4XB6B

Structure of the e. coli c-p lyase core complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
192
Chain Sequence
MTLETAFMLPVQDAQHSFRRLLKAMSEPGVIVALHQLKRGWQPLNIATTSVLLTLADNDTPVWLSTPLNNDIVNQSLRFHTNAPLVSQPEQATFAVTDEAISSEQLNALSTGTAVAPEAGATLILQVASLSGGRMLRLTGAGIAEERMIAPRLPEILHELTERPHPFPLGIDLILTGERLLAIPRTTHVEVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the bacterial carbon-phosphorus lyase machinery.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr. mg1655
molecule tags Transferase
molecule keywords Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase s
total genus 52
structure length 192
sequence length 194
chains with identical sequence F
ec nomenclature ec 2.7.8.37: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase.
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05845 PhnH Bacterial phosphonate metabolism protein (PhnH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11310 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4xb6B00
2FSUA 4XB6B
chains in the Genus database with same CATH superfamily
5K0CA 4H1HA 4UEQA 5M34A 3CLUC 3MQFA 1YZQA 4LRTB 1RQGA 5DX8A 1WXEA 1U5AA 1Q22A 2Z95A 4BBAA 4CR8A 1NZJA 1RXCA 1SVNA 2XMZA 3K9GA 5T41A 4YRLA 5BSRA 3OPXA 2H4FA 4DLBA 2V7WA 1XDSA 2NMVA 1VHQA 3ILVA 5BSHA 1XQ6A 3EVZA 5BQPA 4AN1A 1ZN2A 3GLQA 5LKRA 2C8VA 3KD3A 5HE9A 1HQDA 4FUQA 1X9HA 1SZDA 1Z0ZA 3O8BA 4K9OA 4V24A 1LGYA 3QMVA 4O4JA 1DBVO 5CRIA 1B1CA 4Q4DA 1ZK2A 4RVCA 4CF7A 1I4OA 2IC5A 1T9DA 4FOOA 4IIBA 4MUFA 4M9CA 3M6XA 4EMUA 1SUSA 4UUAA 1NV9A 3UMYA 2XUKA 3L6OO 3SE0A 3VOBA 1ZI8A 1JQ5A 5LDGA 1P1FA 3NGXA 3HJUA 3WAKA 3ZLVA 3HM9A 3H5RA 1ETUA 2WNIA 4W1PA 3CLHA 3G89A 2WINI 2X5XA 4ZOAA 1C3XA 3IB6A 3GU3A 5AOVA 5C3UA 1B6SA 1EYZA 1N8KA 2IXTA 1QHNA 3LC1O 3KFVA 3WISA 1OFUX 3MJTA 1QAQA 3OIYA 4ROSA 4G9GA 1RJEA 1Z88A 1H5UA 4H3VA 5IVKA 1T34A 5HUHA 5FT9A 3FNGA 3H2SA 5MFPA 4OTZA 1CUVA 3C6BA 4LIPD 1QRTA 4NYMR 1JA9A 1EAYA 1E18A 2FHPA 2JFHA 3OUTA 4WXHA 5CH3A 2IIVA 2BPOA 4FMDB 3BGSA 4MKRA 5LP6A 2AI1A 5LU8A 1P44A 3MRTA 3G7NA 1O6BA 3WIVA 2O8CB 1M7GA 1ZFNA 3NHFA 2PGJA 4DEYA 9LDTA 4YJDA 5KX5B 3QI7A 5KAMA 4CR6A 1PCXA 2OA0A 2NUBA 3FPJA 4H1UA 3VX4A 5AM0A 5DDIP 4EF5A 3UBTA 1PI3A 5FOTA 3QXCA 4HWOA 4Q66C 2OORA 2P2DA 4FE3A 4DRXA 1MHPA 1WD5A 5T6MA 2WICA 4CV1A 5FUMA 4MQFA 1KBZA 2JAWA 4TL7A 4Z9XA 3KHKA 5M2QA 2YV5A 3ELBA 1Y37A 4QXMA 1EXWA 1OR8A 3E9ZA 3SF0A 2JCSA 3HKCA 1G38A 3ZCTA 3BXZA 1QRRA 2DPLA 3CEHA 4D9NA 4EA7A 4MHSA 4GVPA 2Z6UA 3IO5A 5CXQA 1RMQA 4N8DA 1BH2A 2BYTA 5C52B 4FHFA 4DDWA 5HKAA 1QQTA 1CFJA 2XUAA 3PUIA 3QFFA 3UTDA 3WHIA 1O9HA 3MCZA 3FYUC 2DHDA 1N8NA 3KVOA 1QCZA 1EWYA 2HMTA 2OHFA 3S2FA 1L9XA 4K9RA 3O5AA 5I7EA 2QL6A 5EA2A 