4XB2A

Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with nadph
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
MKVNISIFGFGTVGRALAEIIAEKSRIFGVELNVISITDRSGTIWGDFDLLEAKEVAESTGKLSNIGDYEVYNFSPQELVEEVKPNILVDVSSWDEAHEMYKVALGEGISVVTSNKPPIANYYDELMNLAKENNAGIFFESTVMAGTPIIGVLRENLLGENIKRIDAVVNASTTFILTKMSEGKTLDDAIEEAKSLGILEEDPSKDIDGIDAYYKAKILHWVSYGEPPEEEERLGIREVRDARNVRLVAQVSKGKISVKPRKLSSDNPLLVEGVQNAAVIRTNNLGEVILKGPGGGGRVTASGVFTDIIKATLKFPNLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of a Hyperthermophilic Archaeal Homoserine Dehydrogenase Suggest a Novel Cofactor Binding Mode for Oxidoreductases
doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Oxidoreductase
molecule keywords 319aa long hypothetical homoserine dehydrogenase
total genus 108
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4xb2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xb2A01
3DBVO 5L4LA 2ZKLA 4HNHA 4R51A 4JXKA 2OXIA 2DBRA 1IL0A 5JAQA 4B4VA 2NVUA 2HO5A 1LXCA 2EG9A 5HWSA 1N9GA 1R4MA 2NNLD 1Y8QA 3AOEC 3V1TC 1YB1A 2E49A 1F12A 1I30A 5FI3A 1YQDA 3CKYA 5F1PA 3WSVA 3WIDA 4AJPA 4BO0A 3JD3A 1YGYA 2EJVA 2X23A 2BLLA 3JYPA 1MV8A 1KY5A 1M67A 1BTOA 1Y5MA 1XQ1A 3RAJA 2ZIZA 2UAGA 3GLQA 1LC3A 4IXTA 3VH3A 4YA6A 4DA9A 2AG5A 2G5CA 3VDRA 1BVUA 4RVFA 4KZPA 1SEVA 1T25A 4BNKA 1KS9A 1PZHA 5T64A 1UDCA 3D4OA 3PHHA 3D4NA 1ZNQO 3WLEA 4BVAA 2OGUA 3Q0EA 2WEKA 4G65A 2VUTA 4WCDA 1RWBA 2I5PO 1MP0A 3TWOA 3ZV6A 4BNWA 1LQUA 1R12A 5FI5A 2Q2WA 1FDSA 5A9TA 4A7PA 1X7HA 3C3XA 3ITKA 2J3KA 4WEQA 3ICPA 4JK3A 4NK5A 5KVSA 1PEDA 2DT5A 2V65A 2Q99A 1ZJYA 1PL7A 3UXYA 1DC5A 2PH3A 1LA2A 4XJSA 1T2CA 2JFFA 2XXBA 4NBUA 1Q7BA 2NTVA 4MKXA 1O5IA 3QLJA 3RASA 4EJ0A 2ZYGA 4QSMA 2X58A 1LDNA 1LSOA 2H6EA 3DXFA 1NWHA 2V6GA 3FWNA 1PJQA 3W8FA 3RJ5A 1JAXA 3QHAA 3VPFA 3JQAA 1PGQA 1ZVMA 4JBIA 4CMIB 1H94A 3S2IA 4F45A 4IZHA 1P77A 3R0IA 4EDFA 1YB4A 3VH2A 5L3ZA 1ENOA 4L76A 4FJ0A 4NFYA 1XHLA 1UJMA 1PR3A 2X22A 4FSHA 3QW2A 2CVZA 2Y0CA 4PCVA 5KJFA 5BSEA 3UF0A 1X14A 3WMXA 3Q2IA 1U8XX 3QJ5A 4DREA 3D1LA 1NQAO 5DBFA 1ZH8A 2PGLA 3JQAD 4HWKA 1MA0A 1P31A 7ADHA 3ZNOA 4QO8A 3B1JA 4JNKA 4DYVA 2Z95A 4ZA2A 1XELA 1M6HA 3EZLA 2HCTA 4XQCA 3KRTA 3VKUA 4NR0A 3LC2O 4E2ZA 3O8QB 4IJUA 5COQA 1EVJA 1PL8A 5JDCA 4W7HA 3JQ8A 1P0FA 1U2GA 3OJFA 4YBZA 1XEAA 4HADA 3ETGA 1XCBA 1XWFA 1U5AA 2X9VA 4TWRA 1AN9A 3EYWA 1H2HA 3SLKA 4GVLA 1ZSVA 1FK8A 4D45A 4E5NA 1U8FO 3RJ9A 3B70A 2EV9A 1CF2O 4CM5A 4HXYA 5KVQA 4NPCA 1T1SA 3OEWA 4ALLA 5F3RA 1H9AA 5I7VA 3W4JA 4CQLB 3AM4A 5CDUA 3RBZA 4IQ8A 1ADFA 3H7AA 4PRKA 1WPQA 3AM3A 1U9JA 3FD8A 1ORRA 2YDXA 3L6EA 3S2GA 3SVTA 3KXDA 2Q4EA 3BIOA 1YRLA 2BI7A 3IIEA 1B8VA 4EI2A 5I8ZA 2NM0A 2X9GA 4A73A 4CQMB 1YB5A 4DXHA 3L9XA 4OO3A 4B4WA 2GASA 4GI2A 4J9UE 4NBTA 2W2KA 1GUYA 2HJRA 5I7EA 1I3NA 2AA3A 3CE6A 1GCUA 4BMVA 4RVGA 3S2EA 2O23A 3MZ0A 3DR3A 3HG7A 3HN2A 2VHWA 3KYDA 4R5HA 4XX0A 1EMDA 2EGGA 3E48A 2PA3A 3N58A 1A7KA 2Y1CA 3V1YA 1H5QA 4GMGA 1E6EA 3NJ4A 4Z6KA 3HWRA 3HNPA 2GERA 1HYHA 2UV8A 4PFJA 2DM6A 3BHIA 3ZV5A 1QORA 1NQ5A 4IQ0A 4CLEA 3WICA 3OH8A 5I7FA 2V7PA 2Y67A 2QG4A 3L6OO 2ZJ1A 3E6AA 5M6DA 1Q2XA 2DTDA 1N2SA 3GAZA 2VZ8A 4L4SA 3WFIA 3ZWPA 1EVIA 1NTOA 1B15A 3OJLA 4GLLA 4E5PA 3V1UA 4NK4A 4FFMA 4XB1A 2ZB8A 3BMQA 3WGOA 2UUOA 4LCJA 4E13A 4D43A 4U6SA 5H81A 3PZRA 4IS2A 4R1TA 1X1TA 2X6TA 1GR0A 3HZZA 4XD2A 2GYYA 5G0WA 5LCXA 4IXWA 1PS0A 2IXBA 4N5MA 4ROSA 1XA0A 3JQFC 3RD5A 1DFIA 5JCJD 1SOVA 3D4PA 3RU9A 4Y8VA 2NU8A 1HZJA 3JQ9A 5F5NA 1G6KA 2NTJA 3GGGA 4IZIA 5DZSA 3PTZA 3OEYA 1HDYA 3NT4A 4FGWA 4TROA 3L9WA 2Q1WA 2DBQA 2HMVA 1CJCA 1IHYA 4RLHA 3H9QA 4QT0A 1L1FA 5A1TA 3DBLA 1A72A 1LBEA 4DIFA 1KVQA 3BXXA 2JFHA 1VL6A 1WDKA 4N5LA 1GYQA 3E82A 1I3KA 4C4OA 1H6BA 4ALJA 1NAHA 1PJ4A 1BW9B 4CM9D 3JYLA 3GEGA 1HDXA 3D5TA 3G49A 5DF1A 1DB3A 4M55A 3GNTA 4FDAA 3MJ4A 1DAPA 3AU9A 1JWAB 2HUNA 3ASVA 4ZVVA 3JQEA 2TMGA 3E1KA 1BSVA 4PZEA 3U9LA 2BMAA 4ID9A 4CLXA 5JS6A 2VWGA 1PGJA 4BNTA 3WJ7A 3GVXA 3I6IA 3UAGA 2B35A 5COBA 4BQRA 1WVGA 4QFDA 3DMTA 3DBRB 4UEKA 3UH1A 4LMRA 4INAA 5G0VA 3WGTA 2OUIA 3PXXA 1DBVO 2VHVA 3IP1A 1U2DA 3O03A 1CWUA 4J7XA 3PFWO 1EVZA 2FWMX 2B69A 3EHEA 1R0LA 4WCFB 1HEUA 2FPIA 3QRWA 2JHGA 1NVGA 1R37A 1WWKA 4BNZA 5A9SB 1HDRA 4I9UA 1UR5A 2VNSA 3ZWMA 5L7TA 1QLJA 1W6UA 2P2SA 4H7PA 3HB5X 2C59A 1GYPA 4XYLA 3QVWA 3PDJA 4PVDA 3BMOB 1E7QA 4QFCA 1KEUA 2VZ0A 5G0TA 3E03A 1P45A 1YOVB 2B5WA 4BO8A 4D0RA 4O0LA 2DQ4A 1ZZEA 2FSSA 4ILKA 4R69A 2R2GA 2QZZA 4D42A 3SC6A 1E3IA 2OHXA 2EHDA 4Y6SA 4L74A 4IDDA 1LDYA 5T57A 1C0LA 1DAOA 3DWFA 5A9RA 4IPTA 3H65A 1ONNA 4M86A 3DTTA 1ZJZA 4ZRNA 4CLOA 1X13A 3DMTC 2YHIB 1SCUA 2AMFA 1B26A 5JDCC 1HYGA 2JL1A 4S3MA 2XOXA 3ULKA 1RJWA 1W4ZA 3EUWA 1NNUA 4ND4A 5CG1A 3M2PA 4CM3A 3KBOA 4OOEA 4I8XA 1B3RA 1BDMA 3H9UA 4RLSA 1EDOA 3Q1LA 2GD1O 2HRBA 3ZWNA 2XAAA 5DCWA 1B16A 1LSJA 1Y81A 4HFNA 4BL5A 2D3TA 4Z9XA 2E4AA 5DBIA 4BKUA 2YUTA 5EIOA 5FYDA 4B7XA 5BNIA 3RC2A 4YB8A 4XQGA 3DEYX 5ENDA 2E37A 4J1SA 1DHTA 1T2EA 1R4MB 2RCYA 4B7CA 3KEQA 1VL0A 1H2BA 4UEJA 5L51A 4PGFA 3T7EA 3DAPA 2BD0A 4CM8B 4MKZA 3IS3A 4DL9A 4U8GA 5FF9A 3ZWOA 5JY1A 3KOUA 4XEHA 1HT0A 4QO7A 1HL3A 1ZSNA 2OORA 3DAGA 1A9YA 4GQAA 3TOZA 