 3T4EA 2GF2A 2OP0A 3FPLA 3E5MA 3FR8A 3HDHA 3L9XA 4N5NA 1MV8A 4UAGA 3NDIA 2ZB3A 4J4BA 2V65A 5GZ6A 3DZGA 4WLFA 3ZHBA 3OH8A 2EJVA 3RJ9A 3DXFA 1HYEA 3W8FA 1E3EA 2H9IA 4ND5A 4PZDA 3U0BA 1ISJA 3HNPA 3KB6A 3RVDA 2O23A 4TRNA 4W9NA 5EPOA 1GL3A 2QRLA 4ZA2A 3C24A 3W8DA 2VHWA 1IZ0A 5M6DA 2QIOA 3QWAA 2BFPA 4LVCA 4UUMA 3EC7A 1TT5A 2NWQA 2Q2WA 4M1QA 1FDUA 4LVUA 4BKOA 3RUDA 2NADA 2VHXA 2DBQA 2DUUA 4L8VA 4XB1A 3K2EA 4RDIA 1H5QA 4RF4A 4EJMA 1DRUA 4BO1A 2OMEA 3WQSB 3Q11A 5K9ZA 4E4YA 1P1FA 1FDTA 1LU9A 4PZCA 1PR3A 1SMKA 1CEQA 3SJUA 3WYEA 5F3RA 4ROSA 1SO8A 3VTZA 3ANNA 5KJEA 2CDAA 1O9BA 5IDYA 1GY8A 2WYUA 3L6OO 2HRZA 4HNHA 1ZK0A 4E12A 3DO5A 4AJIA 4AVYA 1JU9A 1K5HA 2DKNA 2JAHA 1GD1O 3DFUA 2YHIA 4ONEA 2AQIA 1DIBA 3BYZA 3NTQA 2R00C 4Q3CA 4J7CA 3TOXA 1E7YA 4CLRB 4CM5A 1BSVA 2ZYAA 2PWZA 4EDFA 2ZQZA 3AJRA 1GYRA 4YJGB 1MG5A 4NFSA 2O3UA 4PLGA 2JFFA 2BHLA 2J5RA 1Y8RA 2JFHA 4E30A 4R4JA 4BO4A 3PIDA 1J5PA 1QG6A 1VKNA 1HETA 4AJ4A 5BR7A 1XQ6A 1Y5RA 3W1VA 5H81A 2D2IA 2J3IA 4DLBA 1PQUA 1XU9A 3DTYA 1RM3A 1E1KA 1X13A 5CHEA 4WUVA 2NU9A 3JQAA 4GAEA 3E9NA 4A5OA 4BO2A 2NM0A 5B4VA 4RORA 1UDAA 4RVHA 3RC9A 1HTBA 4PFJA 5HA5A 3EW7A 4ND4A 3QWIA 1GV0A 1F06A 3TFQA 3BZUA 1ADBA 2X9NA 3D64A 1XELA 2AQKA 3K5PA 3O8QB 1EZ4A 3QVSA 3TOZA 1F8GA 4B4OA 4X54A 2BLLA 1PZGA 4Y6SA 3JV7A 1ONNA 3SC4A 5KJFA 4ALIA 3IAHA 1PQPA 4LW8A 1PX0A 3D3WB 4NNJA 2O3JA 3AU9A 2GZ3A 1ADFA 4ITUA 4MVJP 2WTBA 4K6CA 4GX2A 1P1HA 2EGGA 3IKVA 4F3YA 1P44A 4CM4A 2ZB8A 5A9SA 2VRBA 1YE3A 2IYOA 5IZCA 3D7LA 4YQYA 5JY1A 1D1TA 4A7PA 1T2CA 1QYWA 3JQDA 4M54A 1ARZA 1NPYA 2UUOA 5THQA 3FRJA 4NHEA 3ZHYA 2EKLA 1GYPA 1NR1A 1E5LA 1KY5A 1U8XX 1Z7EA 2QYSA 4IDDA 2BMAA 4RPKA 1KOLA 2OBNA 1U8FO 5JAMA 3GRKA 3IQDB 1AUPA 2WE7A 2P9EA 5IDQA 1YOVB 4S3MA 3ZWYA 3GMDA 5AQ1A 3JCZA 4TWRA 4DC1A 3OICA 2QX7A 3ZV5A 3GG2A 2IXBA 4L74A 1Y8QA 2ZYDA 5T73A 4DBVO 1ISHA 3GHYA 3DMYA 1P77A 2A35A 4E0BA 2HCTA 3W4IA 3MJ4A 4R9SA 3NJ4A 4ALKA 1BG6A 2WYVA 3TZQA 4CM6A 4B4WA 4WEOA 1YWGO 4I9UA 1OZAA 4II2A 3DONA 1N1GA 1PJTA 3DDNA 3ITDA 3P19A 4BNUA 3QWHA 3AUAA 3EK2A 2ZJ1A 5JO9A 1JA9A 1ZKMA 1MC4A 4PLPA 3P2YA 5U4QA 2PKRA 1Z7BA 5T8KC 1EVZA 4ID9A 4PLZA 2Z5LA 3U49A 3V1YA 1WDLA 1XLTA 4PG7A 4BNGA 5JAZA 2QZ9A 1PS0A 4K6FA 1FDWA 5TS3A 2ZJ0A 2D1YA 3D4NA 3F6YA 3ROQA 3OF2A 3GH3A 1BVRA 2HMTA 1P0CA 1MC5A 3UFXA 3INRA 4XYGA 5A9RA 5KWEA 3IKTA 4RF2A 2X9VA 3PEFA 1O6ZA 3PHIA 4Q3AA 4BV9A 5JY6A 3KBOA 4WLOA 1I33A 5B37A 1EUDA 3KXDA 2VTDA 3BIOA 3ZHZA 1KS9A 1T1RA 1ENPA 2B83A 2PZMA 1JKIA 3ZWWA 3A06A 4R51A 1WP4A 2QG4A 1L7DA 2AMFA 2BFOA 4FFOA 3S55A 3V2UA 3TJRA 3VPFA 3ROKA 4BKRA 1LLUA 3VPHA 4YT2A 4CLDA 4TSKA 2PTGA 1I2ZA 4CLOA 1DC4A 4M55A 2YV2A 4FOSA 2X1HA 3VZPA 3Q1LA 1S6YA 4RVFA 1BRMA 4M49A 3ONFA 5ITWA 1IUKA 1GR0A 2DM6A 2Y1CA 1JVBA 1XWFA 4XIJA 3ZDFA 3Q9NA 5DBFA 3LLVA 5JO0A 1FDVA 4PLVA 2O4CA 2PD3A 2CDBA 5I9NA 4Q9NA 3I4CA 4LISA 1ZK4A 1CQJA 3OSUA 2GO1A 2W2KB 2Y1EA 1R37A 5IDXA 2NQ8A 5H83A 1SZJG 2RH4A 3DOOA 3OA2A 4QXMA 1I3NA 2VWHA 2UUPA 3MTJA 2WD8A 4IDAA 1Q2XA 4YJFB 3AY6A 3OECA 3SC6A 1OBFO 4TKLA 1UUFA 3IL2A 3F1KA 1GYQA 1PEDA 3F9IA 1LJ8A 3WJ7A 1RJWA 1LXCA 1P31A 