3D4IA 1L1RA 1TVCA 1SU6A 1E79D 3I83A 2HLNA 1GZDA 4AKIA 1SIBE 4JOCA 4LGMA 4O59O 2P9QA 2OLEA 1E2MA 3GV0A 3QFHA 4M53A 3U3ZA 4AYWA 3NGLA 1QDUA 4YAJA 4AMVA 1XROA 3GH3A 3VU3A 3VM6A 4DC1A 1CJTC 2ASEA 5AHRA 4HQRA 3UC9A 3EEYA 1QCYA 5ALYA 1SUIA 4ALNA 5JZVA 1Y6RA 4MARA 1PR6A 1RMYA 1ZOPA 1T91A 1BVHA 3NU1A 2CXNA 3TLAA 1Z13A 2IZ7A 3SP1A 1PBNA 1T2DA 2W4QA 1PV4A 2V4UA 2AFHE 3ZY3A 2PXHA 2YL2A 3DZJA 5AR1A 2HSWA 2FP4B 3ANXA 4PWZA 3REGA 4BEJA 3QE4A 1SOUA 1EQ2A 2CVQA 3D6VA 4ND6A 3GGCA 4B8YA 4F56A 1AKQA 1HX7A 2ADOA 1ZWKA 2EBHX 4U02A 4J49A 2OHIA 1T8PA 4WKGA 5ALIA 2R25B 1MOQA 3W05A 3KBBA 3QPVA 3WLKX 4ZVRA 4D6PA 3LC7O 5EWLB 4XB2A 3HBLA 2PSSA 5ALQA 2FJPA 1EGVB 1WJGA 1EINA 2BF4A 2NO0A 3DDNA 3KE8A 4B82A 4BMSA 1E9DA 5IEJA 3U3MA 4A0QA 3O92A 1KTIA 3U4CA 1LJUA 2J48A 3B13B 1I6WA 3CNHA 2AGVA 4URFA 1ACMA 5KUTA 1NF9A 3V97A 1QGUB 2VWPA 4MP6A 1ZXXA 5TS2A 3TNJA 3P0HA 2WB2A 2I62A 4EUSA 2PZGA 2Q2VA 5IULC 2DC1A 4XJVA 4N3AA 2O05A 5EE5B 4J2OA 2VWGA 1L3CA 1Q1EA 2AOUA 3OQ6A 1KE1A 3DPIA 2NV6A 2NT4A 2O6LA 3IHTA 3K8ZA 3LG2A 3LP5A 4RIIA 4L50A 4ZC1A 4JLBA 4UVGA 1D5CA 1L8LA 2X8WA 3MIZA 3V8PA 1H4QA 4F38A 1CVRA 4FNAA 4BNHA 3WGOA 1QUFA 4IGKA 1FB5A 4X1OA 1UEJA 3EDYA 4RS3A 1AUVA 2NZXA 4OG2A 3SZGA 2DH6A 1QGAA 2RC6A 2VDKB 4JJZA 1UWCA 2JAQA 3F4LA 3PI6A 2RK3A 3L1UA 4IHKA 3SIWA 5B5SA 1JVSA 2G6TA 4G89A 1JE1A 5L3SA 1OHHD 2BISA 4N18A 5IKEA 3ZCRA 1ADFA 3EEQA 2XHEA 4PGHA 4BV2A 1JKMA 4UQLA 1TTPB 4PXYA 5IUKC 4KR2A 5L7YA 1JXAA 4MRPA 3FKSD 4MYDA 4XD2A 3Q8LA 1ULBA 3U62A 4AY5A 3T3IA 4DZRA 2XVZA 3GNLA 4LJ9A 4MVJA 4DT1A 5JAOA 5A9RA 1Z33A 2R6ZA 3B8HA 1YZKA 2CFRA 2IOYA 3JQGB 1CZRA 1LK0A 3FWHA 3MTQA 3URKA 3KE9A 3M70A 4PGFA 5FPTA 4COKA 4ZQCB 2BF7A 1QK5A 3A2NA 4U7DA 1U63A 3RYIA 1JIQA 1IN8A 3HB9A 4C6TB 3BULA 1U1GA 1NC1A 2IZ0A 2Q6IA 3GIWA 3OPYA 1DI0A 4JQZA 5TGZA 5CBPA 2G1PA 2DCUA 1IBCA 1BRMA 4BQEA 5LJIA 2Z3ZA 4XYMA 2FQYA 2FUG1 2N47A 2NYAA 3GDFA 1OX4B 3HVHA 4HVCA 2QYOA 2ZRBA 3E8XA 4M0FA 5DB4A 3ACDA 1DCMA 1SHLA 4K81B 4L8LA 3OAAA 2ZSEA 3D4BA 1WXWA 5CM2Z 4ZAXA 5LXTB 1YJCA 4RH3A 4MVJM 2PKQO 2W6QA 2QA5A 4TTVA 3DLTA 4E14A 3IQIX 5J63A 3WJAA 2QVGA 1XXHA 3KV1A 1EM8B 1ZAYA 1SZCA 4FFSA 3TLGA 4HK4A 2QRUA 1EJ6A 2AZ4A 3ANYB 2OBMA 3RWBA 2AR7A 1XNQB 2ZE8A 5JQGA 4MZXA 3MRVA 1YOVA 2PYIA 4EB0A 3W79A 3L7CA 3ROFA 1RJ9B 1YIOA 3UWOA 3R9KA 2PRSA 1XTVA 4MWDA 5JRZA 3AIMA 1TLTA 4PGMA 5AHWA 2VLBA 4M37A 2G9ZA 4X9XA 2JGEA 4JP3A 5K9ZA 1U3GA 4CM4A 4YV7A 3PNQA 3L6EA 3CCCA 1YT5A 2ZI3A 1JQBA 3EOBI 4X63A 4DUGD 3EA5A 3WL4A 1OZHA 1LBTA 1NI5A 1UPUA 3UUEA 5KQPA 2HGZA 2FUCA 3E1SA 4JP1A 1XV5A 3GOHA 1JIVA 3QYPA 4JQSA 4YJFB 3EFEA 4FT2A 4H4EA 4MUYA 3KS9A 4FX5A 4FCVA 4MWZA 1RRGA 3EZLA 1BHO1 1MQAA 4K6HA 5HK8A 3QBTA 3WK6A 1AKVA 1I1OA 3MOIA 4LJLA 