4XB2A

Hyperthermophilic archaeal homoserine dehydrogenase mutant in complex with nadph
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
MKVNISIFGFGTVGRALAEIIAEKSRIFGVELNVISITDRSGTIWGDFDLLEAKEVAESTGKLSNIGDYEVYNFSPQELVEEVKPNILVDVSSWDEAHEMYKVALGEGISVVTSNKPPIANYYDELMNLAKENNAGIFFESTVMAGTPIIGVLRENLLGENIKRIDAVVNASTTFILTKMSEGKTLDDAIEEAKSLGILEEDPSKDIDGIDAYYKAKILHWVSYGEPPEEEERLGIREVRDARNVRLVAQVSKGKISVKPRKLSSDNPLLVEGVQNAAVIRTNNLGEVILKGPGGGGRVTASGVFTDIIKATLKFPNLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of a Hyperthermophilic Archaeal Homoserine Dehydrogenase Suggest a Novel Cofactor Binding Mode for Oxidoreductases
doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Oxidoreductase
molecule keywords 319aa long hypothetical homoserine dehydrogenase
total genus 108
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4xb2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xb2A01
3DR3A 4WEQA 2Q1UA 2V7PA 3GUCA 3OIFA 2NVUB 5KVSA 2H6EA 4WASA 4BB6A 4ZQHA 1B3BA 5ICMA 1K2WA 3KZVA 2BF7A 3U9LA 1MC5A 5U9CA 3GDOA 1LDYA 4IDFA 2E4AA 3SJUA 1EE2A 4N18A 3DZJA 2O2YA 1VJ0A 2A92A 4XYEA 4W82A 2DKNA 2TMDA 5TX7A 4XB1A 3WSWA 2VQ3A 1JU9A 3WQRA 9LDBA 1PTJA 3PZBA 1N9GB 3JQBA 4CMAA 4ZVVA 4CMCA 2BGMA 2BH9A 3RC2A 2EXXA 2GR9A 4OXYA 4TRNA 1VM6A 1NWCA 2PGDA 3W4KA 1QYVA 3CKYA 4QTZA 1Z74A 4DWVA 2WDZA 4FFPA 4J0EA 4I08A 2B83A 4KP7A 4XQEA 5FI3A 3S1LA 3EVTA 3ADOA 4FFRA 4EJ6A 1I01A 3ZU3A 3LT4A 3NDRA 1NNUA 4KWHA 1KVUA 3AY7A 3PTZA 5I9LA 4KZPA 2EHDA 2R00C 1W6UA 4D7AA 3INGA 5EQFA 4CM3A 3ZV6A 5A1TA 3JD3A 1PX0A 4R9RA 3MEQA 4DBZA 1HYGA 4JJIA 1KY4A 1SMKA 1WP4A 1LI4A 1GUFA 4WLVA 5JO0A 4Q3CA 5J9GA 1B16A 1NAHA 1T2DA 1ZJZA 4KOAA 2PV7A 3OM9A 4DYDA 4IQGA 1EMDA 1HE4A 3ZGYA 4CV2A 2GN8A 3JQDA 5B4TA 1Z73A 5JO9A 1BXKA 4GX1A 5DCYA 3I83A 1PJTA 2AMFA 2FZEA 4CLHA 1Y5MA 3NEPX 5B37A 1ADBA 3PI7A 1BGVA 1PJ3A 2ZB3A 1AE1A 5JPIA 5KKCA 2YY7A 4R68A 3NRCA 4XCVA 5ADHA 1ZKMA 1HYHA 3QVSA 2J6IA 1TI7A 2AQKA 1YB5A 2YHUA 1U8FO 1E1MA 3EW7A 4MVJF 1GQ2A 3WJAA 4RF4A 4BNYA 1DOHA 1Y7TA 3IJPA 2QHXA 2Z95A 4CR6A 2HK7A 5EQDA 2VUSA 1XYGA 3NJ4A 1BRMA 1JN0A 1PR9A 3ST7A 1O0SA 3BYZA 1IULA 1DEHA 2ZCVA 3ZNOA 2UV8A 1WNTA 1MG0A 4IJVA 5JS6A 1HDZA 1FDUA 5FYDA 2IRWA 2PD3A 6ADHA 3KLPX 3IKVA 1N7HA 1UDBA 4GSLA 3FD8A 3GZNB 1JAYA 3E9QA 3K92A 1WLYA 4FJ1A 1O95A 2AQ8A 4JBGA 4OMUA 4BUCA 4QQRA 3HJAA 2Q99A 3ZU5A 4MDHA 4LCJA 3PHLA 4E30A 2X9GA 2CY0A 5CG1A 2ZQYA 1HE5A 3DBHA 5AYVA 1EK5A 1E3JA 1VJTA 3D0OA 4B8ZA 3WG9A 1UP7A 2NNLD 3DZIA 4P4GA 1GPDG 5B12A 1QYDA 5FEUA 2Q50A 3DTTA 2ZTMA 4E13A 3ONFA 1HTBA 1P74A 2Y1EA 4W9NC 4ALJA 1K5HA 3PHHA 2WEKA 1SZJG 5DP1A 1Q7GA 3D4OA 3VKVA 3PEFA 1MX3A 4KUEA 3VH4A 1I2ZA 2IZ0A 3ZWPA 5BT9A 1LQUA 3WGQA 8LDHA 2HK8A 2NVUA 1PL7A 3PVZA 5CG2A 2Q2QA 4IIUA 5F5LA 1LLQA 2FR0A 3TOZA 2PKQO 1R37A 3HADA 3RI3A 4CL3A 3OHSX 4R16A 2Q45A 5KWEA 2O2SA 4BNLA 1RKXA 4PGFA 4NBRA 3TDKA 3V5NA 4DQUA 1E1NA 1WZIA 4RJTA 1VKOA 2VNSA 2CF6A 4AFNA 1N5DA 4JNKA 3SXPA 4AJOA 3TZ6A 3PDJA 1SB9A 1DHTA 5TGDA 4CQMD 1DIHA 1N8KA 3VAZA 3GEGA 3AY3A 3IP1A 3ROQA 2G1UA 3VH1A 1NQAO 1UXKA 2PNFA 4FR5A 2X6TA 3I6IA 4UREA 4CM9D 1ADFA 1LC0A 1GL3A 1QLJA 2AEFA 4Q9NA 4D3DA 3JYNA 3I6QA 4ALKA 3FRJA 3LSYA 2FSSA 4URFA 3SEFA 4CR7A 3HZZA 4JROA 1W73A 1EZ4A 2P5YA 5DCWA 4BOYA 1PWXA 2CD9A 4P38A 3ROKA 4J6FA 2D3TA 3HN7A 2NLOA 2Q1TA 3H9UA 3MJSA 4L4RA 4MKZA 4LCEA 1E1LA 2WYVA 3OJOA 2P9CA 3TN7A 4PZEA 4AJNA 1ULUA 1V8BA 5I7FA 2QG4A 3DMTC 3NDJA 2V6MA 2FZWA 2PD4A 1WMAA 2UUPA 3ZH2A 1R4MA 1GEEA 3KHUA 2QRKA 1BXZA 5CEFA 4J1SA 3JQCA 5J23A 2B5WA 1PQUA 2DTXA 1CETA 2HMTA 2YFHA 1DLIA 2VYVA 3PK0A 3ZU4A 2H1SA 1TT5A 2NU8A 1ZSYA 4DBVO 3VTZA 3DFUA 4I5DA 3GT0A 3S8MA 3SC4A 1ZH8A 1N92A 1F0YA 1RJWA 4TRMA 4II3A 4BO3A 2JAPA 5T73A 4I5EA 4RVHA 4YQZA 2PY6A 4UEOA 4YJHA 3Q9NA 3D3WA 3DBLA 5JYEA 3WBFA 4FDAA 2E49A 4WK6A 3CH6A 4JN6B 1PJCA 1NR7A 3HDQA 2LDBA 2I9PA 1MB4A 4PG8A 4IXTA 5LDHA 2YJZA 3UUWA 4WOKA 1A4IA 2BGLA 5CFZA 3FNHA 4FGWA 3CZMA 3AM3A 3DOCA 4KQXA 4B4OA 2NQ8A 4DL9A 3DBRB 5IDXA 2A4KA 2DUWA 4JLWA 3GN2A 1SNYA 3C7DB 2NWQA 4NU6A 3WYEA 2VTDA 3C1OA 1GZ4A 3ENKA 3I1JA 4KMSA 4PLGA 3ZV5A 4CM9A 5A02A 1IPFA 1P45A 3P2YA 2C7GA 4IDCA 4RQTA 4CMEA 5A9SB 1O8CA 1R4NA 2FR1A 4OL9A 3JQBC 3UHAA 3M2PA 3ZZNA 3PQDA 3Q9UA 2IXAA 1IYZA 3TF5A 3Q11A 1QSGA 3UCEA 5ENVA 1MLDA 2JCXA 3WJ7A 3S2EA 3ICCA 3G79A 3H5NA 5T8KC 1I2BA 4EJ0A 2ZKLA 5KTKA 1ZBQA 4J3FA 1ISIA 2ZB7A 3MJ4A 3RUEA 4YR9A 2V6GA 1HSZA 3CXRA 5DOVA 4BNJA 1NQOA 3KEQA 3GZ4A 5JXWA 1NFRA 4AJEA 3JQGB 5H82A 4D0SA 5IN4A 3LT2A 3IJRA 2EV9A 3ZHXA 2WJPA 1PQPA 3PLNA 3C24A 2CDAA 3H5AA 1X1TA 4K6CA 5A9RA 2XPCA 3R0IA 3RBXA 3U62A 1WXDA 3B6ZA 1YB4A 5EESA 2DQ4A 2Y1CA 4RVFA 5JE8A 3OJFA 3FR7A 1KYQA 1K6XA 4GQAA 5G0UA 4CLDA 3ITKA 3RWBA 1DIRA 1Q1NA 3LF1A 2OBNA 1ZNQO 2C7VA 3MWDB 1O6ZA 4A5OA 3FN4A 1GFSA 5L7WA 2VWHA 1T4DA 2Y05A 1Q2XA 4XEHA 2AG5A 1PSDA 3GG9A 1UH5A 2OP1A 3M1LA 4CQMA 2UAGA 5C5IA 4L4SA 2JL1A 1KS9A 1UXHA 1U7HA 1KEVA 2W8ZA 1R15A 2JCYA 1LLDA 3K8ZA 1TB4A 3P2OA 1I3MA 3KYCA 3PGXA 4RGBA 4BKUA 3JQFC 4BO6A 1F06A 1MFZA 4IJWA 1Q0QA 2EP7A 3FWNA 4OO3A 1W4ZA 4YVFA 4MVJM 1I8TA 1BVUA 3UCFA 3ZWAA 3TL3A 3LF2A 1UDAA 3BMOB 3I9LA 3TZHA 4YT5A 2X9NA 2UYYA 1R0LA 