3F3SA 1N7GA 1N92A 5DOVA 5HS4A 3JYQA 3IS3A 3H5AA 5FFFA 1YBAA 1EK6A 4WOJA 4QX6A 3OIFA 4FFNA 3TQHA 1CETA 1C1DA 2Q4EA 1E92A 1TVEA 1T1SA 2IODA 1IB6A 1YB5A 2IZ0A 3DZFA 3RSHA 5K6AA 2X86A 3DHNA 2FR8A 2BI7A 4DWVA 3H9GA 3PYMA 3H9QA 4NJOA 3QVOA 3NRCA 1P1KA 3TWOA 2VWPA 2HK7A 2DPHA 1LSUA 5JYDA 5FYDA 4BKUA 3WWYA 5THKA 4ZN6A 2NVUA 8LDHA 2B4QA 4E2ZA 1P1IA 4MVJG 3OQ1A 2V6GA 4BO9A 4IM7A 1BXGB 1XQ1A 1IOLA 3PJDA 4K28A 3PQFA 4U0KA 4O5OA 5J9GA 1HE3A 4AICA 2A4KA 3OHSX 1H2HA 4K26A 5C7IO 4L9RA 1P9LA 3EVTA 5HM8A 4P4NA 4ZICA 3FNHA 1ZH8A 4XB2A 2I67A 3RFTA 5L53A 1ONPA 2JHFA 4YT8A 4XJTA 5JYEA 1BXKA 1R16A 1WMBA 2ZTVA 4UUNA 5DF1A 4E5PA 4CODB 1WNTA 4CM9D 1C3VA 3LLSA 1YONA 4Q3BA 1E6UA 4YBZA 2JD0A 3WFJA 2JHGA 1DHRA 4FBGA 1ZCJA 1KVSA 2OBYA 2YV3A 4EZBA 3I9KA 1DC5A 1E7RA 2PZKA 4RLSA 5JNLA 1SPXA 1VLLA 3WNQA 4RPHA 4XR4A 2Q3EA 3K9QO 1H9AA 4YAIA 5JPIA 5TX7A 4O59O 1ULUA 4TMFA 1M67A 3WGHA 3UCFA 1U2GA 2CFCA 4YAJA 5JBIA 1ZXBA 2I9PA 1QMGA 2GGSA 4CMIB 1LLCA 2DFDA 2WDZA 3AU8A 1P1JA 1O89A 4G65A 3ZWMA 4K1LA 1T2DA 4BNNA 4FQ8A 1R4NB 3JQ8B 1HDGO 2Y93A 4NJMB 2YQ4A 3F5QA 2P91A 4M86A 1QYXA 1FF9A 3I5MA 3SX2A 3A14A 4YA6A 4YJDA 5GMOA 2GPTA 1NP3A 1OOEA 1RM0A 1DEHA 1B7GO 5DDIP 1V3TA 3QIVA 3UCEA 1L7EA 1E3JA 4BNWA 1ZXLA 1HDZA 1X7DA 5IZCC 1DDOA 1ZSYA 2Q50A 4PLYA 4B3HA 4K9DA 2BKAA 1E5QA 2DBVO 2GNAA 4QFCA 3RUIA 1R12A 4XWYA 2OFPA 3V1TC 3EDMA 3BA1A 1N7HA 3ANMA 2CZCA 3PHLA 4KQXA 5HS6A 3TL2A 5JC8A 4MINA 5G4KB 1UXGA 3JD0A 1R6DA 1GCOA 3UGKA 3CINA 1J0XO 4FB5A 3ZWVA 4DPLA 1VSUA 2DAPA 3KLPX 2VZ8A 4R68A 3GVCA 5KCZA 2YQ5A 3C7AA 4OYRA 2HK9A 4IJUA 1I36A 1Y6JA 4XGKA 1R66A 3W6ZA 2NU8A 3GR6A 3WXBA 3Q9UA 5U9CA 4LCEA 1I5RA 1Y1PA 4CUZA 5C37A 4HNGA 2B37A 4OH1A 5T64A 1BW9A 1Q1NA 4FN4A 2VYND 1CWUA 4IY1A 4F46A 3LT4A 3DMTA 4YWJA 4A03A 2OXIA 1QV6A 3BTSA 2XOXA 2GLXA 4GX0A 2Y0EA 3GK3A 3OQBA 2VUSA 3PDUA 5BSEA 2X4GA 1AHIA 1RPNA 1AGNA 5G0TA 8ADHA 3BMQB 3GPDG 4U7WA 4DREA 2I6TA 3ZGYA 4RPJA 9LDBA 2YHUA 1B0AA 2V6FA 1M76A 1XSEA 3ZW8A 4E5YA 3GVXA 4W6ZA 3JQ6A 1YXMA 5JAQA 3RKUA 1WMAA 3PHJA 4KUHA 1UP6A 3PK0A 4KUGA 5C7OO 2JKVA 3GN2A 4PLWA 5B4TA 3TZCA 1NQ5A 3UF0A 3B1FA 1HSOA 1YO6A 1VI2A 2NTJA 2YFHA 3G0OA 4BGIA 4MKZA 2AQ8A 1IYZA 2EP7A 4DIFA 3VPGA 4MIOA 3ZWAA 3WGOA 5JDIA 3CKYA 4XGNA 2PD4A 4UEKA 3HADA 3GAFA 1VE9A 2HQ1A 3M2PA 1CJCA 4CV3A 4W82A 4EUFA 1EDZA 3OETA 5T57A 3JYPA 3QVWA 4JBHA 4IUYA
chains in the Genus database with same CATH superfamily
3ND5A 1LDMA 3STYA 3WLLA 4U2GA 4Q4JB 4Q12A 1SKUA 3VZRA 4YDQA 2NO9A 1LZLA 1S3IA 2W37A 3NCTA 2Q4RA 3ULKA 4ZZ3A 2CVQA 1QU3A 1Z5UA 5TMBA 4L6AA 2BE7A 1NNLA 4LJLA 1NI5A 2O8VA 1W0JA 2AFHE 1YZHA 3CA8A 3AHIA 3M6UA 4J0KA 4QPCA 5AIAA 2Z2XA 3D59A 1A5TA 2F3TA 1ZONA 3MF4A 2IW1A 4C7OB 5JAHA 3R77A 1MB9A 4TX1A 4GL4A 5FADA 3KPYA 5BUSA 1H3EA 1TYBE 3W3ZB 1GZ5A 1VIAA 3V5NA 5B3JA 2MSCB 3N8IA 5EGNA 1PI3A 3KELA 3PC2A 4ZEXA 4YJ2F 1NRWA 3ZHRA 2X8JA 4OGKA 5EWJB 5HF5A 1MGOA 3B2QA 4LHEA 1FVOA 4OU5A 1U3VA 5DCUA 3TQFA 4S1TA 2IZ6A 1WXFA 3DV9A 4NZPA 3WQHA 4OLBA 3H2ZA 3K3PA 1TADA 3OJ0A 1GG5A 1Q16A 6PFKA 1E2PA 1ULAA 1V4NA 3B12A 5LQUA 2CCKA 4M9UA 3NHRA 1F8YA 1JR2A 4CMEA 