4I9NA 2X1HA 3LT5A 1Z5WA 3C6MA 4D4MA 5DTEA 2P2LA 4XZ3A 5JATA 4H7DA 4F3KA 3BTSA 5E9JA 1T1GA 2UXCB 5SZIA 3ZLUA 1BU8A 2IOQA 3AUSA 1NIJA 2G72A 4AIRA 1XWIA 1UEXC 1FNNA 1P7PA 3AZPA 2JL1A 2UKDA 2C9MA 5ARCA 2R2GA 4UQOA 4X54A 3PI7A 3AFHA 3SZOA 1U28A 4IOJA 2WTAA 2XD9A 3TX6A 5KTNA 2PQ0A 4OOFA 4AJ9A 4NU5A 4D4LA 4OQMA 4MPJA 5B2ZA 3PNMA 4FHZA 1I4EB 5ECGC 5KNDH 2F43B 2PG3A 3BDVA 1TZKA 1BMFD 3WOHA 3CUUA 1RWOA 2P1ZA 1E9AA 3HYLA 4KMMA 3FETA 4US1R 2AHRA 3MBIA 4ASUD 2JLXA 3DEAA 4OQYA 3CVYA 4BVJA 3LQ1A 5EL0A 2A88A 5AKZA 3GLRA 3HLKA 3QM1A 1GITA 2OD2A 2W2MA 3A6GA 1I3LA 1E3DA 4LJ6A 3SNHA 2DPHA 4IKEA 4ZVPA 4RANA 2GO1A 5F98A 3NV7A 1SVWA 3K0KA 1XD2A 3JWJA 1NBAA 5FTLA 2BCJQ 1XHEA 2XNJA 3V34A 1J2YA 4HOYA 1TMOA 3PHIA 4R68A 3AUXA 2RBEA 3I5YA 3THXA 1GNSA 1U3FA 2IU6A 1EG7A 3LC2O 1DZ3A 4B6OA 2R1VA 4U8HA 3CPEA 3IFSA 1V2HE 1KXZA 2V5UA 3PQFA 2WAAA 5B1EA 3A70A 4MEJA 4U5XA 4HFNA 3WLNA 3WA7A 2RHWA 3QV1A 1P4RA 1E0AA 2MINB 1R4NA 5H8WA 3W2GA 4QVGA 1WHTA 2DR0A 2YRXA 2NOAA 3WGJA 1V3QE 1PNQA 2CLEB 1P45A 1LS1A 2RHDA 3DBVO 4I4TA 2W48A 3UUGA 2PRJA 1VPVA 5IFKA 2HW8A 3W3AH 1YHZA 1KO7A 2B4YA 2HZBA 1J39A 4HGYA 4TTRA 2YUTA 2HQ1A 1S7GA 5LA6A 4ZEMA 2ZU0C 1I13A 2QX4A 3M83A 2Z9BA 2OB2A 2Q5HA 3IMFA 4FW8A 4B4KA 1ZBDA 4TKUA 1VLMA 2IITA 1XQYA 1Z8NA 1T9GR 4YALA 5AHXA 4X62B 2CNDA 3K20A 5DLQC 4F04A 5GV8A 4ESHA 1L7AA 2DWOA 3EVAA 4BMXA 1G1AA 1DBIA 3VJKA 5C37A 1B41A 4J0HA 5CBPB 3BSWA 3D2BA 3QVUA 2G17A 1GTVA 4LJ8A 4O08A 2ZQZA 5TJ9A 1YE8A 2HGSA 2J7PA 3L8YA 4GLFA 2ZRQA 3ZU5A 2GXSA 3HI4A 3KG2A 3C70A 1M8JA 1U9IC 4YAGA 5J47A 3X43A 4L7QA 1VHWA 2C92A 4G4SO 4M1YA 4E2WA 1FFXB 7YASA 5DN9A 1NBWB 1VSBA 3P8ZA 2V98A 1Z83A 1DAFA 4PSCA 5KPDA 1XTJA 2ZM5A 4EKEA 1DWPA 4KC0A 1ZR2A 2JHFA 2Y6VA 3DZCA 4FPXA 2OCYC 5CIWA 4F8JA 4BRWA 1V3VA 3O3OB 4H27A 5BUCA 2CLMB 5BSUA 4UTRA 2GHQA 2WWVD 2AHOA 2L42A 4JBGA 4BTEA 2PUAA 2LIPA 1JLLB 1NXPA 5LZ7A 3UMVA 1PL7A 3SHQA 4ND2A 3SU8A 4WNAA 2XUFA 3OTOB 1PZEA 3PSHA 2CHEA 2OPHA 5L95A 1XTZA 2VL7A 3H9GA 3TDMA 1NJ8A 4BY9E 4ZEOA 5KQGA 2FR8A 3U13A 3LGXA 4DAOA 3IQGX 1K8XB 5HBRA 3WBKA 4YLYA 5ANRB 1WUHS 2QP4A 5IN4A 1ZXBA 2EWWA 2I99A 4DR2B 5ALDA 4J43A 4JB8A 4RF5A 2EW8A 1N5LA 1TXGA 1H3EA 4YRKA 1VLZA 1Z16A 4G8BA 3RROA 3HYRA 5K6AC 1COWA 2HMSA 1SN7A 3DNMA 3DDWA 3RVRA 1I5EA 1W88B 1DEOA 3GMDA 3AI2A 2NYUA 3ZGNA 3KBOA 4FIDA 2YY6A 3LRTA 5DCYA 3VFDA 3DSRA 3OZWA 1JW9B 2VT7A 3AFMA 5KNDD 2HM7A 2VTVA 5EJIA 3WLRA 3DHEA 4OEHA 4WZ6A 3QJYA 4MICA 4ZTZB 2HD4A 2F1IA 4JLAA 4MUNA 4UUOA 4XOUA 5GY7A 5KYXB 3DQZA 1RXIA 3HR8A 2GN1A 4TLEA 4YUXA 4RMHA 4EG6A 1B6RA 1PGNA 2VJMA 4J1TA 4DM3A 1KVRA 1N6IA 5EIWA 2BHLA 2FYTA 3IUMA 4HV4A 1I01A 3WLEA 2Q4OA 2HXSA 3RFTA 4P83A 3TN7A 1FTNA 3LCUA 4EVRA 1QIGA 4BRSA 1A2QA 2N42A 4HNAA 4E88A 