4XB2A

Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with nadph
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
b'MKVNISIFGFGTVGRALAEIIAEKSRIFGVELNVISITDRSGTIWGDFDLLEAKEVAESTGKLSNIGDYEVYNFSPQELVEEVKPNILVDVSSWDEAHEMYKVALGEGISVVTSNKPPIANYYDELMNLAKENNAGIFFESTVMAGTPIIGVLRENLLGENIKRIDAVVNASTTFILTKMSEGKTLDDAIEEAKSLGILEEDPSKDIDGIDAYYKAKILHWVSYGEPPEEEERLGIREVRDARNVRLVAQVSKGKISVKPRKLSSDNPLLVEGVQNAAVIRTNNLGEVILKGPGGGGRVTASGVFTDIIKATLKFPNLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 319aa long hypothetical homoserine dehydrogenase
molecule tags Oxidoreductase
source organism Pyrococcus horikoshii ot3
publication title Crystal Structures of a Hyperthermophilic Archaeal Homoserine Dehydrogenase Suggest a Novel Cofactor Binding Mode for Oxidoreductases
doi rcsb
total genus 108
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4xb2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xb2A01
2PZLA 1NNUA 1ONNA 1WP4A 5F21A 3AWDA 1LDNA 1NAIA 2X5JO 4YJFA 5HTOA 3TSCA 3UCXA 1WDMA 1D1TA 1MX3A 1BHSA 2PWZA 5TS3A 4BNLA 2DPGA 3V1YA 4XQCA 1HDCA 4TKLA 1BXGA 1U8FO 5BSHA 3K31A 3LC7O 4IJVA 4AJJA 3A1NA 5A1TA 4Q39A 2O3UA 4LSWA 3P2OA 3BA1A 1H2BA 3IJPA 3DTYA 4B4WA 2EW8A 4W9NC 2UUOA 2HRZA 1AXGA 2PD3A 5CDUA 5AOVA 2OUIA 4LN1A 2I3GA 2X0IA 2IYPA 4MIYA 2NVBA 4B7CA 1PZFA 4Y9DA 4EDFA 2IXBA 4L8VA 4CMGA 3GC6A 4Z9FA 1HDZA 5F5LA 2Q46A 3V1TC 1NYTA 4XJTA 4E13A 1IL0A 1P0FA 2PFGA 5ER9A 3K2BA 3JD3A 3OECA 1E6UA 4J9UE 3D1LA 2V6MA 3CE6A 3ONFA 4UUMA 2WE7A 4O63O 2XOXA 2VTEA 3NT5A 2YW9A 3G1TA 1DIAA 2O3RA 5ENVA 1YL5A 2ZTUA 4IDGA 2YFHA 4K28A 4KQXA 3TOZA 1ADGA 1LDBA 3HQ4O 4WLUA 1N1GA 1NTOA 2EEZA 3IDSA 1TEHA 3JQ9C 2FSVA 2JD1A 1HTBA 1EK6A 3W8DA 4ALNA 3JQ8B 1U2GA 1P1JA 1KEVA 2QRKA 4YCAA 1RM5A 2YDXA 1LTHR 3E1KA 1KC3A 2CF5A 4RF4A 5FI5A 3UAGA 2GERA 3D3EA 3JQGB 3HJAA 3PWZA 1ZSNA 1LSUA 2CY0A 4EEXA 5I8ZA 1KVTA 1DBVO 5EQDA 2PGLA 3NDIA 4YTEA 1K6IA 4XEHA 3L4BA 3AFNA 4AL4A 1RM4A 2A9FA 4NH4A 2H1SA 3CZMA 4GVLA 3SX2A 4LMPA 2PTGA 2X9NA 2WYVA 3FWNA 5JAIA 4ZRNA 1IYZA 5IN4A 2C7VA 3DMTC 2I76A 2QW8A 1K0UA 3F3SA 3JQAA 4WCFB 2P9GA 3WNQA 2QZ9A 1NFFA 1R66A 3HG7A 1PU2A 3R3SA 3AM4A 3QWAA 2RIRA 3FR8A 4KDFA 1EZ4A 3RUDA 3ZU4A 2O48X 5IXYA 1J4AA 2P9CA 3GZ4A 2WEKA 4IXTA 3RUEA 4C7KA 1PWXA 3K2EA 3GVCA 3KEOA 5HWSA 4FJ1A 4M1QA 4FOSA 1V3UA 4L4SA 1YBAA 4FC7A 5IDQA 3S2GA 7ADHA 4EUEA 5BR7A 2J3HA 1OFGA 2NV6A 1GEGA 2B5WA 5G4KB 2RAFA 5ITWA 1PR3A 3WLEA 4EGFA 1A4IA 4PG7A 1ENYA 1MP0A 3TF5A 1OBFO 3CINA 3JQAB 4CMIB 2ZTMA 3OH8A 2DM6A 2VHWA 1ENPA 1E5QA 1KEWA 1WXDA 2JHFA 3E9QA 1E0DA 3MOGA 5I7EA 1QG6A 3MTJA 4GMFA 1C0LA 1NM5A 2Q99A 3RBVA 4QXMA 4IJKA 1Y8QB 5CEJA 1XSEA 2B37A 2FR8A 1I10A 1Q0QA 3C24A 4GQAA 4PLHA 2G17A 1C14A 3VPSA 3BTSA 3H6KA 2DT5A 4XKJA 2GGSA 3UXYA 4CLXA 1PJLA 3V2UA 2P91A 2AG8A 4CMEC 1ZBQA 3PZBA 3JQ8A 1DRVA 1NQAO 5A02A 5DBGA 1E7QA 3OA2A 1Z45A 3IKTA 3ZU2A 1HYGA 1E7SA 5KVVA 3DR3A 3LVFO 4YPOA 4MPDA 4P4NA 3WFIA 4IDFA 1R0KA 2OO5A 4RPLA 4BKRA 5JDIC 3Q9UA 4MVJE 3CPSA 5G0TA 2DPHA 3WS7A 3CMMA 5DZSA 5AQ1A 4I5EA 4RZHA 3U09A 2BKAA 1Y8RA 5L4LA 5JPIA 4FBGA 3SLGA 4L75A 1PWZA 4OOEA 4D42A 5K6AA 1UP4A 2D8AA 4QSMA 3AOEC 4J9VA 5EPOA 3DO5A 3WSVA 2JAPA 2OFPA 2VN8A 3M6IA 3LF1A 4BMNA 4IDBA 3BMQA 4W99A 4AJNA 1VM6A 3BHIA 3NT2A 3E48A 3ZH2A 2W98A 4IDEA 4RLSA 5A3VA 4ZGWA 1CEQA 4L9RA 4EI2A 3B20A 5IZCC 5L4NA 2HMVA 1A27A 1JTVA 3OQBA 4XRGA 2Y99A 2AQHA 3WICA 3R6DA 2AQKA 4YJGA 4ALIA 1ZSYA 1E7MA 3KO8A 1FDUA 4Q3CA 1R4MA 5TJ9A 3PJGA 4EUHA 1VSVA 4PIVA 1E6EA 3BHMA 3GNQA 2YV2A 4L76A 1J6UA 2CVOA 4NU5A 1Y6JA 3NTRA 3JD0A 3AY6A 2XPCA 1G0NA 3QVXA 3AY7A 3I9MA 3UN1A 4ZICA 3ZNOA 4I9UA 3PI7A 3PK0A 2VUUA 3TZ6A 3CEAA 3Q11A 2X0RA 1GDHA 3PLRA 4Q3NA 4QECA 4E6PA 1SMKA 1I3LA 1W8DA 3I9JA 4NBRA 1R37A 3QJ5A 5L7TA 3UFXA 3I83A 4DL9A 1EUDA 2E48A 5A5EA 1NBOA 4A0SA 4IJWA 5IDXA 1HE5A 1GV1A 4M89A 2ET6A 3NT4A 3M2PA 3DAPA 1E7RA 2HRBA 4UAGA 2ZB8A 4OXYA 4TVBA 4DPMA 4Z9YA 3GN2A 5JMPA 4IY1A 5IDYA 1N9GB 3VOSA 2VZ0A 2RBEA 2VNAA 4DWVA 3Q3CA 4WCFA 4R16A 3WJAA 4CM1A 3MZ0A 3ULKA 5JS6A 4DQVA 5KWEA 1ISMA 2VHYA 1C0KA 1BSVA 4GVXA 1PGQA 1T1SA 4E21A 2G0TA 2X23A 3H65A 3Q9NA 1HZJA 5DCYA 1LLCA 3JYLA 3SXPA 1WZIA 4LGVA 2EV9A 4UVIA 2WSBA 3W8FA 5B4UA 4WUVA 4B8ZA 4CLOB 3BMNA 1GQYA 1U4SA 1P3DA 4RVHA 4GBJA 2V6FA 1P9LA 1PS9A 4PLFA 1XEAA 1YOVB 1XDWA 4YRDA 4BO4A 1LRKA 3IC5A 4K1LA 2OHXA 4HBGA 1HF3A 3GDGA 2GYYA 4PZDA 4RORA 1YWGO 4GX1A 2R00A 3IUSA 3CKYA 2FN7A 4MVJH 1TT5A 4D41A 4CMCA 4FPXA 4CQLA 1TLTA 2PH5A 3WTBA 3I9NA 4GSLA 4NJOA 2JFFA 4YVFA 4OIMA 1B8VA 1UUFA 2FPIA 3PHLA 2DAPA 3GRKA 1DAOA 1XCBA 1V35A 4BNZA 5KKAA 4Z6KA 1I2ZA 2IXAA 1XQ6A 3KRTA 2X8LA 4N18A 1PQWA 4J1NA 5F1OA 5IN5A 3ZNPA 2NNLD 3GF4A 5ER6A 3ETDA 2FP4A 3I6IA 4CQMB 1MGOA 4OHUA 4ILKA 2FZWA 1K6JA 4E33A 3NX4A 3DQPA 4L73A 4II2A 4LK3A 1QKIA 5GY7A 4BO5A 5TQVA 5F5NA 4NFYA 5EMHA 3NGLA 5G4LA 4XB1A 4UUPA 4Y6PA 3BTUA 4A73A 3BMCB 2Q1UA 4CLDA 5GZ1A 3NYWA 3DAGA 4ZJUA 1M75A 1XLTA 2WD8A 5F1KA 5AXDA 5TF4A 3MJSA 3I23A 3GY0A 4TRJA 1JU9A 5CG1A 3ZU3A 1UZLA 3DOCA 1Y8QA 4M87A 3QV1A 4RJTA 4UUNA 2ZCUA 3AI1A 3L0DA 1FXSA 4KDEA 2B4RO 5BT9A 1W4ZA 4RF5A 4GAEA 3HE3A 3L6DA 3D7LA 4HFRA 4Z3KA 2I3AA 2ZTLA 2JCXA 4U0KA 4BO3A 