4F96A 2EKPA 5NULA 1P3JA 1EVEA 1JRLA 2IYQA 3T3IA 3URMA 3GLGA 1NQOA 1KU6A 3PXEA 3P45A 3REFA 3TRIA 3JAMA 1SUWA 4RVOA 1RVDA 1A5BB 3LPLA 1L8OA 3GRYA 4RE6A 2F64A 1LDNA 4X20A 4QXPA 1ULTA 2PX8A 3R3YA 4IGFA 5KB3A 4IIJF 2HLDD 2VPZA 3WLJA 1C30B 2UDPA 3MWYW 3FGZA 1VE6A 3CY6A 2GN8A 5CURA 3T9FA 2BCJQ 3K6JA 2HMUA 1UBRS 3KTAB 2JBWA 2YY6A 3FNFA 2F00A 3O8QA 3R4CA 5FHRA 4EUNA 1GM5A 4DB2A 3PJEA 1XZMA 2K4MA 1I2DA 3NC0C 3UANA 2FR8C 4RA6B 5YASA 1E5TA 4CEHB 1P7CA 1J2UA 1CY7A 1E98A 4MPJA 4OK5A 3JQFA 2Q21A 2ZCVA 3QKTA 4B6PA 2BFBB 3DEZA 2BDUA 3F3KA 4CT4B 3K0EA 4O4IB 5DCLA 5LZ5A 4DBLE 3K30A 3TEFA 5TSDA 1L4BA 6AT1A 1Z2DA 1BZYA 2FUNB 4GWKA 2IP2A 4C30A 1E3DA 4EFKA 4HP8A 1RKVA 3TQRA 1NW3A 4LFAB 4CM8B 3DEYX 3DTTA 5CGZA 4XIGS 1NXQA 4NZOA 4NONA 1KDOA 4A0QA 3ASYA 3MC1A 1V4BA 2YWBA 1SFRA 2NLOA 3N07A 1ZUD1 5HKLA 4KXLA 4HTFB 4BNKA 4S2UA 2IKSA 4URHA 1XC7A 3K09C 4HX5A 3N8HA 1OFVA 5EJ2A 4AXBA 2UUAB 1NBAA 1O08A 1ORHA 4ER7A 1YJ8A 4BMDA 3WAKA 5ALQA 2BJVA 2BP7A 4D97A 1I72B 3ZV7A 2AMLA 2IHUA 2JGKA 2BM1A 2V8BA 2VAVA 3DHVA 2JARA 5I3ZA 5ICSA 2XRFA 1SQ0A 1L5KA 1XRQA 3H4VA 2C83A 2PFGA 4KXFB 1Z29A 1KZHA 2P2YA 3U4HA 3QBTA 3P20A 3QE3A 4HNRA 3HDQA 1PE0A 5EUMA 1XQ9A 4F1WA 4FEEA 3FTPA 3NGLA 2WFLA 2Q1TA 5BSTA 4YPFA 5AI0A 3FCXA 5EIHA 5IASA 2XUGA 4UVEA 3ADBA 1HSZA 1IG0A 2O3SA 2IFTA 4Q93A 1SK9A 1TAGA 3UT0A 5I9SA 4CNQA 3LXXA 4QT0A 2GAIA 1F2VA 1WJGA 5I7HA 1QH0A 4L9AA 2C04A 3L43A 4WZBB 3UV3A 2JIMA 3M1LA 1XL1A 3QXCA 4KODA 7REQA 1RLOA 3HJUA 4G4GA 4YBRA 4JI2B 4Z0TA 4MDFA 3PNOA 1A50B 2YQZA 4HNUA 4TZTA 3GHHA 3KQLA 3A6GA 1EFKA 4XAQA 1NRJB 2ZUBA 4L76A 2AG1A 5T3YA 5EN4A 5KSZA 4HWTA 3VC7A 1KDRA 3C3AA 3ADDA 3C8UA 1XVTA 1XZJA 4KREA 4EHNA 4JMPA 4J8PA 5CM2Z 2PTHA 4MV6A 2CBGA 3SC2B 5JYFA 4B44A 4ESOA 4G07A 4D57A 1DC3A 3MQ4A 1T8SA 4GECA 4EY5A 6Q21A 4M38A 4KPYA 1CVLA 2B5WA 4G9EA 1NUSA 4LWZA 4OSEA 3QNUA 2HW8A 4DZZA 2E4ZA 1U0GA 4F4JA 3MG9A 4BJ6A 1UBSB 3PIRA 4QPNA 4TMKA 1H4TA 5A7HA 3ZDZB 1VBNA 4D5EA 2A1IA 4EFNA 1R1DA 1J2RA 2VRWA 2ZRGA 5A71A 3WY9A 2OHFA 1F4VA 1FSSA 1O96B 1S5PA 2P6MA 3QVJA 4GC9A 5P8WA 3UMSA 3J7AC 3TRFA 4G1CA 4MPDA 4DA6A 3EJWA 5LLDA 1E32A 2OOKA 3BTVA 1BS2A 1GUBA 1OX4B 5C7YA 5DYNA 4Z0HO 4C7MA 3GIDA 1ZOPA 2JGMA 4YI5A 1A4IA 2ZBDA 4EGQA 4CQJA 4B6QA 3DWEX 3ZE6A 4CI9A 3ONNA 2C1EA 4XOIA 2AIRA 2Z6VA 1DQYA 1U0FA 2RCNA 3TGPA 2WUDA 1P4GA 2IBSA 4TL9A 1YCGA 4WIAA 4N65A 5LC1A 4GOMD 2ZAOA 2R85A 2YBDA 4B74A 1U8YA 3W9BA 2R79A 4Z9YA 2W2XA 2Y8EA 1BMFD 3T1TA 3NV9A 4HEA1 1PJ4A 3Q8WA 1DCFA 3RRMA 3P9CA 3SSMA 3ZTWA 1I7CB 3QVXA 3FSRA 4RGVA 4UARA 2OBFA 3PFKA 3NHAA 1QUEA 3KEOA 3TLMA 2WEKA 1E6MA 3CLTC 4OI0A 1RR6A 4EGSA 1NJ8A 2XTAA 3BN3A 3OSZA 4TS4A 1TCCA 2A9OA 4YXWD 1WB9A 1A3CA 3ZX5A 2QUIA 4UBMA 5LSAA 2H7YA 3FKQA 5JS6A 4U7GA 4PN7A 4E5SA 2ZR8A 1OFTA 4A8PA 3OA0A 2FV8A 2F59A 4U2EA 2HSDA 3CF4A 3M6FA 4I3GA 3TFOA 4NF2A 4WLVA 1E2UA 1NASA 3IA7A 1JEEA 1ZJ4A 2Q9UA 4NATA 2ZM5A 3OTHA 3Q5EA 1IPHA 1MVOA 1LS6A 2W2KA 4H0NA 1E96A 1ZISA 3GLHE 4IW3B 3W04A 3GP8A 4Z4EA 3QYJA 2W98A 2H16A 3LD9A 1QANA 3ZWPA 2E4XA 4EUSA 2JAXA 1DKPA 1PL6A 1M6WA 4PR3A 3ZCPA 5LVAA 1KO7A 3DP7A 5AI4A 4YJFA 3HVIA 