1CQJA 1E6CA 1FLDA 4UBKA 4UPDA 2FMTA 5P8WA 3QZUA 3VH2A 2D6FA 4D7AA 1L4HA 5C4MA 3GAZA 1I14A 1AG9A 2JH8A 2VPYA 3O8DA 4FFWA 4I6GA 1DEKA 4NYMQ 4B7UA 1OIWA 3N2YA 3IEIA 2GM3A 4P4TA 4ZDIA 5ICGA 3D7NA 3IR5A 5JE8A 4GOJA 1DO8A 4JVOA 4N7BA 4ENSA 2RH5A 4OFXA 4TSFA 1PKXA 3HLTA 2WDPA 1FQWA 4BX0A 4WFKA 1N5OX 1FQOA 4KXYA 4RYLA 1Q0RA 3ZIAD 3JYQA 1FIUA 1KI6B 3DZDA 5LC1A 1GGHA 1DX9A 4HGOA 2D62A 2PL1A 4S24A 5AVWA 4JNKA 1WW2A 1TZCA 5BN1A 3W2FA 3FOAA 1NKSA 4QO7A 1JWBB 2WJAA 2O2JA 1IC6A 3FHJA 1NAIA 1UBRS 3AHJA 3N6VA 1SZJG 3AT1A 1KJYA 1L4MA 1ZCZA 5EJMA 4N3NA 1NR5A 1QCDA 3R6WA 4JLWA 4CMCA 4ZIRB 3CEPB 3D8UA 4U7TB 3PT9A 2QRMA 1NUHA 2HHHB 2BM1A 2X4LA 4C08A 3N3BC 2V7TA 3CBGA 3H7IA 1FP7A 3NVAA 1QGYA 4OIFA 4FOSA 4ARZB 3OCVA 3PQCA 2Y0CA 4YUYA 2I33A 5ES4B 8MHTA 3QWAA 5CLHA 3FXAA 3NBKA 1AXGA 1N2CE 4TPKA 3ZR4B 3T7KA 2J0UB 4ACBA 3VDMA 2FDCA 3IS3A 1E5VA 1H2AS 3JQBC 4NZMA 5A1TA 1E9BA 4KQHA 3QU2A 2ZZNA 4NFYA 3ILYA 3VDQA 1ZVMA 2GCNA 4F3YA 1E9SA 1XJCA 5JSYA 4ZYVA 2J5XA 3LFHA 4TGLA 4M9UA 5FFFA 4NE9A 3NFRA 2FPKA 4LZZA 4U2CA 1XEXA 3X2EA 1IOZA 2EKPA 3QVMA 1DB3A 5CX1B 1EFCA 2QMYA 4LDZA 2EKDA 3TOVA 2F4VB 4H3KB 1KMMA 2A1UA 2ZSBA 2D4HA 2QQFA 3PUKA 3ROXA 1JHZA 4QDXA 4X7BA 4D3DA 4DREA 1QZTA 2PBLA 2HNKA 2NAPA 4GE0A 4GQIA 4TWAA 1DKLA 4PRLA 3GRYA 5COAA 2VTDA 3B48A 4I3FA 2RK4A 5I9TA 3W90A 4QXPA 2X9VA 4HXFB 4JEIA 3TAHA 4C9BA 4I2VA 4HYYA 3CZ4A 3BA6A 5KU1A 4HNUA 1KORA 4BGDA 4Z4EA 3ROZA 2FEOA 1S5PA 2DZDA 2HCTA 5C7OO 1NU8A 2K5UA 4RCZA 4WASA 5I9LA 4JV5B 3U7FB 1Z26A 3SEZA 2AOWA 1X9IA 3IB3A 2B2NA 2FX2A 1OXBB 2QSUA 1E3IA 1Z34A 3ASYA 2YC4C 1U7XA 1G7SA 3DZIA 3GGGA 4XYLA 5LVAA 4CV2A 4KPEC 3Q3HA 4D4JA 3EMKA 1YB4A 4N01A 1EUDB 2NU6A 3NC1C 4Q7KA 4TYMA 2W6PA 2VWHA 2W2VA 3NWEA 4U6QA 5F9HA 2W2PA 1OW3B 4FWIB 4OHVA 4DCMA 1F5SA 3HHEA 3GBVA 5FAKA 4FK8A 5T7BA 1KZ1A 3K8YA 3RTAA 1BJTA 5DN6D 2AI2A 2D1RA 4RTLA 5FI3A 2OQVA 3JQAB 1RE1A 9ATCA 3RGGA 2O2ZA 4Q1FA 2VJMB 2OZPA 5C80A 2C3MA 1KGDA 3FCAA 3PQ6A 3M5PA 5TMPA 3U1BA 2HQRA 1D0VA 1O3YA 5JH7B 1YBMA 2QY6A 3R7LA 4TV8F 3P26A 4GXTA 4D9IA 2O0LA 5EP4A 4ZVOA 4ER6A 1UMBB 2ONCA 2AEFA 4K9MA 1JEQA 3R6GA 1BA2A 2N9UA 3WGKA 3QLUC 1P0QA 4QQKA 3JQ7A 2XB2A 3NLLA 4M54A 5K4HA 1CETA 3AR2A 2Q45A 1LKZA 3RAEC 4I4NA 3ZDBA 2C4WA 2J31A 4B6QA 1CUUA 1UOEA 2X0IA 3U44B 2XUGA 5CHYA 3RSSA 2C5AA 4M0UA 4M4SA 2K7FA 1JVNA 4RYDA 1WM1A 5CK5A 2P6UA 5K6AA 2WWWA 4CYMA 5AQ1A 2BHSA 4KSBA 1W35A 2I3GA 4NBWA 4PG6A 5EJ9A 2CHQA 2IPOA 4Z4HA 2XRFA 5JVDB 5JS1A 3KJHA 1ID8A 1PR3A 4WN9B 3O4HA 4YONB 3F71A 1ZGAA 1DMRA 4MLZA 4MVJI 5D3QA 4Y7DA 3O2JA 2V4ZA 4LW8A 5IJWA 2SECE 3W5DA 1UMDB 3ICEA 3AVQA 4URHA 1P73A 3I3SR 3PX3A 1JA0A 2FUG6 1TMKA 5LZ4A 4DNFA 2E21A 4K40A 3M89A 2XNKA 3CN7A 5T67A 2WG0A 3WV4A 5HJ5A 3U7GA 