2UUOA 1H6DA 3KB6A 1GR0A 2DU8A 4GAEA 3GVXA 3KUXA 4QT0A 4Y6PA 2HAEA 1HDXA 1QYWA 4FPXA 5I9MA 1C1DA 5H83A 5IDYA 4BNTA 4ID9A 5C7IO 2HRBA 4XYGA 4FSHA 4AJIA 3UICA 4CM8A 4Z9XA 3FCOA 2CMDA 3C85A 1PGQA 1EDZA 1FK8A 4F6CA 4CMIA 4BO4A 1E3LA 2C0CA 3C1AA 1BDBA 1EVYA 1WMBA 1X7GA 4YYZA 1HETA 1C0LA 4OGWA 3RUHA 4AJKA 3EC7A 3MJEA 4J1TA 2EJWA 1WVGA 2HSDA 4XRRA 1IY8A 1HF3A 3QSGA 1U28A 4ND4A 4ND2A 2DC1A 3RUAA 4YRDA 5KCZA 3JYLA 1EVJA 2Q4EA 1ISHA 1U9JA 4WNCA 2DLDA 4BNFA 3OQBA 4E0BA 3HFSA 3ONEA 3GGGA 1FXSA 1I5RA 4MIOA 4DIFA 3OETA 5LDGA 4A0SA 4A10A 1C0KA 2BD0A 3Q2IA 3KYBA 3DMTA 4D45A 1IUKA 4NBVA 4BNVA 2BKAA 1WDMA 3ZHYA 3F5QA 1E77A 5JDIC 2WD8A 4JQCA 1Y6JA 4CLOB 4D44A 2H63A 1H6AA 3MJCA 3GDFA 3DL2A 3ANLA 4YT4A 4CUJA 4EITA 4N7RA 4ESOA 3WIDA 3U4HA 4L8VA 4TROA 4DVJA 3QVWA 1O5IA 1CF2O 1PJLA 4BO7A 1ENZA 1ZK3A 4IS2A 3RKUA 4D79A 3H4VA 1ZO8A 3JV7A 1DC5A 4HFRA 5T8KA 2J5RA 5EL0A 2FOIA 4LSMA 1T24A 1GADO 2J5KA 2ZB8A 4BKQA 3GVCA 5TC4A 1V3TA 3L6OO 4BO1A 1F12A 4ND1A 3LC7O 2Y67A 4R9SA 2ZB4A 3ETDA 1OBFO 4DLBA 5L7YA 2PZKA 2EW8A 1CQIA 3SJ7A 4CLOA 3BMNB 4JJFA 3SX2A 1DPGA 4E33A 1XR3A 3LLSA 3I4FA 4PG6A 3GEDA 2RBEA 5TT1A 3FPCA 1U4OA 3L6DA 1CYDA 4RPJA 3F9IA 4GLOA 1AUPA 1MC4A 1EE9A 3G1UA 1ZEJA 2DBZA 3JD4A 4MINA 3O03A 1VE9A 3I4CA 3OIGA 4W4TA 5JAMA 3C1TA 1U1IA 4NZ9A 3ADPA 2D59A 4RVDA 1GDHA 4NNJA 2POQX 1RM4A 3RIHA 2HU2A 4G81A 5KJFA 1R12A 1XG5A 3LLVA 5T64A 4TSKA 3W8EA 2O7SA 4DTIA 4EYEA 1ONNA 4WCFC 2HMVA 4NK5A 5ITVA 3R6DA 1DRUA 3OA0A 5DCUA 5JYAA 3BHJA 1ADCA 4OHUA 2O3TA 1DC3A 3ABIA 3V2HA 1U7TA 3H6KA 4BO5A 4DLAA 3H3FA 1Y9AA 1PGJA 3WLFA 2HUNA 4CQMB 3INTA 3MJVA 3T7CA 3G0OA 3NDIA 4O63O 1YJQA 1XSEA 4IQ0A 1K0UA 3W8FA 1UP4A 2CSUA 1YVEI 3ZWWA 1BWSA 4YJDA 3HDJA 2H9IA 4DQXA 4AJJA 4HBGA 4PN3A 5LC1A 3JQAA 3VKUA 4C7JA 3O9ZA 2PH3A 1XU7A 3D5QA 1GYPA 3CE6A 4NFYA 3JQ9A 4CMGA 2UDPA 1LX6A 5BR7A 1DIGA 4WCFB 4PLWA 4PVCA 2VT2A 4NJMB 4XX0A 1UAYA 3RJ9A 4BKPA 4OOEA 4YAGA 2D5CA 4I9NA 1C1DB 2Z1NA 3FTNA 1H0KA 4C7KA 4ZQEA 2EG9A 3W1VA 4GWGA 2AHRA 4FCCA 3KM0A 5F1PA 2OFPA 3PJFA 9LDTA 4IMPA 3GAFA 4OYRA 1B0AA 3RFTA 4DQVA 3WNQA 3DTYA 5I8WA 1YOVA 4IZIA 1LBEA 3NGXA 3INRA 2YFQA 5L3ZA 2OXIA 5JAZA 2JFHA 3LVFO 4GVXA 3LU1A 4D41A 3EVNA 2NQTA 3OECA 3X2FA 3AOEC 4EDFA 2Y1OA 3QWAA 1NP3A 2YV1A 4E5MA 2GZ3A 3NT2A 3GQVA 5T6BA 2C82A 3QY9A 5DOZA 1XELA 2AQIA 1B14A 4D0RA 1HSOA 3EUWA 3BTVA 3F5SA 3U4DA 1C1XB 3ZCXA 3JQFA 4R4JA 2B37A 2O3JA 3NTQA 1K3TA 3BMCB 2YZ7A 4EUFA 2WSBA 3I3OA 1B8UA 4Y98A 4YXFA 4NU5A 3PFFA 4PLZA 1VPDA 2IE0A 1U3WA 2EGHA 2P4HX 3HG7A 3KEOA 4U0KA 4O6VA 1UUFA 3H9JA 1H5QA 4IJKA 2G17A 1C0IA 1SBYA 1SEVA 3OICA 3PXXA 4J1NA 4JBHA 1OFGA 2PZJA 5EMHA 1HDRA 4FFMA 1XU9A 4CUZA 5LCXA 5TLSA 4KDFA 2O3RA 1EVZA 1LSSA 3EMKA 4UEJA 5HBRA 1JWBB 4PG4A 3GEMA 3DOJA 2PKQP 2C07A 3LYLA 3RU9A 1Y8RA 2ET6A 4Q39A 1YQXA 3UAGA 3DDNA 2GPTA 3ZW9A 1RPNA 4CPDA 4B4VA 1MXFA 2W2LA 3MWEB 3AUUA 3VOSA 4Y67A 3K5PA 3HN2A 2JHGA 4E3ZA 4BVAA 2G76A 3GRKA 3NT4A 3RC7A 4B7XA 3AI1A 1H9AA 3CMCO 3VH2A 3U49A 4OAQA 1MXHA 4WPGA 4BNMA 1H6BA 3GH3A 3MOIA 1PU2A 3WFJA 2FSVA 1JTVA 1DRVA 1P1IA 3KSUA 1M6WA 2NACA 4O5OA 3UN1A 3BMQA 2Y99A 2JD0A 5IXYA 2PGJA 4EJMA 3OEWA 1PZGA 4XGIA 1EBFA 4WUVA 5T5QA 4ND3A 2PKRA 3DWFA 3FBGA 3QIVA 4E32A 1ADGA 3ZWMA 3LQFA 3PRJA 3N74A 2JHFA 2FPIA 4II2A 2QX7A 4BNXA 5ILGA 4WJZA 2OMEA 3AW9A 4QSMA 4CQLB 3GOHA 1P9LA 2X0IA 3ASUA 5TJ9A 4DMLA 2NM0A 4XKJA 1ISMA 1BVRA 4YQYA 1V35A 1YJ8A 3UOGA 4MKRA 4NR0A 3BTOA 1LNQA 3GA0A 2VOJA 4DIBA 2C59A 5C3MA 3VZQA 4BB5A 4ZQGA 1IZ0A 2QIOA 4J7XA 4ZQFA 3H9GA 1JKFA 2V6BA 4G2NA 4WLEA 4YT2A 3OF2A 5JY6A 5IZCC 4D46A 1J5PA 5THKA 1VRWA 3GAZA 4FFNA 4TZKA 2P91A 4L74A 3GPIA 2XOXA 1E7WA 3RC1A 1QG6A 3V2GA 4DPLA 1K6JA 3PWKA 1GY8A 4XIJA 4UULA 1D7OA 2BLLA 3WMWA 1FDTA 4UVHA 4LN1A 4PFJA 4I1IA 3AUAA 4AJPA 2W2KA 4LMRA 3LZ6A 2AE2A 4L75A 2CVOA 3RBZA 1PJ4A 5L51A 4J2HA 1ONPA 2ZTUA 3HQ4O 1D3AA 4JCOA 3UH1A 1VL6A 4M87A 4W99A 3LT1A 2X8LA 4BMSA 2G0TA 3DB2A 1AXEA 4CMHA 5GMOA 1GZ6A 1XA0A 5KVCA 2CNBA 4B3IA 3KLMX 4IUYA 5K0ZA 3O4RA 3OBBA 2PFGA 1R16A 1DHRA 2EW2A 3GVPA 3I23A 3QWFA 4LSWA 3CINA 1D4FA 2VRCD 5DT9A 1NXQA 3AM4A 4XB2A 3BMCA 1YBAA 3T7EA 3WMXA 1O94A 4XDZA 2VYVD 3PWSA 1HXHA 4N5MA 3ZWVA 1IB6A 1JQBA 3FHLA 3FSRA 4HNGA 5A9TA 3D5TA 1PL6A 1TA4A 1UAGA 4AICA 4R3NA 1OC2A 3AU9A 1MP0A 4YA6A 1T2EA 3K9QO 3H65A 3I9KA 4AL4A 3DZHA 4J9UE 3SLGA 3QV1A 4PLYA 1KC1A 1DRWA 3OQ1A 4F45A 4CMEC 2BFAA 2VNAA 4ITUA 4E21A 1Y8RB 1YL5A 1ISGA 1MFPA 5ES3A 3P19A 5CAEA 4NFHA 1YQDA 4RVGA 2YQ5A 5I8ZA 4FC7A 1M75A 4MOWA 5A3JA 4BS9A 1WAMA 4DRYA 4G5HA 1Y8QA 3ZWCA 1U3TA 3EZLA 2X7HA 5DZSA 5K9ZA 2FP4A 1X7HA 4KUHA 1BMDA 2J3KA 2GZ1A 1QYXA 3D3EA 3O26A 4B4UA 2YHIA 2A9FA 1I30A 1E5LA 4Z9FA 1DJNA 1P1HA 4NBTA 1H93A 3NJ8A 2X0RA 3QVTA 4J2OA 4L76A 4BNWA 3D7LA 3ROMA 1TVEA 1QXSA 2DUUA 4MKXA 1ZIDA 1Y5RA 4JIGA 4LK3A 4Y6RA 3UCXA 3AJRA 4W7IA 4YJGB 5KJ6A 4J7UA 1MUUA 4LGVA 1HEUA 1CDOA 4QFCA 1YONA 1FMCA 1Y1PA 3NV9A 3RUDA 5COAA 4YDRA 4ZRMA 5C37A 4PLHA 1SC6A 4M86A 4CR8A 5L45A 1ZW1A 1JDJA 1ZJYA 2PR2A 3TFQA 5L4SA 3MTJA 4HY3A 4PG7A 3B1KA 2WD7B 6LDHA 4F46A 2FN7A 4WEOA 1H2BA 5EIOA 5MGBA 3VPSA 4DMMA 1LC3A 4ZU3A 5IN5A 3OJEA 4HX5A 3L9XA 4WLUA 3TWOA 2F1KA 1U8XX 1YDEA 1VLLA 2GN6A 4CMIB 3GGPA 