2IH2A 2Y9MB 3CKLA 1JIUA 1DJLA 1EWVA 5BN4A 3WO0A 1E6CA 4LSGA 3U1BA 4W9MC 3PNLA 3KVRA 1MORA 4H1TA 3H1FA 3KCQA 2WJHA 4AK9A 2VYNA 5F2NA 1N2IA 2Q5QA 3PU6A 1SCKA 1Z63A 3FH0A 3PD7A 3GAAA 1JHMA 3G3EA 3FNQA 3TIVA 4TTIA 3BWXA 2RGWA 4ENVA 3IQXA 4HQFA 4ZK6A 5FUQA 3KZOA 3W8EA 1B1AA 4AY6A 3GRPA 1QFSA 1M72A 3NT4A 1NBME 1UZUA 3URKA 3ZDXB 4BNLA 5ITSA 1EX9A 1YASA 2IZ1A 1QRUA 3GCWA 1LJLA 1YJBA 3EZYA 1Q7GA 2C59A 2JASA 4K0RA 4AB1A 1XZKA 5EZYA 4MA0A 2HSZA 2BSQA 2GPBA 2AF4C 2AN9A 4EFDA 4D5GA 1U2QA 1A76A 5DYYA 4BNZA 3KR9A 5IULC 1TFRA 1QO0A 1NW8A 4DYVA 1NJ5A 4W5WA 1XYVA 5ES3A 2HA5A 2QHXA 4JT8A 2YNMC 2GASA 1A72A 4RK6A 5I8PA 2CNWD 1UQUA 2WZQA 1P62B 5TY0A 3AWDA 1K3TA 1DAGA 1NWCA 1N2XA 1XD8A 3GOQA 4GW3A 4JQZA 4PBRA 4R3UC 5FR2A 3RV4A 1THMA 1SNYA 1IMJA 4NWIA 4XDYA 4F5ZA 2FZEA 1T4DA 4RMIA 1A5SB 2AJCA 2CCJA 3L79A 1VIVA 5CB4A 3QLUC 3JYNA 2NUBA 4D56A 1XTIA 2CYBA 4DJJA 2WTNA 1UK7A 1Y6RA 4CR7A 2JI4A 2ZDQA 5ALMA 2ISSD 3AP3A 2XUIA 3RSOA 5KQRA 2ZAIA 3AFIA 1FYXA 1YJ5A 5ILQA 3C3PA 1GGNA 3PFCA 4G37A 5E6UA 3KU1A 3HHEA 2ZBFA 1NUAA 1SVKA 4NBNA 4F3NA 3EGVA 5HFNA 4XQEA 1ATZA 2GYVA 3H0WB 2NSHA 4G85A 4JDUA 5IN5A 4Q7QA 5FLXA 5AKIA 4BMVA 3QX8A 3P4XA 2NZ8A 3Q9SA 4PX5A 4WXRA 3ZI0A 5F9FA 4H7EA 1FRFS 3EARA 3VDXA 1XA4A 3CS3A 5DX0A 1LDEA 1P5JA 2PWYA 2GX6A 2X3FA 3FKSD 3IBSA 3T61A 3VR6A 3IHLA 3KHSA 5J9FA 5CCDA 1V26A 3LZ6A 5HK9A 1K6IA 5TF4A 2V4ZA 3CCFA 3D6TB 5F33A 5JUWA 1U3CA 4C6HA 3PQ3A 1H0SA 1L7OA 2XGJA 1DIGA 1E7SA 5ITZA 3IP9A 1WPXA 2AN3A 3D3QA 5I7UA 1B6GA 5EXTA 4O1MA 5JXHA 3B2EA 3KYJB 2AJTA 1KORA 1ZGAA 1G64A 3LS2A 3OUZA 4CIAA 3B38A 5ELMA 4NI5A 3IJRA 2PY6A 3KQWA 1VDZA 2AZDA 4FGKA 4LMPA 3T1NA 1NVMB 3D6VA 1GO2A 5TMDA 1L4HA 3CUUA 3O0DA 2P77A 3PE3A 5SICE 5CVTA 2GBFA 1P6UA 3KFLA 5EIAA 4M0MA 5FA6A 3L6BA 4F72A 4DDTA 1C1XB 4MRNA 1IZZA 2JCSA 1QFYA 3EAFA 1V35A 1SHJA 1D1SA 1QZXA 1T3LA 2OOSA 2R48A 3GJRA 1KK3A 4RK5A 5AHOA 4B1FA 2XMBA 1ONSA 3WIOA 4XTCS 4KGVA 4NMLA 2LKDA 1T3SA 2B78A 4FFLA 2WQZA 4J2HA 4G09A 3V1UA 4BX0A 4G0WA 2JFWA 2BDEA 1CYDA 1UANA 3JQQA 2HBQA 3OOJA 4KMRA 2ZT8A 3BWVA 3SOZA 1X7ZA 3MJTA 2ZE7A 5ARDA 1WB5A 2WAYA 1AHHA 1N5MA 3PD0A 3SIRA 4J1TA 3L46A 1NQUA 3HBMA 3IOYA 4HI0E 2BEKA 4MRVA 4WRRA 1T91A 4J4TA 5EG5A 1IJKA 3QX7A 2O5VA 3DBVO 3AR2A 1S8NA 4NCNA 4QOIA 4QHYA 4RQTA 2CLDX 3F74A 3G8DA 1I79B 4FI3C 5J2UB 2EKZA 2VJKA 4LVOA 4YO7A 4DLZA 3BWMA 2J9GA 1K8RA 1P0FA 4U2FA 4GI1A 1IHYA 4MLPA 1W8IA 5AJZA 1PK8A 1WOMA 3IUYA 3D7KA 3IMGA 1O2DA 2E55A 3PE6A 3IPXA 1CFZA 2C0QA 4LXUA 2AR9A 2GPSA 2ZBEA 4F92B 1RWNA 1OV6A 4EB0A 5DTQA 2MDTA 3UO8B 1PQWA 1VXOA 2NYRA 3FG9A 1X0XA 3PD1A 4MS3B 1DWOA 3TKAA 2P2ZA 3UJHA 1UK9A 2Y1XA 4UM7A 1ZHOA 2AFRA 2NGRA 4IH4A 1QOPB 4UTOA 5IXYA 1RTKA 3BTUA 4HH3C 5CBKA 2KJQA 1E3SA 2QAGA 1VZ2A 3LX8A 1VTKA 1JS1X 2I71A 3GJTA 4ON9A 5C18A 1N36B 1HYGA 4DCCA 5CDSA 4B3FX 2MT9A 5K01A 4JLOA 4BS9A 4L07A 2WAOA 2V5UA 4AZTA 5TRTA 3BQNB 4EABA 1YZ3A 3IWDB 3DCIA 3MUFA 1A9ZA 2QR5A 2ID8A 4DJDC 4JOQA 1KXJA 1KVTA 1M2NA 2P69A 2ET6A 4D41A 1K66A 4ZCSA 4TV8B 4P7BA 3GRFA 3HBLA 2A0UA 4B3XA 5FTWA 2HMSA 3JZMA 1PTKA 2AUTA 3AG6A 4TLAA 3BSSA 1HXHA 1PJRA 3DHYA 3GXBA 