4XB2A

Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with nadph
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
b'MKVNISIFGFGTVGRALAEIIAEKSRIFGVELNVISITDRSGTIWGDFDLLEAKEVAESTGKLSNIGDYEVYNFSPQELVEEVKPNILVDVSSWDEAHEMYKVALGEGISVVTSNKPPIANYYDELMNLAKENNAGIFFESTVMAGTPIIGVLRENLLGENIKRIDAVVNASTTFILTKMSEGKTLDDAIEEAKSLGILEEDPSKDIDGIDAYYKAKILHWVSYGEPPEEEERLGIREVRDARNVRLVAQVSKGKISVKPRKLSSDNPLLVEGVQNAAVIRTNNLGEVILKGPGGGGRVTASGVFTDIIKATLKFPNLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 319aa long hypothetical homoserine dehydrogenase
publication title Crystal Structures of a Hyperthermophilic Archaeal Homoserine Dehydrogenase Suggest a Novel Cofactor Binding Mode for Oxidoreductases
doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Oxidoreductase
total genus 108
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4xb2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xb2A01
2QHXA 3LC2O 3IJPA 3JQFC 4J2HA 4XQGA 1ORRA 1ZW1A 3K5PA 3CMMA 4BO6A 3DR3A 3CZMA 4NFHA 3FD8A 1I33A 1Y7TA 2W90A 3RASA 1GU7A 4W7HA 3TZKA 4GLLA 1GV1A 5BNFA 2PZLA 5JAZA 5JMPA 4ALKA 1ZSVA 3WNQA 4BNVA 3GH3A 3TSCA 3LDHA 5CEFA 3CH6A 3JD3A 4LMPA 3MZ0A 4RPJA 3AM3A 4PIVA 1M66A 3HADA 2VN8A 4BNMA 3ZI0A 1B8VA 2BELA 3PJFA 4YRAA 2TMGA 1HKUA 1LEHA 1P9LA 4TKMA 3JQ9C 4WPGA 3I9OA 1H9BA 3WGTA 4IXTA 4AJ1A 5THQA 2IYPA 4CLRA 1LDYA 2OZPA 5C7IO 5JYFA 3WSWA 2W4QA 3L6DA 5BR7A 1ENYA 1UZNA 3GVIA 4BNNA 3RUFA 3KLMX 5IDQA 3RFTA 3ZU4A 4BO5A 4P8RA 4JJFA 1EMDA 1XQ1A 5KKAA 1PZFA 3OEYA 4H16A 1KS9A 3I23A 1N1EA 4N54A 1U2DA 3F9IA 1C0KA 4MKZA 1VPDA 1V9LA 3WFIA 2GZ1A 1IB6A 1NASA 1CETA 3F46A 5BNIA 1Y6JA 1Q2XA 4E5NA 5G4KB 3PYLA 5IZCA 2XXJA 2XAAA 1K6XA 3TOZA 4IDGA 3P7MA 4FSHA 2D3TA 2GRAA 3W6ZA 4L4RA 2YFQA 4J9UE 3EZYA 4ZQHA 1G6KA 2EG9A 3LT1A 4BB5A 2IZZA 1MB4A 3H3JA 1W6UA 1KETA 1SCUA 2JFGA 1LC0A 4HXYA 1AHHA 4MP8A 1TB4A 1Q0LA 4DIBA 3UUWA 1ISJA 4BNHA 1D4FA 1E6WA 4LGVA 2GZ3A 4HNHA 1E92A 3PQFA 4GPD1 1T1SA 4I1IA 1B26A 4G81A 3HNPA 3DZHA 5AXDA 1E1MA 3HB4X 3PZRA 2Q1WA 3IKVA 4CMHA 4FOSA 1N5DA 3PHHA 3OJEA 4RORA 1M6WA 1HTBA 1YOVA 5JFOA 1S7CA 2B37A 2EHDA 4CODB 4D44A 5B12A 1H2BA 2D1YA 5G0WA 1ID1A 3DMYA 3E9MA 1I3KA 4BUCA 3PQEA 1R15A 4JN6B 3AM5A 5A3VA 2WE7A 3WXBA 3ZHZA 2FMUA 1UJMA 4ESOA 4EW6A 3D3EA 1OBFO 4C7JA 4BV9A 4ND3A 4G2NA 4YJGB 1YB4A 3ZU5A 2RHRA 3BMNA 4ZQBA 3Q3CA 1SB9A 5EJ2A 5F5LA 4BB6A 2HKIA 3OJOA 4O0LA 3RC1A 1EE9A 1ZVMA 1XIVA 2NTNA 4OAQA 3GPIA 1X7DA 2Y93A 3INGA 4OQZA 1LDGA 5IJZA 3FTNA 5KOIA 4R3NA 4OJNA 1GAEO 3KYCB 1WW8A 1WZIA 3GAZA 4YRBA 3D64A 2LDBA 1E7SA 3H5NA 3A28A 2Y66A 4ZQEA 3T7EA 2Y68A 3AY6A 3DFZA 1YB1A 1C3VA 4MVJE 1GFSA 2Q1SA 2OFPA 1ZJZA 3JQBC 4OOEA 4XYGA 5JLAA 2HCTA 1F8GA 4A5OA 5ILGA 2NWQA 2O50A 3EUWA 1ZFNA 3CSDA 2VRCD 5A1TA 1VJTA 2ZB4A 3ROQA 1PR9A 2E37A 1ZK2A 1Z45A 2FR1A 2WEKA 1ARZA 3OECA 4EEXA 5TC4A 3ST7A 2Z95A 2YHIA 4J49A 2FN7A 4K9DA 5EERA 1PS9A 1QSGA 2HRBA 3NDIA 4NU5A 3PJGA 3VH4A 1R16A 3EK2A 4IPTA 3HSKA 3ICCA 4WCFC 2QYSA 5F1OA 5JDCA 3GA0A 5A05A 3BMOB 1DPGA 1WMAA 4LK3A 1GEEA 1UP6A 3HZZA 5F1KA 4J9VA 2VYNA 1PQPA 2JD1A 3QY9A 5JW6A 1ZZEA 1JWAB 4HFMA 4D3DA 4JJIA 2W2LA 2D0IA 1U3UA 3FR8A 3DZGA 4F6LA 3L4SO 3TZHA 4BQPA 3TZ6A 2PZJA 2HK7A 3ZWBA 4R3WA 2DT5A 2VWPA 1I2BA 3LK7A 1NP3A 4NR0A 3KUXA 1KVTA 5IFLA 4Z9FA 3U09A 2EGHA 3AUSA 1JA9A 1VL8A 5L45A 2EF1A 2J6IA 2DFDA 1BMDA 4B4UA 3JQ8B 2VWGA 3ULKA 1BSVA 3B1KA 3HDYA 4M86A 4H7PA 1LTHR 4X54A 4RGBA 3VVCA 4CL3A 4BO4A 1JVBA 1GQ2A 4U5QA 3Q2IA 1O9BA 1MC5A 1XA0A 5T5QA 1E77A 4EJMA 4XRGA 4BNKA 1IZ9A 1U1IA 1HDCA 2VWQA 1CEQA 4RVDA 5U1PA 1ZH8A 1LQTA 2NM0A 2E6UX 4R5HA 4MVJD 3WQQA 1E1NA 3HDJA 1R0KA 5JDIC 4CMJA 1WWKA 3ITKA 2YV2A 3IUSA 4U8GA 2PY6A 1EDZA 1I2ZA 3RFXA 3VH1A 1UUFA 1U28A 3OJFA 2BFMA 4IDEA 2ZCUA 2PGDA 1P77A 5IF3A 5ES3A 3JQEA 2NU6A 4U0JA 3UGKA 1QV7A 4GBJA 1YH3A 3KO8A 5C37A 1RPNA 3ZNNA 2O3TA 4FR5A 1Z74A 4IJVA 3WWYA 1YS4A 2J8ZA 5JC8A 5T73A 2CF6A 5TJ9A 3D5TA 1IUKA 3JYQA 4YEDA 1HWYA 1WXDA 3HDHA 2FR8A 1B14A 4NK4A 5TJHA 3FTPA 1SOVA 2R00C 2PD4A 4YBZA 3UHAA 1JKJA 5JO0A 5TIIA 1QYXA 5LDHA 5IAAA 1E3LA 3W1VA 2CSUA 1PJBA 4C4OA 3P2YA 5CAEA 1V3TA 4OM8A 4J4TA 4D7AA 2YV1A 2UAGA 3MJCA 1BVUA 3C7DB 3G0OA 3BXXA 5JYAA 4K6CA 4LCEA 4YJDA 1NFFA 1UH5A 2BFPA 2CD9A 1VSUA 4ID9A 1NQTA 5H81A 3GVXA 3OICA 3IP1A 3EY4A 2EP7A 1X14A 4NZ9A 4XCVA 4QECA 3A1NA 3MOGA 4KUGA 2EWMA 3O9ZA 4GX1A 2BH9A 3Q2KA 5KIAA 1DB3A 2HRZA 4YJHB 1CIVA 1QLJA 3VPFA 3GMDA 3JD2A 1T4DA 3NEPX 2HK9A 4TRMA 4DIOA 4EUHA 1ZUD1 1ZK1A 1W73A 1N7HA 4EBFA 2XOXA 4FJ1A 3VAZA 3C3XA 3RAJA 4CM8A 2UUOA 1U8XX 1NNUA 3NJ4A 4TZTA 4EEZA 2QRJA 3LSYA 2NU8A 1ZK3A 4KWHA 1LUAA 1HXHA 4R1TA 1B15A 3A14A 4GLOA 4CR6A 4ND4A 4CJXA 2YQ5A 3VDQA 4AFNA 1GQQA 2NVBA 4Y67A 5I9MA 4RVHA 2GPTA 1GCUA 3FI9A 4IGFA 3UAGA 1HYGA 3H9UA 4M49A 5TGDA 1KBZA 4J7XA 3WGZA 2CUKA 2DLDA 1K3TA 4BO3A 5EINA 3DBLA 3R6DA 4YT8A 4DRYA 4BKOA 1MXFA 2V6BA 1B3BA 4NBUA 3I83A 3GZ4A 3ZWNA 5A9RA 5JAIA 2A94A 1VKOA 3UH1A 1H9AA 5AXAA 4OXYA 5L40A 1XWFA 3GGPA 3I9MA 2Q22A 4D0RA 3MTJA 3OH8A 5ILOA 2G82A 1LSJA 2WJPA 3JV7A 4S3MA 2GDZA 3NV9A 4RQTA 1ISIA 3ONEA 3PTZA 2EW2A 3NRCA 3ZV6A 2AQIA 1Y81A 2OP0A 1JAYA 5DBFA 4ND2A 1YONA 3GT0A 4IQ8A 2DBVO 1IZ0A 4XQEA 