3OH8A 5AXCA 4ZRNA 3S2FA 4E2ZA 4KWIA 5GY7A 4I5FA 3HUDA 5CDGA 3ETEA 1PZEA 1M2WA 2JCVA 3LK7A 2ILTA 1T2FA 1M76A 1S6YA 2F00A 4PRLA 4C4OA 5HRUA 5G4KB 4HFJA 4BNZA 1F17A 2O4CA 2X58A 3PIIA 1K6IA 2B0JA 3C3XA 4XQGA 1GEGA 1E3WB 3W8DA 1HLPA 4A73A 2W2KB 1GPJA 4MVJI 1LRKA 2I67A 3GMDA 2BI8A 4Q3DA 5TIIA 2C29D 1AHHA 4OXKA 3QVXA 1BSVA 1C3VA 2QYTA 5A3VA 4GL4A 3ZI0A 3MOGA 4IQ8A 4WLFA 3RJ5A 3T4EA 1LJ8A 2DT5A 5KKAA 3PQEA 1DAPA 1J6UA 5A06A 3Q6IA 2OL4A 2X0NA 4X54A 4E5NA 2CDCA 4XQCA 5I7SA 4RLHA 4GMFA 4HUJA 1BHSA 4H7PA 5ER6A 4NJOA 3VC7A 3WWYA 4MVJD 1JVBA 1P3DA 2PLAA 4RVUA 1DC4A 4BKRA 4OIMA 4E5KA 3JD2A 4RPHA 1XQ1A 1BXGB 1KETA 2Y1DA 2A35A 4E2WA 5I7VA 1NX6A 2FR8A 4EW6A 3MCVA 2PWZA 5G2OA 1OZAA 4BMNA 1DLJA 2P9GA 1I36A 4M55A 3G17A 3QLJA 2D8AA 4E6PA 4PLVA 3JQEA 3F3SA 4CLEA 4OH1A 1XWFA 2OP0A 2WTBA 3F1LA 3RROA 4IINA 3EZYA 5EERA 3BA1A 1QRRA 1NPTO 2DAPA 4MO2A 2EF1A 2B4RO 2NADA 5EJ2A 3OQ6A 3HE3A 3IUPA 3C8MA 1PJSA 4QUKA 3TNLA 1NQ5A 1VI2A 5BNTA 1B15A 2VHXA 4TKLA 3PHGA 4TZTA 5JAQA 3ZWOA 1LDEA 5DBIA 2FPPA 1ZVMA 1ZMOA 4NK4A 3E9NA 3P5SA 4RZIA 4N54A 2C5AA 2JKVA 2QRJA 1LLCA 1Y8QB 2BGKA 1TT5B 5AVOA 3CZRA 4ZICA 4YAKA 1UDCA 2X5KO 1KEPA 1U5AA 2QZZA 1P77A 4ALIA 4RVSA 1U3UA 4BNUA 3RFVA 1T1SA 1D8AA 5FFFA 1A9ZA 4RLSA 3NTOA 4YRAA 4YWJA 4HXYA 4J43A 4ZQBA 2VRCA 3TRIA 2IYPA 4OQZA 1IL0A 2Y1GA 3JQ8A 1NFQA 4MVJA 2P9EA 3RFXA 4CM5A 4DGSA 3AM5A 5C7LO 1B3RA 4U7WA 1KERA 2NTJA 4CODB 4Z3KA 1HZZA 1GQQA 3COSA 1ZSNA 4HKTA 3STHA 3WGZA 1NFFA 1VC2A 3GUYA 4BGIA 3GHHA 4UVGA 4CMKA 1TXGA 2FMUA 1OAAA 5MDHA 3BIOA 3WDSA 1P0FA 3PQFA 1OI7A 3ORFA 5COQA 3KBOA 4TRRA 1DIBA 2RH4A 3IQDB 1OOEA 2GN9A 1DJQA 4D3FA 1RYDA 2GD1O 1TLTA 3R3JA 2JFFA 5M6DA 5A5FA 3UXYA 1RM5A 3IP3A 2GLXA 2Y68A 4BKOA 4XDYA 2Q2WA 1KOLA 4YEDA 4BV8A 5ILOA 2B35A 1Q7CA 4LRSB 4IXWA 1N1EA 2Q46A 5DN9A 1ID1A 2Q1WA 4IDDA 3ZWBA 1EBUA 5FWNA 1PGPA 5G4KA 3D4PA 2R2GA 1JLLA 3IMFA 3ZHZA 5HA5A 4RL6A 1HZJA 5JC8A 1PS0A 3PFWO 4EEZA 1E3WA 1CIVA 1ZMTA 3U5TA 1HDCA 1C1XA 1GV1A 3NAQA 4RQUA 4PLCA 3ZV4A 2PK3A 4N5LA 1CEQA 5CEEA 1YB1A 3G3EA 5KJ1A 2NV6A 1NWHA 2VRBA 2Q4BA 4FOSA 3L4SO 3PJDA 2PD6A 3K2EA 2YUTA 1ML3A 2Y66A 4QECA 1YDWA 3RUFA 4DYVA 5JYDA 1ZK2A 3L4BC 3PIDA 1NPYA 1L7EA 3CMMA 1UZNA 2VHZA 5JW6A 4I5GA 2WE8A 3EYWA 1Y9EA 4EGFA 3RSHA 4J91A 4FFLA 3BTSA 4HFNA 4B79A 2VUTA 1KY5A 4R1TA 5JBIA 4MIEA 3DAGA 3PHJA 1XEAA 2QQ5A 1YL7A 3A1NA 1V3VA 5JCJA 4MJLA 1SOWA 3GC6A 3IC5A 5BSHA 2W4QA 3IS3A 3ZWXA 5ENDA 1PIWA 1SOVA 5IG2A 3HB4X 4IMRA 1EUZA 1UXJA 3ROPA 3E48A 4WLOA 3TOXA 3PWZA 4U5QA 2I5PO 1A5ZA 3LDHA 5CP8A 5DNAA 4J0FA 5AOVA 4MP8A 2GRAA 1O89A 1PWZA 1XCBA 4QXMA 1G1AA 2R6JA 4EBFA 2G82A 4CLRB 4OKIA 1ZK0A 1E3SA 2ZATA 3BMQB 3V1TC 1Z7BA 5K6AA 3EDMA 3KYDA 1U3VA 5IXSA 3QA9A 1O9BA 4U8GA 2NTVA 5GZ1A 3V2UA 2GCGA 5G4LA 5CPBA 4R01A 1CQJA 3ZWYA 4NMHA 2GF2A 3AUTA 5KJCA 3SVTA 3K6JA 4K28A 3L77A 4ROSA 3D1LA 1ENPA 1ORRA 3WYBA 2VTEA 4D43A 4ZN6A 3QWBA 2RHRA 1PS9A 2ZTVA 3M1AA 1T26A 1SEPA 4IGEA 2X4GA 1HYEA 4BNGA 3E82A 2GNAA 5CHEA 2BFMA 1UZMA 1ZZEA 1E6UA 4CV3A 3GZNA 1YE3A 4RDHA 3A9WA 5TJHA 1JWAB 2Q3EA 3DBVO 4XYBA 2B4TO 4BNKA 4MVJP 4RPLA 2VWPA 3NKLA 5JCJD 5A03A 1AGNA 2Q2VA 3AOGA 4KTVE 2Y1FA 3JQ7A 3VZRA 4AJ4A 4E12A 3L0DA 1GYRA 1CJCA 2HKIA 1FDVA 3DBHB 4FJ0A 1I2CA 1A9YA 3B1JA 3VTFA 4ALLA 1ZK1A 4XYLA 5CDSA 2Q49A 3DZGA 1AXGA 2HMSA 3KXDA 1LA2A 2V65A 5AXAA 2NUAA 2VYNA 2I3AA 3ZDFA 3AUSA 1ZEMA 2V6FA 5KJEA 5JMPA 3DBRA 2C54A 5A9SA 3RVDA 1A72A 1EVIA 1J0XO 2YDXA 3PJGA 4LVCA 1VJ1A 4TQGA 4B8WA 3VZSA 3FI9A 1ZFNA 4CM6A 3GGOA 3VDRA 5F1OA 1KIFA 3KO8A 3W6UA 3AWDA 3U4IA 1PGNA 3OSUA 1GUYA 1B8PA 4YCAA 3BMNA 4M54A 3VPXA 3UFXA 3DAFA 5GZ6A 4RO0A 3E9MA 1E92A 3R3SA 4IGFA 4K1LA 5HM8A 1IZ9A 4ALMA 1HRDA 4CLXA 3B1FA 4BQRA 1WW8A 4JJGA 3DHNA 3K31A 1DBVO 3VVCA 4M49A 3ZNQA 5I9NA 3DO5A 5AXBA 2C5EA 2D2IA 3FTPA 3OJLA 4TVBA 3L6EA 1MG5A 4UUOA 1Z75A 2OOSA 1PR3A 2FY8A 2WWRA 5CEJA 1T2AA 4HNHA 1IPEA 3RKRA 3S2IA 4YACA 1CRWG 3O8QB 5DF1A 2CVQA 1UJMA 1ZK4A 3H7AA 4UAGA 1DXYA 3DONA 4OOFA 5BSGA 2AW5A 2PZMA 3MJTA 1SO8A 3AI3A 2BHLA 4RF3A 1E7MA 5ICSA 4R54A 3DHYA 4E2YA 1ULSA 1JKIA 2DVMA 2I3GA 3QW2A 1T25A 4XA8A 2D4AA 4LW8A 1M6HA 3OP4A 1NBOA 1PZFA 3GVIA 4LVUA 2C20A 3EK2A 4TWRA 4Y9DA 1EDOA 3U4CA 3W4IA 4B7UA 3NYWA 3WS7A 3FNFA 5L4LA 1E1KA 1HDYA 2DTDA 4B3HA 4UVEA 2ZYGA 4J4TA 4BV9A 4BGEA 4ZD6A 3GN1A 4CLRA 1YL6A 4RCVA 3WICA 3JQAD 3I52A 3E1KA 4GSKA 3E5RA 1ENYA 1NHGA 1WDKA 3I9OA 4WKGA 5IDWA 3MTGA 2X0JA 1VL8A 3I9JA 1GCOA 5G0SA 1LXCA 1Q0LA 3LT0A 2D1YA 3IOYA 3RASA 4U6SA 1HDGO 2RIRA 4UUPA 3TZCA 1DC6A 4JBIA 1S7CA 2IEBA 1E7RA 5KVVA 5TT0A 2O50A 3EY4A 2I76A 1YBVA 3JYPA 1H2HA 4RV9A 3UW3A 3Q3CA 4CV1A 1G6KA 1IOLA 3JQ9C 4UUMA 4YPOA 5TS3A 2J3HA 3IIEA 1UP6A 3IL2A 3H9EO 2B69A 3A4VA 1HL3A 5I7EA 5A5EA 4R69A 4LMPA 4DC1A 3F46A 4RDIA 5JSFA 1JKJA 3WFIA 3ZW8A 4KUGA 5G0WA 1JVSA 4EEXA 4GMGA 4WLNA 1I3NA 2EERA 3D4NA 4XYMA 5HWSA 3VPFA 4PIVA 3FBTA 1A27A 3F4BA 4XGKA 1V9LA 3DC2A 2VHWA 4JXKA 4KQWA 2B4QA 3JQGA 2VWGA 2W98A 2ZYAA 3DHEA 2C2XA 5TNXA 3ZNNA 3EHEA 4MIYA 1F8GA 1XDWA 3EAGA 2WYWA 3JYOA 1WWKA 5U4QA 4PZCA 1L1FA 4EUEA 3GNTA 3WXBA 1NASA 2Y0CA 1WPQA 5B1YA 1M66A 1P0CA 4XRGA 4BMVA 1L7DA 3WIEA 1I33A 3WQSB 5DP2A 4I8XA 2EEZA 3H9QA 5ER9A 2GO1A 3L9WA 