2FV8A 3CNEA 4E31A 4HNTA 1E1MA 1D2MA 1SA0B 1P7YA 1WUYA 3EHEA 3LHDA 3HDHA 4TSKA 5FHRA 4EI7A 2J9XB 1XNGA 3LO5A 3PRHA 4ZOQI 5EZYB 3L5OA 3D0QA 1V3TA 1KQPA 1RWBA 2JAHA 2PA3A 3GJ3A 3HDVA 1DO0A 3LVFO 1W96A 4X3PA 4ZHSA 4IS3A 1TKAA 3ZGLA 4D4GA 1ID1A 3GNTA 2OV3A 4EEZA 3W3AA 4EG7A 1S0UA 3ETNA 4OFWA 2GYUA 2M1XA 1NQ5A 3FVQA 5ECYA 1TQ4A 1N0HA 3U3DA 3VZDA 3ZWYA 4BVHA 1PR4A 4GZ3A 4WY8A 4K9DA 2WWYA 2AQIA 2BCGY 2FWJA 2EHDA 4HVTA 1MJFA 3MMSA 3DV2A 4RJ2A 4AMGA 3CKKA 5JAQA 2YIVX 3PDIA 3HVJA 1LW7A 2PMEA 4AG5A 1RC0A 1USKA 2ZRNA 2BDUA 2ORED 2QTBA 4YCSA 5BSFA 2BLLA 3FUVA 4D02A 3PVCA 4TZ0A 5G53C 3PFBA 4ALLA 5A7HA 2FSSA 5C3MA 4B4UA 3AYZB 2XSZA 4HMQA 3S1SA 1OY1A 1MV8A 1A9XB 3ND8A 4N47A 2NLOA 1Q91A 1TQHA 2QIPA 1Q7BA 5DHRA 3C8MA 4P3KA 4O3MA 3RIHA 1J25A 3TS1A 4DE5A 2FFJA 4DB2A 2WZCA 2X76A 4NV1A 1MO2A 1O5OA 2VJDA 4GPZA 4B6EA 4S35A 2I3AA 4GWKA 1CUGA 4J0JA 4R54A 1L1FA 4E2XA 5EMMA 1OT5A 1T8WA 4AJ4A 3KJIA 3J80A 1JHUA 3ST7A 3MOGA 1Z4JA 3LK6A 2CK3D 3CUVA 4MW7A 1Y33E 4DM4A 2P5SA 4ZT7A 4B6GA 4DRZA 3DTNA 4RKRA 1BXZA 1E4EB 1L4UA 5A1JA 3UIEA 1OH8A 3PFHA 1ZD4A 3F8TA 4RKEA 1HFEL 5HIJA 1DAGA 2GZ1A 3P9CA 1G7RA 1UXOA 1ZOLA 1D2NA 1XMJA 2H7VA 1ZGJA 1XF9A 2KX7A 2OGUA 3HL4A 1M6VA 1KVQA 1SXJD 1MT0A 3B60A 1VCMA 2QLLA 4A6PA 1LVHA 1V6AA 2X8LA 3D6TB 4OH1A 4G1MB 4NOMA 3TW6A 3FOWA 3BA1A 1JR3E 4UU1A 3EN0A 1HC7A 1C81A 3TZBA 1ZM9A 1MJHA 2ZTUA 1NATA 4NH0A 5E7QA 1GQYA 2VC2B 3CZAA 1GIAA 2XPCA 3A04A 1S2IA 3BXEA 1ESZA 3I45A 2WJZB 2YOHA 3UJ9A 3P45A 2BFEA 2ZSUA 1YACA 2GH1A 2OFFA 4XJXA 1RM5A 4O2RA 1T8TA 5ALPA 5T4HA 3UJHA 3UUWA 1KOJA 4H35A 4DV7B 2GETA 4XPZA 5AM4A 3T94A 2IY7A 3OC6A 4ZCSA 4ZAVA 1BXGA 4KP7A 1F17A 5EWLA 3T3EA 3HS3A 1NSFA 2FZEA 4FVTA 3NETA 2UZ4A 1V95A 1CBUA 1RPJA 5F4BA 3VHXB 4B35A 4N7JA 1ENPA 4PG5A 1GQ2A 4GQBA 5TGTA 1ZEMA 3K4HA 3SVZA 2B5WA 3DJFA 2OQRA 3FH0A 1EEHA 3QJGA 5AJUA 2Z1NA 4PBTA 4ARSA 4C29A 2GD6A 4UFPA 1S4MA 4OSOA 4I1VA 1WG8A 5FI1B 3FJYA 1POXA 4Z9AA 3T5CA 3ZHTA 1O95A 4J0IA 2VTEA 5E4JA 4KRFA 3TEJA 4JVLA 4CQLA 4HDNA 2O8NA 3E2MA 1VSVA 3R3YA 5CXUA 1KY2A 3CPJB 2BKVA 5I01A 1M66A 4OGLA 1HZZA 1SC1A 3IQXA 4M6WB 2J3DA 1KY5A 4E32A 2AR9A 3A3YA 1T1EA 3W1VA 3LL4A 3TNDA 2ZBUA 2CN1A 3F0TA 1CRZA 3JD2A 5I9IA 5J4YA 4UU8A 4DVGA 1MLDA 3KZ1E 4U2DA 2ECQA 2VEDA 3UFXA 3K6JA 4KHZA 3EIHA 1KZ4A 1LBQA 4U7FA 5KNBH 4LZJA 2AXNA 4Z9YA 3KWFA 4GW3A 3O8QA 1ND6A 4JLOA 4R3WA 3UM9A 4L5CA 2FZWA 3KEQA 4OU5A 2F55A 5KOHB 1T5BA 4AT1A 3IMCA 4XR9A 4EJ0A 3X1ZA 2EHJA 3IVRA 1AGXA 3JZFA 1L5GB 1P7CA 5HQ3B 2AYYA 3L8MA 1NXVA 2V7XA 4UCWA 5DYWA 2AFHB 5KVQA 4K6CA 3TD2A 1Z06A 2PWZA 4E22A 2HNAA 3HP1A 1HE1C 1D9ZA 4JI5B 1PSZA 5IJZA 3RLFA 2IEBA 3LOUA 2VG8A 3PF9A 4E30A 3U4QB 3SY8A 3TG2A 4RA6B 3BBLA 3IEXA 3BERA 1W5SA 3MINA 4RQBA 1WB4A 