2QF7A 2HK8A 2R6ZA 5IYZA 4AMUA 3ABQB 4XM0A 1X70A 3EUAA 4LV6A 4YAGA 1EUZA 4ME6A 2HT1A 2GCIA 4L75A 1AKEA 5ECDA 1Z4LA 3KPVA 3OEEA 5FTMA 2W22A 4OAQA 1U2PA 4WY5A 2ECQA 3TJZA 1CR4A 2WFZA 5JCOC 4HHEA 3F47A 2XNHA 4OQYA 5CNMA 4MP6A 3IKLA 1P0IA 3DOHA 3RHTA 2JFYA 1E1QD 2GJKA 2VL7A 3GH1A 1XZEA 4G84A 1QRRA 4FHCA 2QM8A 2V7TA 2Z9DA 3LY7A 3TOCA 3H8WA 1S4MA 3D81A 3NOVA 4C9BA 3PEWA 3HKCB 3QJGA 4Q37A 1CP3A 1AKVA 1C3LA 1KP9A 3DBIA 4WCFA 2IBTA 2AFHB 3RPEA 2QTZA 1NXWA 4GSKA 4PZYA 2XF8A 3LYLA 3LY5A 5DBIA 3PTZA 4OQLA 1RBYA 3LUHA 3MZ0A 1WDWB 1IHOA 1TZJA 3KL4A 3O95A 2OXTA 1U0TA 1JZSA 5A1JA 1U80A 5KI6A 1QJ4A 2WV7A 3TTXA 1H2EA 4EB6B 4I4LA 4BP3A 4EKNB 621PA 1QPZA 1F8FA 1NVVR 2XHEA 2WVJA 1F4LA 3ITKA 1CUAA 1EFLA 1NQTA 1ZSVA 1M6VA 4AG3A 5EJ6A 1M2FA 3FHTA 2FMKA 5AW3A 5CVVA 4JIMA 3HE3A 3V8NA 2GPWA 1HK7A 1UBUS 3KOUA 3L06A 1EG7A 4HDMA 3TGLA 3QV1A 3DYBA 1CVIA 1WTCA 3M4JA 4YACA 2DTEA 1GFSA 2VHTA 3ICOA 4HAVA 4LN1A 4UE2A 5ALDA 2GLUA 1OQAA 2H2HA 3E8XA 4DIKA 4BVGA 2PDAA 5LNK6 4R7ZA 3GBPA 3CX4A 5AM1A 3BMNB 4D4IA 2O7VA 3PKIA 5HBRA 4YT5A 1WXQA 2H9YA 3HBFA 2AQHA 3OIYA 4ND2A 5FWYB 3DVAA 5AXCA 1TAUA 1K7XB 1E3WB 3STVA 1QYRA 3PTLA 3CH6A 3QMWA 3A28A 5AI8A 5REQB 2IXAA 3V42A 1CDOA 1N9ZA 1AX9A 5HGJA 2C84A 3UN1A 1TZKA 5K99A 2HMAA 1HNWB 1UZMA 3IQFA 4DSZA 3ROMA 3N53A 4QDTA 5KOIA 1F3OA 1O6BA 2PKQO 1ZUWA 3A1NA 3FPGA 5AJVB 2ACKA 4DE5A 3V48A 4I50F 4KIGA 1DAEA 1T9ZA 1AKTA 3A4MA 4Q5IA 2NP6A 1GG8A 1I1HA 1Q57A 1XHFA 1YBMA 1XDWA 2WWIA 2G9QA 2Z5VA 3BB4A 3IRUA 4HBGA 4L4YA 4D0RA 1HNZB 4I7EA 4MGKR 2IXFA 3KCNA 3I9NA 2PS1A 2VHUA 3B7GA 5JJCA 4JSTA 5JVDA 1FTNA 3VR2D 2IDZA 3RYCB 4HAWA 2XRZA 1YR3A 1OWPA 1WMSA 3VNBA 1S3SA 5K03A 4QJ4A 1MOZA 5K0SA 3TUJC 2PLRA 1XB2A 1Y98A 2OCBA 5TVOB 2J0UA 1N6OA 2Q4OA 3B53X 2B2CA 2JK0A 5LLTA 4AN4A 1LZKA 4CHTA 2OM6A 1AS3A 4JL8A 5AI6A 4C5BA 4JX9A 2VDOB 2HUPA 1UBJS 3PPXA 2FEWB 3GYBA 2GEDA 2D7CA 1GTVA 3U62A 2AYZA 2ZUTA 2PKQP 2IYNA 1WXXA 3IA2A 2QN1A 3CR7A 3KAKA 1NM5A 3CWQA 3L7OA 4EO7A 3EIEA 2DZDA 1L5MA 4Y18A 4H3SA 3D3KA 3N8KA 2QT0A 4YXFA 5D87A 1Q0LA 2JAPA 1EBUA 1V3QE 4E13A 4CQLB 1TXGA 3QFHA 1G1AA 1MRNA 3CNQS 1UZAA 5LU9A 1JHDA 4BP9A 5DVZA 4HMOA 1SOWA 1F0KA 2A3NA 4TRJA 4TV9F 5JTTA 421PA 4PNPA 4CG3A 5CHYA 3L1KA 3KBBA 3N8NA 3DQQA 5LMZA 4TYNA 1W19A 5CNJA 1IPEA 1S2MA 4MR8B 4OKIA 4ZQIA 1XEAA 3GA5A 1YSCA 4PZLA 1U4NA 3CR8A 2OAEA 1DJMA 1U0JA 1C8LA 1I3LA 4BXOA 3DZ2B 1WLSA 3PC6A 3OZAA 3AEZA 3E7DA 3IP6A 3O21A 4YDHB 3BXHA 1ZPDA 4PLHA 3HVKA 2C0PA 4JUCA 4R1QA 2RGEA 1QWSA 4WDQA 2X5OA 3LK6A 2LRHA 5CX1B 1NN3A 3N2YA 4F6RB 2HKIA 3GA0A 4QXAA 1E20A 3EXEA 4H7JA 1S02A 4L28A 4X7BA 3UK2A 5JSUA 3OQPA 2R8XA 4I46A 3CSDA 1UBFA 1EJ2A 4NNOA 4JITA 8ATCA 2I2WA 4DR6B 1QLJA 4DRZA 1BKYA 1GL6A 1OXUA 2GK6A 5EMNA 3GAZA 4EHAA 2WZDA 3A37A 1ORIA 5DKFA 1KI7A 4HDSA 4HDKB 5A3RA 1HYHA 1X1BA 3W2TA 1N2BA 4UQPA 4Q3NA 4QLOA 4ZCPA 2BMJA 3VI3B 1G6Q1 3OOHA 5FB3A 2D0PB 2ZWMA 1TJ3A 4EB3A 4CKWA 4QOHA 3HEAA 1JLHA 3BHMA 3FPFA 3P2EA 1MIOB 5DNCA 1AKMA 3RS5A 4GP9A 5DBOA 4LWOA 2C07A 2CD9A 3UATA 4P08A 5J1TB 2CLKB 1LPOA 2F17A 3GRUA 4IIEA 4R2XA 3CLRC 4RACA 2DTXA 3EPPA 4JBLA 2VPPA 