2Y0DA 5L40A 1LRJA 1SAYA 2B36A 3HHPA 4GX0A 3AI2A 4KTTE 1F14A 1UXGA 2I99A 1KBZA 3GFGA 4L0QA 3VZPA 5A05A 1BTOA 2CUKA 3ULKA 2PZLA 1D1TA 4H15A 2O3UA 2PA3A 4L4XA 4NPCA 1BG6A 5ITWA 3GPDG 1MV8A 3PZRA 4BIIA 4BL5A 5JYFA 4DA9A 1RM3A 3ZNPA 1BXGA 1DSSG 3WYCA 5BNFA 1AHIA 5CDUA 4HFMA 4E5PA 1PQWA 4A2CA 2GASA 5CDTA 3I5MA 2VZ9A 2WMDA 2A94A 3W6ZA 4ZJUA 1B26A 4A27A 4J4HA 2E48A 4EI2A 3L07A 2E6UX 3BAZA 3AU8A 2HDHA 2VHYA 2QRLA 4M8SA 1E7YA 1KVRA 3QWHA 2CF5A 4YAEA 2SCUA 4U0JA 2GN4A 1QLHA 2VHVA 1VSUA 1Q0HA 2NSDA 1MGOA 4HV4A 2X5JO 1H6CA 1XKQA 2VOEA 3JTMA 1FJHA 1ENOA 1A7AA 1EEHA 2HRZA 1JA9A 4O1MA 3C7CB 5F21A 3KSZO 3U3XA 3WB9A 3ASVA 3DZKA 4R5MA 2ZIZA 5FI5A 4R1SA 2ZCUA 4IZHA 1EUDA 1LTHR 3HB5X 4L9RA 2JD1A 3OIDA 1X14A 4Z0HO 1LDMA 2O3QA 3ZV3A 4ALNA 1TEHA 1U4SA 2VN8A 3LC1O 2ZJ1A 3AK4A 2YV3A 3ZN2A 1LSUA 4BO0A 4CM4A 1DAOA 4FJ2A 4XR4A 1PS8A 1GQYA 2BI7A 3ANMA 1XIVA 2HO5A 2OHXA 3UF0A 3KTDA 1R4MB 3VPHA 3E03A 5F1KA 3IUSA 1DDOA 1ISJA 4IS3A 5BQFA 1MA0A 4XIYA 2PGLA 3QHAA 2JJYA 4B4WA 3JD0A 4MVJH 4Q3NA 5HTOA 4BNHA 3JCZA 2NVBA 4NQZA 3A28A 2EKQA 1A71A 2JFGA 4W7HA 3H3JA 2YYYA 3S2GA 1NVMB 1E7SA 3GVHA 4QX6A 4YAJA 3VH3A 1BW9B 2Y0EA 4WGGA 1QR6A 1GAEO 1IHXA 4RF2A 2P5UA 4QO7A 3OA2A 3ANNA 4PLTA 1JW9B 4AJHA 3ZHBA 1BDMA 4MVJG 4AG3A 1LLUA 3WX0A 2Z1MA 1YOVB 3DZBA 1DB3A 1X15A 4CM7A 5JC1A 1LDGA 4J1QA 4BNNA 3HWRA 4M89A 5F3RA 1I0ZA 4YTEA 3DQPA 1R0SA 2EGGA 4XGNA 4K6FA 3QRWA 1TT7A 1Y81A 3C7AA 4JX8A 2FRDA 3WBBA 1YWGO 3F4LA 4XZ3A 1EQUA 3M2TA 1X0XA 5IFLA 1LSJA 2D0IA 3P7MA 3BZUA 1HT0A 4FB5A 4AJ1A 2E37A 2X1HA 3BHIA 2NU9A 2J3IA 2GERA 4O59O 1I24A 2QW8A 3HNPA 2HMWA 1I32A 2NVWA 3KV3O 2LDXA 2GSDA 5TQVA 1DFHA 1EUCA 2NU6A 2TMGA 1IE3A 4IM7A 3ZWNA 1RM0A 1EK6A 1GZ3A 1HE2A 2GDZA 2CDBA 4W6ZA 5HS6A 3WOHA 3FNEA 2O7QA 7MDHA 3X2EA 2VCYA 4XD2A 3PP8A 3GF4A 2BMAA 5IZCA 1E6EA 1J4AA 2XF8A 3WGOA 4E2XA 3E6AA 3HDHA 3KRTA 2YHIB 3DFZA 4DC0A 4P8RA 3ETGA 1ARZA 4AVYA 2B5VA 1XGKA 3EGOA 2HK9A 2I66A 4HP8A 4MVJE 3BXXA 4PRKA 5COBA 2ZTLA 1LEHA 4EZBA 3F47A 1CERA 2AE1A 4TMFA 3GMSA 5JCXA 2P68A 2GUGA 4R51A 3GG2A 1ZCJA 3JQAB 4FGSA 4YJGA 3WGHA 4J7CA 2CVZA 3WR5A 4JGBA 3VVBA 2FHSA 3U09A 1E7QA 3NX4A 2VT3A 3PJEA 1NPDA 2OORA 4YB8A 4IDGA 2X5OA 3RC9A 4B3JA 5GZ3A 3TFOA 8ADHA 4NJMA 1P1FA 5AQ1A 3KYCB 1E3EA 1ZSVA 4IBOA 3RQSA 3E18A 1GUZA 4BGUA 2ZQZA 3TPCA 1P31A 4IDBA 5T57A 1ONOA 4LRTB 3R1IA 4FOOA 1M67A 3GY0A 4CV0A 3H5RA 1P1JA 4QEDA 3WSVA 4BHTA 4S3MA 4TKMA 1UZLA 3GFBA 1NYTA 4IIVA 1T4BA 3QQPA 2O23A 4QFDA 3F6YA 5EN4A 4RORA 5HS4A 4DPKA 5G0VA 3WTCA 1GV0A 3H8VA 1LDBA 4DUPA 4Z3DA 2JD2A 2AQHA 2OZPA 2DBQA 4R41A 4OM8A 5DDIP 4J49A 4OSOA 3QJ5A 1N1GA 1KC3A 1ZUD1 2BELA 4M1QA 4XJSA 4D42A 2J8ZA 3FF4A 4NG5A 3K2BA 5DULA 1P1KA 3SC6A 2Z5LA 1GCUA 2O48X 4PLPA 3B70A 4JP3A 4FN4A 3NTRA 1KVSA 3FWZA 1P44A 4NBUA 4RF5A 2NU7A 3D64A 5TRTA 1LUAA 1LU9A 4ONEA 4DXHA 5T67A 1B8VA 1NM5A 2FWMX 3CSDA 3KVOA 3NUGA 4H16A 4RPKA 3PYMA 1KEWA 4BO9A 1VL0A 3CPSA 7ADHA 3JQ7B 4YAIA 1W8DA 4CMBA 2DFVA 2BRUA 4XQ9A 4PZDA 3ZU2A 1I10A 3DZFA 3E8XA 3QE3A 1SPXA 1C14A 2I65A 5KNLA 1BW9A 4ND5A 5U1PA 1YS4A 1E0DA 4IDAA 1I3LA 4NH4A 4XJTA 4BNIA 3JSAA 4GLLA 2GYYA 4BO2A 4GPD1 4ZGWA 5BSEA 4N5NA 2AA3A 4OJNA 1YKFA 1YBMA 1VSVA 4DPMA 1DFGA 2I6TA 4RZHA 2DM6A 3RD5A 4FIZA 4GKVA 4XR9A 1YXMA 2WE7A 3V8BA 1QMGA 4INAA 3TQHA 4CM1A 3F1KA 3ON5A 4R5HA 4HWKA 1J49A 1A4UA 3TL2A 4Z0TA 4YBZA 2D5AA 4NDNE 1QV7A 1XLTA 4E5YA 3PYXA 2ZK7A 4PCVA 5G0TA 4ZHSA 1X13A 3TZKA 1P1RA 5JDCA 3QWIA 3V1UA 4YRBA 1U2GA 4B7CA 4NHEA 5DBFA 4UVIA 2W2LD 4WE3A 2IDZA 3PDUA 4Q3BA 3RUIA 3H2ZA 3AOEA 2PTGA 2OBYA 4A26A 5CDYA 1NHWA 3Q1LA 1HWYA 4FW8A 3IKTA 1F8FA 2DPHA 5BNIA 5B4UA 5JDIA 3N58A 4PG5A 3AY6A 4L73A 3N7UA 5C7OO 3KETA 2HJRA 4R1UA 2AEMA 4ILKA 4PLFA 3WGIA 1HLDA 1T2CA 4J16A 3JYQA 1Z7EA 4FS3A 2AEJA 1E3IA 3K96A 4S1VA 5JY1A 1FDWA 1RYEA 2RHCA 4K26A 2EP5A 1B7GO 1QV6A 3O8QA 3CTMA 1GYQA 1IHYA 4WOJA 1LRLA 5EINA 4FFOA 4A03A 4F6LA 2YV2A 3HFGA 2X22A 4QO8A 4JP2A 5IJZA 2HLPA 2JAHA 4GGPA 1XHLA 2W90A 3Q0EA 1NAIA 4FBGA 3GR6A 1QORA 4A7PA 4GH5A 1SCUA 3TZQA 1ZXBA 4UUNA 2X9VA 2AG8A 1DO8A 5L4NA 4O0LA 1FF9A 3PYLA 3JQ6A 2OO5A 2EKLA 3GHYA 2ZYDA 2AXQA 1GU7A 2HCTA 4WECA 4F3YA 4UVDA 1C0PA 5BSFA 1NVTA 4TVOA 3H2SA 4BQPA 4YJHB 1X7DA 2XXJA 2OGUA 3D3WB 3DBLB 5IAAA 4J4BA 5KOIA 1ISFA 1KVQA 1UXIA 1AN9A 5JNLA 3AFMA 5L7TA 5L95A 2HMUA 1LQTA 4DREA 4XWYA 3M6IA 4YT8A 3LC2O 4AJ2A 3FPLA 3WGYA 2VZ8A 5A4DA 2O3SA 4KDEA 3RBVA 3VHRA 1B2LA 1N7GA 4ZA2A 2O4UX 2Q22A 4FQ8A 4Q3EA 2XAAA 4Q3AA 4MP6A 5AXDA 4I9UA 1NTOA 4E31A 3DOOA 3U0BA 3W4JA 3WQQA 5TF4A 2G5CA 4YJFB 1RWBA 3BHMA 1Z45A 4WCFA 5EPOA 3MZ0A 1R4NB 3UKOA 1E6WA 1VKNA 4Z9YA 5CPFA 3WGTA 1WDLA 3T4XA 3UVEA 1FDSA 2IXBA 3Q2KA 1HE3A 1Z82A 4J9VA 3OEYA 2OUIA 4IDEA 4BGVA 1PJBA 1E5QA 2CZCA 3OFSA 4J90A 1DFIA 1KEUA 1ZXLA 3HSKA 1XQ6A 3I9NA 3CUKA 5FF9A 4CJXA 1OMOA 1GD1O 3CEAA 1T1RA 2BFOA 4RPGA 1NR1A 5H81A 2DBVO 3GLQA 2HJSA 2PH5A 1Z6ZA 1PJQA 4IY1A 3JD1A 5IF3A 4NI5A 4HADA 2J5QA 2R00A 3E5MA 3RAJA 4TRJA 3WLEA 1R66A 1N9GA 5JDCC 5KVQA 3K30A 1D1SA 1LDNA 2DBRA 4GWKA 3L4BA 3CIFA 3GK3A 3KOUA 1EQ2A 1I3KA 2X86A 3GRPA 2RH8A 3ONDA 4GVLA 2VZ0A 2QYSA 3G1TA 4GX2A 4UEKA 3K73O 2H5LA 2P4QA 3RUCA 3FR8A 1QKIA 3DEYX 2RAFA 2IODA 1V0JA 4OSPA 5JFOA 