1ZX1A 1KE2A 1I2CA 1H23A 4C7VA 1QH8B 2WM2A 1ZMXA 5LCXA 3UYKA 3JYOA 4JQCA 5BVHB 2V6JA 4IM7A 2WSYB 4OCZA 5AIAA 4XIYA 3HBJA 3LUKA 5KWVA 1NXSA 1E2UA 5TY0A 3SVLA 4NS4A 1R50A 1G6KA 3IHLA 1LWOA 3NRJA 1Q11A 4G8JA 4WZAA 3N86A 3OIVA 5DI3B 1E6WA 1UOOA 3GIDA 3LFUA 3H19A 3WTCA 1IFXA 2DWQA 3OZRA 3BIWA 4JUAA 3U4MA 2BFDA 3T6KA 1N1GA 1NR1A 2A9RA 3ZWPA 3JD3A 3V1UA 1E1CA 4FBMA 7MDHA 2QRVA 3UWKA 1GU1A 3DYBA 4Q47A 4E5DA 2I3ZA 2Q3BA 2CV0A 3FNFA 3QBEA 4JVNA 4CM9A 5HYVA 5MF6A 3ONFA 3ADCA 3CZ5A 3QITA 5LQNA 1E94E 2IZ5A 3VNQA 3MJFA 1WB5A 1ZU4A 3ETEA 3TO5A 4L15A 1QH1A 2ANBA 2DU8A 4RV4A 1C8VB 2J3QA 4OHWA 3O0DA 2HV8A 1NOIA 5H3CA 5GZ6A 5JMPA 3PEFA 2P2YA 2JF0A 2P41A 3GG2A 2GDJA 1XZBA 1UKYA 1Y1TA 4AF6A 4L4SA 2BMJA 5KB3A 4IGIA 2A86A 1QHIA 5HHTA 3WKCA 2WVJA 4EHFA 2BHRA 4X8LA 1NNI1 4YRNA 1TPZA 4X60A 3OTGA 1P8AA 1C9NA 3JAKA 3LKZA 4K46A 1NJFA 3GCXA 2OL4A 4LQLA 4GPTA 2WYIA 3EW9A 3HUUA 5PNTA 2XZOA 3ZVMA 2PUEA 1OIVA 4RLHA 4ZT5A 5AVJA 5JOQA 2EOAA 1NM5A 4YP6A 3CF2A 4ZVQA 2OHGA 3ZHBA 4BO8A 3G59A 4A91A 3WGIA 1QHEA 3QTTA 3SX0A 1Y9JA 3G0BA 3L7MA 1ZCBA 4NEQA 4QD3A 1ADBA 1J9ZA 2NSJA 4D4KA 3OZFA 3PR3A 2XUZA 1FUUA 1YRAA 3IULA 3KKPA 4IW3B 2WW8A 1E2NA 3B3FA 2JRCA 3A6LA 3EIUA 1ATIA 2ZU6A 3LD9A 1WHSB 2PQ2A 3RE1A 3EMBA 2DAPA 4NXMB 1XLTA 1F2VA 1QOPB 3IUJA 4S1TA 1GPKA 2QNRA 4R8SA 4HADA 5DWQA 4KUEA 4P4SB 3EK2A 3AUFA 1E3SA 1J8MF 2VHCA 3QLTA 3VR6D 2C2BA 3OWOA 4G67A 4CV0A 4HG2A 5KNCD 2ZRIA 1CWUA 3THWB 1GV0A 1EBFA 1YE5A 1YZTA 2RHOA 3T0GA 3OQIB 1E7YA 3S68A 1UDAA 4YMWA 1N7GA 1OSNA 1TYCA 4HEQA 4CQLB 3BRCA 4PGGA 3DLCA 4S04A 3N9IA 1PYDA 3R5HA 5F9MA 3GUCA 4OQNA 4YJHB 5TR9A 5A03A 3M6AA 5E3JA 5JRDS 4IV8A 5CA1B 1CLUA 4H7JA 1KO5A 3P0EA 2MTBA 1J33A 2Z2YA 3DFKA 1GY8A 4BNGA 1H93A 2FFBA 3EA0A 4YR7A 1JUDA 2PVPA 3JQ7B 2G40A 4TS3A 1TU3A 3UATA 4A03A 5FTMA 4WNIA 5CVEA 2FHSA 1NLZA 2A3RA 5BSVA 5EMHA 2ZWVA 5J59A 1WSDA 1KEZA 1Y34E 3A1EA 3GDGA 4BQQA 1GTL1 1I1NA 4P7GA 4R84A 1CB7A 3DMFA 3ZTWA 1CDZA 4U7JA 1EGHA 3LYUA 4WNAB 2NU8A 4RS4A 5GJCA 3UXEA 4XVHA 4EGJA 1JFSA 2HXYA 5I48A 2P5TB 2F00A 1FFEA 2H4ZA 4RETA 1B4DA 2ATIA 1LUAA 2D7JA 1QORA 2GZSA 3ASVA 1PX2A 2W4MA 1G8JA 1I9GA 2NSLA 4F96A 4MVJG 5CD1A 2PX8A 4HXEB 1V4BA 3MMNA 4WCFC 2DT8A 2PKXA 3IKLA 3QXXA 4LNUA 4OKNA 3ZU4A 1R6BX 4TVKA 2J5QA 3CLTC 1XMSA 4P53A 1L8AA 1EWTA 2BH9A 2X58A 4J9VA 3WDSA 1XJ5A 3WFIA 3LQKA 1J99A 4Q15A 3QLEA 3M7IA 4I4CA 3H9QA 3CZCA 4AAYA 3WMFA 4Q3NA 4RMIA 3TZEA 1KH2A 1DIAA 2QVCA 2ZJZA 2XB8A 4J7UA 4M1OA 2OYRA 1K6EA 1MO6A 1QIEA 2NQ8A 5FUYA 2G5PA 3M6UA 3DMRA 2HSGA 1E6UA 4TV8A 2AMJA 3RT9A 4BLSA 4IO0A 1PDVA 1ORDA 5DI3A 4EPVA 1Q6YA 3D64A 4RHYA 4QM7A 4OFBA 1FQKA 3ND6A 4ND5A 2RHRA 2AN9A 3FUUA 4YRSA 2X5NA 4XYEA 5BNIA 2O20A 4GOKA 1SXPA 3BAFA 2REQA 3G88A 