1SO8A 1HDZA 4DMMA 2I65A 3U4DA 4J90A 1H9BA 4A27A 4AJNA 2A35A 2Q4BA 3KYDB 2HRZA 4J4TA 3C24A 1GUFA 4BNGA 3JQ7A 3DZIA 4BUCA 1LQTA 1O9BA 4R1UA 4BO6A 2F1KA 2QRJA 1LC0A 1HTBA 5EJ2A 1CETA 1U5CA 1WLYA 3FSRA 1FJHA 3NV9A 4WK6A 3ZW8A 2DTEA 3R3JA 1JAYA 3BMOA 5JSFA 2GGSA 1V9LA 3IAHA 4NJMA 1M66A 4EGFA 3K5PA 5CDYA 3PIIA 4WLEA 2OL4A 1YJQA 4GSLA 4NG5A 5BSFA 1EFKA 4RVSA 3QWHA 4XQEA 2CVOA 2ZCVA 1WMAA 1LLUA 6LDHA 2X0RA 2IYPA 4E33A 5JO9A 5L45A 1ADGA 5JC8A 4MVJG 4WOKA 5ES3A 2WTBA 3NJ8A 2D4AA 4CLRA 3WX0A 1U3TA 4YEDA 1QYXA 2PD6A 3GZNB 4WUVA 4PLVA 5KJCA 3V2HA 3DZGA 3LSYA 4HUJA 4FR5A 4E5MA 1D1TA 4TRRA 1VSVA 3VDQA 4J0FA 3L4BA 3WGGA 1PZFA 2CSUA 3BMNB 2GN6A 4DLAA 2R00C 2EXXA 2O4CA 1PGPA 5JMWA 4DMLA 5TS3A 4GGOA 1UH5A 3RFVA 4AJ2A 4CM4B 4EZBA 5JYAA 1UXGA 1Z6ZA 4XDZA 4AICA 2YHUA 5JDIA 4NBWA 4U5QA 1YQXA 1KOLA 3AFNA 1UUFA 3TDKA 2ZTMA 3GFBA 4RDIA 2D2IA 1F8FA 2RHCA 1T4DA 4L75A 3ROKA 1DHRA 1JW9B 3KSUA 4RGBA 3ZHXA 4YDRA 1AHIA 2Z5LA 1FDVA 1ZEJA 2RAFA 3OECA 7MDHA 2WE7A 4M1QA 3WFJA 4CMBA 1Y7TA 1C14A 2OP1A 5J23A 1ZMOA 3MJEA 2VYND 2Z1MA 1KY4A 4KUHA 4NH4A 4IY1A 3RUHA 3U09A 1VJ1A 1VRWA 3NT5A 2YZ7A 4NIMA 4WLFA 2HQ1A 1IULA 2GNAA 3IQDB 3WGHA 1A9ZA 1XLTA 1C3VA 3WBBA 3AFMA 4QQRA 4UVDA 2EERA 4RZIA 4WGGA 3GG9A 2J6IA 1VE9A 3VZPA 1ZEMA 2Y66A 5DNAA 4GLOA 3PJGA 3I52A 4XRRA 3JV7A 4G2NA 4YAIA 2QW8A 5C3MA 2O3SA 2VHZA 4FFRA 1CQJA 4XB2A 1B14A 1F17A 1IOLA 3GUCA 4JJFA 4JP2A 4MP3A 4JQCA 3OP4A 3DHEA 4BNVA 1LSSA 3FNGA 4W7IA 2GDZA 3PHGA 3ZHZA 3GF4A 1U7HA 4CV0A 3D0OA 5EL0A 2D1YA 3GRPA 4CV1A 4NU6A 4L4RA 3S2FA 3ZNNA 3U62A 1PJ2A 4AFNA 3SXPA 4K6FA 1Z82A 2FSVA 1MGOA 4O6VA 4E5YA 2OZPA 4CV3A 5ICSA 4BNJA 3W4IA 3JYOA 1DJQA 1EEHA 1UXHA 1EUDA 5TSDA 3KB6A 4PLGA 1DPGA 1Q1NA 5BQFA 4DWVA 4MP8A 5TT1A 2HAEA 2VTEA 3FNEA 1SPXA 1HRDA 1DFHA 2YDYA 1LNQA 2WSBA 5F5LA 3PEFA 4WECA 2DAPA 5JMPA 4NDNE 3K31A 4II3A 4YT2A 2ZTLA 3GR6A 3GPIA 2XPCA 4R3NA 1KVRA 4DC1A 4FD3A 2PR2A 4YJFA 5JO0A 1P9LA 1SOWA 4MVJI 4RQUA 3D3WB 4A2CA 3DMYA 4MVJD 1GZ6A 2HK9A 2NVBA 3C7AA 4UVGA 4CODB 3HB4X 1EQUA 5G2OA 2BH9A 4FOSA 3ICCA 1L7DA 5LC1A 1A71A 1OC2A 1GZ3A 1MFZA 3UVEA 1JDJA 1Z73A 3OJEA 3RI3A 2H9IA 1E7WA 1HSZA 1J4AA 3QWAA 4JGBA 1XR3A 4Z9FA 3KEOA 1LLCA 3PIDA 3QA9A 3GG2A 2D5AA 4FPXA 4RQTA 4MVJA 4OSOA 3QY9A 4R3WA 3HADA 4AJJA 5CEJA 3DFUA 3O8QA 2J5KA 4TKMA 5H83A 3GA0A 1BHSA 3WNQA 3WQQA 1B3BA 1O8CA 4JP3A 6ADHA 3AU8A 3VAZA 1E3EA 2SCUA 4H3VA 3FRJA 1CERA 1HKUA 1I8TA 1V3VA 2HMUA 2LDXA 3H6KA 4UULA 2X5OA 4BNIA 1CQIA 2A9FA 4OOFA 4WJZA 3DBHB 3GPDG 3OQBA 3QQPA 1J0XO 1RM3A 3KUXA 2O3TA 1G0NA 4KQXA 5A05A 2C54A 2NSDA 1WAMA 3EDMA 1AE1A 3GGPA 4K6CA 3HJAA 4XGKA 3RQSA 2P91A 1SMKA 2PZJA 5DCUA 1TEHA 1E3LA 4D46A 5A04A 4WASA 3NYWA 1V3TA 2O2YA 4CUZA 4OIMA 3ETDA 4A10A 4BV8A 5I7SA 9LDBA 4DLBA 5IXYA 3INTA 5JFOA 5GZ6A 1Y5RA 4J2OA 3L6DA 4PRLA 3UCEA 1JKJA 1MX3A 2VRCA 2I3AA 1XKQA 5AQ1A 1YBVA 2PY6A 1E3WA 3MEQA 1HE3A 4ZN6A 3IL2A 3P2OA 2Q50A 2J3HA 4FCCA 1UDAA 5L95A 5KJ1A 1EUCA 4ALMA 3AUTA 1YO6A 1I24A 1OMOA 3PQDA 3ZN2A 4BNFA 3GY0A 3OJ0A 4FB5A 2C2XA 4YJGA 1UP7A 5T67A 1I0ZA 2QYSA 5KVCA 3DZHA 3DBRA 1JLLA 3FR7A 2AQ8A 3FF4A 3AI3A 3UUWA 2AHRA 3JQBA 3VPHA 4E12A 4Q3EA 1P3DA 1Y8RA 2X7HA 1FF9A 3K8ZA 1U4SA 3VTZA 3JD4A 3W8EA 4QTZA 4AJ1A 5IF3A 1KERA 4WLUA 4UVEA 5F21A 2VYVA 5G0UA 3W6ZA 4EUEA 5CAEA 2OBNA 1Y8RB 3L4BC 1K3TA 2AQKA 2C5AA 4PLFA 3Q3CA 3P5SA 4U6QA 2A94A 5AXDA 2QX7A 3SC4A 4BGIA 2C29D 3D5QA 1P33A 1R66A 2IZ1A 4BNYA 3RKRA 4IIUA 4DPLA 5CPBA 1X0XA 2PZKA 2EJWA 2D59A 3GRKA 5DN9A 2IEDA 3FNHA 4P4GA 4NU5A 4AJLA 1Y8QB 3F4BA 1M2WA 1YS4A 4YAEA 1DC6A 2Y05A 4CPDA 4MIEA 2PD3A 4A0SA 4BO4A 3EW7A 5BSHA 2EP5A 4BO9A 1VM6A 3FTNA 2X8LA 4YT4A 1YDEA 1M75A 2CD9A 4KWHA 5ER9A 3NKLA 1E3SA 3F4LA 4HBGA 5T5QA 4RVDA 1TXGA 1GPJA 2O7QA 3CZRA 1ONPA 2IRWA 2VHXA 5JCJA 1TT5A 3D7LA 5DBGA 3PYMA 2VWQA 5EINA 2NLOA 1LRKA 4MINA 4WEOA 2ZYDA 5F1KA 2GUGA 5KNLA 5EQFA 1P1HA 5A02A 4CQMA 4E30A 1EDZA 3H5NA 3G17A 5TC4A 3CEAA 4BGVA 1GUZA 3A9WA 3HN7A 3I9KA 1OI7A 4WE3A 3C85A 2FP4A 3QVOA 4PG8A 4BO7A 4ITUA 4GBJA 4JJIA 5LDHA 2VWHA 1ISFA 2W2LD 5C7LO 1X7DA 2W90A 3GMDA 2GZ2A 3CIFA 3ZU5A 4CQLA 1R4NA 5KKCA 4P38A 4O1MA 4WLOA 4XWYA 3Q11A 2YJZA 4DBZA 5TT0A 1JKFA 4CMEC 4D44A 3EC7A 1P74A 1WXDA 2PGDA 3AUUA 4Q9NA 1DIBA 4KMSA 4P4LA 4CUKA 3GH3A 4WNCA 4FOOA 3SBOA 4B3JA 4RORA 3GDOA 2C20A 4YTEA 4DIBA 1NPDA 4E0BA 4UUNA 1OC4A 1XYGA 1I10A 5JAZA 2FOIA 3SEFA 4WLNA 1KVSA 3HQ4O 4R68A 4J3FA 1V35A 1F8GA 3STHA 2WWRA 1XIVA 2JAHA 1KEWA 4TVOA 4GMFA 3UW3A 4UEOA 5K6AC 5IAAA 2CDCA 4XDYA 1ISJA 2BGKA 3MOGA 3RBXA 3BZUA 4Y98A 3FNFA 1AHHA 3KETA 2JCYA 1VI2A 3D3WA 4CL3A 2BI8A 1NHWA 3QWFA 3H8VA 2NQTA 2VT2A 4LSWA 3VOSA 3E9NA 1PWXA 4YPOA 3JD0A 4LISA 1GAEO 1NXQA 1JA9A 4RV9A 1X7GA 4I5EA 1MUUA 5T8KC 5JW6A 5A06A 4FC7A 3A1NA 2PD4A 3P7MA 1A4IA 2HK7A 2W2LA 1E5QA 1C1XB 1D3AA 2CDAA 4DIOA 3H3JA 1KIFA 4RVUA 2HKIA 3DOCA 4R1NA 1PGOA 3VVBA 3FCOA 1ENZA 2P9GA 5A5EA 2IE0A 3RIHA 3S8MA 4PVCA 4BKOA 3E5RA 1HYEA 4LMPA 3TRIA 3WNVA 4FN4A 5IN4A 3H2ZA 5JXWA 5TJHA 4OGWA 5KKAA 4NI5A 3TFOA 1IPEA 2NVWA 4E2YA 3DZKA 4HY3A 1F06A 1ZSYA 5COAA 1VJTA 1IUKA 3GEMA 3JQ6A 3ASUA 3ROQA 1YQGA 2W4QA 1D7OA 4HFJA 1YDWA 2NADA 2W98A 3WG9A 3NDJA 5I9NA 1N1EA 1KVTA 1IB6A 1PJBA 1R4NB 4J43A 