3SLKA 2VWQA 3G49A 3GNQA 1JAXA 1G0OA 4CMJA 3A14A 2EJVA 4IPTA 5THQA 3BTUA 3SBOA 3WWZA 4GKBA 3WGGA 4NFSA 4IJUA 5TSDA 3ENNA 2C2YA 2YW9A 3PGJA 4I9HA 2IEDA 5JLAA 4R3WA 3QP9A 3BMOA 3DXFA 2BFPA 3KYDB 4P4LA 2DTEA 1X1EA 5B4VA 1QYCA 4EUHA 1NVGA 4MPDA 1HKUA 1P33A 2YDYA 3I9MA 2IZZA 3HDYA 1W0CA 5F5NA 2IZ1A 2RCYA 1EFLA 4LISA 4NBWA 3ITDA 2EWMA 4GBJA 4Z6KA 1QP8A 4Y6SA 2WM3A 4OXNA 4P22A 1SB8A 3NGLA 5L9AA 3S55A 4CM8B 2QZ9A 2XXBA 2ZJ0A 4PVDA 3DMYA 3O38A 3RU7A 2VUUA 2WD7A 2GZ2A 4K9DA 1EFKA 1NQTA 2J3JA 1LSOA 1UR5A 3RCBA 2FPGA 3PPIA 1N2SA 5JMWA 3V1YA 2CFCA 2NTNA 3PHIA 2P2SA 3NT5A 1U5CA 3KSDO 1V3UA 2Q1SA 4JK3A 4OQYA 5K6AC 4CQLA 1Q7BA 1PEDA 3QVOA 3WTBA 3ICPA 2Y93A 4FC6A 2YQ4A 4DLLA 1YGYA 1KVTA 3A06A 3B20A 3IAHA 4GX5A 3TJRA 1YH3A 5DBGA 1PJ2A 3VDQA 4CM4B 3WNVA 1DIAA 4OKNA 4GI2A 4Z0PA 4FD3A 3VPGA 4E4YA 4D3SA 3JQ8B 3OJ0A 1H94A 3AFNA 1CWUA 1PL8A 2GGSA 4MP3A 4Y8VA 2DPGA 3PLRA 1U2DA 5JAIA 4CL8A 1R6DA 2DFDA 1V6AA 3GDGA 5IZ4A 4G65A 1YO6A 4H3VA 3FNGA 5A04A 2VYND 2E82A 3DAPA 1GTMA 3TSCA 4YJFA 3UGKA 1G0NA 1PZHA 1WZEA 3OMLA 1PGOA 1R0KA 3IDSA 1YQGA 1K89A 4NIMA 1X0VA 4WNIA 4WCDA 5IDQA 4DIOA 1YRLA 4R1NA 2EIHA 3GNSA 5L53A 5KIAA 1HDOA 2X23A 4CUKA 2HQ1A 4AJLA 4U6QA 4W9NA 1H9BA 1OC4A 2UVDA 4GGOA 4BO8A 2EKPA 2IYOA 2WYUA 4P4NA 1A7KA
chains in the Genus database with same CATH superfamily
4F4UA 1KEKA 4R83A 1ESEA 1WG8A 2Q1UA 1WNFA 2V7PA 3CF6R 3GUCA 5KVSA 4LX0A 4X41A 4LFBB 2H6EA 5CH8A 1CZUA 4NZMA 3SFVA 3ZJ5A 1QE3A 4RQAA 4BB6A 3GO4A 3L0YA 5DV9A 3WKBA 1H3NA 2E4AA 1NQXA 2J59A 3C3PA 5JWRA 2JKZA 2N0SA 4LYYA 1UOEA 4G1UC 1Y3BE 5K3AA 2O2YA 3HSSA 4PPFA 5JATA 2L69A 4QHSA 3DULA 1JU9A 4MA5A 2BGJA 9LDBA 2AV6A 2D00A 3PQ6A 5K45A 2WHPB 3DZ6B 5BVGA 5AMXA 5IASA 1PHPA 4PSKA 2BGMA 4CMCA 3SEAA 5AOBA 3LLUA 4Q37A 1IY1A 4D56A 2ZUEA 2GS9A 4LG1A 1IK6A 2W2TA 1VDZA 3PS9A 1TIPA 3K15A 3K8YA 5AT1A 2IYQA 1JKMA 5K2MA 4C04A 2VJBA 4FFPA 2YJ5A 5CVTA 1BOOA 4DJTA 4I08A 2B83A 3AG6A 4UATA 1XPOA 1JEYB 2FZLA 5FFNA 4TX1A 3ZU3A 1NNUA 1P6XA 4CIWA 1KVUA 3ETHA 3LUFA 3WDMA 4P98A 5EP1A 4ARSA 3ZWQA 1OKKD 2VP6A 4JJ8A 4B44A 3FFXA 2R5FA 3BORA 4O2BB 4O4JF 4X1OA 4QASA 1EVLA 2DPYA 3GRUA 2FN4A 4R9RA 3MEQA 5K0JA 2UUBB 4JJIA 1XA4A 3NVMB 2WFMA 3HL0A 4HAIA 1I4EB 4MW6A 2WWXA 1LI4A 4Q7LA 1G60A 5BN3B 5C8YB 1GUFA 3AR6A 2NO9A 2P4UA 3MRVA 5JO0A 4X65B 4JLNA 3R7SA 5J9GA 1MOQA 1VMEA 1T2DA 1ZJZA 4GMHA 4OI1A 4DYDA 3EIWA 1QANA 2XDQB 5CIWA 4BN5A 4D8YA 1EMDA 2ODNA 4M1MA 5D7BA 2OY0A 3JQDA 1UK8A 4K7JA 2G9QA 4UHJA 2YS7A 1L7RA 4FONA 4GX1A 3QMWA 2R6AA 5C1DA 3I83A 1PJTA 2BP7A 3K9FC 2PUAA 2FZEA 2ZUSA 3CLKA 2ZB3A 4DT1A 5I01A 2W6QA 4BECA 4DMRA 1OLXA 2GVNA 3FH0A 3L7MA 2VAXA 4XCVA 3JASA 3MHTA 3HXMA 4P4NA 1TI7A 3WJAA 2NO7A 4CTNA 1U8FO 4RF4A 1E8DA 1Y7TA 2Z56A 2Z95A 3CJTA 3P20A 4RLFA 3DUWA 5AI6A 4CR6A 5K0FA 2H07A 2HK7A 4UPVA 5EQDA 2VUSA 1BRMA 821PA 2ZJ6A 1JA1A 1O0SA 1YJBA 4MR7B 2F4NA 3I05A 4L8GA 5BP7A 5FOUA 1BD3A 3ELYA 1K7FB 1XEXA 1M6VB 4I36A 1YS2X 4IJVA 2JGFA 3NV7A 2QE7A 2Y0BA 1I7QB 1QOQB 1CJVC 3DC7A 2PD3A 1P91A 1G55A 3IKVA 1P3Y1 1SCIA 1UDBA 2FPRA 4I7EA 4PZZA 3BL8A 3Q40A 4PCLA 1YVRA 2ZW9A 2OCXA 5KTNA 2ZZKA 3HI4A 4DA0A 1DKOA 3DYIA 4OB8A 3KPYA 1Z2AA 4BAGA 4C7BA 1QGOA 5B30A 4TUYF 4B73A 3E9QA 3IUYA 3K92A 3PXAA 4KVAA 1GZVA 1NXTA 2R96A 2GF9A 4M0UA 3ET4A 4E07A 3AF2A 4ER5A 1EGMB 2JZNA 2Q8QA 1LS1A 2HA7A 2CHUA 3EVCA 3LUBA 3OIUA 3BFJA 3F96A 1E98A 4N3NA 4U7JA 3HJAA 1WHTA 4MXDA 2XZDA 1QBKC 3ZU5A 3IMKA 1OYWA 3UJ9A 2CHGA 2GPJA 3I04A 2CY0A 1IWPB 3T5CA 4DV1B 4OQMA 2RDMA 4ZOLA 3D6JA 2HA6A 3DBHA 1T34A 4WL0A 3T1NA 1VJTA 2YHSA 3D0OA 4G84A 4C0HA 4GS5A 2IBTA 1LF5A 1SVWA 4PPYA 2OZEA 5B12A 3ND6A 1QYDA 3UH0A 4G1EB 3DE1X 4UQPA 5JH7A 1QG2A 4KQJA 1XPRA 1HTBA 3FHTA 3HVUA 3PQ4A 1K6EA 4BJ3A 2RAVA 2CNOA 2OFFA 1VCMA 1Y8CA 4PAQA 2CK3A 3VKVA 2QQGA 1MX3A 1K97A 3RVNA 3FTFA 3BSFA 1OGYA 1XK6A 4IHAA 5BT9A 1LQUA 3DD1A 5THKA 3R7NA 2R1TA 3HLKA 5J5AA 3U39A 1SM4A 3EBOA 1L0BA 4UBJA 4DCUA 2J32A 4HVAA 1PL7A 1VJCA 3TKYA 3L43A 3NYQA 2Q2QA 3C87A 1HX7A 3W8NA 4IIUA 2PR7A 1LLQA 3E1GA 3KPUA 4AECA 2BM0A 4R16A 2LWIA 1HT3A 1P4JA 2WUDA 2O2SA 1Y9JA 2Q0QA 1P1BA 3ICWA 4NBRA 3TDKA 1E1NA 1EX6A 1WZIA 1ZMRA 5K0NA 4DBLE 4DLSA 5JADA 2WLTA 2WHEA 5FWYB 2REOA 3VR6A 2JFBA 1I14A 3GIDA 1L7QA 2BIFA 3KQQA 3PDJA 4QLAA 4W63A 1DHTA 4MIKA 5LP6C 1Y42X 3RKSA 4CQMD 3VSDA 2PXAA 2F90A 3ROQA 3AVWA 2HLDA 3VH1A 3RDPA 4LHYA 2R8RA 1NQAO 2RGEA 3EBPA 3C3EA 3I6IA 1SOMA 4IOMA 2M6LA 3VZDA 1GL3A 4EG4A 4C78A 1AO0A 2F1RA 2P3LA 4H35A 2C9DA 3EIFA 4XWTA 4GQIA 4JEIA 1GU0A 3R8FA 2IU3A 4MV9A 9ABPA 1O95D 5A71A 3SEFA 4IP0A 4HQRA 4JROA 1EZ4A 1JHYA 2CE7A 3LFHA 4BOYA 2NPIA 5FHQA 3N8GA 2REBA 1KHHA 4BQOA 4J6FA 2D3TA 1DARA 3NIBA 3FMFA 4MKZA 3OLYA 3UBTA 4OFWA 1DINA 3BXZA 3VUFA 1C7IA 3HKDB 2VDPB 3ZY2A 4CEIB 2PS9A 4HDAA 3KSAC 3MWJA 1JQ3A 4XFDA 1GNLA 1HNXB 2Z5GA 2UUPA 4JT8A 4IIFA 1R4MA 1Z5OA 3O8NA 1GEEA 3VU9B 2PVCA 1S8OA 2IUTA 3NBKA 3QFTA 5JZBA 1BXZA 1JX6A 2OOKA 4J1SA 3UJDA 4OBXA 2B5WA 1C9JA 2IL1A 3DEJA 4G9EA 3SKYA 1ODSA 1CETA 4AMZA 2HMTA 2YFHA 2MSLA 4EHAA 3IHKA 2H1SA 2NU8A 2ZJOA 3TLJA 1ZSYA 3GLIB 4ZANA 4NPAA 2PSDA 4I5DA 4B3BA 3GT0A 4EPTA 1DX9A 1KU0A 1F0YA 4HYYA 4OTZA 3DG9A 4RK6A 4TRMA 3WAGA 5T73A 4I5EA 4YQZA 1LWNA 