1E2LA 1DG3A 2GBCA 1XXLA 1BMQA 2K2QB 3R3JA 1RIIA 3O8OB 3ZEIA 5CT5A 5IZ4A 5E1BA 1EMDA 3DCJA 1VJRA 2Z09A 3EXG2 1GL3A 2CGEA 1RQLA 1ZA1A 3A9SA 2IXEA 3O1HB 3QVLA 4IQ8A 4QM6A 1RBYA 2HO5A 3C16C 3KUCA 3L2OB 4MRSA 2ORYA 4RXTA 3ZHXA 2H85A 1O89A 1U3TA 7ABPA 3UA4A 4FR0A 4KFRA 4C06A 5IABA 4LF7B 2JHCA 2AVDA 2FK8A 2DQYA 4DKJA 3IA2A 1Q21A 3OQPA 4LG1A 4H1WA 1YVPA 1MMFB 1DQSA 3RUCA 4HGNA 1NIPA 1SAYA 3ZVKA 2DHEA 2JI4A 4YLGA 5DTJA 4X1IA 2EYUA 5EJ6A 4NFHA 2F3SA 2I22A 4JUBA 1E8MA 3CXUA 4E5UA 1RRPA 2PA0A 2FJ0A 2H1SA 3ANMA 3G02A 3P9XA 2QV7A 1SD1A 3KOOA 3QFSA 4MB6A 5CW2A 1S6YA 3T1OA 4EEXA 1NL3A 3AILA 3LIPA 3AHCA 2J3KA 3H8VA 4G1CA 4NZZA 2CWDA 4ZI7A 1WEHA 3HSYA 4HUQA 4YPOA 3EUFA 1FVHA 1B26A 2O3TA 1EVYA 3K2IA 3JD0A 3OIGA 4QASA 4RA9A 4LS3A 1RBQA 4NPHA 2BN4A 1GKUB 2ZQ5A 2O2DA 3FB1A 4Q93A 2AG8A 4EYEA 5JH7F 2IKSA 3AIOA 1ISHA 2GQ0A 1EK0A 3JY6A 5KKAA 3O8LA 4M99A 3IAXA 1Q1GA 3O03A 4L8VA 1EAMA 1KAMA 4LXQA 1KFJB 3OLWA 5DBGA 4DG8A 1KVTA 3EGDB 1N2OA 1D7AA 4WH0A 2Z8XA 2FW9A 1P0MA 2Y4OA 2XRYA 2OY0A 1R5BA 2ZT6A 5D1NA 5GIOE 4DXAA 2V1XA 3HBNA 2OZVA 3FYHA 4ML3A 5FF9A 4PLFA 2A35A 2YWEA 4FGLA 1P9OA 2FRXA 3CH5A 1BQEA 1H22A 3WXBA 4YT5A 2KM1A 4XYGA 3OCCA 1Q83A 3X2FA 3C1AA 1TW3A 3HUDA 3H4IA 2WWFA 5GZ1A 2E82A 5DNWA 4K8RB 4P3OA 5F35A 2IYWA 1KMHA 4YASA 1M2OB 4ZEXA 4O0MA 4G01B 4ZTBA 3E9EA 2J3JA 3R7WA 4CLHA 4F4UA 1ZRHA 3T7JA 4F7DA 5FFMA 4EB8A 1GZ5A 5AYVA 3EOZA 1T3ZA 3W8RA 1AU9A 4Q3BA 4E07A 1S3FA 1MAVA 1HLDA 1L4GA 4BXOA 4LSZA 4QTZA 2OQIA 2VPTA 4QGBA 1PQYA 4Q3DA 3I4LA 3OJFA 2H1RA 1NBEA 2ZI5A 4UUBA 3M6WA 3PEVA 4IEFB 3SOZA 3SICE 3ZH2A 2J3HA 2D5CA 1W8IA 4KODA 2HJHA 2Y71A 4RLSA 4RIFA 1ECBA 1E9FA 1VKHA 3E48A 2D54A 3RS4A 2QUZA 3Q4GA 5JECA 2YJ3A 2R0QC 4QPJC 4RE6A 1GPJA 3NBXX 4Y9TA 1M2GA 1E7MA 2QZ4A 2EKQA 2ZI7A 3UVEA 1YIDA 4IX1A 4Q9AA 5L4SA 4HLNA 1H65A 1LK5A 4FN5A 3IBFA 4F5EA 3KTAB 3QHAA 1RZRA 5DRTA 1KI3A 5LWHA 1TQ2A 4D9KA 4JJKA 1ISJA 1OBHA 2YOGA 4BRZA 2Z9CA 2WP0A 3U2QA 2R8OA 1HYBA 4BZZA 2GCGA 1R0SA 5A6VA 5JJ5A 1AO3A 4JC5A 5A0TA 2J45A 2D13A 1TEVA 1LC0A 2W0SA 2R84A 2CVZA 1NW6A 4LOLA 5LD2C 1ZSVA 2IVFA 3IPCA 1T8RA 1RLUA 4IYRA 4QOEA 5FADA 2QHXA 3SE7A 5HS4A 1VBMA 3DXFA 4FX2A 3GAFA 4MW2A 4INJA 2R00C 4URZR 1JHQA 1DAOA 4GMKA 1FRFS 1W73A 4IZ6A 1JDBB 2C4TA 4NI5A 4HDSB 4P93A 3GCDA 1XZGA 4JKIA 4J2HA 5K03A 3H1GA 3W2EA 1G2PA 2ZJ0A 3FDIA 2B98A 1DELA 1P1BA 5A3VA 5H4HA 1BS9A 2G1KA 1L7OA 3EXEA 1AHPA 5ICCA 3MMXA 2WR8A 2JIPA 5LIRA 3FFTA 2ODAA 5JCOA 4D8WA 1BSVA 5B64A 5AH0A 2YZGA 1ORIA 1UKZA 3WQSB 2VUUA 4PAMA 4JYMA 4YX9A 4KI7A 1ZNWA 4X61A 1G9SA 1RBMA 3A3OA 3GRZA 4LUCA 3ZDYB 3W0LB 4DEVA 3PFNA 1DDOA 1E1RD 1OC4A 2J33A 2ZS9A 3I2JA 5CNKA 1JEYA 4CRWB 2Q0XA 3LYAA 5ADVA 1TIPA 3DL7A 1FP4B 1T3SA 4KQ2A 3EBOA 1JAXA 3GB9A 