1BWSA 3M6IA 3R3SA 4ONEA 4C7KA 5ICMA 4PG6A 3G79A 4OMUA 1NQTA 3WGQA 4NBRA 2FHSA 4YQYA 1WNTA 3AUAA 2VWPA 3P19A 4MDHA 4DLLA 2B4RO 5JAMA 3DBHA 5HS6A 3DHNA 3TZQA 2DFVA 3G1TA 1ISGA 2GN9A 4OSPA 5ILOA 1PTJA 3W6UA 2JD2A 1BW9A 2FZEA 1NP3A 2OOSA 1Z74A 1YL7A 2VUUA 3BAZA 1U4OA 3VH4A 4B4UA 3PLRA 4CUJA 4BS9A 1I32A 1C0IA 5DOVA 1X1EA 4HFRA 4UREA 1HWYA 3E18A 1YBMA 4E2WA 5B1YA 4BV9A 3LK7A 1JKIA 3BMCA 3IJRA 5HM8A 3TF5A 5L9AA 3MOIA 4NJMB 2DTXA 1PJ3A 2NUAA 1NQOA 4TQGA 1NVTA 1ULUA 1DXYA 4X54A 3RSHA 1IYZA 2Y1DA 2VYNA 3NUGA 4CMJA 2YFHA 4ZJUA 5C7IO 4BKQA 4UUOA 5TF4A 1GQ2A 2I3GA 4OQZA 5TGDA 3KTDA 2H1SA 1DRVA 1YWGO 1GD1O 5IZ4A 1F0YA 1E7MA 3LVFO 1E6WA 1ISIA 3ZCXA 2ZK7A 4RDHA 3T4XA 4YJDA 1LLQA 4DRYA 3JQCA 3PFFA 4AJKA 2IEBA 2GN8A 2BFMA 1E1KA 2H63A 3BTOA 4TMFA 3IP3A 5I9MA 3BA1A 3KZVA 3K9QO 5G4LA 3TZCA 4HKTA 2C5EA 2VHYA 1FXSA 5TRTA 2GCGA 4F3YA 5IDQA 4R5MA 1GADO 3C1TA 3BMQB 3K2EA 4XR4A 1EUZA 3U4HA 2O2SA 4B8ZA 4IMRA 4C7JA 4AJHA 4E21A 3LLVA 3ZU4A 3BMNA 3IKVA 1DJNA 2CZCA 3TSCA 5CPFA 5DP1A 2C82A 3BTSA 2X86A 1GYRA 2B83A 4FJ2A 3R6DA 4URFA 1RYEA 4YAJA 3PPIA 3K92A 2YY7A 4EEZA 4YR9A 3RBVA 4YVFA 3ABIA 4BNXA 3ZWWA 2W8ZA 4MOWA 2YHIA 2RBEA 4DQVA 3NGLA 3LC1O 4RL6A 3FPCA 2VCYA 1J5PA 4P8RA 4IDAA 1FDTA 3COSA 5L53A 4N18A 5A03A 4ESOA 2AEMA 3DB2A 4MJLA 3GN1A 3VZSA 4TRNA 5J9GA 4RPJA 4YJHA 1O94A 3TZHA 1NR1A 3HDHA 4CLDA 1EVYA 3P2YA 3NT2A 5A3JA 2J3JA 4FC6A 4L0QA 1GPDG 1Y9AA 3O26A 2VOEA 3SJUA 5CDGA 2NU7A 2CFCA 1E1MA 3Q2KA 3I6QA 4LVUA 3PRJA 3ORFA 3JQFA 1JVSA 1N7GA 3AM5A 5TIIA 1DLIA 3JQDA 3L07A 4I5FA 5EMHA 3WR5A 3RFTA 4BGEA 3INRA 4G5HA 4ND2A 3WOHA 4R9SA 3V5NA 4L4XA 2EGHA 1QR6A 2X5KO 2Y1EA 3LF1A 3FTPA 5TNXA 3JQ9C 1R16A 2VTDA 4S1VA 2X4GA 1XU7A 5JYDA 1PQWA 2I66A 3OA2A 3GGOA 4OL9A 1VLLA 2JCXA 2PK3A 1DFGA 2VYVD 2BFAA 3NTRA 3PHJA 4CM6A 5BSGA 5KJ6A 3DZJA 1N1GA 2P5UA 3ITDA 3M1AA 4NBVA 4B3IA 1OAAA 4O59O 2F00A 5I8WA 2CUKA 1GU7A 4BMSA 5CP8A 3HSKA 3DHYA 3HFGA 2B4TO 3TL2A 1PSDA 1ZKMA 3G3EA 4NFHA 1VKOA 2EEZA 1SBYA 1OOEA 4RZHA 1IZ9A 2WE8A 1T4BA 3ONDA 1DIRA 3CINA 5H82A 4BNMA 5KIAA 4CR8A 1BRMA 2FR1A 4NJOA 1PJCA 1YOVA 4IJWA 3BTUA 2Q2VA 3WLFA 2B0JA 4XR9A 4R4JA 2UVDA 4XGNA 4DPMA 2VRCD 4RPHA 1L7EA 3AW9A 1XQ6A 5IN5A 3DBLB 4PLZA 5BR7A 1C1XA 4E4YA 4J9VA 3ROPA 4N7RA 3I3OA 2P68A 3BYZA 4F46A 1QYCA 4MPDA 2AG8A 2PLAA 5JY6A 3ADPA 4JCOA 1PJSA 1E1NA 1LRLA 1H6DA 1NFRA 5TQVA 3S1LA 1GFSA 5C5IA 1H6AA 5B4UA 1PJTA 3RUDA 2I6TA 4FGSA 5GMOA 5ITWA 4ZD6A 3WXBA 3WYCA 2NU9A 3JQBC 5JC1A 2R6JA 5HA5A 1GL3A 3K30A 5JYFA 4RO0A 3U5TA 5BNTA 4ZQBA 2HU2A 4WLVA 4Q3CA 3K2BA 4W9NC 1HXHA 3QV1A 3GC6A 4L9RA 2NV6A 3WBFA 2QRLA 4DTIA 1NWCA 2YW9A 2EP7A 1U1IA 3RUIA 2G1UA 2UUPA 2LDBA 1N7HA 4J4BA 2VNAA 3KLPX 3W1VA 4E2XA 4BO2A 1QV6A 2DU8A 3RROA 4IINA 4DPKA 1HLPA 4AJ4A 4BO3A 3I5MA 1HDOA 3PVZA 3M1LA 4WPGA 4XYEA 1K6XA 4BQPA 3IJPA 1I3MA 2ZQYA 1E92A 3QE3A 3UOGA 5K0ZA 4CM1A 3K6JA 1P1IA 2IXAA 2X1HA 4K28A 2ZATA 1Y1PA 2JD0A 2B37A 4W99A 1E3JA 4NFSA 4YJGB 3AK4A 4CMHA 2HMTA 5CEEA 3PGXA 4UUMA 5HS4A 5A4DA 4ZQGA 1OZAA 4PLPA 1GQQA 3S55A 2X0NA 1H6CA 2UYYA 3I9MA 1GTMA 4R41A 2ILTA 5KOIA 1UAGA 2BGLA 2PNFA 4FFPA 4PZDA 2CMDA 1FMCA 3OA0A 2BFPA 4ALIA 3TQHA 2FY8A 2WD8A 1TI7A 2PWZA 3O9ZA 1MLDA 3WIEA 4RCVA 3TNLA 3ON5A 3D3EA 4L73A 3EY4A 3NEPX 5AXCA 4YAKA 2BFOA 1R6DA 4MVJE 4ALKA 3LT2A 2EW2A 4TSKA 1EK5A 1B8PA 2ZQZA 4AJOA 2E6UX 5L4NA 1XG5A 4II2A 1ZBQA 3T4EA 2UDPA 3JQGA 3WGYA 5AYVA 1NPTO 1LDGA 4J7UA 3TOXA 1UAYA 1BVRA 3PI7A 1LI4A 2PKQO 2DFDA 1VL8A 1XGKA 1MFPA 4IUYA 3WQSB 4IDCA 1DIHA 3ZV3A 3C8MA 3SLGA 3B1KA 1N92A 4A5OA 1GQYA 1Z75A 5TLSA 2DC1A 2J5QA 2PGJA 3MTGA 4ZQHA 2FPPA 3ZHYA 2FR0A 4Z9YA 4R01A 3U0BA 3U4CA 4L8VA 1HZZA 3VC7A 4R54A 5JPIA 4I08A 3RUFA 1TVEA 1MC4A 1DOHA 1E7RA 3CSDA 4WOJA 4GKBA 2OP0A 3E9QA 4GH5A 1PIWA 4DQUA 1JWBB 4NZ9A 4WKGA 3CUKA 4YT5A 3BTVA 3E9MA 4B7UA 1TT5B 3GHYA 1QYDA 1J49A 3O38A 4CR7A 3ZWXA 2AXQA 3INGA 3VH1A 1O0SA 1HF3A 3W4KA 2QYTA 4IS3A 2G17A 1K5HA 2A92A 1BGVA 3AI1A 4NQZA 1WDMA 3QSGA 1S6YA 4D0SA 4KDFA 3HDJA 3K96A 1T1RA 3F5SA 2ZYAA 1HDGO 2HMSA 1ML3A 3UN1A 3MCVA 3OQ1A 3C7CB 1E7YA 4BO5A 4EYEA 3N74A 3QP9A 4R9RA 3ANMA 4YCAA 1C0PA 1DIAA 3RWBA 4CR6A 1DRWA 1QXSA 1K0UA 3QVSA 3WS7A 4CM8A 3ZNQA 1PZEA 3VKVA 1PGNA 3ZZNA 1ARZA 1Q7GA 3U4IA 2WYWA 1VSUA 1QYVA 3GZ4A 3KV3O 4HV4A 3PYXA 3WYBA 3AY6A 1O6ZA 4B79A 3OSUA 2ZTUA 1PR9A 1F14A 1EK6A 3A14A 1RYDA 1T2AA 1RKXA 2NTNA 5JLAA 3OF2A 1H93A 1W8DA 4W6ZA 2Q46A 2O3JA 4CLRB 1I5RA 2E48A 3PP8A 2QQ5A 3EVNA 1I3LA 4CL8A 1ISMA 4ND3A 3PWKA 4CQMD 5A3VA 4FFLA 2YQ4A 4BGUA 2JCVA 1CEQA 2IZ0A 3DFZA 4O5OA 3OICA 5B12A 5FFFA 4XKJA 3GN2A 4J1QA 1QRRA 5A9SA 1AXGA 2ZB3A 3G1UA 5FWNA 3H2SA 1K6IA 4BNNA 1AGNA 1ID1A 2D5CA 2EWMA 2Q1UA 2BELA 2FMUA 3VPGA 3VPSA 4D3FA 5L40A 3OMLA 5ADHA 3U49A 1I2BA 5IZCA 1FDWA 3NDRA 2DBVO 2AEFA 3PWSA 3PQFA 3ZNPA 1YL5A 3LC7O 4OH1A 1ADBA 4I5DA 2Y99A 4BNLA 4CLOB 8LDHA 3CPSA 4GAEA 1SAYA 4R16A 4PLYA 3T7CA 3WSWA 4GVXA 1V3UA 3IUSA 4OAQA 4TVBA 1JVBA 3AY3A 3X2EA 5CHEA 2YV3A 2BGMA 2X9NA 1K2WA 2RHRA 1ZUD1 4OQYA 4Q3BA 3VZRA 4EUHA 5C37A 3QVTA 3KO8A 3DC2A 3RUCA 5CG2A 3V2GA 1BMDA 1SB8A 4LRTB 3LF2A 3WWYA 1J6UA 3FI9A 1Q0HA 3I4FA 1YVEI 1DO8A 4KUGA 1D4FA 1E6UA 5JNLA 1V8BA 3LU1A 4MIYA 4NHEA 4ND5A 1X15A 