3ZW9A 2AQ8A 2DTEA 5CDSA 2OHXA 2B4RO 3UCFA 4IMPA 3D4NA 1XSEA 3M1AA 5TF4A 1UXJA 2QX7A 2PWZA 3ASVA 1ISHA 1Z7EA 3NTRA 5DULA 4CMIB 2DUUA 1T24A 1NHWA 4D43A 4YYZA 1LSUA 1N9GB 3ADOA 3OA0A 3RCBA 4W9NC 4A0SA 4J7UA 4Q3DA 1MV8A 1M75A 2VCYA 2XXBA 5KJCA 1C14A 3PWKA 5HM8A 3NJ8A 3WIDA 4W99A 1DJNA 2NTJA 3KHUA 4I8XA 1FDSA 4JIGA 1DC3A 1NWHA 4K28A 5ENVA 3GY0A 1GUYA 4MPDA 2OUIA 3IP3A 2X86A 1NFQA 1YBVA 1TLTA 4R1NA 1LQUA 1QMGA 3ZWCA 4R68A 1KYQA 2GO1A 1QR6A 3HHPA 4FGSA 2PR2A 4XQ9A 1D8AA 3VH2A 4WCFB 4BVAA 1CJCA 1MFZA 4BNLA 1EZ4A 2VZ8A 2FR0A 3PYMA 4JBGA 2WYVA 2JKVA 4ALIA 3KB6A 3HN7A 3T4EA 1TEHA 4XYBA 4IIUA 2XF8A 2YJZA 1H2HA 1LLCA 2OMEA 2P2SA 5B4UA 3WGQA 4GSKA 3VPSA 3LT0A 4PLPA 4GWGA 3GQVA 3H6KA 1C0IA 1U4OA 3BMQB 3IUPA 1O6ZA 4J1NA 1KEVA 4AVYA 3ETDA 4WLUA 3FF4A 3EHEA 3TOXA 2HMTA 4JP3A 4LCJA 5AXCA 3ZGYA 4L73A 2IEBA 2ZB7A 4QQRA 1Y8RB 2VHXA 2EKQA 4S1VA 5A04A 2ZJ0A 4DQUA 1O89A 3BHMA 3INRA 4CM3A 1ZMTA 3Q9NA 4IBOA 4NFYA 4NJMB 3PWZA 4QX6A 4NPCA 3LC7O 3V1UA 2O3JA 5JCJA 1QYDA 4BO2A 1ONOA 2JHFA 1DIRA 3WBBA 3TPCA 2XPCA 1LDNA 4HNGA 3WGYA 3G49A 1WDKA 3RC7A 2DAPA 4GMFA 2B4TO 3AJRA 1AUPA 2X23A 4XEHA 3LLSA 2GYYA 1DAOA 4NFSA 3ZWMA 5I7EA 1FDTA 2O2YA 1DSSG 4UEKA 3PFFA 1X13A 1VE9A 1P1RA 1MC4A 4XYMA 3I9JA 3DWFA 3OHSX 4FCCA 1PZHA 3T4XA 1SMKA 4II2A 4I5EA 4P22A 3I52A 1R0LA 2NNLD 4AG3A 3PJDA 2QIOA 3AW9A 2P9CA 1ZK0A 1RWBA 2EEZA 3RD5A 5K9ZA 2PD6A 2NTVA 2VYND 2NVUB 5I8WA 4A7PA 2HAEA 2BMAA 3LT2A 4K6FA 4J1QA 2G17A 4Z3DA 4YJFA 1VSVA 1ENOA 1PJSA 4D0SA 3DTYA 2C7VA 1X7GA 4EDFA 4L8VA 1LBEA 1I3MA 5U9CA 3SLGA 2X6TA 6ADHA 3O8QA 3BMCA 4MIOA 4MVJH 3WJ7A 1UXGA 1QV6A 2QZZA 3DOJA 3BIOA 4PLYA 1GZ4A 4BQRA 1VKNA 3WFJA 3OQBA 1P74A 4R54A 2C7GA 5K6AA 4GGOA 4FOOA 2CZCA 5GMOA 3STHA 4CQMB 3B1FA 4Z0HO 4Z0TA 5T64A 4PLTA 2J5QA 2EGGA 2WE8A 3I9LA 1WPQA 2P68A 3H3FA 4TRRA 5DCYA 5K0ZA 5GZ6A 1E3IA 4MIYA 4RZIA 3V5NA 4D41A 3WTCA 1T26A 5J9GA 5HS6A 4CM7A 4FC7A 5L53A 4IZIA 4RPKA 3TFQA 2UDPA 4KP7A 2VUUA 1X7HA 4D46A 4J91A 5BSFA 5T57A 2JD2A 2C5EA 3U49A 4H15A 4CPDA 3JQGB 3RBVA 1E6UA 4O59O 2WD7A 1PGOA 1L1FA 1PJTA 2H63A 2GR9A 2Q45A 3MTGA 4XKJA 2JCVA 1PZEA 3W8DA 1EK6A 2H5LA 4MJLA 1HF3A 3NDRA 1DIAA 2RH4A 4FS3A 2V7PA 5A3JA 1RKXA 3PEFA 3K6JA 4MIEA 1XR3A 4IM7A 3BTSA 2DM6A 5JCXA 2AQKA 3TRIA 4LRSB 2EERA 3AU8A 5FFFA 4E13A 3M6IA 4KDFA 5BSHA 2DBQA 4Y8VA 1NFRA 2GN4A 4JBIA 2A92A 3GN2A 1ENZA 1R4MB 2EXXA 1PGPA 1PJCA 2YFHA 3JD4A 4JLWA 3F4BA 4CR8A 4LMRA 4MVJF 1HDOA 2BD0A 2QZ9A 1BW9B 1PJQA 4RPLA 3V2GA 4CV0A 5JSFA 1EE2A 2B0JA 3H5AA 1IOLA 4U7WA 3OM9A 5KNLA 4KUEA 4DLAA 4YT5A 3VH3A 4UUMA 3E5MA 3ZHXA 3QW2A 3WYCA 2FOIA 4D45A 1NWCA 3K2BA 4I9HA 3ABIA 4BNUA 3PPIA 4N7RA 4CM9A 1EK5A 1N7GA 2X58A 5MGBA 5IZCC 4XA8A 3TNLA 2I3AA 1NAHA 1V0JA 3C1TA 1JAXA 1P44A 2JJYA 4KZPA 2P4QA 1MUUA 3IS3A 4NBVA 4PCVA 3DO5A 4NBRA 4YVFA 2W8ZA 3C8MA 1HRDA 3JYLA 2W2KA 4BKRA 1PGNA 2PNFA 4BO1A 3RC9A 1TI7A 2C29D 5CPFA 1H6AA 3ZV3A 2CDCA 3W6UA 1TT5B 3S2EA 1YJQA 1MGOA 2J3IA 4BGUA 3BTOA 4XZ3A 4CQLA 3ONDA 3ETGA 1K5HA 3I3OA 2PTGA 2Q4EA 4R41A 1DRWA 1PJLA 2NQTA 1QORA 1X0XA 2PK3A 3KXDA 3W4IA 4CV1A 7ADHA 1GTMA 1RJWA 1EBFA 2Y1EA 3GGOA 4E6PA 4WK6A 3GZNA 2C0CA 1I01A 5GZ3A 1T2CA 3RJ9A 4E32A 5ITVA 3GN1A 3TL3A 5JMWA 4GAEA 3BHJA 2BRUA 1SOWA 4IJKA 3SC6A 1GDHA 1BXZA 2B5WA 2POQX 4Y6PA 2W98A 4W4TA 3DMTA 1BXGA 5DBGA 4CQMD 1NYTA 2AE1A 3JYNA 1P1HA 1PS8A 1HSZA 4ONEA 4YDRA 4XD2A 1GY8A 2BGKA 3PHJA 4DIFA 4UVGA 2CVOA 1A7AA 2I99A 4BMNA 4QEDA 5EPOA 5A4DA 1XELA 1H93A 1U5AA 8ADHA 5HWSA 3QVTA 3H5RA 3ZN2A 1ULUA 4HFJA 1EVIA 1NM5A 3DZIA 4DBZA 3C1AA 4LRTB 5IXYA 4ZHSA 2D8AA 4OHUA 1H6BA 1N8KA 1M67A 1QXSA 3RBZA 2OO5A 2RH8A 3ANMA 2IYOA 3A4VA 4RL6A 1QG6A 4DBVO 2GD1O 2PLAA 3EDMA 1HLPA 4WLEA 1GZ6A 1PGJA 1ZIDA 1PS0A 4YAIA 2DU8A 1ENPA 3D0OA 1VLLA 2HJRA 2WWRA 5JAMA 3JQFA 5BSGA 3KM0A 1DAPA 4FPXA 4OSPA 4B3HA 4DWVA 4XB2A 1L7DA 1C1XB 2VTDA 2X9GA 1T2AA 3U5TA 4NMHA 2GUGA 9LDTA 4Q3BA 4R51A 4NNJA 1A9ZA 1PIWA 1VRWA 3IDSA 1AE1A 1A27A 2WYWA 4AJPA 3WBFA 4TSKA 3UKOA 1Y5MA 3FR7A 5JAQA 4IY1A 3Q11A 2VHYA 4L4SA 3GG2A 3OQ6A 3H65A 1DBVO 2I5PO 1SNYA 1LLUA 3MJ4A 4QO7A 4F46A 3WG9A 5C5IA 3P2OA 2E48A 3KYDB 3L4BC 5DDIP 3GDOA 1KIFA 1I3NA 1QYWA 1WMBA 1U7HA 1LRKA 3DZKA 4GX2A 4RO0A 5EMHA 5G2OA 4E31A 5L4NA 5KKCA 5I8ZA 3EVTA 5A02A 4EJ6A 3U0BA 3R3SA 3WTBA 3Q6IA 3R0IA 2BGMA 4GVXA 1I2CA 1HT0A 3VKUA 3JQ9A 4I9UA 3VKVA 4CUKA 1FF9A 4TMFA 4B8ZA 3CE6A 5C7OO 3SXPA 1AHIA 2X5KO 2AW5A 2P9GA 3JQ7A 3GG9A 5JS6A 2A35A 5TQVA 1P31A 3PJEA 3AFNA 4L9RA 2GN9A 1DC5A 3QWFA 5A9TA 2WYUA 2OP1A 3A06A 2H9IA 1PSDA 3CZRA 1YE3A 2VWHA 3GNTA 3OMLA 1HEUA 3DBVO 1KEWA 4BO8A 4ALLA 4HADA 2I65A 3SJ7A 1IHXA 4AJNA 4FD3A 3GFBA 5L9AA 1LLQA 3PHLA 4M8SA 1CWUA 1RM0A 3E6AA 3E8XA 3IJRA 3WGHA 4XDZA 2C82A 2GASA 3S55A 1MG5A 2VZ0A 1EFKA 1I5RA 5TS3A 1T2DA 3QWIA 3I6IA 4PZCA 1R66A 5IDWA 2X9VA 4UVHA 2Y0EA 4YRDA 2D5AA 1UZLA 1LLDA 4UUPA 3QIVA 5C3MA 3CXRA 1N1GA 1I36A 4B3IA 1T4BA 1LRLA 3L77A 4NIMA 3UOGA 4CLRB 4EITA 3GEDA 4IJUA 4DQXA 3QWBA 1V3VA 5ICMA 2YDXA 4ZICA 1W4ZA 4YXFA 3LVFO 3GRPA 4R5MA 4CV3A 1XCBA 3TZQA 5T6BA 3SLKA 3ZHBA 5I9LA 1HDRA 2X8LA 3BZUA 4IUYA 2I67A 3CTMA 1U7TA 1D1SA 3X2EA 3DAFA 3I6QA 2Y67A 1DIHA 3NTOA 4FC6A 3RUHA 5M6DA 3PP8A 3QWAA 4B3JA 4CMKA 4OXNA 