1KQPA 2LKCA 3PXDA 4UEOA 5B2FA 3Q9NA 1W36C 3EHDA 4WXEA 3N8NA 1E2JA 4RHEA 1XVUA 3B5IA 4KODA 4FU0A 1NR7A 4QYXA 1PWYE 1YNSA 2WYOA 4HCJA 2QRGA 4PG8A 1DP4A 1Z6YA 4AN1A 5EJ9A 4WOKA 2WUGA 1NLUA 1VECA 3EIOA 3PPYA 3CZMA 1S2MA 1YGPA 2QN3A 4JC5A 3DOCA 3A2NA 2JIRA 1FC0A 1XNRB 1Q44A 2FI1A 2HDNB 2VDOB 2IDJA 4P3NA 3S7ZA 2GX6A 3TI9A 3AF4A 2A4KA 1VBFA 2DUWA 3GN2A 3PD1A 4PC1A 4QDXA 1N7JA 4WZAB 5HZHA 2VHUA 4FIDA 4CM9A 3EA4A 5A02A 1IPFA 1P45A 1DQYA 2I1LA 2ZIXB 3KJXA 4RQTA 5DSTA 5LQRA 1GHTA 3G2PA 5FOXA 1R4NA 5B1SA 4CHGA 6REQB 4ICIA 5JARA 5IVDA 3PQDA 3Q9UA 1X3SA 2FQXA 3M6WA 3N86A 3RWMB 2WI8A 2BUAA 2P5SA 2NZ2A 1FX0A 1NUSA 4V0MA 5T4FA 5I7OA 3PC8C 1VB3A 5ENVA 1KK3A 5FBRB 5IAJA 2IBSA 2JCXA 4ABYA 1KYTA 3S2EA 4D9FA 1BWPA 3RS3A 2OD9A 1CEEA 4TYPA 5FPHA 3GH1A 4EABA 4KR2A 4HRVA 2OVFA 4L9AA 2JANA 1UQUA 2V6GA 3GJ0A 4MRVA 4YR9A 5SZJA 4BNJA 1C4OA 2FQ1A 1XMVA 5KYWA 5F7ZA 4PNZA 4HLCA 3GZ4A 3WBJA 3LVBA 4CKBB 4EPVA 5JXWA 2UYCA 1NFRA 3IMEA 1AXRA 4HT3B 4FMCB 3BKXA 3LT2A 4D0SA 4PZAA 2EFHB 3OZTA 2UXDB 5EQJB 1N2XA 3SQMA 3KJNA 4C4TA 1ADJA 521PA 2CDAA 3CZ4A 1J25A 1WQ4A 3HM2A 2UYHA 5EZQA 2G72A 4RM2A 4U7GA 1Q20A 3KZNA 1W5EA 3TSOA 2DQ4A 2H17A 4DOMA 4YP5A 4DCCA 3SC2A 1CT9A 5JE8A 3O82A 2J31A 1K6XA 4GQAA 5A3RA 1VHWA 4CLDA 1EWQA 3RWBA 1FFXB 1FTQA 1D5WA 2BT4A 3OT1A 2ZBVA 1M8PA 2BJHA 2OHGA 1JR3D 2C7VA 1X7WB 4HQLA 3Q98A 4HSEA 1Q92A 1GFSA 3FN4A 4WZ6A 5E4TA 1X1SA 2CFSA 5BOVA 5K0LA 3HV2A 1T4DA 2PS0A 2WQZA 3VNSA 4B4KA 3E8SA 2ZE8A 5E3IA 3OZBA 5T3UA 1BN6A 5FH9A 3A0RB 2GAJA 4NBNA 4EY6A 3PGVA 4XGRA 4RXTA 5E0OA 2ZM5A 5JAHA 3QV2A 1TB4A 3NU1A 3NXSA 3KYCA 4RGBA 4L4ZA 1F06A 1U0NA 1WHSA 2X4DA 4HRYA 1Q0QA 2OZLB 5K51A 1ZD5A 3GQBB 1A5AB 3GOQA 2ZWIA 4MVJM 2Q7XA 1JQ5A 2D7JA 2N1MA 3ZWAA 4AWAA 3TL3A 3U4QA 3MS4A 1KSJA 4UNSA 4CKCA 4BRWA 1P29A 3FG9A 1O5OA 5HX7A 1SUAA 5AVRA 4N48A 2FN8A 1E3DA 2EBFX 2UYYA 4IIGA 1KMQA 3W9SA 2VP3A 3ZJYA 2BRUC 2HZ7A 2YRFA 4C43A 1GR0A 1T9KA 1HQYE 2VLBA 2Z2ZA 3FTCA 1QLWA 3B8HA 4EB3A 3HUTA 4KL8S 4KV9A 2HAEA 4BE7B 5A7HA 1Z25A 5I9MA 2HX1A 1E1QD 4GWLA 3W06A 5IDYA 5LJIA 4XLTA 4BNTA 4DTCA 3ZGVA 2HRBA 1CR4A 4XYGA 4FSHA 2PKEA 3R9KA 4CKEB 3PENA 5KC9A 4LNUA 2JLXA 3W5AA 2IPOA 3EA0A 2AZ4A 2YOGA 2NZYA 3TE7A 4R8SA 2K4MA 3FZEA 1X7GA 3FIUA 2CMKA 2PO7A 3IB6A 3DMGA 2AG6A 3NIFB 4KU4A 4YYZA 1C0LA 1MR3F 1PT6A 1FYWA 3KQPA 4OGWA 2FPGB 1YI1A 4FDMA 1JBEA 2GD2A 3C7KA 5B58T 3J81A 1GDTA 3SR3A 4XRRA 4C5AA 1IY8A 1BS1A 2HRRA 3SF8A 1U28A 4KAJA 4O89A 3AX6A 2DC1A 3ONNA 5CGZA 5LZ5A 1RBQA 4PY2A 4ZXFA 1JLKA 4QPZA 1K8YB 2XBLA 5KCZA 3JYLA 2VZEA 3R20A 5G3YA 5KAPA 4HAUA 4HNAB 4BNFA 4LJRA 2ZSEA 4E0BA 1G3QA 1KKMA 3PC2A 3OZSA 1AKNA 4DIFA 1T2VA 2XSZD 1XZBA 2QVZX 3HRHA 3MCZA 3WKEA 4A0SA 4W5QA 1C0KA 2BD0A 4WN3A 4JR1A 1PNRA 4JD5A 3MMNA 3FTQA 1TZJA 2XW6A 5DGTA 4E7OA 4AZ0A 4KFRA 3BBLA 2BKAA 5G02A 3ZHYA 3F5QA 1E77A 3NAGA 2AOUB 2WD8A 4YQEA 4O08A 2D2XA 1J21A 4YLGA 1QUEA 2GK3A 4JVSB 2CCKA 3MUFA 1FXWF 1PEYA 2Q3HA 3GDFA 3LKZA 1SIOA 3OCJA 1MRNA 3SYLA 4YT4A 1DZIA 5H80A 4JFAA 1CJMA 1UKVY 3CFYA 5ED0A 3U4HA 3ZUPA 3QVWA 4BO7A 3SFTA 1ENZA 4C3OB 5FIUA 4MULA 2B1QA 2IWHA 1ZO8A 1DC5A 2RI6A 3BKWA 4IL5A 4CTMA 2HB6A 4MARA 1VYUA 2EX1A 3EVDA 4BKQA 1WKCA 3GVCA 3GU3A 4QEZA 3L6OO 1F12A 4LBVA 1RAAA 5K3SA 3T9BA 5KQGA 5JCZA 3A1WA 1OBFO 3ETDA 4UBNA 2NZ8A 3PEEA 4RV5A 3FCSB 1KQOA 4G89A 4FGJA 3AESB 3JWHA 5B1HA 1T9CA 4E11A 4K03A 2M1ZA 3TUTA 3FNRA 1W4RA 5JRDS 1PQYA 2QTTA 1A97A 4WKBA 3EEBA 3UFXB 5DRYA 2IUSA 3I4FA 4PG6A 2BBOA 4PCAA 2RBEA 4TLEA 1XMQB 2PJUA 1A7JA 2JCSA 3L6DA 3TQTA 1TFRA 1QGZA 3MLEA 1AUPA 1MC4A 4R7GA 2RGCA 2RJNA 4KIGA 3H0WB 2SCUB 4MWEA 2DBZA 3JD4A 3O03A 4O5AA 2J3LA 3AP3A 5KREA 3ADPA 5DTMA 5KYYB 3Q0TA 1I4WA 2D59A 4RHXA 1GDHA 2POQX 3PHBE 4JQYA 4J3JA 5EHNA 3VR2D 2Y2VA 4DR1B 3L1HA 1R12A 3DP9A 3FOBA 5T64A 3PXGA 4HDRB 1TLLA 3R9IA 4M8LA 1SZDA 4MUHA 4BB0A 1ONNA 1JAIA 2QD1A 4N6NA 3OA0A 1CJUC 3B8EA 4XIGS 5DCUA 5JYAA 3BHJA 4RD6A 1ADCA 1T9AA 4DLAA 1KO7A 3ABIA 1P9OA 1R0BA 1EWTA 2CLKB 3C43A 1ZW6A 4ZO4A 3TXAA 3WDLA 4PGHA 4I6EA 3V46A 1VGVA 2HUNA 5B3LA 1TK2A 2G36A 1TIBA 2KBEA 2V5UA 4KWEA 4RKEA 2PQ0A 4QD3A 3N2EA 2PMCA 1UADA 3IAEA 5DN6A 5FOWA 1EFRD 3EGDB 3HGQA 1YJQA 3AQIA 3NWBA 4P4SA 3OM8A 4R6XA 1Z08A 2ICAA 1CG6A 3BPSA 2ZBGA 4M1WA 4V0SA 5J2UB 1BWSA 4K81B 3TEMA 3RYFB 3HDJA 4DQXA 1G20E 3X3HA 1ZMBA 3CIOA 4HBGA 5CBPA 2F3PA 3H5IA 3NKVA 4C7JA 1E2IA 1YA6A 2PVSA 1XU7A 3D5QA 1GYPA 2IH4A 2FG7C 4A92A 4L95C 3SZRA 3JQ9A 4L5JA 1LX6A 1QWSA 5FB3A 1ZGAA 5L3QB 1TAHA 3OHPA 3CH7A 3GYGA 4X93A 2W8BA 1M6YA 4WERA 1QG4A 4KR0A 1UAYA 4G0ZA 2CEKA 4OOEA 1HM5A 2V1UA 2D5CA 4OHXA 2NMVA 1VA4A 2CL0X 5JRJA 3I72A 3FTNA 1H0KA 4C7KA 1SCDA 1AGRA 1P2BA 3OWOA 1G21A 1Z3CA 1G20B 1FYDA 4H3KB 1QQ5A 4GWGA 4FCCA 1NR5A 4YMSA 3HMKA 3RFTA 5I8WA 2C84A 4HWPA 3WNQA 4DQVA 1TEXA 1Z6GA 2WJIA 4DIUA 3UG6A 2D0OB 2QM3A 3LY9A 1PJZA 1BEUB 3LY7A 5L3ZA 4X8OA 3WL6A 5JAZA 2JFHA 5DX1A 4TL8A 5ERXA 2IIPA 3U61B 2O0KA 1JEOA 1Q16A 2ZS8A 3C6ZA 3CB2A 3H8SA 4K46A 2I7VA 3ER8A 3V8PA 2CLLB 4D57A 4EDFA 2XWQA 5HF6A 1KI6B 1PW5A 4UCFA 5CX1A 2UZAA 4XDHA 2GZ3A 3NT2A 3GQVA 5T6BA 2JF0A 4E5MA 2O14A 1XTKA 4MROA 2BHSA 3ZLVA 3WIBA 4GLFA 1SBCA 1B14A 4NU8X 1GDDA 4PSAA 3CLSC 2I7XA 3D2AA 2J0UA 3TPZA 1RZVA 