2IZZA 3E5MA 4PLHA 2BKAA 5FEUA 4W9NA 1ZXLA 5THQA 2PZMA 4A03A 3IDSA 4GSKA 5ER6A 3ZDFA 4IMPA 4LN1A 2VT3A 4J2HA 4JIGA 3VVCA 1NBOA 3QVXA 3F6YA 3ZWBA 3FHLA 4ZGWA 2VN8A 3IUPA 1NX6A 4CLHA 2G76A 1Z7BA 3FBTA 2OO5A 1PZGA 2FRDA 1RM5A 2XF8A 3KSDO 5KJEA 3JCZA 5IJZA 1PS8A 5LDGA 1LU9A 3ST7A 1NYTA 3MTJA 1UP6A 2I67A 3JQ7B 5EQDA 1ENYA 3FBGA 2DPHA 4BO1A 5GY7A 1YE3A 3H5RA 1IHXA 3MWDB 1WZIA 2PH5A 4MO2A 1WMBA 4EJMA 4XJTA 3KYBA 3L77A 1IY8A 3VTFA 2NU6A 3ZV4A 4BB5A 3JQAB 4XA8A 3NRCA 4QUKA 4OJNA 4DGSA 3H9EO 1UXIA 2NQ8A 2ZJ0A 2E82A 1HDCA 3CMMA 4H16A 3W8DA 2IDZA 3H5AA 2YV2A 2YV1A 5K6AA 2DLDA 4J91A 5G0SA 5KVVA 3ROMA 4IDGA 4OHUA 4PN3A 2IODA 4OKNA 2OBYA 4O63O 5B4TA 2O50A 1JTVA 5AVOA 3TZ6A 2Q1SA 1I33A 4YRBA 4RF3A 1EBUA 1R15A 4OXKA 1PJLA 5KTKA 1SC6A 1M6WA 4KTTE 4XIJA 3NAQA 3I9LA 3WQRA 3OIGA 5DP2A 4ALNA 1LLDA 4QX6A 2BHLA 4JN6B 4ZHSA 1GDHA 1HLDA 2YFQA 3QWBA 1YONA 3PHLA 5DOZA 2GR9A 3X2FA 1V0JA 3F5QA 4GGPA 4BB6A 4Q3DA 2ZB7A 3WGIA 1E77A 4J4HA 4BNUA 2Y93A 1VKNA 2EKQA 3ANNA 2NACA 4CMIA 5BT9A 1TT7A 1DLJA 3KLMX 4RPLA 2C2YA 3GHHA 1Q0QA 4XIYA 4DQXA 1VPDA 5T8KA 5HRUA 4IJVA 3WJAA 1NM5A 3PJDA 3FN4A 5B4VA 5THKA 2Y1GA 1XSEA 2RH4A 1U3UA 2JAPA 4Z0PA 2EKPA 1QKIA 2B4QA 2EF1A 2AE2A 1QYWA 1X0VA 5K9ZA 3NDIA 4YAGA 1M76A 4IDBA 3I1JA 4Y67A 5BNFA 1ZK3A 1C1DB 1NFFA 2POQX 1U3WA 3AY7A 4FFNA 1OFGA 2D8AA 3DAFA 4M49A 4PIVA 3OFSA 4GKVA 3AJRA 2C0CA 3I9NA 2VZ9A 1LTHR 4TRJA 4BKRA 2FZWA 1T2FA 4PG4A 3VPXA 4K9DA 3KHUA 4YACA 2YYYA 2V6MA 3NTQA 1E0DA 1AXEA 4I5GA 4Y6PA 1ISHA 1ONOA 3GT0A 3IKTA 4FIZA 3GUYA 2Q2QA 4Y9DA 1ZO8A 4Z3DA 1BXGB 2P9EA 1EE2A 4UVIA 4LVCA 1WP4A 2TMDA 3OM9A 4RVHA 4YJHB 2GZ3A 1A7AA 1ZCJA 1LDMA 1BXGA 1LJ8A 5IDWA 3RC9A 1E3WB 4B3HA 4CV2A 1SB9A 3ONEA 4XGIA 3B1FA 1I2CA 2YQ5A 3RC1A 3QWIA 1MG5A 4ZICA 4BKPA 4HFMA 1W73A 1VJ0A 4U0JA 4Z0HO 1GEEA 3TN7A 1S7CA 4HX5A 1KVUA 3ZWAA 5U4QA 1PQPA 1WDLA 3RFXA 2H5LA 3PYLA 3JSAA 1P1KA 4MIOA 2VOJA 4DBVO 3EK2A 2P4HX 2DKNA 4OM8A 2Y0DA 5GZ3A 2FN7A 4DC0A 3RCBA 4GX1A 1BG6A 3C1OA 4Z3KA 3GOHA 5F1OA 4RF2A 4UAGA 3ZH2A 3IMFA 4B8WA 2FPGA 3EMKA 1KC3A 5G4KB 1HETA 3LZ6A 3GQVA 3F1LA 5EERA 3F1KA 1YXMA 3B6ZA 3MJVA 2CF5A 3JQGB 1LUAA 2I76A 1CYDA 3A4VA 2ZTVA 3I4CA 3O4RA 4MP6A 4D79A 1O95A 2VQ3A 3HUDA 1UZLA 4TZTA 2P5YA 5HTOA 1IPFA 1RPNA 3F46A 3TJRA 1KEPA 3OIDA 4N54A 3CZMA 4UUPA 3L4SO 4J1TA 2G0TA 5DDIP 1PWZA 3GMSA 2JD1A 3HHPA 4GX2A 4U7WA 4XYBA 2CDBA 3ZU3A 1NAIA 5KWEA 4MKRA 3ETEA 5L4SA 4PLCA 1P1RA 1QG6A 2X5JO 1E5LA 1A5ZA 2Y1FA 4CMEA 1E7SA 3PDUA 1A4UA 3JQ8B 1QP8A 1EBFA 5DULA 1ZMTA 1WZEA 4J1NA 1PS9A 3WDSA 2OFPA 4J6FA 4JJGA 3RC7A 1SEPA 2DBZA 3OBBA 1GY8A 4I9NA 5IXSA 3MJCA 4FFOA 2C7VA 4GX0A 5AXAA 2HSDA 4NMHA 1QV7A 3GVPA 3JYQA 2GZ1A 4J7CA 1Z7EA 1H0KA 1P1FA 4EBFA 3OJOA 3UHAA 2O4UX 2GPTA 4AJIA 4M89A 3GFGA 4DYDA 3NX4A 3DOJA 5MGBA 5JYEA 1HSOA 3N7UA 3EVTA 1AUPA 2Q3EA 1B7GO 4FW8A 4B4OA 4DUPA 3V2UA 1SZJG 4ZRMA 4IQGA 2O48X 1QLHA 3AOGA 5U9CA 2GLXA 1QMGA 3HDQA 4YRAA 1OBFO 1UXJA 4BNHA 1YKFA 3ENNA 3DDNA 1ZK4A 1TA4A 4P4NA 2JKVA 2R00A 3H9JA 2J3IA 4IDEA 1NFQA 2RIRA 4OXNA 4E3ZA 3KYCB 1RM4A 1V6AA 4RF4A 3E8XA 5EPOA 5KCZA 1T24A 4I1IA 4N5NA 3PWZA 5TJ9A 1UP4A 5A5FA 2C7GA 4HP8A 4CMKA 4PG7A 4K26A 2O7SA 3GNQA 4XZ3A 3EZYA 3Q9NA 4AG3A 4IBOA 2EKLA 1R0SA 1DC3A 3CMCO 2QZ9A 2DVMA 3BHMA 4D3SA 1BXZA 3UKOA 4YT8A 1HE5A 1B2LA 5AXBA 3PZBA 1I2ZA 4XYMA 3R1IA 3ZWYA 3C7DB 5TX7A 3VHRA 4NNJA 5JDIC 2EW8A 4PLWA 1PX0A 2QHXA 4Z0TA 1JN0A 2WJPA 3I9OA 3TPCA 1T26A 2WYUA 3BHJA 4OKIA 4J16A 1LEHA 1BXKA 3GK3A 1O89A 2IYOA 3DOOA 4MVJH 2AE1A 2JFGA 3OHSX 1UXKA 2DUUA 4E32A 4KTVE 3GAFA 3M2TA 4ZQFA 1XU9A 2P9CA 1ENPA 4OYRA 4ZQEA 3KM0A 3ANLA 1BDBA 1Q0LA 3K73O 2AEJA 3LDHA 3QIVA 4Y6RA 1EQ2A 4BOYA 2HK8A 1CRWG 3ZI0A 3DONA 5T6BA 4CM9A 3DTYA 3LLSA 2JJYA 4MVJM 1B8UA 1YH3A 1B0AA 3IOYA 2QRKA 2I99A 4KWIA 2WM3A 2PFGA 1W0CA 2ZCUA 4EEXA 4EJ6A 4MVJF 3OETA 1I36A 3PLNA 3Q9UA 2Q22A 9LDTA 1LRJA 3MJTA 4CMGA 3EGOA 3WGZA 4BIIA 3GVIA 1TB4A 2GRAA 4PZCA 1GCOA 5IDYA 3JYNA 4H15A 4Q3NA 2FR8A 4XCVA 4U0KA 3WYEA 4EITA 2P4QA 4W82A 1YJ8A 4CJXA 1GEGA 4Q39A 1ZFNA 4WNIA 3LYLA 2Q49A 4JBGA 3LT0A 3FPLA 3H4VA 3HE3A 4XYGA 4AJEA 1MXFA 4FJ1A 3ZWCA 3IC5A 2OMEA 3KYCA 4LRSB 4IM7A 3MJSA 4BMNA 5IZCC 1A27A 1KYQA 2D0IA 3H3FA 1G0OA 2J5RA 1WW8A 3OQ6A 2BRUA 2GSDA 4KUEA 4LW8A 4ND1A 5I9LA 1ZK0A 4F6LA 3CTMA 1KC1A 3F47A 3WTBA 4AL4A 5ENVA 2B5VA 3UICA 2VUSA 3D64A 1XDWA 4R1SA 1ZW1A 2CNBA 2Y68A 4YQZA 3SX2A 3UFXA 2EIHA 4W4TA 1NVMB 2CY0A 1U28A 4D7AA 4DVJA 2RH8A 4E5KA 1D1SA 4PG5A 4I9HA 2PV7A 1GV0A 1KETA 3ZGYA 3RUAA 5EN4A 5U1PA 4XQ9A 2HJSA 5CFZA 1MC5A 1K89A 3TZKA 1KEVA 2GN4A 1ZK1A 2V6BA 3F3SA 5JCXA 4FBGA 1ADCA 3RKUA 1CIVA 4A26A 3KVOA 2PZLA 3RU7A 4MVJP 3WWZA 1PU2A 1FDUA 4J0EA 1I01A 2O3QA 1YL6A 1EZ4A 1PL6A 4D41A 2AQIA 3JTMA 1JQBA 5L7WA 2CVQA 2DPGA 2Z1NA 1NASA 4OXYA 4BHTA 3FR8A 4RPGA 3PHIA 4CM7A 3GNSA 4RF5A 1HE4A 3ADOA 5MDHA 3DQPA 3LT1A 5B37A 3ZWVA 5IG2A 1U7TA 3GVHA 3H9GA 3V8BA 4JX8A 5DT9A 4GWGA 5EESA 1Q7CA 1TLTA 3GDGA 3UCXA 3WMWA 4YJFB 4YYZA 3ZU2A 1U3VA 4AVYA 2JHFA 3ZW9A 4QXMA 3PJFA 3LQFA 5AOVA 4E31A 4HNGA 1HE2A 4LGVA 1MB4A 3UGKA 3GDFA 1UZNA 1DIGA 1PQUA 2CF6A 1CDOA 3B20A 2PKRA 1JU9A 3I23A 1QSGA 4D3DA 4GWKA 1T2DA 1Y9EA 2O3UA 3OIFA 1ZIDA 2PTGA 2I9PA 3TFQA 