2DUWA 4BKUA 3DBRA 4WNIA 3C24A 4DL9A 1X0VA 4YQZA 2PV7A 5KJEA 3ZWVA 4HFRA 4OL9A 4J16A 1ULSA 4NDNE 3QVOA 5F1PA 3ZV4A 4WLOA 3GEMA 1V6AA 1R4NA 4BNGA 3FNHA 2O48X 3DQPA 3N7UA 3PGXA 4F6CA 2IZ1A 2Z5LA 1ONNA 4FIZA 4IS2A 3QJ5A 3S8MA 1E7YA 4WLNA 3NKLA 1UXIA 1QLHA 3Q0EA 4UUOA 1K6IA 1F8FA 1Z7BA 2HMSA 3P19A 3WQRA 3CIFA 5H83A 3F1LA 3K30A 1P3DA 2I3GA 3ZNQA 1H5QA 4IQ0A 2VHWA 1QYCA 3DBHA 1E0DA 2X5OA 3DEYX 1YOVB 4ZRNA 4GKBA 3NX4A 2ZK7A 3U4IA 1BDBA 2O3QA 2RIRA 3JQBA 4FFLA 4JQCA 4KOAA 5HS4A 4TQGA 4DYDA 3KSUA 1SEVA 5DCWA 3ONFA 3VPXA 1GADO 3G3EA 2ZIZA 1B7GO 1EQ2A 3WWZA 4PLVA 3FHLA 1AXEA 1OAAA 2X0JA 1R6DA 3JD1A 3E82A 4R01A 5IN5A 1WP4A 5FI3A 3BMNB 3TZCA 2Q2VA 1ZMOA 4WE3A 2Q46A 4BKPA 1KVRA 2VQ3A 4UVIA 3C7AA 8LDHA 3FN4A 3PVZA 4N18A 2Z1NA 2DTDA 4CM9D 1FJHA 1WDLA 3FBTA 5AQ1A 3DZBA 5L95A 3GEGA 5KVCA 4M54A 4TKLA 3DHYA 3G17A 3E5RA 4GSLA 3LU1A 1XGKA 5TRTA 2UVDA 2X9NA 3JD0A 3D3WA 4RVGA 4MP6A 3ROMA 1ZSNA 3FSRA 4HWKA 5A5EA 1HZZA 4R1SA 1LXCA 4MVJP 1RM3A 4WGGA 2NVWA 5JPIA 4GX5A 3VZSA 3PYXA 4BNIA 4J0EA 1WNTA 2AA3A 4KTVE 3UICA 1QP8A 1YGYA 4IINA 3M2TA 4U6QA 4YCAA 4CLHA 5HTOA 4E30A 4ZGWA 3JQAA 5GZ1A 3RWBA 2X4GA 1LJ8A 1G1AA 1E7QA 3MJSA 5DT9A 4Y98A 2VT2A 2YHIB 1ZSYA 2YHUA 4IGEA 2ZYGA 1EUZA 1PWXA 1KOLA 1I32A 2B83A 3B70A 2QRKA 3UCXA 2JL1A 4M1QA 1DOHA 1SEPA 1EUCA 3PHIA 4Q3AA 4ALJA 1GPJA 4OOFA 4BMVA 1BWSA 3H9QA 3MWDB 4MKRA 3BTVA 3OEWA 4J4HA 2D2IA 4FFOA 1U3WA 4FJ0A 4RVFA 3GVCA 1I30A 5CDGA 1RYEA 4XIYA 3KTDA 4GX0A 3PGJA 1C1DA 3HFGA 3FWZA 1F12A 4RV9A 2HO5A 3O38A 1U5CA 2H1SA 1A7KA 4O63O 4RLHA 3RQSA 2JCXA 5J23A 1KVQA 4N5NA 1KERA 2PZMA 3NUGA 2YDYA 1Z82A 4TRNA 4RQUA 1ZXBA 2VUSA 4CLXA 1E1LA 2GSDA 1RYDA 1UR5A 1O8CA 4YAEA 2QQ5A 4ITUA 4D3SA 5U4QA 1GUZA 3NT5A 2RAFA 1A5ZA 1HDGO 1KC1A 4PFJA 1GV0A 1YBMA 3DTTA 4YA6A 4B79A 2R00A 1J4AA 4PG4A 3DZJA 2EJWA 4LSMA 5CDTA 1PZGA 3OFSA 1HE5A 2VNAA 4WASA 3COSA 3V1TC 3RROA 4E2XA 4DVJA 2P5YA 1E5QA 1ADCA 3HFSA 5CG1A 4BO0A 1TT7A 4R1UA 4D3FA 5TNXA 5I7FA 3QRWA 5JYDA 1P1IA 4BGEA 1M2WA 2VRBA 4BIIA 3LQFA 4XRRA 2UYYA 3RKUA 2HMVA 2WSBA 2CF5A 1OMOA 3ZHYA 1B16A 3F6YA 1FDWA 4ILKA 3AU9A 1Q7BA 1PGQA 3D4PA 1E5LA 4MVJG 2JD0A 4WECA 3N58A 1HDXA 3TF5A 3E9NA 2LDXA 1RM4A 2BFAA 5JYEA 1HZJA 4U6SA 1VL0A 3AOEC 2ET6A 2ZTVA 3G1TA 4NG5A 4WJZA 5CG2A 2EV9A 5CDYA 1JN0A 2AQHA 2O7SA 3W4JA 1PTJA 3N74A 2P5UA 2PGLA 4ZQGA 3GNQA 4XJTA 2O3RA 3H4VA 2WMDA 2YQ4A 1A9YA 3AK4A 5JC1A 4CLDA 3QVXA 2NADA 3ZWXA 1Y8QA 3AY7A 1VJ1A 2QG4A 2VUTA 2Z1MA 4E5MA 2DQ4A 2NU7A 4JK3A 3K73O 1GL3A 3S2GA 3PLNA 1LX6A 3MJVA 3AY3A 1BVRA 3U4CA 4DXHA 2BLLA 4FB5A 1PL7A 4TRJA 2E49A 4GH5A 4XDYA 4BNZA 2X5JO 5DCUA 1H0KA 1B2LA 4CLOA 4GMGA 5DF1A 5BT9A 1XEAA 1HE2A 2WM3A 3QA9A 1G0OA 3R1IA 5ER9A 4CM8B 4I5FA 4K1LA 4CMBA 4IJWA 3WB9A 1HLDA 4KTTE 1WZEA 4ND5A 2QRLA 2QW8A 1JWBB 3QQPA 3KVOA 1LA2A 2C5AA 4C7KA 3DB2A 1Y9EA 3EGOA 5F5NA 1E3SA 5FEUA 2VHZA 4I08A 1MA0A 3L9XA 4AL4A 4H3VA 1YDWA 3FCOA 4GI2A 3DBLB 4XJSA 4RF5A 3UCEA 4UEOA 2P4HX 4UUNA 2W2LD 2X1HA 2NU9A 5JBIA 1XQ6A 1JLLA 4Z0PA 4NBTA 3ADPA 3U9LA 3IL2A 4FBGA 1T1RA 4OKNA 3ROKA 2H6EA 4FGWA 2O4UX 1FMCA 2Q99A 3BA1A 1I24A 2G76A 4P4NA 3A9WA 3SJUA 4ZQFA 5JY1A 3NDJA 4Q39A 1PWZA 1NR7A 4HY3A 2Y05A 5B37A 1YBAA 4WUVA 4NBWA 1X1EA 3LT4A 4FFNA 4WCDA 4D42A 3ZH2A 1TA4A 4GVLA 4O6VA 3QLJA 3VVBA 1I0ZA 5DP1A 4RPGA 3F3SA 4NHEA 1UXKA 3OBBA 1O94A 1HE4A 2FRDA 1BHSA 2FPGA 3B20A 3K8ZA 4CMEC 1I3LA 1JU9A 3D7LA 2AXQA 1YL6A 1K89A 3RUDA 4U0KA 4W6ZA 5B4VA 1XLTA 3ZU3A 4OXKA 1XHLA 3GHHA 3PIIA 3U4DA 3SBOA 5KJ6A 3ITDA 4CV2A 3RUAA 3VPGA 1VC2A 4BO7A 4KUHA 4E2ZA 2YZ7A 5COAA 4WLVA 2IXAA 5AVOA 1JQBA 5JXWA 2FP4A 4WLFA 5DN9A 1EUDA 2OGUA 2ZCVA 2IXBA 3GLQA 4IDCA 1E3EA 2BFOA 1ZBQA 2IODA 4AJEA 4CMGA 2EP5A 4OMUA 2YV3A 1U3TA 3OF2A 5G4KA 4XR4A 4F45A 3OJLA 1Y1PA 1NVGA 1I10A 3GFGA 1X15A 2JFHA 3WGGA 3PIDA 3PDJA 1HDZA 2HLPA 5EL0A 5KCZA 4CR7A 4QSMA 5L51A 4ZA2A 1E3JA 4XR9A 1T25A 1NTOA 1ML3A 5FYDA 2VTEA 4ZD6A 5FI5A 4AJHA 4A27A 1GZ3A 2C2YA 3FNFA 1KY4A 3GR6A 5T67A 3DL2A 3DMTC 1DIGA 5AOVA 5KTKA 3GDFA 1EFLA 2NUAA 3UN1A 2Y1GA 4PLWA 4HV4A 3B1JA 4B7XA 4IDAA 2I76A 4B7UA 4XYEA 4MVJI 2G0TA 2E82A 1J49A 4G65A 2ZKLA 3AI1A 2ZYAA 1EVYA 1YJ8A 3I9KA 4PN3A 1F06A 1XU7A 1MXHA 3P5SA 4I9NA 4OKIA 3HQ4O 4J43A 4XWYA 1KVSA 1MX3A 2YYYA 4K26A 4YJGA 5ITWA 2DFVA 4J6FA 1CERA 3PDUA 2DPHA 3S2IA 2VOEA 3JQAD 3DOCA 3V1YA 4BGIA 2CVZA 3GPDG 4M87A 1PQUA 4AJJA 3PXXA 4E2WA 3L6OO 2ZTLA 5TX7A 5I7VA 1GR0A 4IDFA 3KYCA 2ILTA 1S6YA 2EIHA 3T7CA 2AEJA 2X0NA 2YY7A 2PA3A 3MJEA 5FWNA 1RM5A 1ISMA 1YVEI 1OZAA 2Q3EA 4MOWA 5AYVA 1IULA 1HDYA 1A4UA 4O1MA 1EVZA 4DLLA 1QRRA 1U3VA 4WEOA 1A72A 1NPTO 3RIHA 3ENKA 4QUKA 3WDSA 3O4RA 2VHVA 3KEOA 2Q1UA 3GOHA 2OORA 5A06A 1U9JA 3HDQA 4YJFB 1Q0QA 3QE3A 5CP8A 5IDXA 3SX2A 5BSEA 2D59A 1P1FA 3QVSA 1YQDA 3NTQA 2F1KA 1DLJA 5G0SA 4PLZA 1NPDA 4JCOA 3O8QB 1JTVA 3BMCB 3WLFA 3JQDA 1ONPA 1IL0A 1KEPA 3CUKA 2PGJA 4DUPA 1KC3A 3BYZA 4CL8A 1IPEA 4EZBA 3HUDA 3DAPA 5LDGA 2FSSA 4PLCA 1NVTA 3F5SA 4DMMA 7MDHA 1DIBA 2Y0CA 1GYRA 3EAGA 2P91A 3E48A 3KSDO 3BMOA 1E7RA 2VT3A 1C0LA 2PKRA 3DOOA 4RF2A 3WNVA 1DJQA 1HE3A 2JAPA 2PFGA 4RPHA 1OC4A 1E3WA 3E9QA 4XQCA 3WQSB 3BAZA 2GN8A 3I4FA 2BI7A 5BQFA 4OYRA 3HB5X 4PRLA 4DREA 1H6DA 3QWHA 3NAQA 4QTZA 