1EEHA 2Y0CA 3TJRA 2V6BA 1U1IA 2B36A 2X9VA 2D3TA 3EZLA 5BSFA 3VPHA 1RYEA 3E5RA 3UW3A 3KUXA 1EUCA 4RF2A 4MVJD 4Z3DA 4CM8B 4CPDA 2ZKLA 1GQ2A 2JFGA 1O6ZA 5F1PA 3ZU5A 2Q45A 4OXNA 4FJ0A 4GLOA 4GGOA 1AN9A 1HE4A 2AW5A 4XR4A 3L6OO 4XYEA 4GH5A 2BGMA 4UVHA 4DIOA 4PFJA 1LDEA 1CQJA 1EE9A 1OI7A 1T2FA 1WMBA 3GNTA 4B4OA 4XRRA 4JXKA 1ZXLA 3Q2IA 4MVJM 5JC8A 3RFVA 1E3IA 2HJRA 3V5NA 4YJDA 4GL4A 3JYPA 3C3XA 2VYND 2I5PO 4BB5A 1BW9B 4FFLA 4NFHA 4ZQHA 4DGSA 4Y67A 5EN4A 4LSMA 3WGZA 1LSOA 2H6EA 3DZHA 2J3IA 3V2GA 4XCVA 1MFZA 2Y1FA 4WLEA 1C1DA 4YRAA 3AJRA 1DIGA 4KUEA 1PQUA 3BMQB 3EK2A 3U4HA 1Q7BA 3COSA 3GG2A 3L6EA 1X7DA 3RJ5A 5DF1A 4ALJA 4P38A 3GUCA 4QUKA 3ZWMA 5TJHA 4JGBA 4QO8A 4ZQBA 1MC5A 4R3WA 4ND3A 3E5MA 4ZD6A 1E1KA 1MC4A 4PRKA 5JAMA 3ZWVA 1MB4A 3G0OA 4OSOA 3FHLA 2VZ8A 1SZJG 1MV8A 5JY1A 3JD1A 8LDHA 5JAQA 3DHYA 1GADO 5DCUA 1JAXA 4MVJP 1ISJA 3GEDA 3E6AA 1ISGA 4MKRA 1TT5B 3JQ9A 2UYYA 3VAZA 3I3OA 3RUHA 1DO8A 3JQ7A 4N5MA 3D4NA 1KVQA 2GASA 4FSHA 1I2BA 4TZKA 3RBZA 1XU7A 2OP0A 1KY5A 3MOIA 4KTTE 2O3SA 3DZBA 4S3MA 1YB5A 4Z0PA 3ORFA 3EYWA 1M6HA 1P1IA 4OQYA 4QO7A 4H16A 4TROA 5CPFA 4IMRA 3ITDA 2EP7A 2NU8A 3UCEA 3ZV3A 5L53A 3EC7A 3WGYA 2D1YA 2CD9A 4KUHA 5FEUA 1AHHA 4CLOA 2ZB3A 4UEKA 4FR5A 5CPBA 2HCTA 1LX6A 2FOIA 3QLJA 3T7EA 1CYDA 5C7IO 1N7HA 4WASA 1WLYA 3DXFA 3PTZA 2EIHA 4YT4A 5DBIA 2BELA 1HSOA 1U28A 4BKQA 3PYMA 1LSJA 3JYOA 3DMTA 4O6VA 3NV9A 3RKUA 3AU8A 5JDCC 2BRUA 1N92A 1T25A 2Z1NA 4OH1A 5G0WA 1WWKA 4J1QA 1S7CA 4UEJA 3RIHA 2J3KA 4LISA 2BFPA 4OOFA 3LU1A 1EVZA 1KETA 3VKVA 1GAEO 1EDOA 2IEDA 1BRMA 3L07A 4JIGA 1U5AA 5AXAA 1D4FA 4XX0A 2GLXA 5KIAA 3QRWA 3KVOA 4XB2A 3LDHA 3OJFA 1T2CA 3GDFA 4FFMA 1QLJA 1E3EA 2R00C 5JAZA 2YDYA 1X0VA 1XR3A 4IS3A 1W6UA 3AOEA 2PKRA 3NDRA 3TZHA 4ZN6A 4CJXA 3JQFA 3IIEA 4E0BA 4A27A 2QX7A 3H5RA 2G1UA 1BVUA 4WEQA 1N5DA 1NHWA 1LLQA 3S55A 1KY4A 2HUNA 1DRUA 4D44A 3TOXA 1QORA 4IQ0A 4TWRA 1G0OA 5LDHA 5IFLA 4BNTA 4QEDA 4E2WA 1IZ0A 3X2EA 1BMDA 2LDBA 4J7CA 4KWIA 1H5QA 4N5NA 1TI7A 5TNXA 3F9IA 2PH3A 4ID9A 1YKFA 1HYHA 1XWFA 2C5EA 4ZU3A 1KIFA 2B69A 4A5OA 3WIDA 3VPGA 1DEHA 5B1YA 1HETA 3H2SA 4IDCA 3ZCXA 1ZEMA 2I65A 4O5OA 3ADPA 4RV9A 2Q4EA 2C0CA 4YRBA 5H82A 5JDIA 4WNIA 4RZIA 2XAAA 3HN7A 1SO8A 1ISHA 3ON5A 3QW2A 1R4NB 2YHUA 3INRA 2PD6A 4BNVA 4MKZA 1J49A 3GNSA 3HB5X 4IS2A 2QG4A 1VE9A 1LRJA 1A7AA 1P0CA 1X7GA 3CH6A 1ZXBA 3ANLA 3WG9A 2W2KA 3L77A 1E1MA 3P2YA 5CDGA 2PKQO 5A06A 4M54A 2PK3A 2Y1DA 4BB6A 1XKQA 1YH3A 1HE3A 1AGNA 4WK6A 4OL9A 5F3RA 3JQDA 4HADA 3ZHBA 1M2WA 2IRWA 2C59A 2VT2A 3SJ7A 2XXBA 5GZ3A 1P74A 3BMOB 2O7SA 3NAQA 3Q1LA 1Z82A 1A71A 2I67A 4CM7A 2A35A 2Y0EA 2HMUA 4BKPA 4XQ9A 3WYEA 1U3UA 1WZEA 2PR2A 4P4LA 4CQLB 3KZVA 1UDBA 3D3WB 4OSPA 5JLAA 3PWKA 3WYBA 1UDCA 1CWUA 9LDBA 2VWPA 5EL0A 4PVDA 3BIOA 1PGOA 1JW9B 2P5UA 3NKLA 3D64A 4OJNA 1HEUA 3C85A 3QY9A 2X4GA 1RYDA 1UP6A 1YE3A 3FNGA 2DLDA 5IZCA 3F4BA 4B79A 2VYVD 2DVMA 3QVSA 2Y1OA 1WW8A 1TB4A 2CSUA 1DC3A 1T4DA 1IE3A 3F4LA 2PD4A 5TT0A 4UREA 4BHTA 3WNVA 4R69A 4OKIA 2P2SA 2ZK7A 5ICMA 2VT3A 4AJKA 1R4NA 3EY4A 1M66A 2GCGA 3V8BA 3WLFA 4FFPA 4DIFA 2C7GA 1D1SA 1NQTA 4A26A 1EFLA 3H5AA 3I1JA 4GPD1 4CR6A 4CMIA 1DSSG 3N58A 1L7EA 3S2FA 5TSDA 3AUTA 4FDAA 2YZ7A 1F17A 1YDEA 1ZK2A 3IP3A 1X1EA 4BV9A 1DIRA 4DMLA 4JJIA 4CMEA 1MG0A 3B1FA 3ZGYA 4D43A 2NQTA 3H9EO 4BNGA 5A9TA 1W73A 4W7HA 4RVFA 5L95A 1YB4A 2OGUA 3CMCO 1PJCA 4INAA 2W8ZA 3AM5A 3RFTA 1OZAA 5T67A 5T5QA 1F8FA 1N7GA 5KVSA 1P1KA 3GA0A 3INGA 4BGEA 2D5CA 4BIIA 3HN2A 4BKOA 1P1HA 1HLPA 4NBVA 3PVZA 4RVDA 3DBVO 1UJMA 3OETA 4CQMD 4YAEA 1GZ4A 1EVYA 3ONEA 1AHIA 1JVSA 2IODA 1X0XA 4HNHA 4E2XA 4YXFA 5C7LO 5KJ1A 4RLHA 5IJZA 3E9MA 3FPCA 2PA3A 1GUZA 3RJ9A 4H15A 4EJMA 4PLPA 2PNFA 3F5SA 3K8ZA 1YONA 3H5NA 1UR5A 1JLLA 2FWMX 2NU9A 4IGFA 2VCYA 4R1TA 3FTPA 4I8XA 7MDHA 3JQAD 2DBVO 4NQZA 3O4RA 1ISFA 3KSZO 1LJ8A 1SOWA 5DT9A 3ANNA 3PFFA 3JQGA 2CDBA 1VSUA 1MXHA 3VVBA 1E3LA 5BNTA 3M2TA 1I01A 1YGYA 4FGSA 2JL1A 3WJ7A 3MJCA 1GTMA 1UXKA 4HFNA 2E82A 5TX7A 1ZFNA 5KOIA 3ICCA 3GMSA 1I36A 2O4CA 4PG6A 1LLDA 1PTJA 2OXIA 1OAAA 3W4IA 1V9LA 4Q3AA 4L74A 4J43A 5U9CA 4E30A 5KJ6A 4IBOA 3ZWOA 3FWZA 3E8XA 2YYYA 1H93A 2GF2A 1VPDA 1ARZA 3PJFA 1IOLA 1IY8A 4Y6RA 2NTVA 3EUWA 3ZHXA 2CF6A 5B4TA 3DBRB 3VPXA 3O38A 5JCJA 1ZIDA 1DJNA 1LEHA 1N8KA 3DOOA 2I99A 4FC6A 2HK8A 1QP8A 2OBYA 3H9JA 3KYCB 3OP4A 1P1RA 1T2DA 1YXMA 5DN9A 1B3RA 3N7UA 5EQFA 4PLZA 1C3VA 4BO8A 1P44A 3O26A 1BDMA 4NMHA 1HZZA 4CM9A 5BNFA 4WLOA 3WIEA 4NJMB 4DC1A 1LBEA 3K92A 4Y98A 2NU7A 1BXKA 4E12A 3AW9A 1EBFA 3W6ZA 4JK3A 4ND2A 4Q3BA 4DPLA 5K9ZA 2AHRA 2J5KA 5JBIA 1C1DB 1Z75A 3FBTA 4XYGA 3HDJA 4R1UA 5B37A 3ONDA 4B3JA 1NQ5A 1DOHA 1A9YA 4RVGA 1BW9A 1EBUA 1BDBA 2Y67A 3OICA 4CM8A 1H6DA 3DAFA 4MDHA 4R51A 2D0IA 3HNPA 4E5MA 3HWRA 4WOJA 5EESA 5G0SA 3VZRA 4XQEA 2EHDA 3RC7A 1B26A 1GCUA 2GN4A 3OIDA 1RKXA 5L51A 4HUJA 4K26A 3DZKA 2EXXA 3AUSA 3PQDA 4J16A 2VRCD 2O2SA 5ILOA 4FFRA 1PS8A 1X7HA 4RDIA 3BZUA 1PJQA 2HAEA 2VUSA 4XYLA 3D5TA 1XELA 2FMUA 3ENNA 1UZNA 2EWMA 2HKIA 3PYLA 1B8UA 1TXGA 3CZRA 2O3JA 2QYSA 3LT4A 4LMRA 4XR9A 4BNJA 2C82A 2TMDA 4AG3A 4FS3A 3C8MA 3JQBA 3VPFA 4RGBA 3FD8A 2G82A 4I5FA 5AVOA 4WNCA 3B1KA 1ZSVA 4L4XA 3ZZNA 1KVSA 1KEUA 3IAHA 