4EW6A 4KQWA 3GZNA 3A06A 3ENKA 3AI2A 1DC4A 2HLPA 1KBZA 2X0IA 5C7OO 4JBHA 3TL3A 2AW5A 4E6PA 3KSZO 4IIVA 4IDFA 1UDBA 2Q1TA 4CMCA 3LT4A 1IE3A 2C07A 3DO5A 1RM0A 3RUEA 2AQHA 2WD7A 4JROA 4GL4A 5JBIA 2B36A 1LDBA 2HDHA 5JE8A 3SJ7A 4EUFA 5DCYA 4FQ8A 3C1AA 1DSSG 2WD7B 1D8AA 1K6JA 2HMWA 3PGJA 4IGFA 2NVUB 4ZU3A 3RVDA 4LSMA 1GZ4A 2V6FA 1N9GB 1NHGA 4UVHA 1C1DA 3F9IA 4F6CA 1MG0A 3CXRA 1NPYA 3Q6IA 1LDEA 1G1AA 4RJTA 4CMAA 5JAIA 2VRBA 1P0CA 3CH6A 4LCEA 4M54A 3A28A 3JD2A 4J49A 2ET6A 3MWEB 4WCFC 3VZQA 2PKQP 3AWDA 4FS3A 4YXFA 4JLWA 2A4KA 4GX5A 4GPD1 1VC2A 1IZ0A 4G81A 3L0DA 8ADHA 1NR7A 3DZFA 1DEHA 2NWQA 4P22A 5GZ1A 4PLTA 1LX6A 1ZK2A 3BMCB 4KP7A 1P1JA 2WDZA 5G4KA 3HDYA 2W2KB 3NTOA 3GVCA 1Z45A 5ITVA 5CEFA 4YWJA 5IFLA 2GF2A 4KOAA 1C0KA 1P44A 3EAGA 1MXHA 4TKLA 1E1LA 1GV1A 4Q3AA 3FWZA 3PQEA 3AOEA 3PJEA 3HFSA 4KDEA 4TRMA 1LSUA 4IJKA 4XRGA 1Y6JA 3I9JA 2X0JA 2XXJA 2WMDA 3G0OA 3WTCA 2G82A 4IGEA 4TZKA 2Y0EA 1EE9A 3I83A 5L7YA 1UZMA 2WYVA 2J8ZA 3ONFA 4LK3A 5T73A 1ZXBA 2Y1OA 5IDXA 4WCFA 1R0KA 2DUWA 1DRUA 2GO1A 3JD1A 4QEDA 2O3RA 1EFLA 1N5DA 1SNYA 2BF7A 4YRDA 1N8KA 3AUSA 3WB9A 3GEDA 4RPKA 1DDOA 3NGXA 4CM4A 4K1LA 5CDSA 1YBAA 5CDTA 3U3XA 3UCFA 1ULSA 4M87A 3ZHBA 3DZBA 5HBRA 2QIOA 4M8SA 5ILGA 2ZB4A 4QECA 3PK0A 3DL2A 2Q45A
chains in the Genus database with same CATH superfamily
3C15C 2CXUA 2VSNA 3MLEA 2Y71A 1NLZA 2EWWA 2HF8A 2HLNA 1H2XA 3FROA 4JXKA 1L4HA 3O1IC 2OXIA 4B4VA 1TO6A 2NSJA 3OC6A 5HWSA 3ISJA 1EGQA 4O4HA 2VH5R 2NNLD 1Y8QA 3UBMA 4NXMB 3V1TC 1GPLA 3I73A 1IOZA 1YB1A 3P9SA 4QXAA 3RSSA 3SSNA 5FI3A 3GJ3A 1YQDA 3OZBA 1F8YA 1RI2A 3WIDA 3O1JC 2ZSDA 5EHQA 1BQ3A 3IAXA 1RRMA 1PUIA 1M67A 1Y5MA 1W6RA 2AXEA 4CWAA 2ZIZA 1QDUA 2OUKA 5I6DA 5LNK6 2B6HA 2FUNB 1IZ8A 3ZW7A 1X1RA 1ZR4A 4FE4A 3VR6D 1OXBB 4HAXA 4G4IA 1GJRA 3VH3A 2YWDA 1XWIA 1MT0A 2QTMA 2G5CA 3GQBA 2G9NA 1BVUA 2PQ6A 2P2ZA 4KWTA 4Y2HA 3VDRA 3FVQA 5FLKA 4MLZA 4WXPA 3BXHA 5T64A 4EHFA 2OGZA 2WOOA 1OZGA 3D4OA 4LRXA 1OJ7A 4N0DA 3WLEA 3ORYA 4TT3A 2OGUA 3SSOA 3E22B 4RE6A 4DLRA 1ZC4A 2GN2A 4IH1A 5CT9A 4WCDA 5LQDA 2MTBA 3KQHA 1C7QA 3HCCA 3THOA 1XX6A 1UK7A 3QX8A 1GSAA 3NYQA 3HSYA 3LA8A 4QUBA 3VSCA 1XJCA 3WZ2A 1GGKA 3GI1A 5FI5A 1IBKB 4PSKA 1U81A 2Q2WA 3R0XA 4LJ4A 3OMXA 1P7WA 1T6BY 3H84A 3KR1A 1PYGA 4NK5A 4K0RA 1F4PA 4RCYA 2PE5A 1CIJA 4QPCA 1G8JA 4C5BA 1P61B 1ND6A 2Q99A 4TKZA 3UXYA 1FSPA 5DPMA 4U2DA 3W8NA 2GYVA 2NXWA 1SVLA 1CUJA 3ZZUA 2XXBA 1Y33E 2Z9DA 1J7KA 2BHSA 4NABA 5EUQB 3V42A 2K5UA 4ZVRA 1JHDA 1NL3A 1Q7BA 3UOWA 4DVGA 1O5IA 3FTFA 4L9SA 5GJVC 3WNCA 1PFQA 4I81A 1KKUA 2BHRA 4EJ0A 4MUJA 1NOKA 2X58A 3KB8A 4P31A 2H6EA 2BUBA 1THTA 2Z09A 3LX6A 1R6BX 3JASA 1DCFA 1NOIA 3ROEA 1Y8ZA 2OK7A 2JW5A 2BEJA 4C7VA 3W8FA 3OQNA 4PGAA 2WJWA 3KB1A 1WA5A 3QHAA 2PX2A 3VPFA 5BR8B 1PGQA 4N0MA 3EXFB 2GBFA 5AKYA 5M5BA 3R24A 4PPQA 3FFBA 1KAEA 4F45A 1H8EA 5EIAA 2DCUA 3A6PC 3PUIA 4E1VA 4K3VA 4DABA 2HGSA 5L3ZA 5BPHA 1ENOA 1GPAA 3HVJA 4QIHA 3RTEA 1Z68A 3QTTA 1N4AA 2E21A 1PR3A 1JPUA 5CLJA 2C4MA 4PCVA 5EC8A 5KJFA 3GLFA 5BSEA 1CQWA 3UF0A 3P5BA 3QJ5A 1P75A 4MW4A 1TMYA 1NQAO 1MNAA 5DBFA 1ZH8A 2ETXA 2PGLA 2BTEA 2R97A 3JQAD 4DR6B 2O8EA 1P31A 3N3AC 1YNSA 4EYOA 2WTXA 4Z7QB 3DFMA 2SICE 2Z95A 3C39A 2JLVA 1O57A 2ZW9A 4QU5A 2CLHB 3WKCA 1NW4A 1ZU4A 5HQJA 4QOJA 3ZLVA 5DM1A 4JOSA 4KR9A 3SAJA 5JNRA 2YS6A 1MQAA 1NMSA 3O8QB 4E5SA 1PL8A 5DSXA 3PU6A 2PT5A 5LBTA 1GILA 4W7HA 1RKUA 3UKJA 3JQ8A 1P0FA 2DQKA 2Q5EA 5AW2A 1TAUA 5FYQA 1Q3HA 1XCBA 2O0KA 1XDSA 1JU4A 2PVCA 3B85A 2EBWA 3VXKA 3W90A 5AHRA 3EYWA 3K0EA 4YMWA 3DYBA 4DTCA 2KS6A 4GVLA 2XNSA 3CUVA 4EIWA 1KSHA 1X7YA 2VHUA 3QU5A 2ZE6A 2YC2C 2Z8YM 3B70A 3BA6A 3QPVA 4ROTA 3FLEA 3HVIA 2W4IA 4D97A 4CM5A 5BYKA 5JCOC 4HXYA 1XC7A 4NPCA 3OEWA 1NULA 5L8VA 3C45A 1C9MA 3HO8A 5I7VA 2WTUA 2VUIB 2W70A 1UKEA 1XMSA 1TKBA 1HY3A 3H7AA 1ADFA 4TMKA 3RBZA 1W5SA 3ZHTA 2LIPA 1WPQA 3HJCA 1D2MA 1GKLA 2H5IA 1U9JA 2I8LA 4RIFA 1ORRA 4IHJA 1DC7A 4PAWA 1RJDA 3IUEA 3SVTA 1L8LA 1TKCA 1P9WA 3TSZA 3OOJA 3SIPA 3BIOA 4N8SA 3IIEA 1MAWA 3NHJA 5AESA 1CS0B 4PC1A 1QH9A 3FPBA 2NV0A 2NM0A 5D84A 5ALJA 2JI9A 1NXWA 1K63A 1R8QA 3L9XA 5CB0A 1FEZA 2FSGA 2GASA 2BGWA 2W2KA 1XTJA 1UWVA 1NBAA 1JF8A 2JBHA 1GUYA 5ECGC 3L1IA 1T15A 1RKVA 1X70A 5IS2A 3NZEA 5EEHA 3MZ0A 1KP9A 5SY9A 1IG3A 2WV9A 1Z56C 3HN2A 2VHWA 1QHNA 1S7GA 3D4BA 3KWMA 3LCRA 1EMDA 4XX0A 5EWJB 5TY0A 2PA3A 3C3DA 3P96A 3K8YA 1PLKA 4ZDIA 3ZD6A 3V1YA 1XU4A 5DWQA 1ZW6A 1KJ8A 1IJEA 3B2EA 1E6EA 1EHYA 3BHNA 3UV6A 4Z6KA 2EBUA 1HYHA 2UV8A 4KZKA 2ZWAA 4O4JB 5AOCA 4H3HB 2DM6A 3SC3A 1NQWA 2YXBA 4CN8A 3ZV5A 1UMKA 4JEUA 1UKAA 2IHZA 1V1JA 4G0ZA 5SY6A 3LLMA 1QQAA 2CHGA 5IWCA 3OH8A 4QWMA 5KOYA 2YCLA 3DYIA 3K1AA 3IAAA 4JJKA 3UOAB 2ZJ1A 4L4SA 5GJCA 3ZWPA 1B15A 3JVVA 2WHYA 1UC8A 3OJLA 1KR5A 4E08A 3VKWA 2RGUA 4Q82A 5K03A 2CCKA 2ZB8A 4M38A 5A0FA 4PNEA 5JCPA 3F6SA 1F2VA 1H1LB 4R83A 2G8NA 4XEUA 5LDDC 1OU0A 4U6SA 3UG7A 1L0BA 1OXMA 1PZMA 4PONA 4RFSA 4BLRA 3I39X 1HFKA 3MCUA 1X1TA 2X6TA 4G84A 3HZZA 1OE0A 4NZZA 4EG6A 5JXHA 2E55A 2XQJA 1E8NA 1N6KA 3ZDZB 5IU6A 1PS0A 1UOOA 4PHTA 2IXBA 2FPRA 3SYRA 1DFIA 2XGGA 4ER6A 2I80A 4WBXC 4RMJA 1I4EB 1JX6A 2X8BA 4DS3A 4DR3B 5JBQA 3JQ9A 4NZPA 4YMSA 3WADA 3OKFA 2NTJA 