4P38A 4WKGA 1G0NA 4INAA 2EW8A 2GCGA 3C85A 4R16A 3PHGA 1NHGA 1PQWA 2IRWA 1ADBA 2AG8A 4XIJA 1PU2A 2PH5A 1MG0A 4L76A 4AICA 4JBHA 2A4KA 2F00A 3BHIA 1PX0A 2C2XA 3JQ8A 2WD7B 3RUEA 5MDHA 3OQ1A 5T8KA 4PZEA 3PFWO 5KJ1A 5G0UA 1UP4A 2YW9A 4RVSA 4XB1A 3PI7A 3S2FA 3CKYA 3SEFA 1IY8A 3I4CA 5JDCC 1DC4A 1R37A 4HP8A 4NI5A 3GVHA 2HMWA 3HN2A 5ENDA 3EZLA 2B5VA 1EVJA 4TWRA 2Q50A 2EKPA 1C0PA 4GWKA 5L7WA 3FNEA 5EN4A 5COBA 5L4SA 1B8UA 4HUJA 2WD8A 2O7QA 4EI2A 3SVTA 4ALNA 4CM1A 2OXIA 4NH4A 2HSDA 4YAGA 4R9SA 3S1LA 3AM4A 2VZ9A 3IIEA 1QYVA 4IZHA 5BNTA 2CFCA 4B4WA 4BHTA 1IHYA 2ZB8A 5JCJD 1VL6A 4PLHA 3ZWYA 4TVOA 2OL4A 4YT4A 2AMFA 2BI8A 4XYLA 4RZHA 3GVPA 1U4SA 3NYWA 3ZWAA 1JKIA 3Q1LA 3IQDB 2ZTUA 3DDNA 2J3JA 4JXKA 4MO2A 4PG5A 5HBRA 3UXYA 3FBGA 3H9EO 1GYPA 5COQA 5H82A 4FFPA 2DBZA 1YXMA 4IDDA 4NJOA 3NT4A 3MOIA 4Q3EA 3RFVA 4BL5A 1HSOA 4IIVA 2EJVA 2W2KB 3M2PA 1J0XO 2J3HA 4AJOA 4B4VA 1DO8A 1SPXA 1T2FA 1A71A 1ZXLA 4E21A 3EW7A 1R12A 3AUTA 1QKIA 2GGSA 1DXYA 2ZB3A 4Q3CA 3TN7A 4MINA 3KBOA 1SO8A 4XGNA 3GUYA 2BHLA 3VOSA 5FF9A 1ZEJA 4MP3A 4NQZA 3RJ5A 4OH1A 4YJHA 4CQLB 2HQ1A 1YL7A 2V6MA 2D4AA 5JY6A 4ZVVA 1BTOA 3K9QO 5ICSA 2HUNA 3ICPA 1PJ3A 3KLPX 3F5QA 3GNSA 4Y9DA 3LF2A 3GZNB 1EQUA 1DFHA 4ZJUA 2AEMA 2G1UA 4E2YA 3VZQA 3ZW8A 1E7WA 4LVCA 1E7MA 3ENNA 3FPLA 4BMSA 3K31A 4RDIA 4PVDA 3B6ZA 4KWIA 4I5GA 4O5OA 4Z9YA 4EGFA 4G5HA 4DLBA 1J5PA 1JVSA 2ZTMA 4IMRA 1BXGB 4M89A 4F3YA 1YL5A 3WIEA 4YB8A 4BKQA 5A9SA 5LCXA 4EUEA 1U2GA 1Q7GA 5IXSA 4AJ4A 4OIMA 3K2EA 4Z6KA 1DC6A 1LNQA 2CNBA 2JHGA 5LC1A 1Y9AA 5KJFA 1E3WB 4JJGA 1UP7A 2WDZA 3KETA 1W0CA 2PKQO 3TDKA 3L4BA 2JFFA 2AG5A 2IDZA 3H9JA 2IEDA 4ZU3A 3DHEA 1B8PA 4JROA 4R4JA 4YACA 1YKFA 4UAGA 2DBRA 1NQ5A 1HETA 3PZBA 3H8VA 4P4GA 1WVGA 4OQYA 2R2GA 1E1KA 2OBNA 3AI3A 4PG6A 4WNCA 3VTFA 4DQVA 1AXGA 1CDOA 3WGIA 1D3AA 3RC2A 1P0CA 1P33A 1Q1NA 1R0SA 3JSAA 3HWRA 5DOVA 3VZPA 5KWEA 1LDBA 2Q4BA 4E33A 4J7CA 4OO3A 1SBYA 1Q7CA 4KQWA 4OSOA 4PZDA 5IDYA 1XKQA 4YR9A 4A2CA 3I9NA 3VDRA 4A73A 1DRVA 4CMIA 4CM5A 2Q2WA 3D1LA 1KVUA 1L7EA 1N9GA 2O4CA 1GQYA 3U3XA 2CVQA 5B4TA 4FQ8A 2PH3A 3EMKA 1YQXA 2UV8A 1LC3A 2FWMX 4J90A 3SC4A 2O23A 1M76A 1NAIA 3GMSA 3IAHA 5ER6A 5ADHA 3IC5A 1ADFA 3IOYA 4FW8A 4J2OA 2ZATA 4CM6A 4PVCA 3EVNA 3QP9A 3PWSA 3ZV5A 2Y1OA 2JCYA 1UDAA 5L4LA 4J3FA 4R9RA 1M6HA 1PR3A 1PEDA 2HMUA 4A10A 4E5KA 3V2HA 3G79A 1LDMA 2O3UA 3JYPA 3GRKA 4HKTA 1P1KA 4UEJA 1V3UA 3OSUA 4D79A 4WCFA 4YTEA 4WOJA 1Y5RA 3IMFA 4DC0A 5CHEA 1UXHA 1A4IA 5IG2A 3RKRA 3L9WA 3H9GA 3JQCA 4I5DA 4ZRMA 3JQ7B 3NGXA 3ROPA 4TVBA 3RSHA 1PL6A 1JKFA 4XGKA 1F14A 2X0IA 3KV3O 3Q9UA 9LDBA 4HX5A 1P45A 3BMQA 2R6JA 4PLFA 4NU6A 4CUJA 3FPCA 4JGBA 2C20A 3UF0A 1Y8RA 3WLEA 4Z3KA 5F3RA 3LYLA 3NT2A 3E18A 3V2UA 1N92A 4FDAA 4B4OA 1BDMA 2O3SA 4DPMA 1K2WA 5DP2A 4CMAA 2VYVA 3QV1A 4NJMA 2C59A 1XYGA 3PLRA 4GL4A 1CQIA 4JNKA 4L4XA 2J3KA 4RF3A 5EQFA 3FWNA 1SB8A 4RF4A 4Y6SA 5G4LA 3ORFA 3AUAA 4KMSA 2ZJ1A 4MKXA 3F4LA 4BOYA 3OIGA 4TROA 3WR5A 4DC1A 3TQHA 1GD1O 4QO8A 3RU9A 3GK3A 3DONA 3LF1A 2Y99A 3KSZO 2AHRA 3HE3A 1TVEA 1KEUA 1XU9A 2EKLA 1VM6A 5JDIA 1JW9B 4BNFA 3W4KA 1OOEA 3GUCA 2NV6A 3UW3A 2Q1TA 1YO6A 4N5LA 5CEJA 4QFDA 1CF2O 1UZMA 3GAFA 4DPKA 3I5MA 4FN4A 3RUCA 2FZEA 1HYEA 3MEQA 5I9NA 3G1UA 3MCVA 2CDBA 2HU2A 3JYOA 2GNAA 4BS9A 2QYTA 3ZWPA 1DDOA 2YUTA 4ALMA 1ZO8A 3H7AA 3OETA 1PL8A 2DTXA 4E3ZA 3PQDA 1ADGA 5A9SB 4L0QA 4A03A 2NVUA 2AEFA 1NVMB 1OC2A 3ANLA 3JQ6A 1Z75A 1HL3A 2Y0DA 4WOKA 4CUZA 2O2SA 1W8DA 1U8FO 2GN6A 2ZQYA 5THKA 5A03A 3WS7A 3E1KA 1IPFA 2B36A 1FDVA 2BGLA 1ZCJA 3AFMA 3DBRB 4P4LA 4QFCA 3BTUA 1VJ0A 6LDHA 2NLOA 3U4HA 3RU7A 3OIDA 3ZDFA 1LI4A 2BKAA 3MWEB 1ISFA 3WMXA 2GF2A 3D5QA 5CFZA 3O03A 4FFRA 5CPBA 4KDEA 1R4NB 4UULA 2PZKA 3ZNPA 4E4YA 4E0BA 3IKTA 1YWGO 4DYVA 1KY5A 2VNSA 2VOJA 3O26A 4ZN6A 1DFIA 2CMDA 4B7CA 2V6FA 3FNGA 2NSDA 4CQMA 1O5IA 2X0RA 4LSWA 1YRLA 1EBUA 5CEEA 2PD3A 3LC1O 5DNAA 3ETEA 3V8BA 1LU9A 3R3JA 1BXKA 4LN1A 3ANNA 1E6EA 3F47A 4EJ0A 1XG5A 1N2SA 3DBHB 3QHAA 4IS3A 5B1YA 4PG7A 4PGFA 2IE0A 1F17A 5EESA 1H6CA 4J1TA 3H2SA 4N5MA 3WGOA 3WSVA 4QXMA 1BG6A 1CQJA 3VHRA 3WMWA 3QVWA 1F0YA 5IN4A 1BGVA 2J5RA 4W82A 3FRJA 4RVUA 4PG8A 5JNLA 3WJAA 3WX0A 5KVQA 1LDEA 3JQGA 4RCVA 2GZ2A 3L07A 2TMDA 1PJ4A 3QSGA 4GGPA 3U62A 5DOZA 1MP0A 4PLGA 5TLSA 2X7HA 4BNTA 2FPPA 1EDOA 3KEQA 3LLVA 4E12A 1V8BA 2I66A 1NQOA 3DC2A 3L6EA 5KVVA 3ON5A 2IZ0A 5K6AC 4DA9A 2HDHA 1NBOA 1ISGA 4IDBA 4HBGA 1YDEA 1DLIA 4ND1A 3GF4A 3TWOA 2HK8A 4LW8A 2BF7A 3HJAA 1YQGA 3D3WB 4XX0A 4WEQA 3X2FA 3RVDA 4YAKA 2RCYA 4CM4A 4J4BA 2C07A 5DZSA 1NQAO 5G0TA 3GDGA 5L7TA 3CMCO 1CYDA 5C7LO 1R4MA 1YB5A 5JO9A 4E5PA 1MLDA 3WYEA 1ZNQO 2CDAA 4BGVA 3CEAA 1GUFA 2D5CA 5I7SA 4URFA 2G5CA 1BW9A 1D7OA 4YWJA 4IQGA 5L7YA 1ZK4A 1D1TA 1NR1A 2V65A 3ZZNA 1J6UA 1K6JA 3KOUA 3ZWOA 3JQAB 1GCOA 4LVUA 3EC7A 3ZWWA 3H2ZA 5TT0A 1XDWA 1MFPA 1P1JA 3TFOA 3PK0A 3VZRA 2DPGA 1JDJA 1WDMA 1V35A 1GEGA 2P9EA 4FJ2A 4GKVA 2I9PA 4DGSA 4L75A 3E03A 2V6GA 2C54A 1AN9A 2J5KA 5GY7A 4IXWA 2A9FA 4W9NA 3WOHA 1WLYA 4DPLA 5AXBA 3AI2A 2SCUA 4PRKA 5L3ZA 4DMLA 4M55A 5KVSA 3JCZA 5TSDA 1ZKMA 4UREA 3DXFA 1B3RA 3WYBA 1AGNA 3F1KA 3AWDA 4RJTA 1ZEMA 3C1OA 2FSVA 1FXSA 1C1DB 1K0UA 4BNJA 4EUFA 2VRCA 5EQDA 