4WEOA 1PSDA 3NUGA 2GZ3A 1KOLA 4OYRA 2AE2A 9LDTA 3ST7A 4BNFA 4MO2A 1IZ9A 1OC4A 5LDGA 4BQPA 2YV1A 2YQ4A 3LF2A 5COAA 2X22A 3WR5A 1P77A 2EW2A 3WWZA 2B83A 5C7OO 1WVGA 1SB9A 3TFQA 3OJLA 4YR9A 1JKIA 1QR6A 4KMSA 3TPCA 2J5RA 1FDTA 1HDGO 1HDXA 4OKNA 4RPGA 2E49A 1Q1NA 1KERA 1UXIA 4ITUA 2YY7A 4JNKA 2NVUA 1E5LA 1AXEA 2NSDA 2VNSA 3VKUA 6ADHA 2VHVA 5DOVA 2HMSA 3RFXA 3BMCA 4DC0A 2H63A 2Q49A 2WJPA 3SC4A 2OL4A 2JKVA 4OO3A 3RQSA 2RHCA 4DQUA 4FJ2A 4WLVA 5I9MA 3K6JA 1EQ2A 4UULA 3O03A 1BTOA 4GLLA 5A9RA 1DIHA 2PY6A 4CQMA 3HHPA 2H9IA 2QHXA 3NJ8A 4I9HA 4FGWA 1CQIA 2CMDA 2R2GA 2VHXA 5L9AA 2VUTA 6LDHA 4CODB 2D59A 3F5QA 1C1XB 1UXGA 4D0SA 3MJEA 3LT2A 4IJUA 1WNTA 1HRDA 3GLQA 3AUUA 2PLAA 1EMDA 1Z6ZA 3UICA 4J6FA 1J0XO 3ZV6A 4AVYA 1FJHA 1VI2A 1P33A 3I6QA 3JQCA 3PQEA 4PLVA 1Y5RA 1VJ1A 1YVEI 4RPJA 5T64A 3W8EA 3JQ6A 4XYBA 5JC1A 4DBVO 4NU6A 1KC1A 2DQ4A 3K73O 1O95A 2HMWA 3PFWO 1JDJA 3DC2A 1LNQA 2WE8A 4CR8A 3QWFA 3AK4A 2VZ9A 3TDKA 1A4UA 4ZVVA 2O23A 2PGDA 5L7YA 3ZV5A 1DDOA 3GVPA 4X54A 1KVUA 3R0IA 1ADFA 4LCEA 3GEGA 4OM8A 3F46A 2P4HX 3ETEA 3HDYA 2ZB7A 1D7OA 4HWKA 1KBZA 4TKMA 4YBZA 3HFSA 1GYRA 1MUUA 2WWRA 1T1RA 1D3AA 3FI9A 3UCFA 1LA2A 3NGXA 5L7WA 4CMJA 4LRTB 5HM8A 1QMGA 4JX8A 2PGJA 2Y68A 2BFMA 3ASUA 3RWBA 2X9GA 2HJSA 5ITVA 5KVQA 4J0FA 2DC1A 1HDRA 4R5MA 2IZ0A 1NVTA 4GX0A 1BVRA 1JN0A 2J8ZA 5HS6A 3ROPA 1LDMA 3RC9A 1XG5A 2X0JA 4D79A 4UVDA 2J3JA 4XGKA 3WMXA 1PL6A 1GY8A 4XQGA 1ZKMA 2ZYGA 2IDZA 3WMWA 2ZJ0A 1F14A 5CFZA 3QWHA 4CUJA 4YDRA 4AJHA 2VQ3A 3DZIA 5MDHA 5A9SA 4KUGA 4CV1A 4HKTA 1U7HA 1I30A 2Y66A 4NBTA 2JD0A 5JYDA 1LSSA 3A06A 4HFMA 4B7UA 1I32A 2GO1A 4J4TA 1OMOA 4U8GA 1VKNA 3AI3A 4YQYA 5JXWA 3L9WA 4RF3A 3OQ6A 1Y7TA 1VL0A 1ULSA 3I52A 3OIFA 2I66A 4B3HA 3PYXA 3K9QO 4JCOA 1IPEA 4O1MA 1YL7A 4G81A 2ZIZA 4JN6B 4FW8A 3KLPX 1R15A 4UVEA 1B3BA 1I8TA 4F6CA 4R3NA 1U5CA 4YT8A 1MXFA 1SOVA 3TRIA 5GZ6A 1HYEA 4IMPA 3C7AA 4FQ8A 3VZPA 3BHJA 4LVCA 1X13A 2VYVA 4GKBA 4YQZA 3WGHA 1ZZEA 2NACA 3L4SO 4PG5A 4ND1A 3ZWBA 2D5AA 4PLCA 4CV0A 4NI5A 2O50A 5CDTA 4ROSA 3GHHA 2JCVA 2TMGA 4GGPA 3JCZA 2P9EA 3RU9A 3WTCA 2X5OA 4D0RA 4WKGA 2ZB4A 3GN1A 4IQGA 3A4VA 3PIDA 4PCVA 1DC5A 4MVJF 3WQQA 1UH5A 1NP3A 4EUFA 4IUYA 3GOHA 2VWHA 2DFDA 1RJWA 4FCCA 3F1LA 4J1TA 4MIOA 1GZ3A 1I3NA 4AJ2A 4BNKA 1Q2XA 4F6LA 2NUAA 5T8KA 3ZHZA 4R68A 5KJFA 1Y8RB 2C5AA 3BTVA 4AJ1A 2GN6A 1E1LA 2EKPA 5I8WA 2WMDA 3FBGA 2W2LA 5JCXA 2O4UX 3UVEA 3ZWYA 4RPKA 4F45A 3QSGA 3F47A 4JJFA 1DLIA 4DYVA 2UUPA 1GUYA 1UP7A 3M1AA 4KZPA 2AMFA 2GPTA 3TZCA 2Q2QA 4BO0A 3OEWA 1GD1O 2EKQA 1PJ2A 2RH8A 3C1OA 5TLSA 2ZQYA 1DAPA 4B8WA 5C5IA 4NBWA 4R01A 4F46A 5A04A 1IULA 3RD5A 2PZKA 3ICPA 2HSDA 1I5RA 2DUUA 3I9LA 2O2YA 3DONA 1TT7A 1MG5A 3H4VA 4J91A 5L3ZA 1LDGA 4XDYA 4XYMA 5T8KC 4CM4A 5I9NA 4AFNA 1ORRA 5HA5A 4TVOA 4AJOA 5A9SB 2GN9A 3KYBA 3QQPA 3OHSX 3K5PA 4IPTA 3TZKA 1E7YA 3OJEA 3UOGA 3H3FA 3ZWXA 3C7CB 4BQRA 5LCXA 1PGPA 3STHA 2EJVA 4CMAA 3T7CA 3I4CA 4R1SA 1GEEA 1H9AA 1HWYA 4FN4A 4NDNE 1OOEA 3DB2A 4DVJA 4I9NA 1I2CA 1PX0A 3KLMX 4M49A 3F6YA 3ZHYA 2HU2A 2AXQA 1E3WB 3OQ1A 3K96A 3DTTA 5I7FA 2POQX 4JP3A 2H5LA 3TN7A 3S2EA 1UXJA 4TZTA 3LC1O 1NVMB 1ZMTA 2FRDA 2DTDA 5DNAA 5J23A 2DTEA 1DXYA 1E6WA 3JQEA 4CL3A 3ZWNA 2PV7A 2Q1WA 3GG9A 4FB5A 4OXKA 4U6QA 3GPDG 2Y05A 1LDYA 2EKLA 3U4DA 4BNNA 4ALLA 1M6WA 3VH4A 3OEYA 3WGOA 2DTXA 4CM4B 2UV8A 4G65A 2Y1CA 4NJMA 4KOAA 4BGVA 1VL6A 4A10A 2YV3A 1GUFA 1NAHA 2GUGA 2AE1A 4NPCA 3ZWCA 1NWCA 4H3VA 2BGLA 3AFMA 3UKOA 5JO9A 4BOYA 3U49A 1E3SA 4A2CA 2NADA 4J7UA 4R41A 3G17A 4QQRA 3ABIA 5COQA 3DHEA 5G2OA 2QRJA 1H94A 3S2IA 3ZW9A 3MWEB 3SBOA 1U3TA 4GKVA 4YEDA 1HL3A 5GMOA 1C1XA 4OAQA 3OBBA 2BI7A 2HLPA 3VTZA 4BO6A 4AICA 3DBRA 4EJ6A 2B4QA 2BD0A 4BVAA 4NIMA 3BMOA 1E92A 1NX6A 4UVGA 3GT0A 3WQSB 1U4OA 3RROA 2ZCVA 4YJHA 2Q2VA 2HMTA 5KTKA 2HO5A 3H9UA 2DFVA 3JQ7B 3V1UA 4IZHA 3WBFA 3VH3A 3NTOA 3KV3O 4AJ4A 1XU9A 3D3WA 4W4TA 1FDSA 3KETA 3GFGA 3GDOA 1WDKA 5JY6A 1P1FA 2WYWA 3AUAA 2J6IA 3WQRA 1GPDG 4DPKA 5BSEA 1EFKA 4LW8A 4ND4A 3PHGA 4PN3A 2BGKA 4D3FA 2G5CA 4J90A 1Z7EA 1AUPA 1LRLA 4KTVE 3PHJA 1IHYA 2ZQZA 4QTZA 2IYOA 4ONEA 2AQ8A 3WFJA 2GD1O 4JBIA 1WPQA 4FOOA 4GWKA 3RUIA 3BMNB 4G5HA 2A94A 4QT0A 4LCJA 1B14A 4CLRB 1L7DA 1SB8A 2CNBA 5JDCA 2VHZA 1UDAA 1PJ4A 3T4XA 3W4KA 3LZ6A 4JQCA 2GSDA 5KVCA 4IIVA 3PJDA 4CUZA 1ZMOA 5CDSA 2Q1TA 1QLHA 4DBZA 1YB1A 2AEFA 4E32A 5ADHA 2NTNA 4B3IA 1F06A 2VWQA 3JYQA 2CFCA 1K3TA 1U9JA 1ZK4A 3HDHA 3MTGA 4RVUA 4CMBA 5L4SA 1U8XX 3PEFA 1CETA 4MP6A 1ONOA 2FHSA 3IJRA 2GDZA 1ENZA 3IOYA 4BKUA 4DQXA 2GNAA 3RVDA 3DFZA 1Y9EA 3A28A 1X15A 4W9NA 3DZFA 3DBLA 4XZ3A 2FPPA 1LXCA 1E3JA 3O8QA 4K6CA 1JWAB 4URFA 4DUPA 5I7SA 3DOJA 1GPJA 3N74A 4XIJA 5FF9A 4NFSA 1Z7BA 2C07A 4EBFA 4BNXA 5CEFA 1NR1A 1VC2A 1GYQA 4DYDA 4QFDA 1SNYA 1QXSA 4NHEA 1LQTA 3RUAA 1ZVMA 3SEFA 4WCFC 1MFPA 1QSGA 5H83A 2C54A 2HK7A 2DKNA 4BNHA 4EEZA 3HB4X 1B2LA 4EZBA 4KQWA 1H9BA 3PQFA 4YT2A 4D45A 4BNWA 4MP3A 1Q7CA 2Q3EA 3MJVA 4CLRA 3E03A 2G76A 1R4MB 3GZNA 1GL3A 1ADBA 1LI4A 3T4EA 4W6ZA 3GEMA 4CM5A 1PZGA 1QYWA 5TGDA 3TNLA 3S8MA 1BWSA 4WPGA 5HS4A 5ES3A 1PEDA 4E4YA 1SAYA 1XQ1A 3U62A 1HT0A 4GI2A 4Y6SA 1O5IA 1NQOA 1EK5A 1DRWA 4C7JA 2P68A 1T4BA 1DIBA 2WYUA 4LVUA 4YAKA 2NVWA 