3RABA 5DZSA 2VXCA 1UK8A 5J2UA 1L7AA 1WOYA 3T5BA 1QVVA 3WQHA 4M99A 3E2IA 1Y1KE 3NORA 2G9RA 4LYAA 1TFUA 1W44A 1V16A 2H1LA 1J07A 5E4YA 3RANA 1NXSA 2YIJA 3DOHA 2GH1A 1CJCA 2AIRA 1WV0A 2JASA 3H9QA 4CCSA 1J70A 1A72A 4EELA 1QTQA 4LDQA 4IOMA 2VT6A 4QDKA 3HM9A 4DIFA 4TV8B 2Z2IA 2KX7A 1T36A 2RGNA 2Q6OA 1K9VF 2JGLA 4TQUS 2JFHA 3UMJA 2H11A 5KMGB 1VL6A 4EVQA 3D5EA 4DR5B 4N5LA 1ZUWA 4OA5A 4HLQB 5KOHA 4FP9A 3KJZA 3PUWA 4OHFA 5BMOA 3IAUA 4B46A 4K40A 1ZOIA 5I4KA 1VMDA 3DTVD 3H3XA 2GTHA 3DLCA 3JYLA 4YFVA 1N34B 2YFYA 4UEWA 1NKVA 5DF1A 1E2UA 2OHFA 1D8TA 1KGDA 1RKQA 2MSLA 2ZYVX 3IVGA 4HDRB 4M55A 4R1LA 3UJAA 3WLKX 4GKKB 3OTGA 1DAPA 3AU9A 4PQFA 1JWAB 2HUNA 1X7YB 3DDHA 1R74A 4ZVVA 1K5PA 1RCFA 1QH1B 2IYXA 5CUQA 3E1KA 1BSVA 3OD5A 3KSRA 3U9LA 4CNBA 4ID9A 4WAUA 1LF0A 4W8OA 4NX2A 2OV6A 1EWYA 4G9BA 2GKSA 1X8KA 2VWGA 2WD9A 5EHZA 4BNTA 5LMNB 3T7KA 1DQNA 2C8JA 3GVXA 7MHTA 2F3SA 1Q83A 2PTHA 2RJOA 4HS4A 3S29A 4C88A 2B35A 4OQQA 5HMMA 5H4GA 1JFRA 2QN3A 3LYUA 1ISPA 5TQ2B 3TQIA 4HVLA 5DHQA 4QODA 2DYKA 2ZR7A 2YVLA 4INAA 4FXPA 4K8RB 5FLEX 5G0VA 3T5PA 2YR0A 2OUIA 4YI5A 5ADUS 4QRIA 3I5YA 4E07A 5F4BA 4KRYA 2QUBA 3SM3A 2FPGB 4K05A 3DKPA 3DQZA 2FPNA 1PVVA 1WCWA 5HF8A 2KI5A 5DW3A 1MIOA 4WKPA 2FWMX 2CJFA 3QRWA 1R37A 1FP1D 1XEFA 3CJRA 1IK4A 4O3FA 3H04A 3LFTA 4C1NA 4HB0A 3H0WB 2WYOA 3ND6A 2H65A 4KXLA 4XGQA 5DCLA 2VDWA 1WMEA 2FEWB 3ESRA 3OCWA 4MA4A 1CY1A 5DTMA 2PUEA 1QO0D 1ZQ1A 2DMRA 4QYWA 3TUTA 3E7FA 3F6RA 3HB5X 3K16A 2C59A 1SRRA 3IAM6 1Z12A 3DWGA 4DDKA 1FRQA 2OCDA 3MUNA 4MQUA 3G2KA 3PDJA 3FGPA 3WKEA 3BMOB 1E7QA 3T5DA 3OMWA 4HK4A 4F9FA 1N6IA 2VZ0A 5FWXA 3PJRA 2XB8A 1IRIA 2FF7A 1BE0A 1DKRA 1P45A 1R0YA 1YOVB 1YZ3A 4O5AA 4D0RA 5H9WA 1ZR2A 2FX2A 1JR6A 4QL3A 3GT4A 1M7HA 5JQGB 3PUKA 3WYGA 1E1RD 1KO8A 5E7IA 1LCIA 1HEIA 2ZIXB 3CX3A 5LOVF 3NIBA 3VDNB 2W6IA 3VC1A 4L74A 1PX2A 1YC5A 1C0LA 1QVZA 3DWFA 4XLTA 1J2EA 3ANSA 1ONNA 2DUNA 4M86A 5A71A 4UE3S 3ZJVA 1ICIA 3NAMA 3KS9A 1ZJZA 3HHEA 1X13A 1BOFA 1VOTA 2YHIB 4OU4A 3TW0A 4NQRA 3K6SB 1WHTA 1XN1A 1PRYA 2UZ1B 4ZC1A 4MUIA 4ZKDA 3F5FA 2FPKA 2EZUA 5I3CA 1YIDA 3OPYI 2XOXA 1JSCA 3CKMA 3HYRA 1L2TA 3OE7A 2A7XA 3QPCA 5DGTA 1FL9A 1G7TA 5KWIA 4RJLA 1KJQA 5KTYA 3U7FB 1BDMA 3H9UA 2OWEA 4FDTA 4RLSA 1SC1A 4ZO4A 1NBME 2GD1O 1EJ0A 4PZPA 5K3CA 5ALPA 5BSKA 2FWRA 2QD5A 2R87A 3KT6A 4OUDB 1FNBA 1UC5B 3ZWNA 4K8OA 1LSJA 1Y81A 4UARA 4TWBA 1J2UA 2R7NA 3TTSA 4BL5A 3D0QA 2OBXA 2XI4A 4X7PA 5JFGA 2F1RA 4MLCA 1PUXA 4MARA 3ROXA 3RC2A 2NTEA 4YB8A 3DEYX 4BYGA 3RAFC 4IUBS 1T2EA 4GICA 4J1SA 4QOIA 2ZSKA 2OENG 4M21A 1GFWA 3ZVKA 3SYLA 4Q9JA 4LGCA 4RK7A 1VL0A 3UB4A 1H2BA 3DMPA 2AYZA 4G0UA 2GBIA 2AZDA 2BD0A 2OY0A 2NZXA 3MFQA 4MKZA 4TKUA 5FHQA 4U8GA 2YASA 5JY1A 1YUMA 4QRHA 2IL1A 1N8SA 2FQQA 3KOUA 4QULA 4WUTA 1WHSB 4XEHA 3DEIA 1HT0A 3L18A 3KGDA 4QO7A 3NCTA 2GNPA 3DKIA 3EDCA 4M46A 5BUCA 2PT7A 4PCAA 2PKWA 4E1BA 3EN0A 5EZYB 3OT1B 4J90A 4L51A 4ZO8A 4A27A 3LD9A 3BK7A 2ZTHA 3WL6A 4DADA 5DRYA 2Q4BA 4EKYA 2CSXA 5DBEX 4J4TA 1LWNA 4Z4HA 4Q4HA 3C4QA 1TCCA 4BNGA 3JQ7A 3W77A 2A14A 4ZZIA 4HUQB 4JDUA 2IPMA 4ZAYA 4BO6A 2QR3A 2ADFA 4N0EA 1PHPA 2F1KA 1P2SA 1TD9A 4JT8A 4R6XA 3TK1A 1YAJA 1TQ4A 2Z5VA 1JEQB 2Z8XA 3JWJA 3L7JA 4BQFA 1LC0A 2YL2A 3PDCA 5D5PA 1B1CA 3MT7A 5AVSA 1CETA 1QPGA 1PFWA 3FSRA 1FJHA 1L4MA 4KE7A 4EGAA 2JCSA 1SBIA 2Z0MA 3IQHX 3CJQA 1JAYA 3M6UA 2H2HA 2GGSA 3CPHA 5DNUA 5JSFA 4NJMA 3K5PA 1IHUA 2DFPA 3BJEA 4XSVA 4H60A 4C0BA 1G64A 4GSLA 5BSFA 1IMOA 1P2GA 2FMKA 4UJ3A 4MQ4A 2ZCVA 1UT6A 5D87A 3FG9A 1LLUA 3B1VA 3Q7EA 3PEVA 1ADGA 1HLFA 1RAEA 2N3ZA 4HC4A 3SU8A 3L8YA 4MVJG 1M34B 3EZNA 3NONA 4HMOA 2D4AA 1QZ3A 3V7YA 4BASA 5BYJA 1U7ZA 4AZ0B 4IWYA 1E66A 1VLZA 1QYXA 2A0XA 2QUZA 3HKCB 4PLVA 5F7ZA 5KJCA 3IVCA 3LSYA 4OJKA 3FRIA 2A7QA 3GPBA 1D1TA 1LPBB 4TRRA 3I53A 4G1BA 2ZJ3A 2Q0QA 5HJEA 3X1XA 2O8FB 4TV9F 4WXRA 3DCYA 1FPMA 1WCXA 3Q40A 4NDAA 2AKEA 1I13A 1WU7A 3E2MA 1RWPA 1BX1A 5JMWA 2HBYA 1MMFB 3TGLA 3RFVA 4EZBA 4CM4B 4AJ2A 5KSYA 2Q4TA 2JVKA 4O2AA 3W5VA 1M6EX 4XDZA 3OPQA 2FMIA 6YASA 1NURA 1V16B 2YHUA 2C9OA 2PR7A 1EP3B 3NHWA 3VVMA 4EA7A 3HABA 5JDIA 3CLTC 4U5QA 3UHFA 1N32B 4Z4IA 3TDKA 4MYTA 1NVVQ 4WACA 3S2ZA 2KHZA 4HB2A 3GFBA 1JZTA 1L5OA 1EXDA 1N36B 4C03A 1JL3A 1YQEA 2RHCA 2VAVA 2IOQA 1AZSC 3Q7SA 2HUPA 4I99A 4RGQA 1DHRA 1FFCA 2RGNC 4YDRA 1TF7A 3PE3A 4HLDA 1CBUA 1MHTA 1MOQA 3LQYA 3OECA 3ONVA 2WE7A 3P8ZA 3DEJA 1Y7TA 1C14A 1T34A 2OP1A 5J23A 1N6NA 4H18A 5IVPA 2IA5A 4NCIA 4PEVA 4WLFA 4IXNA 2ZBGA 1E0JA 2FFBA 2HSWA 4GR9A 3NHLA 3JALB 3IQDB 4IR7A 1UQRA 3ADBA 2EZ8A 2H08A 1XZCA 4X8LA 4XFDA 1ODSA 3WBBA 4C14A 2RGWA 1DXQA 4ZYYA 4WGGA 3N07A 5IM4F 2QRZA 2JFWA 1VG8A 1AV7A 3GG9A 2PZBA 4XWOA 5CYGA 4BP3A 5FTKA 2V59A 3MCWA 3PJGA 2GTIA 4KYUA 3LW8A 3SOZA 5K99A 1J0DA 1OBVA 1QHFA 4YRLA 1E89A 4FFRA 1BCSA 1CE8B 2F62A 3QBEA 4XIIA 3ZWDA 4JP2A 4JBLA 4BU0A 8ATCA 5D00A 1Q7RA 4WH0A 3DLAA 3EGDA 3FCXA 4G85A 3FNGA 4BNVA 3M4YA 1B0UA 2GDZA 2L42A 3DJYA 1U7HA 3PHGA 2WIBA 3IDAA 3GFRA 5EL0A 2PYDA 3U3JA 3U3OA 4NU6A 4L4RA 4U00A 3S2FA 3I61A 4E5VA 3DDWA 3NHUA 4TUYF 1ICEA 3FTQA 1WSWA 5J4YA 4K6FA 2FSVA 3OWHA 3QMPA 3ZHUA 2XMPA 2WJAA 1OROA 4X1YA 4YYEA 1T0HB 4BWYA 1RC8A 3VZBA 3A31A 1N9KA 5K8LA 3SE0A 