1TT5A 2ZYDA 2CY0A 3KRTA 4BV8A 4YT2A 4Y6RA 3HG7A 3MJTA 4BNXA 1UDBA 2Q49A 1SAYA 3TL2A 4L74A 4MDHA 3ZCXA 4B8WA 1SC6A 5JE8A 4BNYA 2GLXA 4TZKA 4AJ2A 1HYHA 4YAJA 1FK8A 3TJRA 3AOEA 1UAGA 4GQAA 1NXQA 1UDCA 5TT1A 4Q9NA 2Y1CA 1DFGA 4J0FA 3C7CB 3K96A 2B69A 4A26A 3L0DA 3INTA 3KZVA 2FHSA 4AJLA 1GPDG 3AUUA 3GGGA 3W8EA 1BRMA 3RUIA 4YQYA 3OIFA 4AJIA 4CLEA 3W8FA 1SZJG 2JAHA 3RBXA 2GERA 4AJKA 1LRJA 1DHTA 2DKNA 3M1LA 3RI3A 1LSSA 2OOSA 4FFMA 1IYZA 1VI2A 3JTMA 2B35A 2Q2QA 1OFGA 2ZQZA 2AE2A 2FPIA 2NACA 1Z73A 4RDHA 3DFUA 2RHCA 1EEHA 2FZWA 3OA2A 2E4AA 2I6TA 1UAYA 3D4OA 4CMCA 3PRJA 2FY8A 2UUPA 3CPSA 1DEHA 1I8TA 3CINA 1B0AA 3DAGA 1IE3A 1NX6A 4MVJA 4LISA 4HFNA 4OGWA 3WICA 2WTBA 5EIOA 2OBYA 2X22A 3OP4A 1PJ2A 3UFXA 1Y8QB 1Z6ZA 1GYQA 1DHRA 3GHYA 4Z9XA 3UVEA 4E5YA 1CRWG 1DRUA 1C1XA 5A5FA 3NGLA 2NQ8A 2Y1DA 4RLSA 2HJSA 3LZ6A 2DVMA 3I1JA 1T2EA 4R69A 1TXGA 1Q0HA 3GC6A 5G0VA 4DTIA 1P0FA 3ZU2A 1ZJYA 2RBEA 3OJ0A 4MVJM 1LSOA 4ROSA 4UVEA 4NK5A 4XGIA 3AOGA 3VC7A 3KYDA 3EYWA 1WAMA 1O95A 3ZNOA 4CM4B 4BO9A 4II3A 2PKQP 5HA5A 3DZFA 4CLOB 1O0SA 4W7IA 4UVDA 5HRUA 3VPHA 1OI7A 5DBIA 4YPOA 3DHNA 1FDUA 5F21A 1H94A 5IZ4A 2DC1A 3KYBA 4JP2A 2VYVD 4JX8A 4EYEA 1X1TA 1NPYA 3ASUA 4Q3NA 2B4QA 4KQXA 4BNWA 3VTZA 4CMEA 4J1SA 5T8KC 4QT0A 5CDUA 3K92A 2Y1FA
chains in the Genus database with same CATH superfamily
2GCOA 3FMPB 1A8HA 4G5XA 1IUOA 3CLKA 3EJ6A 2EP8A 3BZWA 1OIVA 5C8ZA 1FXWF 3HPQA 2AXNA 3V7NA 2NU9B 5F7XA 3V7FA 4IOMA 1Y7TA 2CXRA 5JBQA 4H9GA 3IYLW 3TZKA 2WHQA 2H11A 2J0QA 2XTNA 3FB1A 3HCRA 1Y98A 3C6MA 1IDOA 4AKGA 2B1GA 2ZSDA 5JMPA 4AECA 1LBTA 4BNVA 2WV7A 2F17A 3IXQA 4J0GA 3GH3A 1N2ZA 1HURA 3A58B 5CEFA 4Z99A 3WJ1A 5CX4A 3AM3A 3FWPA 3ANXA 1T43A 1G55A 2GM9A 1V4VA 1MRNA 1B8VA 4F4CA 4WA8A 4ACAA 1HKUA 1JIJA 4R8RA 2MSDB 4PZUA 4NNPA 5AICA 4QOEA 2CFRA 3HLYA 3JQ9C 1HMPA 1UF9A 2YQZA 3LUBA 3RG8A 3RFUA 3WGTA 4AJ1A 4OHZA 4UNPA 4CLRA 3IDZA 1FDOA 1LDYA 5B58T 1MTZA 5F2KA 4HDRB 1I4OA 2W4QA 3L6DA 1YZHA 3OE1A 3OZUA 3EYAA 3S28A 4X6XA 1NKTA 5CVCA 4RJKA 4N6NA 3GVIA 1ZZGA 4ZHQF 1Z8NA 2EKZA 1P1BA 4GOJA 5EHNA 3ZU4A 4UEWA 4Z4HA 1EFAA 4P8RA 1NYQA 4Q1DA 4WKNA 4I6EA 5A9RA 1NN1A 4P7FA 2AB0A 3WB2A 1EMDA 2ZYHA 3OU2A 3PUIA 4LWPA 4TSRA 3UENA 1U5BA 4QUBA 3PEVA 3OEYA 4AY3A 1E2FA 1KS9A 4D0NA 4MYTA 3FPBA 4N54A 1ZGCA 2C95A 1FQWA 2LIPA 3D6MA 4Q16A 3AGQA 1APBA 4QVIA 1VPDA 3T4UA 2GZ1A 1Z3IX 5LQMA 4HC4A 3HR4A 3ANSA 2JI8A 3F46A 2XDWA 1NNLA 1R8SA 2YMMA 3DAHA 5F7ZA 3PA8A 2R87A 3AHIA 1KI7A 3ICOA 1ONSA 2JGIA 1RPTA 1VE6A 2EOAA 1TA9A 1XCGB 2XAAA 2XNHA 1K6XA 2MWMA 2QRGA 3P27A 3NBUA 3P7MA 4HQ0A 4IDGA 4M36A 4UCQA 2D3TA 2GRAA 3W6ZA 1T36A 4H6VA 4YP7A 4J9UE 3OPYB 4BB5A 5CW1A 3S2UA 2IZZA 5L3QA 1EINA 4KBFA 1F38A 1UKBA 4PX3A 4MP8A 1OBHA 1X8JA 4DIBA 2ZUBA 2GT1A 1YRHA 4BCCA 1Z6AA 5J2UA 2NZWA 1C9JA 1U3DA 5HG0A 1KY3A 2GZ3A 1X86B 3K0CA 4HNHA 1LTKA 1SCIA 4JLSA 3HJFA 5DGXA 1EGQA 1EXMA 4I1IA 1B26A 5CYOA 2XWJI 1OE0A 3QUAA 1FC0A 3DZHA 3MTDA 5AXDA 5K0FA 2XUDA 3CLUC 2HWYA 2R1UA 5F76A 3IKVA 1I7MB 4IICA 4PONA 4CVNA 4W5HA 1QCDA 1U2GC 5F4ZA 1L5GB 2ACWA 1IQ0A 2V3VA 2XMQA 3TPZA 3DKRA 2HPVA 4L4ZA 3C98A 2C5LA 2AGVA 1SBHA 4RD0A 3R5FA 4KK3A 4AY5A 1M73E 4Q9AA 3DMYA 3AR5A 3DKIA 1JE1A 4QOHA 1GNSA 3KTOA 3AM5A 1UAAA 2DWPA 4PX5A 3LAWA 5IU6A 3UQYS 2QTTA 4KSYA 3OE5A 1KK1A 3FJOA 4ND3A 2OD7A 4G2NA 4YJGB 1YB4A 3EP5B 4BFWA 3ZU5A 5HJ5A 2L42A 3KLNA 4NF2A 1SB9A 5F5LA 1TM7E 1O08A 2HKIA 1ORHA 2Z2YA 3RC1A 2WJ6A 4OAQA 4MB0A 5ANRB 5IT9A 2J33A 1TIKA 2R6FA 1G63A 1ECFA 3INGA 1SQSA 1W1IA 1Z39A 2WU0A 2Y93A 4MRPA 4OQZA 4W8HA 4WBSA 3FXAA 3KKEA 3TMAA 4EHJA 3G8CA 1PW7A 1AY0A 1JHAA 1FFCA 1WW8A 1E62A 1G8MA 3FWKA 3PXDA 4ZWNA 2NN3C 1N8NA 2CWWA 3D64A 3ROXA 2LDBA 2RHGB 1K3UB 1J33A 3KC2A 4ZEXA 1C7QA 2Y68A 3P9YA 5EZYF 3C2QA 1U4NA 3GAMA 3OCYA 4MJXA 3IAUA 4FWBA 4H31A 4UDOA 4D81A 3EPJA 4OQLA 1C3VA 1K7CA 5G41A 1SFRA 2P65A 1YNOA 4QD3A 4MVJE 1E4EA 2GESA 2V8BA 4AKIA 1Q5PA 1U0OC 1NUAA 2HX1A 1V7CA 1JR2A 2PUWA 3JQBC 4N47A 3VSAA 5JLAA 5FOVA 2PSDA 2P79A 5FOTA 2ZSIA 4P5EA 5JJIA 3CSDA 1ZFNA 2HA5A 3K6KA 2VRCD 4H4CA 1EIZA 1Z3CA 1U8ZA 5IBPA 3I6ZA 5CIYA 3R5XA 3ROQA 3EEYA 3FUWA 2DH6A 1YE5A 3OECA 3A1CA 2VQDA 3FHCB 4J49A 2KJQA 3B7WA 4HGNA 1QSGA 1PS9A 5F7OA 4J0CA 3NDIA 1DCFA 1Z83A 2F62A 2J5BA 3A2LA 2X41A 3ETLA 3VH4A 4BQIA 2HQSA 3ICCA 3V1NA 5F1OA 4DSNA 1NULA 4HAXA 4QFMA 4IZ6A 5A05A 2XUGA 4B8YA 1DPGA 2H29A 1WHSB 4LK3A 1GEEA 1RQ2A 4FSXA 5F1KA 2VYNA 1SKAA 4KQKA 3WAKA 1V95A 3HVUA 1H65A 4G63A 3CCCA 3MWDA 4HFMA 4HLQB 2I33A 4JYPA 4RABA 4ACBA 1NW3A 4CE6A 1ZINA 1I7DA 1QH1A 4GMDA 1RMYA 3GCWA 3DZGA 3NBKA 3LQ1A 1GAWA 3TZHA 1HC7A 2F1HA 4D8VA 3TZ6A 3HGMA 2HK7A 2ZUEA 2DT5A 4M0FA 4MITA 4AAYA 5ESXA 2RHBA 3RRJA 1NP3A 1UMKA 1WCIB 2IS4A 1KGDA 4KRXA 4Z9FA 3G5LA 2NSLA 1KJJA 3MT0A 4FHCA 2QZPA 1A5AB 4HN9A 3FCAA 2EGHA 4TTTS 1JA9A 4B6FA 4HLUC 3MINA 1ZJWA 2YWDA 1VL8A 3OZVA 2GJAA 3TNJA 2WHXA 3Q9SA 4YCMA 4KBYA 3LWNA 4N0MA 4YQFA 1QJCA 1X7ZB 3IEUA 3W5BA 2YJNA 3SX0A 3FOEC 2PEYA 1VL2A 2CE7A 5CXSA 1FTSA 1QHFA 3K94A 4PPFA 4PNZA 4QJ4A 3ULKA 1GA1A 2OTCA 2JRLA 1SBCA 3FIJA 5B2EA 3EBLA 2JAUA 4L7VA 4FZJA 2HIHA 1GU0A 3RWMB 4BO4A 3QLTA 3V6MA 3W3AH 1MC5A 1F7VA 5AVTA 1E77A 4XRGA 3UIEA 4BNKA 2GFHA 3PC4A 2ANBA 1G7TA 