1E6MA 3IQEA 3HP4A 2GHQA 2VDJA 2XRFA 3EP7B 2P11A 3B85A 3JARB 2ANBA 4G8DA 1U7OA 3N0TA 3BMCB 2BKUA 2F3SA 3JW8A 4QGAA 4YXFA 3CF2A 2JFVA 1E4VA 4C2TA 2C2KA 3CVOA 1M5RA 2AS0A 1D8TA 1F2UB 4KK3A 4LXQA 4AY4A 5C4MA 2OKCA 4POOA 2CJXA 4BLOA 4FBMA 4Y9UA 1FY2A 1SBYA 3PXXA 3OICA 4J1NA 5EMHA 4I3HA 4LJ7A 5KSYA 1XKTA 3MM4A 3TEJA 1V7QA 4QJIA 4ZT4A 4LXYA 4OP3A 4CUZA 5C5CA 1GTG1 1CY2A 5C7YA 4JQSA 2VJKA 4KDFA 1EVZA 4U9IS 1B74A 3TMYA 4ZCRA 3IQFA 4DLRA 1R0YA 5J1SB 4DFDA 3WB1A 3TCNA 1Y8RA 2ET6A 3ZYZA 5ALZA 3ADKA 4Z9BA 4B43A 4DR6B 4EUNA 1YC2A 1QK5A 5GADl 1G3IA 4U2KA 3BSYA 3H2JA 3AI7A 3ILSA 1EFDN 2XE8A 3CG0A 3CRNA 2X0EA 3VOSA 3RYIA 1YRBA 3NHWA 3EGVA 3PA6A 1U5BA 3OCUA 3S2UA 4ZVNA 1X39A 3EZGA 4D9MA 4XSHA 3U49A 2I1WA 4WPGA 1Z68A 5CW1A 4B5KA 2J7PD 2BISA 1PU2A 3SSNA 4QKQA 1QU2A 3E8MA 1GTL1 4U9UA 2PUBA 3K4PA 1JTVA 1U80A 5EEHA 4BLVA 4BV2A 2NAPA 3E53A 3FMIA 3I8OA 4LZAA 3LTNC 4O5OA 2PSHA 4KBYA 1G5FA 2Y99A 3X0DA 2GZHA 4ZYLA 4HQ6A 2PGJA 2ZZMA 3I3SR 3LOQA 4ETWA 5IZ4A 1Q15A 1QDUA 3N3AC 3OEWA 3DHVA 1G8HA 1EBFA 4K9SA 4QVGA 4WUVA 2ZIVB 4CN9A 1OYVA 3W0LB 2F3UA 4NZNA 4FTWA 3PTLA 1YFKA 2O8VA 4GC5A 3T3MB 3N74A 2JHFA 4II2A 1CY1A 1SU6A 1WEKA 4Z7JA 1MQ9A 3UBMA 3AW9A 4NCIA 4NEGA 3EX7C 2IKQA 3F5MA 4O02B 3A4NA 4PGGA 4WGFA 1U0JA 1TIKA 4WV3A 2WYHA 1FZTA 1YHYA 4JZYA 2X0IA 4TV9A 1D4OA 4DSZA 2GN0A 2Q5JA 2ORWA 1PFUA 4NQRA 1BVRA 2QQFA 4EFMA 3T7RA 3UIEA 3UOGA 4QYIA 1DV2A 3PDIA 3OZDA 4IDNA 4NR0A 5EWMA 2A0FA 4L1KA 4KC0A 1N2IA 1LNQA 2HJWA 4MI1A 1NXPA 1JJIA 1BQ4A 3GA0A 4LRQA 5C3MA 4V1CA 5K6TA 1YUMA 2YINC 4MPJA 5E6SA 1YR3A 3VZQA 5CXXA 1F6BA 1IZ0A 2BZSA 4J7XA 4WN9A 4N0QA 5FUMA 5JY6A 1Z62A 1ZC4A 1L1RA 3DKKA 1WCYA 2OR3A 3EH1A 1R88A 3BCUA 4FFNA 2XOKA 4O4JA 2XIQA 1G8FA 1L4BA 3TECE 2TMKA 2XA2A 3MS2A 2D1QA 3A4MA 4JSRA 4RK5A 4NCXA 3RC1A 4HI0E 1QG6A 4M8NE 3OTWA 3R3WA 1UK9A 1G63A 4FLMA 4UVHA 3UJ7A 4C30A 2HK6A 2V8OA 3AUAA 2J6BA 3EVEA 1OXXK 1Y5IA 2OV4A 3HU1A 2BGGA 1YMQA 1M10A 2V7VA 3ETNA 4RH0A 4AN0A 1CY7A 2GESA 1THZA 3R0VA 1N2CA 1GTZA 3PQCA 4J2HA 4QTTB 1N4DA 4B3FX 1U0BB 3HDGA 2ZTUA 1ZI8A 1Y7PA 4B40A 3FUWA 1IXRC 1CJSA 1HGXA 2FRDC 4L3VA 1CUIA 4L0DA 4RJIA 4BJ5A 4ZGBA 4FFBB 5SV2A 1O54A 3P9QA 2PUCA 4DHEA 2XTJA 3QFCA 1U2SA 1V11A 4FYHA 4QHTA 1D04A 3THXA 5IJ0A 3DB2A 1AXEA 1ULAA 4PR3A 3UYLA 1XA0A 2LP4Y 5REQA 3I76A 3I12A 4BX2A 5KVCA 2WIGA 3KLMX 4Z1MD 1IC6A 2UYGA 5BOSB 3QWFA 4LZLA 5H3CA 1USVA 1BWQA 4RULA 1D4FA 2VRCD 2ZI9A 2NTEA 3TD6A 1XTIA 1JIXA 1C3LA 4YHHB 1J2EA 4NEHB 2VYVD 3PWSA 4IMJB 1YTUA 1B8OA 1IB6A 1JQBA 1YQUA 4JXZA 3UAWA 2E21A 1QE5A 1XXLA 4D4JA 4QXOA 1UAGA 1ID8A 3II6X 4L5IA 5C81A 1FP4B 4HNVA 4UOQA 1OC2A 3AY0A 1CZKA 1HYQA 3T99A 3UJPA 2XX3A 4YA6A 3GRAA 1O94C 4HB3A 1YDMA 3K9QO 1ILWA 1XAHA 3H65A 5NLLA 4B6EA 3AJAA 3L18A 1SUBA 4J9UE 4PONA 1V8PA 1RTTA 3MN1A 3SLGA 2YNMD 1NU8A 2XITA 2BTQB 4IZ6A 4PLYA 2YJGA 1LBQA 5IWAB 2VNAA 1XZNA 16PKA 4E21A 4G1CA 4PZUA 1IUOA 3LPAA 1MIOA 4G0WA 2NW6A 4FWIB 3NEAA 5CCEA 3FI0A 6Q21A 2XNKA 4BFUA 1C29B 1EUCB 2W4IA 2FJUA 1QAMA 4AWBA 1XMIA 1EK2A 1KZ6A 1FSSA 2P1ZA 3GJ5A 5I8ZA 1RP1A 4MYUA 5D1NA 2ARKA 3C1UA 2VF2A 3R3VA 4TKVB 1T3TA 2NGRA 2QX6A 1XZGA 2C5GA 2JAWA 1JHVA 2Q41A 1DWOA 1U8CB 2QY6A 3PDHA 1Y8QA 1JT9A 1X8LA 5D6OA 1NJ5A 3I2HA 1OREA 5FUXA 1X7HA 3I37X 1QYXA 2WSYB 3O26A 4B4UA 3KT8A 2HYIC 3K9LA 4MYTA 4EMSA 3KQWA 4HH1A 4QHYA 1EB8A 3D6VA 1XA3A 2DULA 3F8SA 4KPYA 1N5OX 4HEA1 1E6KA 5GJCA 1UJ2A 4ANFA 3R5KA 4OFBA 4L07A 1IN1A 3F4KA 5I5GA 4KR6A 3NJ8A 1N2OA 2VIIA 3QBTA 3W3AA 3NBMA 3IRVA 5TDHA 5MF6A 4M6WA 3IALA 4LDJA 2PU7A 5BYKA 1ZWLA 4F1WA 2O8EA 2EBWA 3AHDA 1OFUA 3UCXA 4DCSA 1K8QA 2CWDA 4J7UA 5KJ6A 4L4YA 2Z6AA 1Z4LA 3MJDA 1RMTA 3LSTA 1Y6GA 3LUKA 1BNCA 3NYIA 2WAAA 4DR5B 3RVOA 4R1QA 4M1KA 4M9UA 5DJ5A 5DYNA 1O58A 1BEZA 5EE1A 4Q01A 5COAA 2G3YA 2QMHA 3LUGA 2BKVA 1G1MA 2D2VA 1S2NA 1FYXA 2JK0A 3AHJA 4M86A 3KS9A 4P6VF 4WX2B 1QO0A 4GD3Q 1JIIA 1D1QA 2LR0A 2PR2A 5JJBA 1G9XA 1JXQA 3N0WA 5MGBA 4DDKA 1CNFA 3VISA 4BPRA 1LC3A 3PI6A 5IN5A 3W8RA 2JLQA 3ZXSA 4EY5A 4HX5A 1H0SA 4Q0MA 3SZOA 5IJXA 5EJ7A 4CG1A 3N6VA 3UPUA 3TWOA 5CBKA 3A1VA 1SBQA 3JWEA 2PUTA 3PE3A 1W85B 1UODA 1YJ5A 2GN6A 4I50A 1JPUA 4PO1A 1SULA 3T61A 1G4UR 1UDWA 4U2DA 4ZRNA 4UNRA 3HDVA 3TVTA 4KWIA 5BY2A 4I5FA 4IH4A 2HWKA 1DG9A 1RFGE 5ALJA 5J1TB 4EJSB 4JI2B 1VBNA 2FJ0A 1NBEA 4X6LA 3ZJXA 2FUKA 2ZWVA 3HA5A 1O9GA 4HFJA 3W5CA 4N3BA 4G2TA 2X58A 4A4DA 3L40A 3PIIA 3R5SA 2O19A 4JHLA 1K6IA 2B0JA 3KCNA 4JP1A 4OJYA 3GFOA 4JR0A 4ZOCA 3TTUA 3W8DA 5BN5B 2VSYA 4K05A 5JBQA 3H9BA 4TN1A 4EHFA 4FNGA 1CFJA 3E22A 3P0HA 4JOQA 3GT3A 4MVJI 2A3RA 3P9PA 3TXXA 1CY8A 2VP2A 4B3MB 2XMBA 3OJXA 5LFAA 3NEJA 1AHHA 2R8BA 1BSVA 2QYTA 2WUEA 5A3VA 3OCWA 3RVRA 1O6FA 2XZPA 3HYTA 4WLFA 1BXRA 4TSFD 5KKAA 1RP7A 4NAHA 1QCYA 5A06A 3DVRX 3EGXA 4AX8A 1XBTA 1IXZA 2OL4A 3FSEA 2X0NA 3O95A 4LHXA 4LSGA 1PG0A 3PBKA 2QV7A 1E9AA 3K8OE 3LUPA 3L6CA 3HEBA 1ZHHA 1A95A 4TMXA 1E5TA 4B33A 1E2GA 1LPNA 4RZQA 1U4NA 3GAMA 4PICA 4MVJD 2PLAA 2Q3BA 3D31A 3LY5A 3OKFA 3D7KA 1D4AA 4KO4S 2VHQA 4BKRA 5BRJA 4JIMA 1BDJA 3LPMA 4E5KA 3REOA 1V7ZA 3DCNA 1XQ1A 1BXGB 3NC0C 1WW2A 2JPDA 2OKGA 5EQTA 3TLGA 1PR0A 3PUHA 1FFBA 4PYRA 3SXUB 1NKSA 2NO4A 3OCYA 2FZVA 4N8SA 4TL6A 2JBWA 3G02A 