1KVRA 1WMAA 4AJEA 3LSYA 3KXDA 3P19A 5JMWA 5T73A 3PXXA 4R4JA 3NRCA 4XD2A 1PJSA 3K30A 4N5LA 1N1EA 3IKVA 4S1VA 5K6AC 2Y93A 2YFQA 2IE0A 3D5QA 4WE3A 1FK8A 4B4UA 1YBMA 2X6TA 3QWBA 2X7HA 4E3ZA 2OZPA 3UF0A 1MA0A 2Q22A 3FNEA 4RO0A 1FDWA 5A5FA 3DEYX 4TMFA 5HRUA 2YJZA 4CL8A 4XA8A 2PZMA 4W82A 4FIZA 4E5PA 3C1AA 3GHYA 4J3FA 3G49A 1C0IA 2EJWA 1KYQA 1O8CA 2HK9A 1ZK3A 4IDAA 4WGGA 5DP1A 3X2FA 2BFAA 2W2LD 5KJEA 4EYEA 1PL7A 2I9PA 5JO0A 3EVNA 4IINA 4DXHA 4KWHA 3PJEA 4YJHB 1ZCJA 5A4DA 1NVGA 2AEMA 3ZWPA 2XF8A 2O3TA 3EMKA 1DPGA 3FRJA 3LT0A 1XHLA 4NR0A 1FF9A 3QE3A 1ZNQO 1Z73A 3IP1A 1JWBB 4D3DA 3LLSA 3PGXA 3FTNA 3G3EA 1VL8A 1OC2A 1B16A 1DJQA 4E2ZA 2QZZA 1U7TA 3INTA 1R12A 4R54A 3GZNB 3MJTA 4I5DA 2X0NA 1YDWA 3KSUA 3HDQA 1CERA 3LK7A 3U9LA 4OMUA 5KKCA 1Q0LA 5MGBA 4D7AA 5CHEA 4ZQEA 4IM7A 3VDRA 3JQFC 5C37A 1GZ6A 1T24A 3ZWWA 3JQBC 3A14A 3KEQA 5J9GA 1HXHA 3ITKA 5FYDA 4BNIA 2HDHA 2X1HA 5AXCA 4CM3A 5ILGA 3M1LA 1PGNA 1VJ0A 1ZUD1 1GQQA 2HQ1A 1ZH8A 1ID1A 3RC2A 4PLWA 3DDNA 4HV4A 4P4GA 4P8RA 3FF4A 1CDOA 5A3JA 4TSKA 1CF2O 3DL2A 5U1PA 3O8QB 3GAZA 2Y0DA 3B70A 1HDYA 5JW6A 3MWDB 3DMYA 3EDMA 4WLNA 2E4AA 4M86A 4DLLA 2VOEA 5JE8A 3RI3A 4I08A 3OF2A 2VWGA 5DP2A 4CV2A 3E18A 1ADCA 3VHRA 1E77A 1F0YA 1UAGA 4IXWA 1Y9AA 2D2IA 4BV8A 1HDOA 3WSWA 1HKUA 4PZEA 3JTMA 2E6UX 1QYCA 3WOHA 1CIVA 2WD7B 4RDHA 2C2XA 3U4CA 4BO2A 4EW6A 1CJCA 4Z0TA 3Q2KA 3DBHB 5AXBA 4I5GA 4RCVA 1I24A 2OMEA 3HADA 3TWOA 1DHTA 3RBXA 4PGFA 1T26A 4BGUA 2C20A 4YACA 3WBBA 1EVIA 4L4RA 1H2HA 1PR9A 1G1AA 3AOGA 2UVDA 3JD4A 5H81A 1B8PA 4XDZA 5T57A 2GZ1A 4E5NA 1SPXA 1ZEJA 4ZRMA 4Z0HO 1H0KA 4JJGA 4H7PA 4J4HA 1B0AA 1RPNA 4AJLA 3WYCA 4DA9A 4J7XA 1T2EA 5IDWA 2FZEA 4BNYA 4I1IA 3H3JA 3IS3A 3WWYA 5T6BA 3ZNNA 5EIOA 3ZNQA 3D4PA 4G2NA 4BO9A 1TA4A 1WAMA 1JKFA 3LYLA 3UUWA 4JBGA 1FMCA 2O3QA 3D0OA 4J2OA 1B15A 3CTMA 5JCJD 1X1TA 1K2WA 1PGJA 4E5YA 4GSKA 3KYCA 3EGOA 2AEJA 3KOUA 4YAGA 3SVTA 4FD3A 2FY8A 1ZO8A 4M55A 3E9NA 3ROQA 4HNGA 1GR0A 4AJPA 5LC1A 1PZEA 4JLWA 2JD2A 1J5PA 1Z74A 3WX0A 3DZGA 1Q0HA 2X86A 1FDVA 4BNMA 1Y81A 5KJCA 4WCDA 3KYDB 3TQHA 2DU8A 5FFFA 3LLVA 4Z9XA 3PWSA 3OJ0A 4J49A 1ULUA 4TRMA 3QVTA 2FPGA 4BL5A 3AU9A 4O59O 4R9RA 4XWYA 2W2KB 1O89A 2Z5LA 1D8AA 2ZTVA 3BXXA 2BF7A 4WECA 4Q3DA 3UGKA 1LU9A 2B0JA 4MKXA 1O9BA 2B35A 1ZK0A 4NZ9A 5CAEA 2A92A 1E1NA 2JHGA 3JSAA 3ZWAA 1V0JA 3S1LA 1K5HA 3GR6A 4PZCA 4UUOA 3SLKA 3GQVA 5DULA 1L1FA 4FFOA 2ILTA 5BSGA 1R0LA 1N9GA 2GN8A 4WLFA 1YO6A 4HX5A 5TC4A 1GFSA 1NFRA 1YL6A 5CDYA 4MVJA 2OP1A 3CUKA 3GVIA 8ADHA 5JYFA 4CV3A 3DFUA 2OBNA 1RM3A 1PJBA 1PZHA 3DZJA 4BO1A 1DFIA 2WM3A 3R1IA 3WDSA 3ZW8A 5B12A 3FR7A 1TVEA 4D46A 3EHEA 3I9OA 4D3SA 2VRCA 4Q9NA 1P45A 2AA3A 1NASA 2Q50A 2V65A 1E3WA 4J1SA 3VDQA 4E2YA 3NJ4A 1NHGA 1CRWG 2QYTA 3GVXA 1QV6A 2WD7A 3DWFA 3Q6IA 4GWGA 4ZQGA 4BMSA 3P5SA 3TFOA 3WGIA 1NFQA 1Q7GA 3CXRA 3GFBA 4N54A 3GMDA 1YQGA 4NNJA 2VYNA 2BH9A 4BGIA 3QP9A 3QIVA 2AG5A 3RCBA 2ZYDA 1JKJA 5IG2A 1H6AA 3CSDA 3W6UA 5JYAA 4DIBA 3P7MA 3PZRA 3SC6A 3GPIA 3QVOA 3KB6A 5IXSA 4EJ0A 4HXYA 1T2AA 1AE1A 3BAZA 1A5ZA 1RM0A 4TRNA 1SEVA 2Q4BA 4PG4A 5JYEA 1YQDA 1P31A 3HFGA 4DLAA 2BLLA 4YWJA 2GRAA 1K89A 3FNFA 1QYDA 3RC1A 4B4VA 5G0UA 2P5YA 2CDAA 4O0LA 1Y5MA 4JBHA 2XXJA 1IHXA 3ASVA 3AI2A 1EQUA 2DBQA 3G1UA 3WGGA 5TIIA 5DDIP 3GAFA 3KM0A 2NTJA 4J0EA 4NK5A 3VZQA 1MLDA 1I0ZA 5IF3A 4YB8A 4DMMA 3C7DB 4J4BA 3C1TA 5K0ZA 4GX5A 3DHNA 1VRWA 1EE2A 2Z1MA 3QA9A 2Q2WA 2NQ8A 1BXZA 1QV7A 1V3TA 3OA0A 3GK3A 3BTOA 4YAJA 2GZ2A 5B4VA 2YHIA 5CEEA 3W4JA 3LQFA 4BS9A 5KCZA 3FSRA 3ETGA 1YBVA 3D4OA 1Y1PA 1F8GA 1BGVA 2O7QA 1GCOA 2Y1EA 3H9QA 2EGHA 4PVCA 4XJSA 4MIEA 2SCUA 1XYGA 5HBRA 1DB3A 1YRLA 5THQA 3EAGA 4K6FA 5U4QA 4CUKA 1R16A 3H7AA 1UZMA 4II3A 3KYDA 3O9ZA 4AJIA 2X58A 1DC4A 3OIGA 2NVUB 4BO7A 4E5KA 4U7WA 1PS0A 3WB9A 4PLYA 1HSZA 1JQBA 4U6SA 4MJLA 2NLOA 1A7KA 3WGTA 5JSFA 2R6JA 3GGOA 1A9ZA 1H6CA 4MP8A 5JFOA 3RASA 3VVCA 3RUFA 5KNLA 1GYPA 1G6KA 4YA6A 1LUAA 2E37A 4ND5A 2EF1A 4IIUA 1R6DA 5A03A 2OORA 4RQTA 5I7VA 5JNLA 3FN4A 3GH3A 1I33A 1ZJYA 4ALMA 1B7GO 5EINA 2V7PA 4DLBA 2Q1SA 5AYVA 4BUCA 1GV0A 3G79A 3PGJA 4L0QA 4EITA 1V6AA 1SEPA 2BFOA 3VZSA 4MVJI 3OM9A 2AQIA 1XA0A 3GRPA 4ALKA 5IAAA 2NM0A 3PIIA 5L40A 1IPFA 2PZJA 1ML3A 3RKRA 1DC6A 4MOWA 2OOSA 2C29D 4CM6A 2DBZA 3KHUA 1PL8A 5L45A 3L9XA 3PRJA 4IDDA 3NDJA 3GGGA 3NTQA 5BQFA 3U3XA 2JFHA 1XIVA 3QHAA 2EGGA 2C2YA 1V3VA 1LC0A 2BHLA 1X14A 1NWHA 2V6GA 2DBRA 3U4IA 1W0CA 4CMKA 1IUKA 4B7XA 5THKA 4K9DA 4QX6A 3EW7A 4OQZA 1PQPA 3SJUA 1UXHA 3EZYA 2FR0A 1WDLA 2JJYA 5G4KA 5TRTA 1I3MA 1ENOA 2QRLA 3GVHA 1YS4A 2VRBA 3TL3A 5ICSA 4A7PA 3HUDA 1C0PA 2CUKA 4QFCA 1R0SA 3JYNA 1JA9A 3AM3A 3DBLB 4IQ8A 3ANMA 3UH1A 2RHRA 5DBFA 2NWQA 3AY3A 3GGPA 1HE2A 3H2ZA 1IB6A 1ZJZA 4PG8A 4MINA 3OFSA 3UHAA 4YAIA 3F1KA 2QQ5A 2FR1A 4Q3EA 1NXQA 2W90A 5G0VA 1JAYA 2F00A 4YJGB 3GUYA 1ONPA 4YT5A 3B1JA 3EVTA 3L4BC 1YQXA 3FNHA 4LRSB 3PDJA 3IL2A 3RSHA 4P22A 3OMLA 2RH4A 5TT1A 4WJZA 4N7RA 1NPTO 3CIFA 4DRYA 1ZK1A 2Y1GA 4XIYA 4J2HA 4NG5A 1YJQA 3WXBA 2D4AA 1KEPA 5DCWA 4CLEA 2YUTA 2P4QA 1SBYA 4ZHSA 4C4OA 2PKQP 4GX2A 4HFJA 4JP2A 1DFHA 1QRRA 2ZATA 3A9WA 3PHIA 3PLNA 1VKOA 1U3VA 5C3MA 3H9GA 1K6XA 1NPDA 4BMVA 2BI8A 2ZJ1A 2CZCA 2CDCA 