1HDCA 1RWWA 4EPTA 4H3SA 2ROQA 3UMVA 1ZH8A 4DCMA 2NM0A 1JDVA 3HUEA 1C7EA 1W0JD 3P9QA 2E6UX 1TEZA 1UINA 3IR5A 4KWEA 4TWIA 4CMJA 1JJBA 1WWKA 2NXJA 3QPVA 4HVAA 3PRKE 2ZI5A 2NP6A 3ZXSA 4KQCA 1D0SA 5EWJA 2EDCA 3DPUA 4ZHQA 1P77A 4E46A 3HY3A 5ES3A 3FWYA 3A0RB 4MGZR 1BCRA 2Q8QA 3EXAA 3BFJA 4LQCA 4OJQA 2B3DA 2O1WA 1QV7A 3AP1A 2WSMA 4U0JA 3UGKA 2O2EA 3U3MA 3QV2A 5AKLA 2PANA 1DL5A 2C94A 2XB4A 3IT1A 3OPQA 2YUIA 1BH6A 2GN2A 3WWYA 3VYTB 1L4KA 3ZE1B 1SXPA 1CEEA 3EIWA 4K6KA 1I72B 2CF6A 2DUJA 3C43A 5JC8A 3K0SA 1PG5A 3D5TA 4YEDA 3RS8A 3FPGA 1GAQA 1AZSC 5DYWA 1Z06A 2AWOA 5DRYA 4BFXA 3GRRA 3X1ZA 2M2IA 3Q98A 4HVLA 5DLYA 1Q19A 3G0DA 1GCGA 1SQGA 1T1JA 3FTPA 3L2OB 4LF5B 5AKYA 1G6HA 1AGRA 4EHBA 5HF5A 2WVJA 1JR3D 4LHWA 4O4LB 5I01A 4C4OA 2ZUDA 3P2YA 1V3TA 3TLEA 1U0GA 2QUAA 3NTXA 3SBEA 4RX1A 2FEOA 2P9QA 2ZYWX 4D7AA 4H08A 5BWCA 2AOVA 3D3NA 4G56A 2R1TA 5CD9A 8AT1A 2CNOA 2ADMA 3G0OA 1P39A 4EA6A 2EZUA 4G01B 1NQTA 1RYNA 1ZGAA 2Z5VA 2OQIA 2RGXA 3EY4A 2EP7A 1CUZA 1X14A 3EY9A 2E4XA 4NZ9A 4XCVA 5FFNA 3VPCA 4H7IA 4BJ6A 4LQ4A 3O8OA 1EJ6A 2G88A 1YASA 4KUGA 4TUYF 2QP4A 2V7QD 3PCXA 4E5UA 3URMA 3EGCA 5A6VA 1RYMA 1D2RA 4Q3OA 2MIIA 1DB3A 4ZT5A 5CU7A 5AUQA 4B3TB 2O1XA 2GXSA 2YNMC 1QLJA 1XLUA 2QI9C 4IYRA 4PSCA 2GBCA 3KQHA 3CWCA 2HK9A 2LCIA 3DTNA 3SNHA 5DNUA 1E9CA 1W73A 3E3NA 3FWHA 3KD2A 6YASA 1PT8A 3M5WA 4YLGA 1GTRA 4UQPA 1BWRA 3LTEA 4CM8A 3C3XA 4OJKA 4KGXA 1U8XX 2VDOB 2NSYA 5FRDA 2FOXA 2JFUA 3FDFA 4NESA 2HWXA 4QNMA 2QRJA 2QV7A 3IESA 4QBIA 2NU8A 1HXHA 1WXFA 3A11A 3R9IA 2AN1A 4Q34A 1AQNA 2YQ5A 3LYAA 3OIUA 4Y67A 3UJPA 3WL5A 2Y0BA 3NBZC 2GPTA 1FRQA 2IYRA 3FI9A 3K32A 4H1TA 3WK4A 4ADSG 1HYGA 2ZJBA 3H9UA 1G6OA 1ULAA 1ZWKA 3CVOA 3WGZA 2V4UA 1C29B 3G02A 3QPDA 1BU8A 3H04A 1K3TA 1CJUC 3FZNA 3SMVA 5LD2B 4QNNA 1R4ZA 1RS0A 4JT2A 4ETMA 3FTQA 4DRYA 4E11A 2FWRA 2V6BA 1B3BA 4CKWA 2O0KA 2W70A 3EVDA 3UH1A 3HUTA 4WH0A 2OV1A 5KQMA 3QXXA 3JASA 1JEYA 4I1YA 1J2YA 5EKXA 4ZT2A 2Q22A 4NE9A 3K9LA 1SULA 3RANA 3WRWA 5ILOA 4BAUA 4S3MA 2UYOA 4OBEA 3MCAA 1U80A 2ZWVA 5EP3A 4YUXA 4U9UA 3BE6A 1KWGA 4O2RA 1QPZA 3DDOA 2EW2A 5IMBA 1KDOA 1QQ7A 4QDTA 2ORED 4JENA 4PTYA 2AQIA 1JEYB 1W85A 1Y81A 2AFHB 2B4YA 3Q6MA 5TQ0B 4ND2A 3GT0A 2DBVO 4DDWA 2ICAA 3OHPA 3A6ZA 1PYGA 3E84A 4RD3A 2JFPA 2R8EA 3GRFA 1FFAA 3PSAA 4J0KA 2DTEA 2ISCA 4CCSA 2OHXA 4YAUA 3CVVA 5TF4A 2GBIA 3D4NA 5C52B 3BFPA 2WPDA 3LT5A 2A7QA 1UM9A 5KNCH 2QX7A 4NHOA 2J3MA 1ISHA 3AW8A 3JARA 2AMJA 3NTRA 1CE8A 1IXZA 2FZ4A 4D3YA 3KXKA 4D43A 3I53A 5IKOA 4HNTA 1DEAA 2AZ4A 3WLHA 4YV0A 2IOFK 2FZ5A 2WAMA 2PUJA 1XQXA 4KN9S 1W44A 1CV2A 1M75A 2LTAA 2VCYA 2XXBA 1NJSA 4Q3DA 5FHRA 3S2ZA 8GPBA 5KJCA 2AFVA 4OHMA 2OWDA 4QPJC 3WIDA 2AEEA 2B3TA 5I4CA 2IL1A 2BKUA 4WN9B 2NTJA 3BX1A 3E3LA 5FUWA 4AZWA 1FDSA 4ZI7A 4BTEA 4JIGA 1NWHA 3KZKA 721PA 1GA4A 3GY0A 4B35A 2W7TA 4MPDA 3DEJA 3G6WA 3IP3A 3VTKA 5AVSA 5JZ9A 1TLTA 2F4VB 1LD3A 1FQJA 4R1NA 5LDDC 4ZCRA 2F43B 1QP7A 2K4MA 4BWFB 4KIFA 1D4ZA 1KJYA 1UKAA 5CLIA 5ALGA 5C8YA 4ZOQI 2OWEA 3RDPA 1E2IA 4V2UA 4XQ9A 3GFPA 1PLJA 4BVAA 1OLXB 1Y7LA 1LK0A 3D8UA 2O8DA 1FTYA 4RSHA 2IBMA 1EZ4A 3GJRA 1Q91A 1P4AA 1U1DA 1XOIA 3PYMA 1E9VA 3ESRA 1SKYB 4IWNA 2C5BA 4Z1MD 5KYWB 2XNCA 1F2DA 4XYBA 4IIUA 1SUPA 5TE9A 2YJZA 1H2HA 2GMWA 2OMEA 4INZA 2QAGC 2P2SA 5B4UA 4GSKA 4KMOA 4TTPA 5ALFA 3LT0A 3DNFA 3GQVA 4LDNA 1JAZA 4MS1B 3H6KA 1U4OA 2P2LA 2PUTA 4MWGA 4ARBA 3LIPA 1W87A 5HCIA 3DQZA 3ETDA 5K6RA 4Q4AB 4CCAA 3EHEA 2I2BA 5AXCA 4HOYA 1TQ8A 2C78A 3PQ8A 3SJCA 1FXUA 1FFDA 5H9WA 1G20E 3WO1A 2ZJ0A 4DQUA 2BFNA 3BHMA 4CM3A 3PI6A 2OENG 4IBOA 3D8HA 3IAS1 1UKZA 2C8VA 3PWZA 3SC3A 1IJKA 3NW9A 6ABPA 2YINC 1VPWA 2O3JA 4WBNA 4ZTBA 2JHFA 2V98A 1DIRA 3WBBA 2QPOA 2G9NA 4DR7B 1JDBB 1LDNA 2O6HA 3WGYA 2MYTA 2Q5CA 3EIHA 5BQXA 2VLBA 2WJAA 4JIMA 4ZFNA 5JRZA 4CWAA 5IKXA 4WNYA 4XEHA 1VCHA 1V11B 1JQLB 3LLSA 1NVFA 4A6XA 1UIRA 1ZN9A 2O2YA 4MTCA 2ZCJA 2VHJA 4URUR 3EQ2A 1OX4A 1VE9A 3RIGA 1O6CA 1JJ7A 2PRIA 4XYMA 3WYGA 3QVVA 4K7JA 4IUCS 4D3XA 3G2HA 1B6TA 1IEXA 4XEUA 4P22A 1THGA 2COEA 1IN5A 1R0LA 4M0DA 2BPOA 3FOWA 4UCFA 4BMDA 3D81A 4D9GA 3LP6A 2EEZA 3G0CA 5KQSA 1PT5A 2H0AA 2NTVA 2VYND 3EZ6A 3LRXA 4C4XA 4BZPA 1GPAA 3VNRA 1FYVA 2G17A 2B20A 3CCFA 4J1QA 2WHPA 3ZZ0A 2ZI9A 1VSVA 2CKMA 3WGMA 2FB9A 1QWSA 2GN1A 4RTOA 2PUGA 3DTYA 2C7VA 1RWMA 1X7GA 3HRIA 4L16A 4P7JA 5U9CA 4N4AA 3NHLA 1ZOPA 3GLFB 1K5GA 5FTWA 2P2CA 2RC5A 2QWXA 2FW1A 4IRUB 1TVMA 2W6PA 4FFDA 3T3MB 3ZQ6A 6PFKA 4MVJH 4K81B 1UXGA 4Z4QA 5E8JA 1UC9A 3BE8A 3VSDA 4WJKB 1KIMA 1Y5NA 4EF6A 2H7CA 2BGJA 4D98A 2IPAB 2HN9A 4BQRA 5T4HA 3GIWA 5T3UA 1XU4A 1N4DA 1M2GA 3EXHA 5E7JA 2BH2A 1GTL1 1Z34A 5HKAA 4D57A 1I4TD 1N5IA 4R54A 2ZU0C 3MXTA 5CXUA 3RVLA 4ZZIA 2H7YA 3G7NA 2WABA 3I05A 4OL0A 2RB4A 4Z0HO 4OXRA 3ZDEA 2AKAB 1I6MA 2AMYA 821PA 3WDMA 1TQ6A 1N2CA 3MCUA 1CB7A 1CDDA 4GRAA 4OK3A 5ECGC 4HGPA 5LQAA 1TPZA 2VDRB 2WE8A 1AQJA 2B7BA 4ZRDA 1MT3A 2ETXA 2PHZA 3Q41A 4X6YA 1Y4SA 2ODQA 4MIYA 4XGRA 4B4DA 4YMHA 2YVKA 4BRWA 8OHMA 4UUAA 2PVSA 4XUGB 5J9GA 1PWYE 2E87A 1JBEA 2IEAA 5HS6A 2OORC 4D5EA 3CV3A 3P94A 1SA0A 4FC7A 4B48A 2W6NA 1QDEA 1BEUB 4D46A 2XB9A 4MAAA 1T4CB 3IHTA 5DJ5A 3L49A 1AKRA 3I2HA 1V7QA 2C5EA 1W88A 4KQ2A 1D9ZA 1LCIA 