5CT4A 1GKIA 2XIJA 1LEHA 2J7KA 3OF5A 3ZWOA 4AF8A 5CAEA 5KTTA 3ZE1B 2OG1A 3AEUA 3VYVA 4E33A 4QVIA 2HGSA 4B0OA 3ND8A 4LOAA 4MKIA 4MP8A 1JH9A 2AZXA 3BQ9A 5BXQC 1GTJ1 1J8MF 4BV8A 1NFQA 1Q91A 4M0EA 5FOVA 2G83A 5CG1A 2WTEA 3T5GA 1J7JA 1ZBDA 1M54A 3CRRA 4JQYA 1WBBA 2OHHA 5JLAA 3AHFA 3IQZA 2F67A 1ZGJA 4LPSA 1TYCA 3QKWA 2JKYA 1SIBE 3U7IA 3LCCA 3QWBA 4L8LA 1TB4A 5DIFA 3X1YA 3I0MA 5C52B 1V11B 4KGXA 3NMUF 2XUOA 3HCOA 1UJ6A 1WCIA 1ZN9A 3FLEA 3WHLA 3UXMA 1SBCA 3EXAA 4M21A 1C3JA 2C1XA 3RANA 5FDFA 1MZPA 1DTWB 4JB2A 4AUKA 3AIMA 3B6KA 1ZOSA 4IYJA 3G49A 2ZJFA 3K6SA 3QY0A 2PMWB 1NZFA 5A4IS 1LW6E 5JHHB 1VKZA 5K51A 4C4OA 4AZSA 4N01A 4HPJB 2PNFA 3DLTA 2A5JA 5H3LA 4QKQA 2W5UA 2B3DA 3ZDDA 1Y3BE 1NV9A 3V7NA 5DYGA 2GVNA 1V5EA 4AJKA 1YA6A 3HJNA 1YS4A 3EEBA 1ODFA 3PL1A 1SELA 4ZP1A 4DNPA 3SQMA 3NBFA 3M4YA 3GB9A 5DJ5A 5C8YA 1WO8A 1SUCA 2J9FB 4AG5A 2C97A 2VP2A 5IK2D 3PICA 3MNFA 3TSZA 2XHZA 2JEZA 3UMVA 2P5UA 3W1WA 4GEKA 2H2DA 4HEA6 3WLHA 4ALJA 1Z82A 2IY7A 2X8LA 3U56A 1B2LA 1YOBA 4BLVA 1K5DA 2ZS9A 3J7TA 2NG1A 2VLBA 3E9MA 2BTQB 1TECE 3LA6A 4DT1A 2Y1OA 1Y33E 1V5WA 3G0GA 4A1FA 4YRGA 1YRYE 5C0OE 2X23A 3KPJA 4GOLD 2J9RA 5LQCA 2H00A 4OJMX 1ZAKA 1ACJA 1RADA 3P9SA 3R3SA 4BYGA 3EHDA 3TLZA 3UWDA 3HTXA 4KFTA 1AIPA 2BR5A 3FHJA 3QE4A 4YAUA 4J90A 4A8JA 3V1NA 2AC4A 3DTVA 1J39A 1F20A 1GEEA 1XKTA 2DLDA 1M73E 2EJBA 2IHYA 3B7PA 4GBMA 4I1IA 3TZHA 1K88A 3H5VA 1E79D 1V45E 5JMTA 2BBWA 4W7SA 3PWKA 3NOXA 2AR7A 3VBCA 3IULA 3N6XA 4QWWA 3RYIA 4F2PA 1CIPA 4N12A 5EE9A 1UKBA 2UVPB 3QOYA 3ZU6A 4BVJA 2Z9CA 1SRQA 4OM8A 5J4YA 2R8RA 4YDRA 5BSWA 1GZDA 4NZ9A 3ZZ0A 1ENOA 3QVVA 2V6JA 3BXXA 1QCDA 3KE9A 1A8SA 3NFYA 3QUTA 5GIPE 3ZVNA 1TC1A 4QNMA 4FOPA 2F1OA 5HR5A 4Z4IA 4GXNA 5FL7D 3EZ2A 1Y81A 5J2TA 2A0KA 1X15A 4DV5B 2C8JA 1A8PA 3OZIA 2Z43A 4OQPA 2Q07A 3I6IA 3JZDA 4JMLA 5AK0A 3UAWA 4RCZA 4ZOLB 3TVYA 2XB6A 2AHRA 2LP4Y 1DELA 4O29A 4WT7A 4TS1A 4PTYA 2D8AA 2GCGA 3CB4A 2X42A 2B8JA 3NI2A 4ZT6A 5K3CA 5JC1A 1TCBA 1BVHA 3LC2O 5KYYA 2HQSA 1WEKA 4CKEA 2WJWA 1IULA 2CXUA 3AUKA 4N6OA 5GV8A 2OZPA 1FQJA 1ZIDA 2Q5IA 2W6ZA 3COVA 4WLUA 3D7MA 3NH9A 4EA7A 4ZDIA 3DYVA 5H82A 2LIPA 4LEIA 4L9SA 3CVJA 2MMGA 2XKAA 3CX7A 3PLNA 1AKYA 4AJ9A 4ED9A 1IG3A 4CLHA 3IEXA 3MRXA 2MMCA 1JBQA 3VNQA 1AQJA 3NLLA 2GPNA 4Z9BA 2F8SA 4ILKA 4UEOA 4DUGA 4ZYWA 3A6DA 5CEEA 3KQTA 3MM4A 5T5QA 3TW4A 4PU0A 4A23A 4JC0A 2EHJA 3GFRA 3FHLA 2OYCA 4YJHB 1CQWA 1GA4A 2RHLA 3R6LA 4NZNA 1OPXA 4WH0A 1NQWA 1IHDA 2MINA 4AZ3B 4L57A 3D4OA 4HN2A 3L9WA 2ZB2A 3GU3A 3N6VA 4JKYA 2B2NA 2ZT6A 4INAA 3GLIA 2ZQYA 3ZIAD 4QYXA 4HB4A 4RMJA 5GV7A 1LS1A 4N0PA 3W06A 3LOQA 4QGHA 3EF3A 1C2YA 3EQ2A 4FX2A 4EEXA 5JJLA 5IFLA 2WK1A 2R84A 3I6QA 3KRTA 1QE5A 4YMSA 1G9SA 2BM9A 5AI9A 5FPHA 4CLEA 5EQJB 2HV9A 4G1VA 1M2OA 2FFHA 1PNOA 4JU9A 1T5HX 3QKSA 4L8YA 5DWDA 4AX8A 4L0MA 2XB2A 4GXQA 4ZPXA 1ZIYA 1E9SA 3MWGA 3R41A 3WE7A 1PQ4A 2KSQA 2CKMA 3NASA 3OJXA 1PFKA 1HFJA 4W1PA 2AHOA 1F7UA 2CLMB 4X64B 1P5FA 1AGXA 1XVVA 2EFYA 1V6AA 2G6TA 5A3SA 1Q6YA 3OTIA 5DHAA 1DX6A 5AI5A 4Y30A 2WAXA 4MUEA 1MX1A 3H04A 3QH4A 4R1NA 3R5HA 1YC2A 2F9FA 2OL4A 1NYTA 1L7XA 1KJNA 