3MEQA 2IZZA 4E31A 3QVWA 1XGKA 1LC3A 5CP8A 4CR7A 3ZDFA 1GU7A 2WDZA 3BYZA 2A4KA 3B6ZA 4PLGA 4A03A 1N2SA 4CMHA 2JAHA 1EUZA 3QWIA 3HZZA 3FCOA 3IUPA 2EG9A 4ESOA 3WGQA 1BG6A 4Y8VA 3PPIA 5A05A 2QIOA 4HP8A 2NU6A 3TZQA 1PIWA 2F1KA 2YHIB 2VTDA 3VH2A 2B4TO 4HY3A 1LLUA 4RVSA 5I9LA 1S6YA 3VH1A 3Q0EA 5FWNA 1LQUA 5EERA 3TL2A 3RUCA 4R5HA 1I3KA 1BXGB 2VOJA 4KP7A 1YOVA 3HSKA 3LT1A 4W7IA 3KBOA 1QYXA 4ZA2A 3H8VA 1M67A 2DUWA 4TQGA 4CLHA 3ROKA 4MVJG 2B5VA 2EERA 4U5QA 4M8SA 2LDXA 3MCVA 3W1VA 3ZI0A 4NBUA 3KTDA 2X5KO 3OSUA 1M76A 2FSSA 3OJOA 2IEBA 2EP5A 4WOKA 4RPHA 1QYVA 4IGEA 1SC6A 4GMGA 3KSDO 2WTBA 4XGNA 1VLLA 4RQUA 3U0BA 3FPLA 4XGIA 3ENKA 3U5TA 1E7WA 2UAGA 5BNIA 2UDPA 3MJ4A 3PP8A 3DBHA 1V8BA 2IZ1A 3V2HA 4R1NA 2CVQA 2J5QA 4DTIA 3JD2A 2I6TA 5ENDA 1ISIA 3LC2O 5FI3A 1SCUA 4YJFB 1PJTA 2GR9A 1H6BA 4ZQFA 1HLDA 2BMAA 5CG2A 3PDUA 1NR7A 4BNUA 4IZIA 4RL6A 1EDZA 5M6DA 2W4QA 3NEPX 1U2DA 3IMFA 1YJ8A 4JROA 1RWBA 3ROMA 4F3YA 3ZV4A 1NPYA 3JV7A 1U3WA 4YYZA 1F12A 2YQ5A 3R3JA 3RU7A 4NK4A 4PLTA 4R9SA 3VTFA 4TRRA 5COBA 3E82A 4CM9D 2JCYA 2ZYAA 4FFNA 3I5MA 4U0JA 3ADOA 5EJ2A 3I9KA 3IQDB 1VJTA 1DHRA 1ZW1A 1EVJA 2CVZA 3PHHA 3ZN2A 1PJ3A 1A72A 1JVBA 1KS9A 1O94A 4PRLA 3VC7A 1UAYA 3RAJA 4UEOA 2Z95A 3I4FA 1DFGA 5IZ4A 4DREA 2RCYA 1DLJA 4OGWA 5DOZA 1O0SA
chains in the Genus database with same CATH superfamily
2OFXA 1Z9BA 1H05A 2PZLA 2IH5A 1FX0B 1ONNA 2JIPA 2GFHA 1YB2A 1ZD4A 3I28A 4FK8A 2UVPB 2J41A 4RSHA 1MX3A 4MX8A 1FVOA 4PIMA 3Q85A 2FQQA 2DPGA 5ICGA 3TNDA 1ZD3A 1VFPA 2V7VA 4FGJA 4RWZA 4EPXA 1HDCA 4HPJB 4I2NA 1TYEB 4ADSG 3CW9A 1IOZA 1U8FO 2RHLA 1PDOA 1QK3A 3KQVA 3M9XA 1CIPA 2JIZD 3OLXA 4HDMB 4I19A 4IJVA 3A1NA 4TOIA 3OCJA 4G9EA 1QH9A 2WYOA 1XMVA 1COZA 1H2BA 3A2LA 4KEAA 1JFVA 1R4ZA 4LZJA 1B6TA 5I01A 2Q5JA 4OK3A 8MHTA 2XYQA 2EQ5A 4D5EA 3GCGA 2LIVA 3ZW7A 2UUOA 3PKZA 1AXGA 1DAMA 5JPDA 4JDPA 5AOVA 4NL4H 2X0IA 4MIYA 2VP2A 1PZFA 3GEIA 4M4SA 2IXBA 2FUG6 3BRCA 4TXNA 3I2JA 4Y9DA 4ZVMA 4CMGA 3GLSA 3TBKA 4LC1A 1N5JA 1NYTA 4MV4A 3WBJA 3H84A 3BSSA 3U7EB 1P0FA 1SVUA 3EEQA 1JQAA 1MTZA 3PX3A 2G9QA 4MKIA 4J9UE 3UT5A 4UTVA 3RS9A 3H1TA 3CJTA 5AVRA 2WE7A 3I9V6 4TSFD 1TVMA 5AKKA 4TV9A 3G1TA 3W2HA 2EQBA 1N4DA 4YV1A 2YFHA 4YLYA 2BFCB 2Q8PA 3QYAA 1T10A 1JDVA 3K2QA 3HQ4O 4WLUA 1N1GA 1Z2CA 3AF4A 4QGHA 3OZBA 5IBRA 4Q4HA 4PYRA 4AP6A 2RFLA 5I45A 4PQRA 2ZRPA 1VGRA 1VE3A 3GFFA 5H9VA 3FVQA 5BNZA 3ICQB 1K06A 3CEJA 1G5HA 3Q3VA 4FYXA 4OXXA 3VAYA 3JQ8B 4OUDA 5JS7A 2A0FA 1KEVA 4YDQA 3QPDA 4FYJA 3HU1A 5AWFC 3MCWA 2B6NA 3KZKA 2BGGA 4DA7A 4B75A 3NM6B 2J59A 3E1KA 1N3IA 2CF5A 2GCIA 3IE2A 4RF4A 5FI5A 4DQKA 4QZVA 3OQNA 2VXOA 3TEMA 4FDLA 4JL5A 1LSUA 4LZPA 1YVDA 3BWCA 3V1KA 4LJSA 5HP4A 3IUBA 1MVOA 5EQDA 3ZDBA 3NDIA 5IEJA 1XZQA 3KUDA 4AL4A 3L46A 4TKZA 1G64A 4DMCA 2E5LB 2ZI3A 1ISPA 1EB9A 2X9NA 1G1MA 4AF6A 3VSBA 5LZ2A 2IHUA 3KL4A 5BMVA 2ZYRA 4OGFA 2J48A 5LZ5A 3VNUA 2JI8A 1QIFA 1C9EA 1KNXA 1WUYA 4CE6A 1RJ9B 1RPTA 3DMTC 3MWYW 4KAAA 3DAYA 1GOTA 3JQAA 5DX1A 2P9GA 1RCTE 4ZKDA 1B23P 5EKDA 1IEXA 1DKLA 2P69A 5AI4A 4WH0A 2R97A 4TLMB 2RKOA 1EZ4A 4KDFA 4K86A 2O48X 4Q9HA 3A8TA 3N8GA 5GINE 2P9CA 2R7LA 4PQEA 4UNNA 3V4LA 5EC8A 3OURA 4X7MA 2VLBA 1H8ED 1GLNA 2MSEB 5C81A 1J1ZA 2R8XA 5DBOA 4WDRA 3P96A 2AI2A 3PCXA 3RUEA 3PNSA 1JSLA 2X8JB 1I7SB 2G9RA 2QSUA 4FJ1A 2OTCA 3BGSA 1TKRA 4NBNA 2X6QA 4FOSA 4JI5B 4AKHA 4GDMA 3KPVA 7ADHA 1GPUA 1FPQA 2IH4A 1L5NA 4M1EA 3HLKA 1Z4LA 2NV6A 5G4KB 4M1SA 4UEWA 3Q5GA 4D4HA 2FUNB 2O57A 1OLOA 3TLYA 3W2EA 3TB6A 4PTYA 5DNVA 3CUWA 3JQAB 1MO6A 1DQZA 4JT8A 4BWGA 3K9CA 2DM6A 4JWKA 1WTCA 2D7DA 3HJNA 4D97A 1VTKA 4YECA 1T2UA 1KEWA 5J1TB 5JCOA 3UHFA 3X1MA 5H3HA 2B1IA 4JEMA 5EZ6B 4C5CA 3NRJA 3PNKA 1QG6A 4I50F 1L4FA 1CUVA 5DHAA 4RA6A 4V3CA 4QXMA 4DADA 3HHEA 1LVHA 1N2IA 2AD5A 3HM9A 4IJKA 5BYKA 1AV6A 4ZO9A 3FB1A 5CEJA 1XSEA 3NPMA 2AOTA 3EQ2A 1NF9A 4EB3A 2XF2A 3NONA 1Q0QA 1O6CA 3IAS1 5AKJA 4CL0A 2BTEA 1U02A 4F2WA 2VPQA 1JXMA 1T3ZA 1U7OA 3H6KA 2N47A 3VPSA 2W11A 4IUBS 5AW8A 1DBSA 1EI9A 1JHQA 4MUEA 3BJMA 1OI3A 4CLXA 5FXMA 1PJLA 4CMEC 2AG8A 4QLOA 3A1FA 3V42A 3P0RA 3GYBA 4HNAB 5EVCA 4G36A 2ZJZA 4QOFA 2ZTHA 1AN0A 4KXUA 2EVWX 2XTNA 3IKTA 2VJLA 3UT6A 3ZU2A 1HYGA 1E7SA 1K6MA 3LVFO 4YPOA 1B0UA 3WFIA 2KSQA 3LWZA 3BF7A 3D4BA 3LLCA 3OTGA 1G5PA 2OCYC 1FLVA 1T0BA 4RPLA 3TLMA 1K86A 3UOAB 1Z0FA 1E9AA 3C43A 2IQIA 5G0TA 4KYIB 3UC5A 1PV2A 3KWLA 3U09A 4EG7A 2ZE5A 4M9ZA 2WF6A 2GZDA 3LV8A 3H8SA 5KWSA 3OCUA 2I22A 3ZKAA 5EIWA 2WB4A 3OIYA 4OOEA 4TL7A 1YR9A 3ZE6A 4PC7A 3CPJB 1J8MF 4GQBA 4P98A 5AUPB 3ZEIA 1WXWA 2VYCA 1C9NA 4KPUB 3LF1A 1JILA 2NAFA 2VDUE 4IDBA 3ROGA 2CBXA 1PG2A 1QIGA 4MS1B 3W3AD 4AJNA 1TOAA 3N2KA 4NU8X 1EJ6A 4Y1RB 1BMFD 3U60B 3HCWA 4ZCLA 2HUPA 2R6ZA 1M7GA 3U7QB 2R7AA 3E48A 2HPZA 2O2GA 3AB3A 3L6CA 4IDEA 5D5QA 5A3VA 5KDLA 4ZGWA 3U80A 1CEQA 4D02A 3TH5A 4R1LA 5ARBA 1QK5A 2RBKA 3D7MA 1OBVA 5E3JA 3VI3B 1YZ3A 1K5DA 2K2WA 5IZCC 4AQ7A 2DPXA 1DKPA 2G07A 1SCBA 1JTVA 2OCPA 2FCAA 1BE6A 5TQ0A 2G4CA 1F7UA 3IUNA 4FFBB 2OD9A 2CJPA 4YRLA 3EYAA 4BZXA 1KYYA 2P2DA 1E7MA 4LNHA 4Q3CA 3VFDA 1R4MA 1XDBA 5TJ9A 2IYNA 1X8LA 1PL0A 3UG7A 2IA5A 2ZRNA 5JEEA 3WO1A 2CKDA 4NU5A 1EZ1A 5T41A 5AO9A 4P81A 4ZYYA 5T4BA 4J3JA 3V2IA 3NTRA 