1IVNA 1WRBA 2CJFA 3ESQA 1VJDA 3JQGB 4HJRA 4RXMA 3R40A 3RGWS 3ORHA 1PGOA 2HIGA 3FYUC 1PJTA 2AMLA 3A3YA 4XKJA 1M1UA 1PZEA 2FF7A 2I4TA 2IKSA 3UXHA 3JZFA 1HF3A 2BHTA 1XTPA 4MKFA 4F0JA 3W5AA 2A4MA 2F4NA 2OSVA 4RHYA 1G17A 2W9XA 2D74A 4B33A 4HDCA 5D1NA 3HUUA 3K6JA 3T3GA 1WSDA 2HJGA 5F35A 3BTSA 2DM6A 3LW8A 3OT4A 3WLOA 5JCXA 3W6OA 3TRIA 1DCMA 2HSJA 4LRSB 2IF2A 3O4JA 3AU8A 3N2LA 1JQAA 3AR7A 5LLDA 4DEXA 3M6IA 1UJ5A 2RBKA 3QUSA 3AIIA 4UHHA 4JBIA 1FFWA 4TS4A 1N6PA 3JD4A 3ZGXA 4CR8A 3QTBA 4JLWA 1PD0A 4ZMSA 5A3QA 1GG9A 1HLGA 4J07A 3KQUA 3K05A 4PXAA 4ZPJA 1SUCA 3STYA 1BW9B 3PQ7A 4RPLA 5IJ0A 3SYLA 2WSLA 3H5AA 3QTLA 2FHPA 4YJ3B 3PFIA 5KNLA 2ZJ7A 2DRIA 1QDUA 2J7PA 3RRMA 4EW1A 5GTDA 5HILA 1CVIA 3WYCA 2BN4A 4FYYA 4GXRA 2AG0A 2A9VA 5AVQA 4URZR 3PPIA 2JS7A 4N7RA 4CM9A 1N7GA 2N1MA 1KO8A 2X58A 2XWPA 4JEHA 5IZCC 4FT4A 1XDBA 2PS9A 5EIBD 2YJ4A 3KXPA 1L8LA 3N8KA 4XA8A 3Q5GA 2QVLA 4HLCA 3ZVRA 2C8LA 1U0BB 3LBIA 1NAHA 2GJSA 2RGEA 2SCUB 3C1TA 5ABPA 1Y82A 4BC1A 1MB3A 4MGKR 4NXMB 3L1KA 2JJYA 3E8SA 4KLRA 4W5OA 2ZPUA 1NRIA 4NBVA 1FX0B 2XRZA 2JAQA 4PNPA 3DO5A 1JXAA 4MW5A 4KQJA 1HRDA 3U7QA 2W2KA 4BKRA 5IC6A 2GSWA 1C7FA 1V1RB 5CPFA 1I3CA 3D3JA 4AURA 4X95A 4R2XA 4A5SA 3DO6A 3QBJA 5ECDA 3U7JA 1ZM2A 3K5WA 1GPNA 2VSOA 3TLAA 1ZJJA 1TT5B 2F3TA 4B40A 1FX1A 4FB4A 1YJQA 1VI5A 2OZVA 3A31A 1EFPA 2CYAA 1EGVB 3SBDA 4D4GA 3BTOA 7REQA 4B9EA 1CC1S 3OKPA 2C3PA 5D01A 5BWMA 4UDYX 1ICIA 4UC0A 1SN7A 2YW2A 1DRWA 3URKA 2NQTA 4AZTA 4DVGA 4J94A 4CV1A 4NZYA 3HACA 4UTOA 1EBFA 3S68A 4P83A 1EGMB 4DS3A 4E6PA 2VYQA 2XRFA 3DW1X 4TKUA 4O1IA 3PXGA 3RJ9A 1GGNA 3NAGA 3W04A 4E32A 1QE5A 5ITVA 5JFGA 3DLHA 2QX4A 2AR9A 1P4JA 2QJRA 2YV5A 4OAPA 3RB8A 4C5AA 5KTPA 3NHJA 4RVOA 1OGIA 4WZAE 1ODJA 3NHAA 2JH8A 4H6PA 2WA1A 3SC6A 3AY0A 2QA5A 2ZRJA 1XT6A 3L0BA 5JJCA 3CZQA 4N3AA 5LQJA 3GCDA 4RK1A 3B82A 2QTBA 2UYCA 4HH3C 2NYUA 4ZO9A 2VDMB 1TU3A 1NYTA 3CNBA 3LXUX 4HRYA 4OY3A 2WPDD 4QPZA 2QF7A 4U7HA 1PS8A 5E3JA 1DWPA 4HSEA 4QJBA 2B8TA 3HKEB 2WZBA 2Z98A 3HXKA 4ECEA 4HAVA 5K0LA 4IOKA 5AKXA 3IWDB 2WKSA 3NVMB 3V1KA 4UVGA 2I99A 2H4JA 2OD9A 1TM1E 3H8JA 1O2DA 2YWHA 1XELA 4GBED 4MDFA 1RHRA 4AQYB 4YMSA 2FPIB 4MPPA 3TEMA 4CBVA 3L7OA 1B8OA 5FWXB 1ULUA 3SN6A 4DNQA 1EVIA 1JXMA 3DZIA 3IULA 4OI4A 4R2LA 4WN3A 3VYUB 2L17A 4PYOA 5CNIA 3UAXA 5K20A 3JVIA 3X1KA 2NYAA 1I1NA 1KOJA 1QVAA 1BKSB 4MW6A 4X6LA 3Q8LA 2ZUFA 3KFLA 1H6BA 1YRAA 2XJ4A 1XXHA 2IP2A 2IDJA 2V58A 5J2TB 2OO5A 3ND6A 4NCAA 1KU6A 3BSYA 2IYOA 3ZE9A 3A1SA 1L7VC 3N2ZB 1QG6A 2I22A 5EA2A 4CN8A 4DBVO 3UT5A 2GD1O 4B6JA 2ZT7A 5L3SA 2PLAA 5K4AA 1HLPA 5KZMB 1U0SY 2DU8A 1QCZA 4GNRA 1YA8A 1VLLA 2ZAGA 3WO0A 4NBSA 1XRMA 1UC5B 3KM0A 1DAPA 3L43A 3OTWA 4AY4A 1UFOA 4DWVA 2JASA 3OOJA 2VTDA 2O0MA 2X9GA 5EXXA 3DF7A 1R5OA 1T2AA 1XVUA 4WNAA 1DPFA 3WLPA 4UCXA 9LDTA 4Q3BA 4R51A 4NNJA 4C5BA 1A9ZA 1H3FA 1VRWA 1E4VA 4WADA 3R76A 4H1WA 1VIDA 3C97A 3FSGD 1L4EA 2XTAA 4PICA 1PFKA 3GEBA 3ET5A 1A27A 4RA9A 3KPUA 1WXGA 4LZOA 4TSKA 4V02A 3UKOA 5KS2A 1Y5MA 5JAQA 3BL6A 4NCIA 3UGJA 4GO1A 3GG2A 4GE0A 4QO7A 2I5PO 3GFQA 3WG9A 4F85A 2UZ0A 5BVGA 4YCBA 2BW0A 1E5DA 1VSTA 3AF5A 1R50A 4C08A 1KIFA 1QIIA 1WMBA 2I6XA 3N8DA 1LRKA 4RO0A 4X1KB 2VQ6A 3JATA 5GM2A 3GJ3A 3W7BA 1JVNA 5J4KA 4K3UA 4BFSA 1QIJA 4B09A 3B12A 1Z12A 5A6SA 4HGZA 5J2UF 3CVUA 4Q00A 4RULA 3R6WA 3R3SA 1I7LA 1ORWA 3U0BA 4HDOB 1FU7A 2ODNA 2Y3IA 1R3DA 4F72A 4PYMA 2EEPA 1HT0A 4JP1A 1HV8A 4I9UA 3VKVA 1S2OA 2J9FB 2JFBA 4DLPA 1J7KA 1H66A 1XTRA 1Z8HA 1ZESA 3L5OA 5IT4A 3E2PA 3T9CA 2F55A 3WWOA 1N36B 1MH9A 4QUDA 4TYQA 3BE4A 1ZG3A 1AHIA 2HA2A 5BVHB 5IAOA 2EC5A 2VSYA 2AW5A 3MT7A 3GG9A 5AD1A 5KYYA 1J0AA 4PAMA 4Q9HA 3U6KA 1TECE 2V5VA 3HDTA 4D4KA 2QD1A 2BTQB 3H0VB 2QVXX 2M1XA 2MR5A 2M98A 3DFKA 2PNJA 4DDVA 5CTAA 5CXXA 3CZRA 4IVQA 3GNTA 4Q5IA 1HEUA 3GJXC 4QICA 3SIPA 3C15C 3ETHA 1GSIA 1JX6A 4LHYA 4RLFA 4ALLA 4BBPA 4FD3A 3FTCA 3S8EA 4BE9A 1C9YA 1WF3A 2AOTA 2RGDA 3I45A 5HFJA 3QF7A 2X2FA 3MW8A 2CZGA 4M8SA 4B3FX 1P3Y1 1VA5A 4C21A 1VMKA 4DA0A 2BAGA 1U28C 4NJEA 2GPBA 4FWIB 5K01A 3QYAA 1O9HA 5H5JA 4DG9A 1NQXA 1MT0A 1SZDA 2OD2A 2Q6LA 4ZOBA 1I5RA 3T61A 2RK4A 2GJ4A 3OAAA 5EJAA 4AUNA 3R7WB 4R3UC 3E58A 4TS1A 3KXLA 1SU7A 3FYSA 3I6IA 1DX4A 3DL0A 3HL0A 4JL6A 4OI1A 5CBPA 3G2PA 5IDWA 1F20A 3CRMA 1Z0SA 1LLDA 1TJ3A 3QIVA 4QU5A 3TK1A 1N1GA 3FDZA 1D2HA 3IELA 2PN1A 1TKAA 4GOMD 4OJMX 1SBTA 3EBPA 4EB6A 1AO0A 1O0CA 1PBNA 4NIMA 3T41A 3O9MA 4G0PA 3ZTWA 3KJQA 4IF4A 1A7UA 1TW2A 4L0DA 4KQ1A 3X43A 2JIPA 1T13A 3B6KA 4PE5B 3RSZA 2XIJA 3ASYA 3NH6A 3LBHA 5DSZA 3TZQA 5IVIA 3AV3A 3QLUA 1HDRA 3TE7A 3NIBA 3PITA 1O87A 3CTMA 3WL3A 2CXPA 5K0EA 3Q7EA 2X0DA 1GKIA 4G1FA 3IJ5A 3I2GA 3HL4A 2HNKA 3CCBA 3FVWA 3VU1A 4FC6A 3RNOA 3RARA 3TLXA 1GPH1 1X77A 2R8PA 3MMSA 2EBHX 3IBTA 3PP8A 2GBPA 3UJAA 1QS0A 1HQKA 1XDDA 3QWAA 4CMKA 5J4YA 4JFAA 2DUWA 3U7RA 2Z57A 4WNIA 3U1BA 3S3TA 1E9DA 4V0OA 1A04A 1UBCA 4N6GA 5E1DA 3T3HA 1IOVA 3V7WA 2WG0A 3U9SA 1OREA 1ZGZA 2PV7A 4YQZA 4DYDA 4GR5A 1W2WB 1QKKA 1MW8X 3EPBB 2IPXA 1S02A 4KXVA 4HFRA 3WLLA 2WWFA 3QVOA 5IARA 2BMVA 1VJCA 4WLOA 2C0QA 1I6LA 4WW0A 4UMVA 4DOMA 2HV9A 4MQMA 3TRKA 1JMYA 3AEKA 5J63A 1HE1C 1S0UA 2O48X 3DQPA 3B7GA 2AFRA 3BH0A 3FETA 3IEIA 3O95A 