4E22A 3U1BA 5DGHA 1OZAA 2EZUA 1OR8A 2P9GA 3L7AA 4M55A 4AS2A 2P8SA 3GLTA 3D6NB 1BE6A 1DOZA 4IOLA 2A9JA 3N2NA 5LLDA 4Q12A 4C0BA 1SUPA 3ONVA 2A4MA 4NMLA 1EB9A 3N2GA 2WIDA 3Q7TA 1JYEA 3F1LA 2RONA 1GGFA 4JYAB 1XTTA 1YZQA 4Q82A 1AF4A 3X1ZA 1AGYA 1NMZA 2XQGA 3O73A 4RA9A 3EZYA 2GEUA 5TVOB 3HYLA 2GCPA 4UFOA 5C1OA 2F8MA 3WP0A 3MCWA 4B6GA 2Q5FA 4NY1A 1NBWB 3IEXA 4OREX 5D1HA 2EF1A 4EYKA 4WBNA 3OQ6A 3AJ9A 3R7DA 2HO4A 5CDFA 1PFYA 4ZZ0A 1PJSA 3P0RA 3MQFA 3D0RA 6AT1A 1IU9A 1HMPA 2QXUA 3PNKA 5JJCA 3L7JA 5BSWA 2B2XA 4OI2A 5IBRA 1P2GA 2H2IA 1EJ6A 3M3PA 5DBIA 3ZWOA 2J6CA 2BHRA 1IBMB 4B3TB 5F64A 3P5SA 1FX1A 1NNI1 1NMSA 2VF4X 2VUIB 4DMKA 1OAOA 3WGNA 5EZ6B 2Q6TA 3CISA 1K7EB 4O4LA 2NPFA 4V38A 2C9OA 4TM7A 4YAKA 3HBLA 1NBIA 2YL2A 4HDMA 4EHNA 2K7ZA 4MGYR 3JY6A 1KEPA 4RHYA 3TSZA 3TZBA 1PV1A 1XWIA 3EQ7A 1G3UA 2R2AA 3AR5A 5B3KA 4RVSA 1E94E 1DAHA 4BNUA 1N36B 2FUG6 3UFBA 2DLCX 4Y2YA 1QFXA 2XCIA 1II0A 2YY5A 2QQ0A 1ATZA 3PNQA 4XXHA 3S2SA 4HDKB 2VRCA 2G8LA 5K99A 4G1BA 2HH9A 2WWWA 4NICA 4F8JA 2ALJA 1NFQA 2AJLI 3VM6A 1RWQA 1PDOA 2V7XA 2Z8ZA 3CLTD 3F8TA 2V7TA 4US0R 1OV4A 4FOLA 3DE4X 1XQYA 3A1TA 5JS7A 2P67A 4Q4JB 5GJWC 4DJJA 1QVRA 1CUDA 4M9QA 3CZPA 4MUIA 2DMRA 3JX9A 2LCIA 4KH0A 3TIGA 4OQFA 4C0LA 2FMUA 2C2WA 4V39A 4P93A 2P4SA 4V24A 5EWJA 5GV7A 3LOUA 4Q7JB 3SK0A 3KQUA 3S7TA 2I4NA 1S0UA 4O29A 2BVNA 2VO1A 3ORFA 4YRLA 3KBOA 2HLDD 4TRRA 1H2WA 5K3OA 4FWTA 3C2QA 1OOEA 2GN9A 1DJQA 5BUQA 4D3FA 4UMFA 1RYDA 2O1SA 1TLTA 4KMOA 2CFOA 1ELOA 2BHNA 5BUZA 3CNQS 4IUBS 4LF6B 2X2FA 2JFFA 2DETA 3UXYA 1IN6A 3IP3A 1Y3FE 3WRXA 2GLXA 2QVBA 4UHBA 2Y68A 4XDYA 2Q2WA 4W5RA 4YEDA 4DF3A 3G68A 1IH8A 1ZD1A 2ZJ5A 4LRSB 4ZPXA 5IT9A 2BI4A 3AF3A 3R5TA 1NZDA 2OO5C 2Q46A 1ID1A 2QRUA 1RJGA 1EBUA 5E3JA 1L5RA 4QDTA 2P90A 1E69A 1FFSA 1KYZA 5G4KA 2R2GA 421PA 3RADC 1JLLA 1M34E 3IMFA 3RIGA 2Q6KA 4ZI7F 4CGZA 5BPHA 5JC8A 1MQSA 1N77A 2JBAB 4EEZA 3X1DA 1D2HA 1ZMTA 4HDNB 2QYOA 3W3ZB 1C1XA 1GV1A 2XJ4A 3O4IA 4NYJR 2BFEB 1X9IA 2RC5A 3W2GA 3AETA 5K1ZA 4C07A 5AW3A 1W0JA 1XRJA 3FIJA 1YB1A 3G3EA 3BFXA 2BE7A 3KT6A 4TLBA 1TOAA 3LXXA 4UNIA 3T3EA 4B46A 5KJ1A 3BT7A 2RHHA 3B1WA 3DQZA 3AJEA 4YMVA 1DRKA 1X94A 2H54A 1RYFA 2PD6A 3FSGD 1KDPA 3K2EA 4PX2A 2YUTA 1ML3A 2ZUBA 1M1YA 1XCMA 2FEOA 4IF4A 3QXSA 1RWVA 4LXTA 1YDWA 5CUQA 2FX2A 5KHOC 1QH8A 5JYDA 3IAM1 2C7QA 3LRXA 2V03A 3W9BA 2AMYA 3CMMA 3BF7A 2DWQA 2VHZA 4I5GA 1HEYA 2PBZA 4F5ZA 3EYWA 1Y9EA 2UZ3A 4N8DA 1NA5A 4FYJA 3HXTA 4FFLA 4J91A 4FCWA 4CT4B 5JH7B 3EWAA 3ODPA 4HFNA 4MWOA 5LLSA 2CKDA 4WJKB 4LY9A 1KY5A 3U6BA 3W5BA 2UYOA 4KI0A 5JBIA 4BC1A 1XEAA 1RAHA 2QZJA 4EYOA 5JCJA 4I9GA 4JJZA 1M34A 2NT3A 1AX9A 3IS3A 5DW3A 1WB6A 1PJAA 1IRIA 1PIWA 1SOVA 2X2OA 4K9OA 3UTCA 5KTOA 3MGGA 2QMOA 3CRVA 3DLIA 3LDGA 4WLOA 3E7DA 3UW1A 2ROQA 1RMQA 5AW9A 1FXUA 1NXVA 4U5QA 4EJSC 4PYJA 3V8MA 3RSLA 4GI5A 1CJKC 1JV2B 1INLA 2HYDA 3BG5A 4PX3A 4YGYA 2SBTA 2VATA 4RK1A 1ONSA 2JFOA 4MV1A 4TLAA 3U3RA 1T6NA 3DFMA 4PYOA 4N7MA 2V4UA 1GRVA 3EDCA 3NVDA 4FBLA 5D86A 4X7PA 5CA0B 2FMTA 1GL7A 3AEQA 3IHWA 4FDLA 1WUHS 4NL4H 3RHFA 4CLRB 2Y1LA 5E2IA 3D7NA 1WMEA 4OKIA 1ZK0A 4N40A 1E3SA 4N41A 3W90A 4D6PA 3BMQB 4XB6B 1GO2A 4Z5XA 1Z7BA 1TD1A 3ESXA 3PHCA 5K6AA 3I9V1 5BUCA 4PHCA 3EFBA 1SXPA 1X92A 1YD7A 1T8YA 1U3VA 1SVMA 2QJOA 3GGSA 4J03A 4JODA 4HGZA 4QQFA 3R4CA 4D82A 3MWLA 2NTVA 3H86A 5CLIA 4ZVMA 2P77A 3ZHRA 2ZUUA 3I0MA 2P5TB 5JISA 3ESYA 5LVAA 1ZRMA 3PNYA 2R5NA 5LSAA 5KJCA 1K5DA 3PIRA 4C14A 3T3OA 4P7BA 5C31A 4A8PA 2XKAA 3L77A 2DFKB 2AVNA 1WPXA 1PSWA 3WYBA 2FSIA 3O0TA 3SCZA 1F8UA 4NECA 5HJ7A 4D43A 3UJBA 1Z26A 2RHRA 1PS9A 5JG7A 4BTLA 1T26A 3MQ2A 3SQDA 2FGJA 4Z4EA 4X8MA 2VRNA 2YMQA 5JPCA 3QMVA 1HYEA 2D2FA 3E82A 1CUFA 1D2RA 4GOOD 3ZTWA 4DIMA 5CITA 3QPDA 5CHEA 2YXBA 2BFMA 2PGXA 3I0NA 2C4HA 2X9QA 2Q5OA 1KJ9A 5CNKA 1VPLA 4LBYA 1I2AA 3F3MA 3M89A 2B4TO 1Z39A 3N2KA 2VWPA 1Z12A 4RPLA 4F2WA 3Q8LA 1AGNA 2HF2A 2Q2VA 3G2HA 5DI3A 1VCOA 3AOGA 4OM7A 2Y1FA 3HZHA 3MAGA 4JC0A 3VZRA 5HKOA 5F76A 4FMDF 2C7PA 1EAYA 1R6AA 2GXUA 2VP4A 2I0FA 2PRZA 2BH2A 3DS8A 1GYRA 2CBGA 4ARCA 4IICA 2R1VA 4JP5A 2NTYC 1QR2A 2XQVA 5C8DA 4XWWA 4P5EA 1WPRA 1E0SA 3NASA 4G86A 1DBPA 5KU1A 2AR7A 4XYLA 3ZY3A 1SVLA 5BMOA 1KAQA 3KXDA 5AXAA 3IDAA 3KK0A 4ZOLF 2I3AA 1L3IA 4KR7A 3AUSA 4PO8A 3PXEA 3PEWA 4ZC8A 4NBSA 4KPUA 3T7DA 1Y4SA 3EZ2A 1F8XA 3PWTA 1O2DA 4JASB 4MO9A 1POWA 4NS1A 1CZHA 4HGOA 4IG9A 2C54A 3RVDA 3DLTA 4B8WA 2UVPA 2YDXA 3BX1A 4IGKA 1V9SA 2WA1A 5KO2A 4AKGA 3FI9A 2JC3A 4ZO8A 2NXJA 1XPUA 4YRQA 4TWBA 2FYTA 1D6MA 1VKZA 3LV8A 1U2QA 1GUYA 1J24A 3UXEA 1CBUA 3JAWA 3Q5EA 5GZ6A 4RFSB 4TQAA 5C8VA 2BEUB 3RW9A 1Y8AA 1E92A 3B2NA 3SDZA 4KSCA 5HM8A 1K1EA 2UYQA 4ALMA 1KZ1A 3U3OA 3BD8A 2QKYA 3IILA 3KQYA 1RQRA 4BQRA 1Q84A 2OZVA 4FSDA 4JJGA 3K31A 4BVEA 4QDJA 1RYHA 3VVCA 3ZNQA 5I9NA 4C4RA 4XUCA 2YC4C 4TYNA 3ED5A 4WEQA 2WD9A 3VNAA 2D2IA 3CZCA 5HK9A 2VI5A 3R2JA 1AGPA 4MGEA 4CYMA 3OJLA 3BGOS 3X44A 4IO0A 2OOSA 5TEWA 5AVXA 2FY8A 4J76A 1VKJA 4MUEA 2IYYA 4HNHA 4Q4AA 3KB1A 4MSUA 2IHJA 2NX2A 5DTEA 1U0EA 1H8HA 3N05A 5BNWA 3FETA 3O8QB 2DHRA 3MFQA 1K9SA 3L6UA 5DF1A 5DK4A 4RKWA 3K0FA 4LFAB 3OZEA 2CVQA 3ZLTA 4DLZA 4KFTA 1UJMA 5DWVA 2WJGA 3H7AA 1ZVVA 2OLEA 4LWQA 3SC2B