2WU3A 1E3DA 4IXMA 4LHXA 2C78A 1PT6A 1LPAB 4QATA 1O8BA 1ZVKA 2AXPA 3KB6A 3OFJA 4MCHA 3GXBA 5MFPA 1BGWA 4BXOB 1TYDE 1QS0A 3LO5A 1DPGA 2FLKA 3QX9A 1M8JA 1NU8A 4YS6A 5AKLA 4MP8A 5DHRA 2C9ZA 5TT1A 3EOBI 4A8JB 2QD1A 5K45A 2C9BA 1HRDA 1U6IA 2VG8A 1LNQA 2WSBA 1GWNA 4KAAA 5J43A 2WJ4A 2DKFA 5CCEA 3ER6A 1IVYA 3HU1A 3UGTA 2W2OA 3RK0A 5ITZA 1ZUNA 4TN5A 3WVNA 3K31A 1O0CA 3GR6A 4R3NA 5DLQC 1KVRA 1V9CA 3NRBA 1P6XA 4GZLA 4N4AA 4R9NA 3W8RA 4DC1A 3O0DA 3FE2A 1FJ2A 5E1DA 4PX5A 4FX2A 2HL6A 2PKEA 3LBFA 4J8PA 5FV4A 2P9TA 4Q18A 1Z7WA 5TB5A 3W6NA 3SFZA 4HVTA 5E3IA 3JZIA 4BQOA 3O6VA 4M7WA 3KDAA 4DF3A 1WMFA 1DJPA 1FDIA 2BR4A 3W2EA 1A71A 4BMDA 2AOVA 1Z34A 5IK2A 1L8OA 3WLOA 3LE8A 1JEAA 2H0QA 1VG0B 3UVEA 3ER9A 1JDJA 2P9JA 3VSEA 2HV9A 1IEXA 3OJEA 2VJNA 4H4CA 4P5DA 2V3CC 2PQ2A 4UHCA 1FPQA 5LU9A 4RS3A 1Z6YA 3F6BX 1X92A 3FCCA 3KEOA 3R6TA 4EJFA 1LLCA 1A9XB 1U0JA 1GN9A 2D5AA 4RQTA 2I6UA 4MVJA 1G5QA 4EYQA 1EP2B 1OYWA 1TTTA 2BKEA 1HZZC 2CJWA 4P3PA 3TINA 4XI9A 3DFUA 3O8QA 3PSAA 4WBSA 3EFBA 4R1MA 1T8YA 1Y9JA 1WZCA 2QMUA 3VYRB 1O8CA 3BDVA 4HJXA 1D0IA 1E9BA 3TH5A 3AU8A 3L5KA 3VAZA 1E3EA 2SCUA 1CERA 1LBHA 1PK8A 5K8VA 1I8TA 2ZIFA 3UK2A 2HMUA 2LDXA 3GJYA 3EG5A 2W6JD 4MROA 3VR2A 2X5OA 4TVSA 3T5AA 2O0HA 1ZH0A 2NT3A 4MDFA 3PLAE 1RP7A 4CG3A 4DZZA 2JGJA 1CZLA 4MRVA 2R8RA 1RM3A 3ESCA 3ODGA 1V8OA 5AVZA 3W2GA 5HQTA 3VGJA 2BSXA 2NXCA 1SC4A 3GGPA 3MIIA 1I94B 4QDOA 2ZR9A 5EGNA 2XKBA 4XGKA 1WKVA 2FNAA 4KEAA 5EP4A 4QZVA 1IIRA 1TEHA 3SFVA 1E3LA 4H7IA 2BTOA 3NYWA 3WE7A 3BAFA 4RUKA 4CUZA 4ZI2A 2CB0A 1VPEA 4MUFA 4OB6A 1L5LA 1TJYA 1Z28A 4DILA 1DZ3A 2XCRB 1PEYA 2IITA 4K6GA 2IHBA 1WO8A 1AKTA 4RZ3A 4DLBA 4PRLA 5DNCA 3ZCSA 3UCEA 3Q7IA 3PHBE 1HG0A 1MX3A 2RHOA 3TIVA 3R7AA 4L2IA 2AKAB 1S8NA 4NMWA 3FPEA 2JF0A 1XKQA 5AQ1A 1J23A 1WABA 4X85A 1YBVA 3V8VA 3GEEA 1PNVA 2GOYA 1RQNA 5F4ZA 1TJ4A 2P3SA 4C0HA 3ZDEA 1VLJA 5AM4A 1UPBA 3BE8A 1UDAA 2IOHA 3JZAA 2LWIA 3EXHC 2OHGA 3K8OE 4ALMA 1OMOA 5BW4A 2IF0A 1L4UA 3R40A 3M49A 3OJ0A 4RTOA 4NCBA 3B6JA 2C9CA 2HCRA 3BSYA 3H42B 3L8EA 4AY3A 1U98A 3PUHA 4EY8A 1J99A 3DZHA 1V37A 5KVCA 1MPXA 1JLLA 1NI5A 4Q0MA 4U1RA 1ZD4A 2OZVA 3UUWA 2QAGA 1R0CA 4E12A 1J8DA 1HDIA 2V74B 4ZHQF 2X7HA 3K8ZA 3JD4A 1E63A 4M0PA 4JUDX 4PICA 1IZYA 2PUAA 5F21A 5G0UA 2BGGA 1WF3A 3LZDA 2GFQA 2OBNA 5CYFA 3DCNA 3QG5A 1LWOA 1N4DA 2LBPA 2WU1A 3LM8A 2LKCA 2Q29A 2XUOA 4OA8A 1NNSA 1OX5A 2IJGX 4JEIA 2XCTB 1RP1A 1EJ6A 2QJTA 3GL9A 4HAUA 4BGIA 2VYCA 2FU5C 4C5CA 1R66A 1DEXA 3WBJA 1Y1RA 3K9FC 1M0SA 3E61A 2ZXFA 1VCMA 3H2GA 4I6EA 2EJWA 4DRXA 2D59A 4IX9A 2IEDA 2R68A 3HB1A 4GXQA 4P4GA 3RVMA 2WF8A 1J90A 3O8DA 4H08A 2HWYA 2PD3A 1FFBA 1GHTA 3AKDA 3LPAA 4TSFA 4BO4A 2CCGA 4XIFA 1LJUA 2DR0A 5JYCA 5DJ5A 2CD9A 4H0FA 4KWHA 5D3QA 2YWFA 3M6VA 5AM2A 3W1WA 3DP9A 1XJ0A 1XI2A 1UPTA 2VJOA 4GBGA 5JCJA 1B1AA 3URMA 5JAUA 4U6NA 3HACA 5DBGA 4G24A 3MWGA 5DYGA 2VWQA 5EINA 1W35A 2ZXEA 1U5BB 3RWMB 3EWSA 3IEIA 1W75A 2QI9C 2WLTA 4MINA 4WEOA 1PDOA 1WMDA 2QPLA 3KPVA 3OPVA 2QIPA 3RHZA 4B0OA 2QLTA 3TXXA 4Q93A 5CNIA 4F9EA 5LQUA 1FLNA 2H06A 5B3AA 4C5AA 5JANA 3AJ8A 4B87A 2FEOA 5I9TA 1R5NA 3X1WA 4Q5IA 1QGUA 2NT4A 1YZQA 2J5XA 5AVKA 3O0TA 3SC2A 3VR3D 3A9WA 3I9KA 1QKJA 1XWWA 2CUZA 1OI7A 2I8CA 3C85A 3JALA 4WE3A 4B4DA 3H2HA 5KTPA 3SN6A 4TQAA 1OREA 3JQQA 3Q6NA 3QVOA 4ENQA 1GKIA 4ITUA 5AM5A 1ABBA 1O95C 2VWHA 4MAMA 1SUBA 1TTPB 4FBMA 4M4SA 4JBNA 1TZCA 1X7DA 1GZ7A 1PT8A 2GWRA 3BKWA 1K7FB 4CQLA 5LL6P 5ARBA 1O77A 3KELA 4ZEXA 4O1MA 4P3XA 4BVHA 3Q11A 3VPCA 1M8FA 2C77A 4CMEC 2QTLA 1INLA 1P74A 3AUXA 1YI8A 5A4JA 2RHJA 1OTYA 1G6Q1 3GH3A 4FOOA 2IS2A 2IS4A 3ZYZA 2OFXA 1I9GA 2OZEA 4BJHB 4B3JA 1UPAA 1HPLA 3GDOA 2GPWA 1NPDA 2EJBA 4UUNA 5EYPA 4B74A 2A9RA 1XVAA 1FJGB 2QENA 1ZHFA 4HEQA 5C32A 5AQEA 1I10A 2WUWE 1DT3A 4G1VA 2FOIA 1P6UA 5KHAA 1MDBA 5A6VA 5HF9A 4Y9UA 3OFVA 4UDYX 2PNJA 1IG0A 1M1YE 3SMVA 2R25B 1C7JA 4X7MA 5D01A 4DSOA 4R68A 1OZ0A 2VK1A 3OLYA 4LJ6A 1SURA 2WWRA 4X0EA 5FPPA 1TJ5A 1KEWA 2BR3A 3UW3A 1G1MA 2X14A 2GEBA 3DTNA 4RIGA 4V0OA 5DEIA 4B45A 2Z4RA 2ZU0C 3KEGA 4XDYA 2I4NA 1XZNA 1DQPA 4H7KA 4N9WA 4LDJA 5I9SA 2C1XA 3ZZMA 2IY9A 3JVIA 1NIPA 1UFQA 1BMFD 2C7BA 3SX4A 2JCYA 4JYZA 1OUMA 2FLVA 2WF9A 1TGVA 3K4QA 1VI2A 1XD2A 2XY4A 4L3OA 3UJHA 2DG2A 2BI8A 4XD7A 5AM0A 2I78A 5MHTA 4ZHQA 2HCFA 2M1ZA 2NQTA 1JUDA 3H8VA 4EL5A 3HJTA 3RWOA 1CUBA 1RYFA 3C3BA 3JSXA 4LISA 3VVLA 3LHFA 1RMTA 1K8QA 1GNQA 2VXBA 3PL1A 4RV9A 1A5AB 2QAGB 3STWA 3P45A 3QE2A 5JHHB 1IPHA 1TD1A 4B40A 4TLLB 2W2LA 3UMCA 1VRCA 4RVUA 2HKIA 1DWUA 2QM0A 1PZNA 3ENWA 1TKAA 4DT1A 3U61B 4ZJYA 5BN3A 3C5EA 2IH2A 1CNEA 3E8MA 1QNLA 1UBGA 4KN5A 2IE0A 4TTJA 4OXQA 4MW1A 2RBGA 2XYRA 1NXPA 3E05A 1HYEA 1G9SA 5ALGA 3IWCB 4FN4A 4FMCB 1V7QA 4B81A 3U13A 5TJHA 4OGWA 1D2RA 3G2HA 1WTAA 4GWLA 1SKYB 1PSZA 3IA2A 3V6MA 1IPEA 1N75A 3DOUA 3KVNA 4BDTA 1GZDA 2EFEB 1F06A 1RQPA 4KIFA 5IW8A 2PXHA 5HPYB 1CEYA 1IOWA 2P2CA 3ASUA 1S2DA 2QSZA 2CC2A 2H48A 1FVXA 2W6CX 1JG3A 5DI9A 1YQGA 2F9FA 2Q28A 2XJ4A 1SXJB 3AEZA 2W4QA 3PKIA 4Q01A 4ARAA 3K0CC 3QE9Y 4LF8B 2EP8A 2NUPB 4FKZA 4Q1CA 1E4YA 2XUDA 3KQYA 1NI3A 1R4NB 1PG5A 1YOBA 3R3SA 2ZLBA 5IKOA 4C7KA 3HA2A 1UF9A 5ICMA 1H0SA 1UM8A 3PS9A 4KXMA 1NLUA 4NBRA 3WGQA 1UJ5A 