2NTNA 3I4FA 3UPUA 2GJAA 3WL6A 2QKYA 3OOSA 5DSXA 3TZKA 1FDIA 2QN6A 1RLTA 3D6NB 2RB4A 1RU3A 4E1VA 2C7PA 1G63A 2Q1WA 4MWGA 3AKDA 3HBJA 2Y1GA 3M4ZA 1UBNA 3PHHA 4LSWA 5I7RA 3EGWA 5AXBA 4X9XA 3OCUA 4OGFA 1DDGA 3EJ6A 4X6YA 1M1UA 1GG9A 1T6BY 4NX2A 5ER9A 2X7JA 3FZGA 1OREA 4OQNA 1UBHS 1YKFA 5T7BA 3CX6A 1MHMB 2P4QA 2WWFA 2W6QA 2XLCA 2H54A 3EA4A 3R5XA 2DVMA 1TNDA 2JLCA 2C4WA 4JKOA 5AKHA 3RYHB 3AK4A 2ZG6A 3WGGA 2G8LA 3M34A 4F4UA 5BSKA 5EYPB 2ZULA 4D96A 5JFOA 4B3IA 4F3TA 1NBWB 4I1RA 4IOLA 2H2AA 1RXIA 2ZYUX 2X77A 3F7OA 5FOSA 2PXAA 2IS2A 5CP8A 4F9GA 1UPAA 4EOGA 5C1PA 3UOAB 3ETLA 3ICEA 2X0KA 3ZDBA 3A4VA 2AFIE 3NWJA 4FDVA 3G5UA 4MVWA 4FCCA 5F7ZA 5FI1B 4DXAA 1XZGA 1JQJC 2BGTA 4GGOA 1MN6A 3F67A 1N2CA 3COZA 4KQWA 4NBTA 4QQFA 4ZV4A 1LLDA 1LSSA 1LLQA 3RT9A 1I9CA 2MIIA 4Q47A 4DVGA 5E7QA 4JFRA 3U60B 2P9CA 3BD8A 1ECGA 4DDWA 1BFKA 4MUKA 1YU9A 3ETCA 1CIJA 1KRWA 1RI3A 1HE4A 4HEQA 2WD7A 3KHKA 3L4BC 1A9OA 1EX1A 1XAJA 2Z8YM 4FYKA 3GF4A 5M2QA 1U8EA 2PUTA 2BHTA 1IEWA 1JHQA 2I62A 1S89A 2FSUA 2XQJA 2HNKA 2R65A 3AHGA 3O9MA 3FWPA 4L02A 2YFKA 1TF2A 3RQSA 3PQEA 4KMSA 3H9UA 5AW2A 5J58A 2V7WA 5JHGB 2IYEA 4MHOA 1M3SA 5EKSA 1KAGA 1X8KA 1PJCA 2QW8A 3A36A 3N6RA 1BDBA 4GLOA 4HAZA 5K0EA 2C7OA 2ZBUA 2J4DA 2EWWA 2IEIA 2WU8A 4Q19A 4B6JA 4UVDA 3THRA 2UZAA 4B8WA 4LDNA 5AM5A 1XZIA 2BI8A 5CT5A 1VCIA 1HWYA 1JJIA 2NU6A 3MEQA 4GM0A 3ZWDA 2X6QA 3CLKA 4TSRA 4ZVTA 2PGAA 4FFVA 3A10A 1Z17A 4U2DA 3AEQA 3RRXA 5I4BA 3C14C 1P8JA 3TEMA 1TOAA 3DZ5B 1YZFA 1PJ2A 2LZ0A 1XDUA 3SZOA 2A0XA 5HKKA 1T4BA 1DBSA 1ZCAA 4GKBA 5EP4A 2VQFB 3NIFB 4MWEA 1A96A 4WNAA 2QRJA 5EZ6B 3BC1A 1I5EA 4WJKB 4YTEA 3DNFA 3QPBA 1HYQA 1YB7A 3AYXB 1FYVA 4G5OA 4I19A 3MSCA 3AI1A 2KM1A 4GC5A 1XZQA 3IIEA 1DCTA 2V9PA 4X1KA 1BTOA 4E14A 1VBKA 1WW2A 2MSKA 4R2LA 2EEZA 2OEPA 2JBAA 3QPCA 1MJFA 1NOKA 5DWQA 3TSAA 3LRXA 5IS2A 1CJBA 1A4RA 1KK0A 4I1SA 3N8DA 4KLNA 5HWSA 1E6LA 1I30A 1PDVA 2Y05A 1JMKC 3LW8A 1EK1A 2QYTA 4FN5A 1VIDA 4JLDA 4PZ0A 3U81A 4BAZA 5FWXA 5GINE 4G5YA 1R3DA 4GPIB 3R8CA 4BLTA 4M87A 4ZIRB 1XMSA 2HA4A 1F5SA 3DUWA 1K8XB 5BRAA 4BVHA 3K73O 4HQKA 2RCYA 3ICCA 4TZ0A 1EGAA 2XODA 2EF1A 3IBCA 4AWAA 1XG5A 3QMPA 4B82A 2ZRIA 3HP4A 4QGSA 4OHKA 3ZD6A 3NEPX 2P9YA 4PHFA 5FPYA 2HCRA 2JH8A 1UFRA 3F8WA 1LJUA 3UWMA 1RZVA 4P4TA 3RVKA 5F23A 4RTMA 1OXKB 2D4HA 3AX6A 4J6EA 1IN5A 2CD7A 3VR4H 4BEVA 2DR2A 4C2BA 4E7PA 4YV2A 4B3MB 3O4JA 4B2LA 4RIGA 4CQMA 1N77A 1TJ5A 3QRWA 4QUEA 4H18A 1IBCA 5ALKA 2XXAA 2OGSA 3KL2A 3UHJA 5AVSA 3CLUD 2WIFA 3NWPA 2VFAA 4G1FA 5CB6A 1RYDA 2V7PA 3KALA 5CLIA 5IF3A 1SUAA 2HA0A 3KSRA 4J2TA 4DLLA 4PHHA 3H18A 2A5YB 3CLHA 1RYNA 2BZSA 3LPCA 2X4DA 1EM8B 4EMBA 3X2FA 1O0SA 2E4VA 4YMUA 1CULC 5TT1A 5HE9A 2AN4A 3EXHB 2AEEA 3OOEA 4TMZA 5C35A 2GN4A 3A32A 3QXJA 3WIBA 5A4JA 3NPMA 2QGNA 3CE6A 1W85A 4XD7D 4BP1A 4IMRA 1ZBQA 3M0EA 4CTMA 3WRYA 3L8CA 1ITZA 1EVYA 2DBRA 1QMPA 4OXIA 3VSEA 5I9LA 1FW8A 3TD6A 1UC5B 2ZSIA 2WUVA 1TT5B 3KTOA 4MO2A 1TK3A 2C98A 1FZQA 1W46A 3MYYA 3OQ6A 5COBA 5CYPA 3TS1A 1VL0A 2XVYA 5FO0A 3RO7A 3WJAA 1YU6A 1KMHB 3RQIA 3BERA 2XUHA 4DAEA 2YZNA 4TQUS 5G0VA 2O57A 4KU4A 5B58T 1NC3A 