3JD0A 2ZETA 4G8CA 2UZ1A 4N0MA 4DCTA 3AY6A 1NYRA 4JYMA 3FHCB 3UN1A 5LD2B 1HFEL 1RDFA 2EKBA 1G8SA 3EBLA 1TZBA 4NPHA 3ZOKA 5HR5A 1Z8DA 3PI7A 4FINA 1QG0A 2VDVE 2ZT7A 3IQXA 2VQFB 3BZWA 3EDYA 1JV2B 2VHJA 2X0RA 3HB1A 2AJCA 1BE1A 1TUBA 1SMKA 1SXJA 4ECEA 1W8DA 2JZCA 1QKJA 2P3OA 4YMUA 5SZIA 3UYLA 2COUA 2VUIB 3I83A 3B60A 1SY7A 3VU9A 3OE5A 2HGSA 1DV2A 2E48A 3DB1A 5AJWA 3V8QA 4B85A 4Z1MA 4ZCTA 5C5DA 4UFNA 5IDXA 5IU6A 5LKRA 2ET6A 5B6PA 2VPPA 1XWWA 1BFKA 3GJ5A 3Q6MA 3DAPA 1PUIA 1E7RA 1OF1A 3EFEA 5DI9A 1EM6A 4JUIA 1P2FA 4U3JA 4DPMA 1VDZA 3GN2A 4UM8B 4ZAYA 3SGLA 3J7AC 4LI3X 4YWHA 1N9GB 4DT1A 4P0QB 1C8KA 1G20B 1RMYA 2VNAA 3N9IA 3Q3CA 3WJAA 3D6MA 3SS8A 2FEMA 3VAAA 2P11A 3MZ0A 4DQVA 2ZVPX 2VJNA 3AV3A 1TEVA 4V0NA 2UZ1B 1OTXA 5IAEA 1ISMA 2BH2A 4MUYA 1WBDA 1NSTA 3G2JA 4U7PB 3PC6A 4X95A 1VIVA 2AXNA 3AETA 1N9KA 3KEFA 3L8FA 2Q5EA 2J87A 4P7FA 4E21A 2F64A 2OV2A 3H65A 4XPZA 3Q9NA 3SXPA 1WZIA 1YBFA 2EV9A 5B1IA 2WSBA 3W8FA 5B4UA 1IQ0A 3P9ZA 4D74A 2EWWA 4B8ZA 4PC2A 4G0YA 1U4SA 1P3DA 4JC8A 3HZHA 1YZYA 3UAZA 3O3MB 1AZTA 1Z88A 2OHFA 3IVMA 4PLFA 1XEAA 5TARA 1K92A 4YP1A 4HQFA 4JQOA 1LRKA 1FJXA 1SD1A 3IC5A 1IBKB 3RK1A 3O8BA 3FUWA 2F43A 2R8YA 3GDGA 5FUXA 1I6LA 1P81A 2E85A 3IUSA 4MGHA 4DDTA 4ZZIA 1G19A 1FFSA 1TT5A 2LTAA 1TU0A 2QVYX 4OQEA 3ZJ5A 3UJ3X 3K1AB 4TGLA 1TLTA 2PH5A 1ZNWA 2H18A 4NJOA 4FONA 2JFFA 3FZGA 2YIVX 4HUQA 7GPBA 3IERA 5BSRA 5EQTA 4LDJA 2DAPA 3KKZA 1JJBA 1EWRA 3FSJX 5F4BA 5CD1A 3EWSA 4MRMB 3GLGE 1I2ZA 5CW1A 4NYIQ 4MI3A 5F1OA 4Q21A 4CKCB 3K09A 1W5EA 5DI3B 4EH1A 5JG7A 4BU0A 3BEOA 3ETDA 5K5EA 1G9TA 4OHUA 3M6XA 3WHKA 4E33A 3NX4A 3E2PA 1T8SA 4JT4A 3BX1A 2ON6A 4LK3A 2QLJA 2QZJA 5TQVA 4XOUA 3IXMA 2YNMA 1AX9A 3M3HA 3NGLA 1JHOA 3OC6A 3CLTC 3M1IA 5AM0A 2WKWA 4Y6PA 1XTSA 4MWSA 1J2EA 1HPLA 2OM6A 5NULA 2ZJ4A 4R1MA 3QMPA 3KJNA 1IQPA 4RV5A 2OVBA 4CLDA 2P6RA 3CNHA 3KQHA 1JQLB 2I54A 3PRYA 5F1KA 1TA9A 5TF4A 4P36A 1W34A 4J8PA 2E18A 4I36A 1DTSA 1T3TA 4PYNA 3DZ4B 2IPXA 3KHKA 1BCSA 1FJGB 1JU9A 1USUA 1ACMA 5CYPA 2JFZA 3K0CC 1C9DB 4LTDA 2O0HA 2OGWA 3EZ7A 3L43A 5FNVB 4KWEA 1TTPB 3D7RA 1RIIA 1X1BA 3OF5A 3IPAA 4IIYA 1FXSA 1EM8A 3C87A 4M37A 4QQNA 5BT9A 3BQMB 3SMVA 1J90A 4QLAA 2JBWA 1IRXA 2EZUA 3HE3A 3MINA 2YY6A 4GAEA 4TYMA 2J45A 1Z4IA 3W2FA 2JCXA 1FYDA 5FX2A 3IVXA 5IK2D 2NT4A 1KO8A 3K1TA 6Q21A 3G2KA 5DLQC 4DXAA 4DV2B 3ZCPA 2ZYWX 1NM5C 2D3TA 2ZS9A 4MB0A 5BSFA 5FTNA 2NXNA 1SU4A 3G2IA 1TZCA 3E5RA 3HFRA 3SHWA 1G66A 1U28C 2NO0A 4MVJD 4Z3DA 1PF7E 4AC9A 1XV5A 2ZKLA 3FLAA 1GQ2A 1IN8A 4HNRA 5AOBA 3OP1A 3V1LA 2BBOA 3PEWA 3HXQA 1X9HA 4OA5A 2GLTA 3AP1A 4GLOA 2WWTA 4GGOA 3ZQUA 2QW0X 1QNLA 1W88B 1HE4A 1CTQA 3DYIA 2A7XA 3L6OO 1Q1QA 4INZA 4V2IA 3X0DA 1IWPB 2BGMA 4D3YA 4UVHA 1I9CA 3FA2A 3UFXB 1IN4A 2EZ4A 1LDEA 4ME6A 4PFJA 2EG5A 3ZJXA 5B3JC 4JXKA 3DA8A 1PT8A 3I64A 4KO4S 5BNWA 4B3BA 4FHEA 2C2BA 4F4JA 1G8PA 3H42B 5CBPB 4QDZA 2H54A 3DXXA 2OLJA 2R8EA 3BKXA 3DL0A 4HDNA 3OOJA 5D5PA 2C78A 4BX3A 1DG9A 1GGEA 2NP6A 4WN9A 1OKKD 4P33A 3TXAA 5HQ3A 4CEHA 4NFHA 2QS9A 1QYIA 1U9IC 3F4KA 1ZYUA 4XSHA 1MQAA 3RRFA 4JB3A 2FZLA 4M0DA 1LSOA 1GR1A 3EEBA 1DUIA 3PD0A 1NULA 2QN3A 2JBAB 3DCNA 3GZTB 3HKEB 1CHNA 1HC7A 5EIBD 3T9EA 3TW8B 4WLEA 3O1JC 4OB8A 1HRKA 1SCJA 1N5OX 2WABA 1TW2A 1A5AB 4O2AB 2D06A 1NXXA 3D7SA 4UZFA 3STVA 4C4YA 1DAFA 1Q0PA 1WSBA 1Q7BA 1WW3A 1GZHB 2OORC 3EK2A 1PR2A 3JZDA 1QRAA 3KP1A 5DJ5A 5K8IA 1NI4B 1Y63A 2JAOA 4TWBA 3A7EA 3CZPA 4ALJA 5JMTA 4U7JA 4FE3A 1A82A 2EBFX 2C97A 4JGBA 3QVJA 5GJCA 4ZQBA 1KIMA 1BX0A 4ND3A 4R8LA 4GL2A 5EMKA 5I4KA 4PO1A 1PYOA 5C1DA 5DNYB 1EHIA 2C9BA 1B8NA 5K51A 1AKRA 3EVZA 5CA1A 3DULA 6AT1A 1JQKA 1O97C 3CUVA 3D8UA 3G0OA 1JB1A 1K8YB 1ADJA 3FHLA 2VZ8A 5CM2Z 1SOUA 5JROA 1SZJG 3EVBA 2ISQA 1ZH0A 4ETIA 1EGMB 1TJNA 2P41A 1O97D 5B6JA 3WLLA 4CDGA 1GADO 4QG7A 5JWRA 2V6JA 2HHAA 3HBJA 3H5IA 2RH5A 2HR1A 2JPDA 4KR9A 4MKRA 3IHWA 1TT5B 2GTPA 1OXUA 3VAZA 1ZNZA 3I3OA 1DO8A 1R1DA 1WSWA 3JQ7A 3QF7A 3ZV7A 4Z4EA 1KVQA 3E5HA 4FSHA 4ZI5A 1XDDA 3HZOA 2D2FA 5FBZA 3DW1X 1WMDA 2VG8A 3MOIA 4BAUA 3DZBA 1QUFA 4L02A 1QE5A 3MGGA 4OQYA 1W1IA 2R44A 4QO7A 4H16A 4WA7A 2CD7A 4IMRA 2OZKA 1SVLA 2YYAA 3IAS6 1HUQA 2EP7A 3X1YA 3ZV3A 2VQSA 3FBWA 2HBYA 3NHZA 3WGYA 4D6PA 4G5OA 3TLZA 4KUHA 2IHNA 3IUEA 1TE2A 2XE4A 1F38A 5CPBA 1DX4A 1LX6A 5IVHA 4GXNA 4Y0NA 4Z9BA 4EZEA 3OZWA 1N7HA 4Y2TA 1GGKA 4CHTA 3VKFA 3WQHA 1TYCA 2HC9A 4BASA 2QUBA 2EIHA 3BGIA 4YT4A 5BW6B 2OESA 2NX2A 1AQIA 1HSOA 1TC2A 1U28A 2GYWA 1UBMS 4AZ3A 4KYUA 5AMXA 3LUDA 4BKQA 3H5TA 4PGAA 8ABPA 4EA7A 5FNZA 4O3FA 3B5IA 2AC4A 2BFDB 3MAJA 1D9ZA 1N92A 2PRJA 2EFYA 2PGIA 3R3UA 3D2CA 2B8WA 4P3PA 3GUVA 3DVQX 4OHXA 4L8LA 3R9KA 3LU1A 1JPUA 1EDOA 5CIWA 1BRMA 1RADA 4JIGA 2PGXA 5EHQA 1VDMA 2CHGA 1XZGA 4D8TA 4E1VA 3UENA 4C6HA 5B64A 2GLXA 2OYRA 5KIAA 3L0PA 1SHJA 1L7PA 4JB8A 3DZ6B 3AFHA 5JD6A 2OAEA 2PX8A 1P7WA 4FXPA 4PU0A 2YWGA 2DR2A 1KK1A 1QLJA 4MW4A 3PQ4A 2O9JA 3GLTA 4E3WA 3MB8A 2GWRA 2N3ZA 1AUQA 1W6UA 4P4SB 1IIBA 2OHIA 3HVKA 2FWRA 3G2LA 5F3DA 5IC6A 4FLFA 2EFEB 4DSUA 3CLHA 3B2EA 4CF6A 4O8JA 2QX7A 1BVUA 4H7IA 1N5DA 1UEJA 2JGFA 1YJCA 3S55A 5TVKA 1BO6A 1M1NA 1UKVY 3A3PA 3DR5A 3CT4A 3FZYA 3SJCA 4OYYA 3TOXA 4D44A 5AVJA 3L7JA 1NDHA 4IQ0A 1W0KD 