4YQYA 4EFNA 5C1PA 3N0TA 4LBZA 2VWPA 4OCZA 3P19A 4MDHA 4DLLA 5JS7A 3H19A 1EB8A 1YZGA 3AF6A 1JSRA 1ORIA 3P94A 3K5HA 4GQBA 2AOTA 4ZAFA 2IU0A 3VBEA 1J00A 3EVBA 3IAS1 1URPA 4JLUA 5AK4A 2I4IA 3NM5A 3GZJA 4RH0A 4WFQA 5ILOA 3R3WA 1FX0B 2X2EA 3W79A 4AY6A 2QVBA 5C52B 3HXLA 3U4GA 1YVUA 3GOQA 3UJCA 4CUJA 2WINI 621PA 1OGIA 2IWRA 4F6RB 2IH4A 2VTBA 2JK0A 2JFUA 1C0IA 1M72A 1X1EA 4IEFB 1AY0A 1OLOA 3H1EA 4Q05A 1HWYA 4N47A 3SYKA 3UJ6A 1QCYA 1R64A 1IDOA 2Z04A 2OCIA 3QE4A 5FUYA 4F5WA 1QGZA 4NJMB 4TVKA 3CH7A 1JA0A 3SPXA 4GM0A 3WGJA 2FWJA 3FUXA 4ARVA 3QSYA 2WM8A 2OCAA 1NVTA 3SMQA 3RSHA 3OOYA 4X54A 5JT1A 3OCUA 4PCLA 2EZ9A 3NUGA 2R96A 3NQ41 3TB4A 5LQMA 4JUCA 2YFHA 1T5TA 5C7IO 2LCQA 2QAGC 5TF4A 2PMKA 4CZ2A 1KEZA 1KR2A 3G5AA 3IQIX 3OPYA 3WL5A 3ZVNA 2HHHB 3WLQA 3CNNA 1T13A 1DRVA 1ZHHA 4L5BA 4DRYA 3ZCXA 4RDHA 2C5GA 3RQIA 3UTDA 5CIQA 2PRSA 1QBGA 1IVNA 4TMFA 3IP3A 4EMBA 3LUKA 4B2YA 1IQPA 2J9XB 2R8BA 1N2OA 2YY6A 3K9QO 5G4LA 2VHYA 1FXSA 4ZEWA 4RQBA 4F3YA 4OPMA 5EE0A 4CI0B 4R5MA 8ABPA 3K2EA 1Z22A 1K0FA 2XJ9A 3OZUA 4RYLA 3BK2A 1U9IC 2NYRA 3U4HA 4JVMA 5IAOA 4LKOA 4NULA 4F04A 3A58B 4C7JA 1W36C 3OO0A 4E21A 4FUQA 3BMNA 3GJRA 1LVHA 3AGPA 3H1PA 1CZKA 1DJNA 2GZAA 3IKVA 5H3CA 4J1TC 2JBAA 2Z2JA 4FE7A 3EEOA 2X9QA 5EJEA 5MN6A 2X86A 4UHKA 1GYRA 4IOJA 1U0BB 1Q3KA 1W36D 3A6FA 5CA1B 3NHKA 5AWFC 2C4UA 2H4FA 1RYEA 1XCLA 2WT8A 3MHPA 4YAJA 1CUDA 1F6DA 2PIDA 2W6JA 4UDXX 4ZVTA 4YVFA 2A6PA 3ABIA 3K1YA 2Q0XA 3R9WA 1YASA 1UMCA 4DQVA 1K97A 2I2XB 3NGLA 1II8B 5K3SA 4RL6A 2WVAA 3CX4A 3FPCA 1J5PA 3G5MA 4IDAA 4MI6A 5L53A 3HXOA 3RTGA 4HVCA 1PKEA 3GLGE 3T1TA 5DB4A 1ZQ9A 1QTRA 1ESMA 2GZDA 5DWVA 4MJLA 2B1IA 4HEA6 1G2IA 3C41J 3EPRA 1CEXA 4YJHA 2Q4OA 4HYTA 4NS4A 3KXIA 2P2DA 2A78A 4CLDA 1C7FA 3P2YA 5A3JA 3RIGA 5NLLA 4R2IA 5CVCA 4JC4A 2IIQA 3DV0B 2PS1A 3ORFA 2L17A 2QW0X 2XQVA 2B4YA 3JQFA 5KTRA 4D8XA 4ZJZA 3K15A 2AZTA 1BMQA 1P2VA 2H7XA 2OK8A 2V4ZA 3LOPA 2H1HA 4FDUA 4LF5B 4O4IA 3M6XA 2FPMA 3M6WA 1GNLA 4UC0A 4NMMA 1O7JA 3L07A 3ORHA 2I91A 2YVQA 2R6FA 2QROA 3RFTA 4BGEA 4W9MC 4G5HA 2JGDB 2YMPA 4YAOA 3A0UA 5ALNA 2JLYA 2EGHA 1QR6A 1TE2A 1H69A 2XTMA 5DXFA 2O0JA 3JQ9C 3PNPA 4Y2QA 1R16A 1IXYA 1VDZA 3JR7A 4K6OA 4FR2A 4S1VA 4CRWB 1XU7A 3GFTA 4BQIA 1DXHA 1PQWA 3WAJA 1NJFA 1TIPA 2I66A 2IYWA 3GLIA 3T3IA 4ZCTA 3W3ZB 3GGOA 4OL9A 1VLLA 4LE2A 4RABA 2C5FA 4KR3A 1AM4D 4RY0A 5CH5A 4UHDA 3PR1A 5EIEA 1KXZA 4G8JA 4LVNA 2XQGA 4Y1EA 1YFJA 3EVZA 2CUKA 1PT7A 1GFIA 2HIAA 2YW2A 4IH4A 1JHPA 3HFGA 3OURA 2ZXUA 4P7FA 2EFCB 3BK1A 2GFIA 3B9QA 3E1GA 1DCKA 3OY7A 1CTQA 5IBQA 1MN6A 4RZHA 1THMA 1G63A 3UNXA 3REFA 3P26A 1IZ9A 1R9NA 4QLBA 4HJRA 1TCVA 1BAPA 1AD2A 1QHYA 3DOEA 1XN4A 1JB1A 1XTRA 4HH3C 3CINA 1M6VA 4D9MA 1DNPA 1QYRA 1SQ5A 2X4LA 2CCJA 3VU8A 4JJZA 4NTZA 5KIAA 1W52X 1YU9A 4I6GA 1BRMA 4KPUA 4GOKA 3QMVA 4NJOA 3ZGNA 1JHOA 1SCIA 1GOTA 1NNLA 3GELA 4P3KA 1TU0A 1QK5A 2BPOA 2JGMA 1RVDA 1KYXA 2VPIA 3KSMA 5EIBC 4K9PA 4DPMA 5CVJA 4LI0A 4GRAA 5CD1A 2MYUA 3MRSA 3EMDA 2Y1WA 1E1RA 1F6BA 3T12A 4D4HA 1MX5A 1MO3A 1K8ZB 4WD3A 1L6IA 4R7TA 2J33A 4B5LA 1ONSA 1YR3A 1LB1B 1QO7A 4ZXPA 4ARCA 2ZROA 3BYZA 3HZOA 4ED9A 3WYAA 1UPUA 2F3QA 3UB2A 4Y1GA 3V46A 3MBOA 4ZO6A 3V4SA 5JY6A 3TKLA 1BVYF 2XMQA 2VP0A 1PJSA 3UMVA 1H6DA 1PR1A 2AN3A 3VDXA 2XWSA 1NFRA 2XNJA 3S1LA 4Z7NB 1X3LA 4AXBA 2OD9A 4UE2A 2I6TA 2IY8A 2IDMA 4O2AB 5I9IA 2W48A 4J0QA 5ITWA 4ZYXA 1VBKA 3WYCA 2NU9A 5JS2A 3AQIA 1WPRA 5JC1A 4QVIA 4JLSA 5AUNB 2R6JA 4OREX 1KYWA 5HA5A 1CR1A 1PTKA 1SHKA 1DOZA 5DISB 4IYRA 5BNTA 2WILA 4WLVA 4ENPA 2DUMA 3K2BA 1G6HA 3DPSA 4A9AA 1HXHA 4B76A 1U7UA 2G77B 2NV6A 3OO1A 3V1LA 5BOSA 5LMUB 3OTOB 4JYMA 1V2GA 2HF2A 3SS7X 3KWLA 2IXFA 1NWCA 4CF4A 1BNCA 5HILA 3RUIA 2G1UA 2ABWA 1JHMA 1GPWB 3EIQA 5CFRA 3S0JA 3DZ5B 1YT5A 3SIXA 5AI0A 1B6RA 1KHHA 4G4SO 1FJXA 2R60A 1CUXA 4TS4A 2PS3A 4TV9B 5AM3A 2O7RA 3T0GA 3P1JA 3B51X 4PAQA 3PC6A 4CEIB 4BO3A 1E2BA 1DV1A 3IRUA 3I5MA 4WESB 3TEJA 4BQPA 4L15A 1FLVA 1K6XA 1M74A 3BRWD 5F9MA 2R9VA 2FW6A 3L1UA 3QE3A 3UOGA 3VJMA 2IBSA 1M1UA 3I37X 3WLPA 5K0ZA 3K6JA 1Z4MA 2IXAA 3C5HA 3IE0A 1VTKA 4ASUD 4ITRC 1XTQA 2A84A 1JJAA 4K28A 1JFFB 2ZATA 4W5NA 2G1PA 5ITZB 2YIMA 2D7JA 1WR8A 5EJ9A 5JR3A 5KINB 4NFSA 2OHVA 3AK4A 5IP5A 3L0OA 2E4WA 1A9QA 2DJIA 3PGXA 3TTUA 2X41A 3MTIA 3O3MB 5F7OA 3QEAZ 3OQHA 1VFNA 1GQQA 3B6MA 4GNRA 1H6CA 2UYYA 5EJ4A 1GTMA 3T3GA 2ILTA 5KOIA 2BGLA 1IH8A 4R2LA 2ZAMA 4V0SA 1L8QA 3OKCA 3OA0A 1GA4A 4PIMA 2WJ6A 5DM0A 1BFUA 3TQHA 2FY8A 2KLHA 1H1DA 1RZRA 4XUCA 3WRXC 1FCJA 1MLDA 3LQRA 1L3BA 4L73A 1WXHA 3EGXB 1SA0B 3P4YA 4LWOA 5AXCA 1R6DA 4ALKA 3LT2A 4G5YA 1O96B 1SCUB 2XB9A 3G68A 3REQA 1EK5A 4WN9A 4DDUA 5AD1A 1O1YA 2X3UA 2E6UX 2PU7A 1WMSA 2ZQZA 4AJOA 2Q62A 1N78A 3ZG6A 4NNPA 3PF8A 2XWQA 4RTNA 3JQGA 1WL8A 1LDGA 3HU2A 2JFXA 3NBMA 1VL8A 3MXTA 4F38A 1MFPA 3VHXB 4IUYA 4FFBA 2AUNA 3AFIA 3SLGA 5TVKA 1C8BA 1N92A 5E6RA 3LH5A 4AMGA 3D1JA 2Q6VA 3HYNA 4GUAA 2DC1A 3WRYC 2PGJA 1RXWA 1G7SA 3OU7A 4X24A 1XQ9A 5HVNA 4PYOA 4JHXA 3MTGA 4BZWA 1V5IA 1Z6TA 4C6SA 3ZHYA 1BN7A 4EFDA 4YP0A 3BIJA 3VC7A 5GONA 2R8PA 4BMZA 3VR3A 3V97A 3LQQA 4I4IA 1H2FA 1TVEA 1PNOA 1XK6A 5SYMA 1MC4A 3EH1A 2UU9B 1E7RA 3CSDA 2X8WA 4MW2A 2XGOA 1E18A 5HSGA 2F17A