1CVRA 3OD5A 4KLCA 5DTRA 2V5VA 5L3SA 1G5RA 4XI9A 3DD1A 2YASA 3EBLA 1ZCFA 3UQZA 1M2JA 2HTEA 3WLSA 1SQ6A 2C9OA 2HV8A 2C2OA 2JRLA 5G3YA 4BFVA 3VU1A 4M4SA 3SIPA 4DUPA 1E8MA 4U1RA 5LUAA 2P5TB 2PWPA 3QXXA 4U5XA 1BN6A 1XJQA 2JJMA 3BZBA 4N3GA 2YCBA 4I0WB 5BOSA 3F6PA 4LJYA 1LWNA 1C29B 2YN2A 1G5IA 2PGNA 3FMOB 1BVUA 1I7MB 2J59A 3BFKA 4GLLA 3K1TA 2G1KA 3ZV3A 2WB4A 1EE2A 2VA9A 3KD3A 2O2ZA 5K20A 5A2QA 2PMDA 5LL6P 1U9IC 2Q1UA 2HCJB 4MMYB 2YW2A 1QE3A 3LVFO 5H59A 4ZI5A 1YTUA 5EJEA 4OBWA 4LMAA 4JJEA 3AQ4A 4ZVUA 1H94A 2YX1A 1GCAA 1Y4ZA 1SD1A 2CLHB 1WU7A 1R5BA 5A05A 1K06A 4HDRB 3ZVRA 4HUQB 3AUTA 5IHPA 1H6CA 1XV5A 1QHYA 2M98A 1L6IA 3ROPA 2I91A 3P9PA 5AM3A 4XVRA 1JJAA 3RUEA 4BLUA 1OT5A 4BVKA 2J31A 1ZX1A 4H15A 1CUEA 4NOJA 3GLGE 1M34A 3HI4A 3WRVA 1TX4B 3HV2A 1YD7A 3LUJA 3Q3CA 4LS3A 3GGOA 3KSUA 1OU0A 2PLNA 4N0EA 5KQLA 5F64A 1WZEA 3NVKI 4IVQA 2W2LA 3GT0A 3GRCA 2K5UA 2X5XA 3FJ1A 4A6XA 1OILA 1F7VA 2UVDA 5J3JA 2HJSA 4GMDA 2NXJA 3TX2A 3AB8A 4FR5A 4PC3A 4B46A 3IUBA 3PFWO 4WHMA 4DMFA 4CV2A 3FB4A 3HBNA 2E21A 4PHTA 1DQRA 3IWBB 1HDIA 4EJSC 4BRZA 4LHXA 2G9ZA 4N3AA 5T4HA 5EHQA 4MVXA 1CV2A 3INGA 2AA3A 3WDSA 4HUJA 4MW7A 1JEYB 1E7MA 5ICFA 2JLYA 1KYVA 2IIBA 4R3WA 1HZJA 1G60A 5BN5B 5K0TA 1DEAA 3WR5A 1TD1A 5TEVA 4QJ3A 4DTCA 4KYUA 4LYDA 1T43A 3R3UA 3P9ZA 2QTGA 3SFVA 5JMWA 5LMUB 1IU9A 3CU5A 1YZQA 4KSBA 3RTGA 2FUCA 1GNTA 2FFRA 1TIPA 1V7CA 4K87A 4QA9A 1DX4A 5TJHA 3E4DA 2V98A 1EDBA 3KZKA 4KG7A 1U5CA 4NECA 4NU6A 4BNMA 4E31A 5A9SB 4MB2A 5CYFA 1UZLA 4X45A 2ORIA 1P3DA 4IR7A 3Q2KA 1JB1A 5LYJA 1Q0UA 1P4SA 4BMPB 1ULBA 4FLEA 2DQYA 2W2NA 2NZJA 1JYSA 1QZ3A 2CVZA 2B0JA 2QRPA 5BWLA 2GDZA 4K2AA 3EP8B 4O33A 5JATA 3O93A 1LPPA 4J0HA 4L1KA 2BMDA 5HF8A 2IP1A 2J7PD 3BXEA 4XX0A 5J4VA 1TEXA 2QQ5A 2PFKA 1PLKA 3JPYA 2ZLBA 2FZWA 2Z2ZA 3QLJA 1Z2NX 4GFDA 4MYHA 3UY4A 4XCQA 4A2PA 1M1NA 1TO1E 2DYKA 4YLGA 3WLKX 3FKJA 1J5EB 5EINA 1W44A 2PRJA 3O83A 1T2FA 3IXLA 1ULHA 2NSLA 3VU8A 1US8B 3DOIA 3M9XA 4J1NA 1JXAA 3FYHA 2FE4A 2F3UA 2QLFA 3OFNA 1GLVA 1FYDA 4ERNA 5LOVA 4I55A 1RZ3A 3DO8A 4PG4A 4MCHA 1IZ8A 1MMFB 5FEMA 3GXOA 1Q7CA 3F8SA 3GDGA 4N03A 4PLFA 2GXSA 3W1EA 3H3FA 1FVHA 2ZZKA 4R1TA 2QUHA 1R6TA 2X3UA 2YRWA 3D5TA 4IUDS 4M83A 5DOZA 1C0EA 3J80A 4OHBA 1IJEA 2G5GX 3MOGA 2JVJA 4N0QA 5J5CA 3RM3A 3SD7A 5BYKA 1AJEA 2JZOA 1TVKA 2CB0A 4X85A 3NHJA 5F1YA 2EFEB 3LIIA 3R44A 4XUCA 4BJ1A 1SU4A 4ZVLA 1FB5A 2F2TA 3FUCA 5CR9A 4BJ3A 2JIRA 4PSVA 3WZLA 3A9CA 5DASA 5BW5A 3S0JA 1H5UA 1RPAA 1IHUA 2PKCA 3VNSA 2WF5A 3TTTA 4RX1A 4MV4A 3O2NA 4JJGA 1A2BA 3BEDA 1RHKA 4CZ2A 1VJCA 1E2MA 2O1XA 2VBIA 1KERA 1ZQ9A 1Y3AA 2ZYVX 2HQOA 4HGOA 4NMHA 2RIRA 2HO5A 1KNXA 1SWVA 1FU8A 4DANA 1OLSB 3SHOA 1DB3A 1PUXA 2EX0A 3UXYA 4IEFB 4W6QA 4LRTB 2FFQA 2HCBA 4PY2A 3AVVA 1NJFA 4IGEA 2ZSBA 3MWDA 1LC0A 4WKPA 4WGGA 3UFXB 2QNRA 2VDNB 3S2ZA 2YWDA 2C8KA 2VQ3A 4REQB 4F1KA 3TUTA 4BB5A 3RT7A 1PFUA 2ST1A 3B1JA 4CMBA 3JWEA 2AGVA 1UJ2A 4G9GA 2FW7A 1IY2A 5T67A 3S4YA 3THXA 1VMEA 2HAEA 4GMKA 2LDBA 2VBFA 4P4SB 3W5AA 1JDBC 2OQ2A 3ZG6A 3DD5A 3GZNA 3O94A 1WEHA 3IJ5A 4HRXA 3OEHD 3M5CA 1ISGA 2IE0A 1AMNA 2MSEB 4BIMA 3R9XA 5K3OA