3FIUA 5IARA 4F04A 4GNRA 2ZJ2A 2NO9A 2A5GA 3EP5B 1JHVA 5IFLA 3N70A 2FKNA 1AK1A 2IYAA 4GP6A 4QEDA 3ZGOA 3T95A 3X2EA 1E98A 1YDMA 2XUGA 2H31A 4N5NA 3F9IA 2AJBA 2PH3A 3ESZA 5IT5A 1TM5E 2I4OA 4AU1A 4ID9A 3COZA 2C5EA 4DLUA 2IP1A 3EFOB 1R7RA 4PPYA 3GGCA 5BQ3A 3CNQS 3OKPA 1GL6A 4JWTA 3BJIC 3L0SA 4IIXA 3WIDA 3T1VA 1O0CA 4HLUA 4TS9A 4IDCA 1W8IA 3DFIA 3HJHA 1ZEMA 2Q4TA 4O5OA 5M34A 1OCEA 3ADPA 4G0PA 5CX1A 3FMVA 3LQRA 2C0CA 1ECBA 3OFJA 4GYKA 1YZLA 2AK3A 3VC2A 5KB3A 2I6FA 4RC9A 2XYRA 5H82A 1JSZA 2C3OA 2V6IA 2AFHB 4OJMX 3HN7A 4RZIA 4XUCA 5ERYA 3WDKA 3ON5A 1EFPB 3M4JA 4L57A 2PD6A 1GG8A 1ZRHA 3PDIA 4MKZA 4BECA 7REQA 4AN4A 4DW8A 1IIRA 4IS2A 4ENTA 1FP2A 5C8YA 3CH6A 1P0CA 1X7GA 2SKEA 1J20A 2Z6VA 3ANLA 3SDSA 2W2KA 2ODTX 1YACA 2QA5A 1E1MA 1HT3A 4ZHQB 4L95C 4ZMBA 5A06A 5HGXA 1XLUA 3DDHA 1SXJC 3GRCA 1R6UA 3W8NA 5EOVA 1ODSA 1RHQA 1L4LA 1U7XA 4WK6A 3BFJA 4HWTA 1LB1B 2JLZA 2NZXA 4HDOB 3QHQA 1QJCA 2CMHA 1QE3A 4LYJA 4KREA 3RIGA 3UK7A 1R8XA 3GFOA 4BP9A 1JR3E 5IT9A 4G0QA 2O7SA 3NAQA 1C7RA 4CM7A 1Z82A 3N59A 3IQHX 3QOWA 4G5XA 2IIBA 4FT4A 4XDGA 5I8PA 1SD2A 1OB2A 4LS3A 1GKYA 1H69A 4QG3A 2J9GA 5DX0A 5FR2A 2ADFA 4ED9A 2SCUB 3GUZA 2IPMA 2PR2A 2YRXA 3RG8A 3A37A 4AWBA 3KE8A 4IIEA 2Q6LA 4KNYA 2B4YA 2IYEA 1R6AA 1P62B 5BN4B 2H1LA 2QD3A 2H1VA 2VWPA 4KN5A 2HF9A 4PVDA 3UK1A 4X65B 1YK1A 3BSYA 4FFDA 1JW9B 2CNDA 2P5UA 2XRFA 1W9HA 2I33A 4OLHA 3SJZA 4B2LA 3BM5A 1XPUA 5IPFA 2GCEA 2GYUA 1KU0A 3MUEA 2X4GA 1YE3A 3FNGA 5DNWA 5IZCA 3BRQA 1P9NA 3IAM6 3DYVA 3EB9A 4H1UA 3F4BA 4MH0R 1L7AA 4QAJA 5CH5A 1RJFA 3PC8C 3QVGB 1WW8A 3OBIA 3WLTA 3JZFA 2OWEA 2XB6A 1N0IA 2L69A 5JU6A 4L5JA 5MF6A 3LDFA 2GARA 4OB7A 4M36A 1V1RB 3H2YA 4LX8A 2ZK7A 4IO1A 1XCGB 3R0XA 1HQCA 2NVOA 4AJKA 1KEKA 1ZMBA 1AUXA 3BA6A 2PYDA 5K8VA 3A4TA 4FMPA 4GHWA 4FFPA 2IV7A 5EJ7A 3OZVA 5DMXA 1AKVA 1SQFA 5EJFA 1EFLA 4TYNA 1JYFA 4EUKA 4CR6A 1Z2AA 2O2CA 4B6QA 3W9UA 5C9ZA 1RQ7A 1JEOA 2BUCA 2DWQA 2R6GA 3AUTA 4P3YA 1NW7A 5DYYA 1ZQ9A 4ZDKA 2LRHA 5KQMA 1YDEA 2OG2A 1ZK2A 2WAYA 3IP3A 4EMTA 5F2NA 1P80A 4XD7A 1DIRA 3I2KA 4EJ2A 1VYHA 4YIHA 4RM2A 3B1FA 4Y30A 4D43A 5KWIA 1VLVA 4YCJA 4BNGA 5EJ9A 3TUIC 5CIQA 4O2RA 4Y1EA 2OBXA 1EHCA 5FV7A 5EKSA 4NDZA 2PKXA 4RVFA 5A7HA 5L95A 2WJJA 1RKBA 3MTBA 5DTQA 4DMGA 1TECE 3CMCO 1PJCA 4INAA 2W8ZA 5J2UB 3RFTA 2ETVA 4RHXA 3RT7A 4PBSA 4KV9A 4OHKA 3CVYA 3O2NA 1TYAE 1PYDA 1GO2A 4NP6A 2BI4A 2Q5LA 5KVSA 4ESEA 1FNSA 2QT1A 3AQIA 2IBTA 2D5CA 4C43A 3BERA 4L2IB 1IHDA 4BKOA 4IIJF 4ASUD 2Y9PB 1RQXA 4NBVA 4RVDA 1RHKA 3DBVO 5B58C 2H4JA 3OETA 1E2KA 3ZJUA 2IHBA 4YAEA 3SFVA 1EVYA 2G77B 5EP3A 4BU1A 4E2XA 2XUDA 4DUGA 5B7QA 2WTXA 4PWYA 4EKNB 3GV0A 3L5KA 1DV1A 4I4CA 5KJ1A 3N8NA 1LVUA 1SRRA 3FPCA 4CCAA 4F5YA 2IXEA 2XVZA 4PLPA 2ZI6A 2PNFA 1KE2A 4YRFA 2QK4A 3K8ZA 4I6GA 4RIFA 3GWZA 4O8CA 1CP2A 4O2LA 1KKUA 3CR3C 3QENA 1L3IA 4LQLA 4BFSA 4C2AA 3F5MA 4F9GA 4CF7A 1ODCA 1QFXA 5HIJA 3N8HA 5ESWA 5I7WA 3T5CA 2C4MA 3O4RA 1JZTA 3KSZO 1VZ3A 1LJ8A 1SOWA 3DO6A 4LF5B 5FTMA 2XZLA 3H8WA 3T0GA 3LAWA 3SNKA 1VSUA 1NLFA 3EG9A 2WVHA 3M2TA 1PAUA 1YGYA 2GZMA 1NV9A 2WJIA 3VSCA 3MJCA 4QAQA 1BS9A 1IM2A 2I78A 3X44A 3AVTA 4YRKA 1NJGA 5TX7A 1DBWA 1Q0UA 2QPAA 5JCPA 1N6PA 3ICCA 1G8AA 2O4CA 1H2AS 1AZLA 2ZI4A 1RQPA 1OT5A 2FMFA 5DXJA 3UUGA 3VZDA 4BEVA 5C4MA 2V0NA 4RTRA 3EF3A 3LS2A 3GLGB 3O2SB 2R0QC 4L4UA 4L74A 2AMYA 4I8IA 4B32A 4BVJA 4DG9A 3CWQA 4QC2A 1GLGA 2EOAA 4LPKA 2HSGA 3HO1A 5KJ6A 2IE8A 3V4SA 5TXGA 2P3SA 2CLSA 2XD4A 3OPXA 2WHYA 4ICIA 5AM4A 3ZWOA 1IWBB 3BB3A 1YOBA 1G8KA 1VPDA 1C81A 4RL4A 3U3JA 2HHJA 3DLTA 4EF5A 3QKWA 2HV8A 1J5XA 2ZUCA 2PKEA 3B6IA 3LUPA 3ZHXA 4RD3A 3BC1A 5B4TA 3AFOA 5HX7A 4EFKA 5C53B 4C21A 4MGZR 5JQWA 2REQA 4RA9B 2L0XA 2PRIA 4QTYA 1N8TA 4B6OA 2J0SA 1UDRA 2WJGA 1N1MA 1OD6A 4TX1A 1GTL1 5CDFA 3H9JA 2HQRA 3KYCB 1ND5A 2DG2A 3CQ9A 3Q3EA 4MQFA 2EU8A 2D5IA 4QBFA 4TMWA 3CNLA 2NN3C 4D3XA 1J00A 2TMYA 3KB1A 1LD3A 1VSBA 3FZNA 4J76A 5ARDA 3VR5A 5KQLA 1NBHA 5DN9A 1XZAA 1B3RA 3N7UA 4PLZA 4ZK6A 3KE9A 1LS6A 2B8TA 5CFPA 3O26A 4B74A 1FQOA 3N75A 1L5SA 5JXHA 4CM9A 3WA6A 5BNFA 3FMOB 3FGPA 2R96A 3GLUA 3KR9A 1U8EA 4MCIA 4NEGA 4NJMB 4RY9A 4TMKA 3OTQA 1FMTA 4EKIA 3COJA 2JZNA 1RAEA 3DMPA 2RSLA 2X2PA 3IODA 3LXUX 3QKRA 3BD6A 1XU4A 4Y98A 1BXKA 4QHSA 5ECGC 1FP1D 5FADA 4TSRA 5FR1A 4RJLA 2GQ0A 4TMTA 2XADA 2Q0HA 2A1IA 1N2XA 2AHRA 2J5KA 4XVRA 1VCOA 1DG3A 4KK4A 4LSGA 3DL7A 3OKCA 2OT3B 4MTLA 2PUCA 1VP9A 3OWXA 1OASA 4JJ4A 1OZHA 3NHUA 1NQ5A 1YI8A 1A9YA 1OHHD 1RRGA 2H8KA 2X3YA 4F1WA 1OU0A 1MZPA 2P9FA 1OXXK 5DBHX 3MHTA 1BDBA 1QG4A 1K7EB 4UNIA 3DAFA 3IHTA 1F6BA 1GKIA 4Q24A 3F5FA 4E5MA 4N5IX 3EMDA 2I6XA 5G0SA 4ZMSA 4XQEA 3HYCA 3RC7A 1B26A 3PT9A 2GN4A 4QGSA 421PA 4K26A 2QUKA 3O4VA 4RAQA 1F0PA 2EXXA 2V9PA 3AUSA 3MN1A 1N77A 4DDVA 5JJLA 1KZ1A 1C7ZA 1H4QA 2VRCD 3G13A 3NM4A 5DGTA 4FFRA 4NXNB 1SHZA 1NW4A 1CY0A 4BFXA 5B58T 3LPMA 5SYNA 4L3VA 3H04A 3VGPA 5DTIA 4ARIA 4A6EA 2N46A 3P9IA 1JG7A 3IGFA 2O8NA 4L08A 3ZCSA 3ENNA 4PC3A 1UZNA 2AVDA 2EWMA 2PUJA 1B8UA 4XR9A 5DEIA 1H5NA 4NS4A 1L4NA 3ONWA 3SQOA 4BNJA 2B5OA 4CG2A 1IBCA 4HQLA 4AG3A 4MWDA 3ZQJA 3R44A 1XQWA 4RGBA 3UB3A 2AF3C 4DM3A 1DADA 3I2HA 2XYHA 4QPDA 3B1KA 1CY6A 1F60A 4L4XA 1JIVA 1OAOC 3MOSA 3ORYA 