4JS0A 3T7KA 2PYDA 1Z18A 2AN4A 2WTNA 2Z5LA 3WISA 5HKKA 4LF6B 1YHNA 2QZSA 3ROZA 1W1UA 1XTTA 4L5CA 3TQQA 3H0WB 5AW8A 5JD4A 1NYRA 2R1VB 2OGSA 3QJ5A 4GR9A 1E7YA 3JPWA 4X66B 4RY8A 4WLNA 3WLJA 1MJGA 4OA5A 1KP3A 3C8DA 4Z7OB 3CRRA 4L9WA 3P19A 2ERXA 1QFSA 1STOA 3EFOA 4QGGA 4IVRA 2JIMA 2OHFA 5FLYA 5K8IA 4UPEA 2HO4A 1P3DA 3KYIB 1H5QA 2VHWA 1QH8B 5AVYA 2WJVA 4R1LA 1QU2A 1YOVB 4C0QC 4EJSC 2VJDA 1EVEA 4MI6A 4DLTA 3L8MA 4TXLA 3U4IA 1BDBA 1K4MA 4JVMA 2FMHA 4ASUD 4B82A 2O14A 3IP9A 3DE6X 4JQCA 5CIQA 3TGLA 1WMFA 2JH9A 3W9SA 2XW6A 2OXCA 4MQEA 2PKEA 5AM1A 5JZSA 4F06A 1EQ2A 3A1EA 3WWZA 1RQPA 1MJGM 1BQ3A 1U0HC 2PX2A 3FSEA 3E82A 3JD1A 3RNLA 3VJMA 3IILA 5DTEA 1V96A 4L2IA 1FVOA 3BMNB 3I2FA 3TZCA 3W5CA 3VHLB 4WE3A 5SY9A 4ZYUA 1KVRA 4QJ5A 2O8BB 1OH5A 2VQ3A 1SQ6A 4UVIA 2J7PD 1ILWA 3C7AA 2XRYA 4XWOA 3EXIB 3WKBA 3C7KA 2BGWA 2Z1NA 4HX2A 3AEUA 2DTDA 2HXSA 4CM9D 3JWGA 4K6GA 1YQUA 4P3KA 5DISB 1R6BX 5HJ2A 4LHXA 5HUJA 2G6TA 5JQGA 3ZD7A 1JILA 4ZVNA 5KBYA 4FD2A 4L0MA 1OQAA 3DHYA 4LJYA 3E5RA 1R6VA 1T0UA 1XGKA 2ZYSA 5TRTA 3WL4A 3D3WA 1SIBE 3HI4A 4RVGA 1TFUA 1H9CA 4OXXA 2VSXA 3IPAA 3ROMA 2IPMA 4HWKA 4P2BA 4O4HB 4A6EA 2EKDA 1OLSB 2OV4A 3PEYA 4MVJP 3WDLA 3TUZC 2EJCA 1KQPA 2NVWA 1SQFA 5IYZA 4GX5A 3B9PA 4J1TC 1ZWLA 4DCCA 3SC2A 4BNIA 1WNTA 4OQFA 1M0TA 1J0CA 2PT6A 4IINA 3M2TA 2BEUB 4YCAA 4OK5A 4XE5A 3WKCA 1RAIA 1AB6A 2ZI7A 4K9RA 1SCQA 3RWBA 3SNKA 3MJSA 2EIXA 5BN4A 4CCWA 5FOQA 4OYHA 1J39A 5FP0A 2DPLA 3M82A 2Y1KA 4IGEA 4QGHA 5A7FA 1JHOA 4WXPA 4I4NA 5HEKA 3UWPA 4LQDA 1JL3A 3OMXA 5FI1B 2B83A 3QOXA 1TAQA 4ZCMA 2VDQB 2QRKA 1O96B 4JLKA 2HOQA 2JL1A 2ATCA 1TCUA 1ICEA 2ZSHA 1UK9A 4LYEA 1DOHA 2WOJA 1EUCA 1NE7A 1NMZA 2CHVA 3O83A 4FW9A 1GPJA 2G4CA 2VL7A 3STWA 4JI7B 3CBGA 4HHEA 5D3MA 4MKRA 3R3WA 3SKYA 2J59A 1Y6RA 2D2IA 2FN9A 1Z38A 4PX9A 1CNEA 3GVCA 5MDHA 2NGRA 1Y5LA 2XYQA 1TZMA 4LVNA 3KTDA 3EFHA 2J9RA 1DE0A 5M5BA 1Q0UA 2GK7A 3FPJA 4JYCA 4IIHA 5ALYA 4S24A 4IILA 5KNDA 1LPBB 1P4HA 5JTTA 4DR3B 5LOVA 2H8KA 4C7XA 5AHWA 3WDKA 4C6RA 1IG3A 1MORA 2XUZA 2XZDA 3CE9A 1ZR2A 2PZMA 5KREA 3OJWA 4RZ2A 1CR2A 4TRNA 1ZXBA 4DF3A 4GS5A 1S1CA 3AB7A 3PDHA 2G9QA 5EGSA 4D3SA 1GUZA 2G7ZA 4N5DA 1QJ4A 1KA9H 1Q57A 1HDGO 3EQZA 3GJZA 1GV0A 3F9RA 4PFJA 4YCJA 4B79A 4V1CB 1DEKA 2VJOA 3HVKA 1JHMA 2D0OB 2I8LA 5A5VA 2E55A 2JIDA 2ZI6A 1VXOA 1EX6A 4XUCA 4GYJA 2Q1YA 4RKRA 4HLNA 4NE7A 4LSMA 4NY1A 2BUBA 3OFSA 1NNI1 3Q40A 3R41A 4N8SA 3QFCA 1RABA 3MT9A 3UT0A 1T9GR 4LJ9A 5DW3A 4A82A 2Q3HA 4TLCA 4X1YA 2R7AA 4E2XA 3RLIA 3BXEA 1ADCA 1Q11A 4MB6A 1D03A 1LBSA 5I5GA 4EPXA 1T0IA 4HGRA 1EK0A 4KR6A 3FGNA 1TO2E 4UZSA 4YC7A 3PDIA 4Z5XA 5B3JC 2XBMA 2JBHA 4C4SA 2FSVC 1QQTA 2DPYA 2IW3A 4PZAA 4XRRA 2NU6B 4XXHA 2WJ4A 3L0CA 4GHWA 2JGRA 1T1IA 3A9VA 2CF5A 1FDRA 2GRUA 1LVHA 3DZDA 4WZBB 5JNTA 3CY6A 1H1LB 2IPNA 3F6YA 5BW8A 1UBEA 3U3KA 3AU9A 4B2LA 5DSTA 4DC9A 2JLZA 3JAKA 1CFZA 2BBTA 1U0EA 4JUFA 1SVUA 1JHPA 2BFAA 3GX1A 4CF7A 1HZJA 4UHDA 1C9KA 4QQKA 4IFBA 1A1VA 3I6YA 2MMCA 4TV8B 4HK4A 4CEJA 5FUQA 4UOQA 4DLXA 1G98A 3NWBA 4N3NA 3W4JA 1PTJA 2E5FA 3N74A 1FNBA 1AKUA 2P5UA 4N01A 4ZPXA 4UOZA 4ZQGA 2B6HA 5HHTA 2PQMA 4QDXA 4TYPA 5CAEB 2JJ8A 3FOFC 4I3FA 2YXNA 1A9RA 1RC0A 5JC1A 2Z2JA 4CLDA 2NADA 3ZWXA 1K5PA 4FQ5A 4AMGA 2PLWA 1VJ1A 2VJLA 2VUTA 4RY2A 2DQ4A 2BONA 3QX8A 4ODIA 4S35A 3K73O 2XKKA 4U2KA 1HH4A 1D9XA 2Y6VA 2PSJA 5C8YF 1KYTA 3OCVA 4UPDA 1BVRA 5C0OE 3RVKA 1D4OA 4I3GA 1FJ2A 5FJJA 2OXFA 3EQ9A 2BLLA 4FCWA 4DIUA 4EHKA 4L6AA 1J21A 5D2CA 5DCUA 1H0KA 3LM8A 5TMBA 3VDXA 1NI3A 2HQBA 2P0YA 2GYUA 1KPGA 2BFEB 3TSYA 2WLSA 1RPAA 2QLMA 4DEYA 4DWJA 2HU7A 2WM3A 1AQIA 1OLUA 4UAUA 3U61B 1G0OA 1KMQA 1UPBA 3A04A 1U1GA 1GUBA 2C1EA 4G24A 4GZLA 4K1LA 4ND8A 2YOHA 4Y6QA 4ZAVA 2FEXA 4BTVA 4O3MA 1ZUNA 3WB9A 1QZZA 2EU8A 3BJZA 4MKIA 4GG1A 2C7QA 1EIWA 1KZ7B 2GD2A 3PKZA 4HGQA 1YBHA 2GM5A 1GGEA 4KN8A 5CX1A 1T8PA 2NZVG 2ZJFA 4KRGA 2BFWA 3VO1A 3WLKX 1LBQA 5IC4A 1BVYF 3OAAD 1M34B 4C7KA 3D2AA 1LVUA 2R2AA 3EGOA 5GGXA 5F5NA 5I9TA 1U2EA 4I08A 2HJVA 2J0UA 1FFBA 2PJZA 3OC6A 5B57C 4O29A 2JIOA 3UBTA 1YD7A 2OZLA 1CTQA 1I9GA 1FUEA 1X1BA 4M0PA 4M8IA 3FCOA 1CBUA 2B92A 2Q5OA 3DBLB 4RF5A 3T06B 3R3VA 4UEOA 4WBNF 3A2KA 3BWYA 5JAPA 9MHTA 4F93B 3SS9X 4QJIA 4R9VA 1J22A 1JLLA 1K63A 3O91A 4ETNA 2HY7A 4ED9A 4EQZA 3UXMA 2XE6A 4L07A 4D97A 1FMCA 3BA1A 3D8NA 4FGZA 1NU6A 3VMMA 4P4NA 4CU2A 3WLAA 2D0DA 3A9WA 2W2PA 1O95C 3R23A 4MYSA 1NW4A 2C9YA 5JY1A 3NDJA 1NR7A 4ZI2A 1ZR4A 4YI3A 1B23P 3MWKA 1LZLA 4WUVA 4DM4A 5CGQB 3ZH2A 4LE1A 4GVLA 2AIRA 1JSZA 2EZ9A 1JI3A 2WF6A 3QLJA 4C7OB 4EB3A 3K5HA 5AW3A 4TOIA 5DXJA 4GZ5A 4NHEA 4NLLA 3UJ9A 1KIAA 1IEVA 1O94A 2MTBA 4ITVA 4WHMA 4C7BA 2IGTA 3TW6A 1BHSA 2FPGA 5CJJA 3B20A 3DE4X 2LKDA 3K8ZA 1RTTA 3CG0A 2YFKA 4NU8X 3IA2A 1I3LA 1JU9A 1L5ZA 3RJMA 1YR7A 3VBEA 4PGMA 4W6ZA 5B4VA 5LQDA 4EL5A 2IV7A 2UXBB 3M8KA 3V7YA 4C0KA 4Q15A 4NZNA 3SBOA 3TO5A 1XO1A 2Q6IA 5HKKD 3HB0A 5KJ6A 3L7NA 2ZIXB 3L8CA 4KK4A 1MVNA 4NQRA 4D9JA 4QE3A 2W2VA 2VPIA 1R7RA 4E2ZA 1JTFA 2VDPB 4IXDA 2P9BA 1RI4A 2VG8A 2IYYA 1JQBA 5HK9A 3NB0A 3PR2B 1CRZA 3I2JA 4MDYA 3THSA 1EUDA 1GTZA 2OGUA 4EJ2A 2IXBA 2FFAA 3L0YA 1QAOA 3FUTA 4IDCA 4YN3A 4V0QA 3R09A 4ZYTA 5IUNC 2CFIA 2IODA 1WVIA 2KWIA 4AJEA