4MI1A 4TSFA 5JSQA 3R7BA 4YMIA 5K8UA 2GZ3A 1JJFA 1C7EA 3O47A 1WCV1 5F35A 3DG9A 3SSMA 5DM4A 3IPXA 4MO2A 3I0ZA 1RFGE 3C6ZA 4QXQA 5L8VA 1FNCA 1DBPA 3TMKA 1JH9A 3BDAA 2X22A 1P77A 3UWSA 4R1PA 2LBPA 1NATA 4HL6A 2W6ID 2H8GA 5I7AA 4YR9A 4KMSA 3CX6A 3THWA 4WZBB 1HMYA 1A2QA 3EP4B 4JLKA 1JLSA 4C2TA 3KAKA 4N7BA 2YXLA 1Q1NA 3FF1A 1NN0A 1NBWB 2Q9BA 3OJWA 4U8HA 2FZVA 1KYTA 2NVUA 1E5LA 1YR6A 4WK4B 2ONJA 3RS3A 3TDNA 3VKUA 4HDRA 4C6TA 2HN9A 5LL6P 1SVMA 2BTOA 2ZJ6A 3RFXA 2YZKA 821PA 4CKWA 2XCQA 3EXEB 3SC4A 3T99A 3C3PA 2BONA 1F2VA 4OO3A 2H0QA 3OOWA 4DQUA 4KPUA 4P7KA 3WGNA 2ZWMA 4OFBA 2DHQA 1R8QA 2QORA 3DV2A 4KQFA 1RC8A 2B9EA 1A5BB 3ZZMA 1XCOA 2QP3A 4ABYA 4EHDA 2AS0A 5A9RA 4V2UA 1VSQA 4OJKA 3T52A 2NYRA 1E0SA 2CVPA 1CW2B 4MS4B 3WZ2A 4KHZA 2QL9A 4D8WA 4KO8A 1TYDE 5EWMA 1M54A 4QPJC 3G7SA 1NGSA 2HCJB 2R2GA 3PEVA 4RZQA 4YY3B 5L9AA 4OD0A 4IJQA 2QP4A 1IN5A 3FMIA 4WKBA 5F73A 4CODB 2JLAA 3N2EA 3VOAA 1VJRA 3LT2A 3F49S 3WRXA 3OWHA 5IM4F 2PLAA 3AUXA 4J6FA 3WL3A 4GKJB 4AVYA 3ADKA 3JQCA 3PQEA 2WUGA 2DFKB 3WGLA 3O84A 5BORA 3HO8A 1YVEI 2RDMA 4RPJA 5T64A 4BUJA 5I7OA 1G98A 3JWJA 1TIPA 4XYBA 2F8LA 5JC1A 1R9MA 3QYJA 5KYUB 1ZUIA 2CHEA 4P5DA 3DLHA 2DULA 1ESEA 1C7JA 2JBAA 4IXMA 3K73O 1O95A 3DLPX 3P2JA 4BQOA 5BW8A 2HMWA 4MITA 2IK8A 1JVNA 2MOKA 2QSZA 2XDQA 1LNQA 4U9IS 4CFYA 2KB0A 2NPOA 3LCVB 1EEXB 1MNAA 3DCIA 3NHJA 3SX4A 3EG5A 3IFSA 1E8MA 1BOOA 3R9XB 2O23A 2PGDA 4DUYB 1SBNE 4S35A 4MWCA 1J33A 5E6SB 1KVUA 4BPBA 3CR8A 1ADFA 3R0IA 2FUKA 1C4OA 3HR8A 4I7EA 1YNOA 1QNFA 1OI4A 4OA8A 4Q4AB 4CCWA 4F9EA 2XKBA 1XN1A 1DCKA 3C8HA 5JAPA 2PGOA 2GNOA 2H4YA 1KBZA 4ENQA 4YBZA 4FE4A 1Z0DA 2DEUA 1PJ8A 2H16A 1RIFA 1IAVA 3HFSA 1MUUA 2M9MA 1CUAA 4KLRA 2QR2A 4MROA 2WD9A 3VR6D 4LRTB 2ACEA 1QMGA 1W4RA 4JX8A 3FGOA 2PGJA 4GXTA 4BQFA 5KTNA 3GX1A 2HJSA 1CZOA 1PQ4A 2A5YB 5A4JA 4LXQA 5ITVA 1RT9A 5EYPB 1W36B 4UC0A 3LRXA 2ZJOA 1F1BA 1TX4B 1KXZA 2XB8A 2X0JA 3ZVLA 4D79A 3LMKA 4GD3Q 1H5UA 1U0TA 3H2GA 5ALXA 2BEWB 2FB9A 1GY8A 4FZ5A 4P82A 2ACKA 5KWJA 3IEKA 3WMWA 4DCSA 2ZJ0A 1F14A 1G3RA 2IEZA 2OXEA 4ARAA 3MWDA 3CVVA 4PO8A 4YDRA 4AJHA 4DKJA 2CNNA 5K0SA 1V8FA 3L7DA 2UYQA 1XMJA 3FTFA 1H2WA 4GS5A 4UDXX 5FPQA 2AXEA 1WLSA 3ENVA 5E6SA 1KXJA 1FXWA 3NW9A 4G09A 2PS0A 3LUJA 5FYQA 4KQEA 1GPWB 4ZK2A 4B82A 5JYDA 4GE3A 3WL4A 2Z3WA 1S3FA 4J4TA 1OMOA 1T1EA 3AI3A 4H1HA 4QA9A 1N6OA 2HRCA 4NAHA 2ZBFA 2F3TA 4IO0A 1X7ZA 2O7NA 3SP1A 2HWUA 3DCJA 2WWVD 1BH6A 3L9WA 1TMYA 5BRAA 1J99A 3QBVA 2XKAA 3T4PA 4ACAA 1JHDA 3GAMA 4MWBA 3MELA 1CJKC 2I66A 3O7MA 4TMYA 3VC1A 5B57C 4O1MA 1IPEA 2FPKA 3SCZA 2IW1A 3DEAA 1QH8B 2CFIA 3KLPX 1NUPA 2W6JA 2CLEB 3GBVA 3QPCA 4OI4A 1R15A 1H23A 1B3BA 1I8TA 2GS9A 4R3NA 1U5CA 2Q0SA 1MXFA 4KAFA 4G86A 1CJTC 1F0KA 4BFUA 2FZKA 5KHLB 3W6OA 1D2AA 1IB0A 4PHFA 5JNWA 3CZCA 1XD2A 2QEQA 2GCOB 4CKCA 1F4PA 4GKBA 4YQZA 2QRQA 3M8KA 1MKYA 2NACA 4PG5A 4FUTA 3OCYA 2B92A 4ND1A 5DXAA 3D8TA 3G2HA 1EP2B 3N8IA 4L5IA 4NI5A 4NYIR 1QFJA 2YWRA 4ROSA 4DDHA 1JQJC 3JCZA 1U4NA 2DR3A 4J0CA 4MUGA 4RSGA 3IO5A 1FFDA 2KYRA 3GN1A 3ZYCA 3IYLW 3MILA 4U02A 1R5BA 1UH5A 3D1JA 4LBWA 4KXWA 1JHAA 1WKVA 1UQRA 4JP1A 3GOHA 2VWHA 1G6Q1 2HFJA 3UATA 1W9MA 2QRUA 4J1TA 4TT8A 3MQ4A 4MIOA 1R6TA 2FFJA 3WXMA 5K7SA 4BNKA 3JZMA 5JH7B 3K6SA 5T8KA 3BCUA 3B2QA 1C9KA 3TAHA 5SY4A 4NCAA 2GBPA 4AJ1A 2GN6A 3B53X 3B3QA 3HA5A 3NAMA 4ZGBA 5JNUA 1O58A 3P9CA 2SICE 3A9CA 1GZ5A 3ZWYA 3GEBA 1Z62A 2Y27A 3D8SA 2H2AA 4CLQA 3GGSA 1DEXA 1P5RA 3AJDA 3UFBA 2I6GA 2IF2A 3BILA 2Q4OA 2R62A 4FCVA 3GP3A 4V03A 5GJVC 4DYVA 4INPA 1OX6A 2ZJAA 2FFAA 3A6LA 1T0UA 4BO0A 1R9NA 5IAKA 4URXR 1NVVR 5JZ9A 1ZC4A 3C1OA 3E2MA 4C30A 3BULA 2NO1A 3RD5A 4DLVA 3RF7A 1OQAA 2ZEJA 1T5IA 4HDMA 1UKCA 3NYRA 3Q2OA 1I5RA 5ALRA 4DEXA 4JOQA 4GYWA 2REOA 3TR0A 1O94C 2N75A 4FE7A 1PEYA 4DZTA 4J91A 5L3ZA 2QIPA 4BTLA 4MICA 2A2ZA 4XDYA 5I9NA 1SZCA 1XRMA 3S2UA 3OQMA 1QIIA 3UAWA 1M8PA 3QVVA 5CLJA 3A1EA 2GN9A 3HKBA 3KYBA 3OHSX 3K5PA 3TZKA 3UOGA 5A9SB 3PFNA 5A5VA 1A04A 3C7CB 3PEEA 1BYUA 1QS0A 1PGPA 3STHA 2ZFUA 2PCLA 4PICA 3CY6A 1Q1EA 4R1SA 4WINA 4RMGA 4WXPA 1ZI8A 4XWOA 1GEEA 5AVVA 3WLMA 4EJ6A 5DN6A 4JLMA 5E7QA 2GO7A 1W0JA 3SLRA 1Y37A 1ULHA 1PR1A 3C5EA 3HB7A 1ZD2P 3K9FC 1F2DA 2KWIA 4I9NA 5FULA 1I2CA 1CDDA 1T8WA 3W9YA 4UU8A 1UPBA 3GCWA 4YJ3B 4ZCRA 1X87A 4ZJPA 3FPEA 3I45A 1G6OA 2HU2A 5A7FA 4F3TA 5ALHA 1VG9B 2AXQA 3AR7A 1OFUA 2I4IA 2O2ZA 3OQ1A 5I7FA 3QNMA 2POQX 4HTAA 2ZP1A 4JP3A 4LYGA 2QDKA 4C14A 3S2EA 4TZTA 2KM1A 3LC1O 4PSKA 4X61A 2PX3A 1NQVA 2DTDA 4EG5A 4RTMA 5LD2C 5J23A 3BXZA 2DETA 4QIHA 1GL9B 2DTEA 3VJKA 4CL3A 2EX1A 3ILXA 4EK9A 2C4VA 1QVZA 2PV7A 2NYUA 4RVNA 3COPA 4POAA 1E9FA 3GG9A 3QKSA 5IAGA 3ZLJA 4QT4A 4FB5A 4U6QA 5HKKA 1QOPB 2CYAA 3KQNA 1LDYA 3H97A 1EJBA 3OEYA 3WGOA 3PFBA 4CM4B 3AF0A 4DB2A 2OGZA 2QENA 2GBLC 3OEHA 2ZITA 4EI7A 4OQLA 3RADC 3AR4A 3I5XA 2VNIA 1FSPA 3SQDA 2BM9A 3X3HA 2GEFA 2GXUA 3NWOA 1E64A 2WIKA 3JX9A 4H3VA 1UBEA 2HBZA 3N2IA 3HCEA 4HAVA 4YIKA 3UKOA 3F7NA 4WOPA 4FYPA 4WFQA 3RAFC 4ND8A 1E3SA 4WKNA 1D4ZA 1IH8A 4J7UA 4RX1A 1YQWA 1RRCA 3QI2A 4LGMA 2G4LA 4QQRA 3DUFB 3LUCA 5EGNA 1JYSA 2W9XA 2QRJA 4ZWNA 3MRXA 4X8LA 1H94A 4D1YA 3DWIA 1CS0B 3RBAA 3SBOA 4EVSA 4GKVA 5KOHB 2I9KA 5ITZA 2SBTA