3N3AC 3GCWA 4IDAA 5KTRA 3CSUA 2OHOA 2CBXA 2GWHA 3A05A 1P3DA 1DEAA 1SNYA 4AK9A 2VYVD 1NI3A 1UWKA 3F7TA 4ED9A 1LC3A 1GCOA 2XX3A 2OO5A 4XE5A 5JS6A 4AURA 5CB4F 1ZVJA 1DTEA 5K8UA 2P9GA 1ZHOA 2F1JA 1WB6A 4W9RA 2BTQA 3AETA 5BOSA 4D56A 3HVKA 3SGLA 3V7UA 2ZWOA 1MD9A 4DGSA 3WNDA 1TJ3A 2IQIA 4NHEA 1USUA 4N12A 1CUSA 4C6HA 3WS7A 4BN0A 2CBGA 2PRIA 2GPNA 1INLA 2VDOB 1IWPB 4M9QA 2G63A 4ZEVA 3QMMA 4RDCA 2ZTMA 3Q2OA 2GPSA 1JTEA 1AK9A 3H87A 2P5YA 4B3MB 1H1DA 1JNYA 1N9ZA 4JELA 3SR0A 1C8BA 1VSTA 4N49A 1UEIA 4HYEA 3HUTA 3T7DA 1SHKA 4KITB 1GPDG 1Y8RB 2QD5A 3VZPA 4S0ZA 1T4MA 4C3OB 5FFNA 2W9XA 3CZRA 2EW1A 1GDHA 3IDAA 3AUTA 5JG7A 4ZZ1A 2QU8A 3TF5A 3QG5A 3CKMA 4AUEA 3CR3C 3PTLA 2PUTA 2JIZA 1TA4A 2WSSA 1ZO8A 3HGQA 3N2KB 4HDCA 4XIFA 5KOIA 4DV4B 3BFXA 3BRQA 2D2XA 3NTRA 1UT8A 5SZJA 2Y6UA 3OT1B 5K6TA 4C4SA 1EFLA 3INGA 4LJRA 4RLQA 3TM5A 1CY0A 1M0SA 4W7HA 1NSYA 3QQ5A 4LRSB 3BGWA 4RENA 5AVUA 2HU7A 2ZAOA 3ETCA 4JKYA 3U7RA 1NQVA 4C0BA 4FYXA 3ZDFA 5ABPA 3BJIC 3QF7A 2IJGX 1ZI6A 4R1NA 2F7SA 4R9SA 2NVBA 3KO8A 2F9FA 4L8FA 1NN5A 2JJMA 2Z2JA 3GEDA 3G2OA 4QXQA 3VZBA 4YI5A 2NZJA 4UZSA 1QNFA 1QO9A 2QB5A 2X5OA 3CJQA 4YV0A 4BC0A 2PV7A 4Q3EA 4GP7A 5EXPA 3SZLA 3ZI4A 4DQUA 3CT4A 3AXTA 4KXVA 3NKLA 3VU9A 3WMXA 1FVOA 4KOEC 1MUUA 1X1AA 2GHTA 3G8DA 2VSXA 4WZZA 1PFUA 1W88A 1KU6A 3VC3A 3BJEA 4I50B 5C18A 3EWNA 3ZK9A 1JSXA 1T6YA 4BMDA 3E8SA 4DQDA 2ID9A 4IJ5A 3M4ZA 2XKKA 3EZXA 2A9OA 1FMTA 3USCS 3U60B 1WBDA 3C5HA 2ZR0A 3HKCB 3KXKA 1D1TA 2X8JB 1RQ7A 1U5CA 3SBEA 4AB1A 3GZTB 1CEXA 1O54A 4XW2A 1WX1A 1YRLA 1GPAA 2HADA 3GJ0A 5DMXA 5LOVF 3HJNA 4OL0A 4OXYA 3T5AA 1WMBA 2YJ4A 4DCCA 1Y82A 3HJFA 3WNZA 1PGPA 3Q98A 2VTBA 5FOXA 2EG5A 4KRYA 5E7MA 4BJ3A 3L3BA 1GADO 2IYLD 3MBOA 5LB2A 3TMKA 1XEWX 2HA5A 4CIBA 1P7VA 3ZW8A 4WDRA 2QLJA 3PNYA 3PWZA 1VB3A 4NU0A 1OB2A 1JPJA 2WJVA 4Q9KA 1GGNA 2H16A 1P9RA 4WZBB 1ZUNA 1XZFA 3GHYA 3KAJA 5TQ2A 2I7DA 2XWBF 2J4CA 3KQOA 5HNKA 2JBAA 4MDFA 2V6MA 4DW8A 4HGZA 3OURA 5C8ZA 4CF3A 4NEGA 3OPQA 3RNLA 4OK6A 4PRYA 1Y1SA 3SJ7A 2WMOB 2Z4RA 4QDKA 2YFKA 4DC9A 4OAOA 4DBLC 3OJOA 4F85A 4EJSC 1O87A 2ZATA 4P98A 1QCCA 2AF3C 3UV6A 1XDDA 1N1MA 3GR6A 4KAFA 2F3QA 3HB7A 5DISB 3AESB 4F93B 1N8TA 5KINB 5F1OA 2D7DA 1LLQA 1SBTA 2OCAA 1XEXB 3HRIA 4K26A 3CMMA 4LZAA 4OI4A 1PT7A 1L4EA 1M8GA 3EFOA 3U80A 3EQ8A 3KHTA 5IAKA 3FMVA 3N7UA 2E1PA 4HDMB 4PLGA 5AI5A 3PBKA 4PLZA 2CEAA 3GPLA 3JQRA 2WOOA 4UBLA 1TLFA 1VIDA 4BASA 3ZE7A 3VU9B 3JYLA 3PKIA 2ZJ3A 4JLSA 2WSIA 4CR7A 5H3LA 2POQX 3UCEA 3WGMA 4HQOA 5KQSA 1F0PA 4Y6GB 4E51A 3MWEA 3UXMA 1Z7WA 3ABZA 4N48A 3TQCA 1QDLB 2GZMA 1K6XA 4KI0A 2KMLA 3WP1B 4N41A 1OFGA 3GEHA 5I4KA 2C54A 2PLAA 2IRWA 3CF6R 4N40A 3PICA 1NVVR 4MVXA 3RSHA 1V1RB 1MU0A 1F6WA 4XI9A 1FPMA 1G6Q1 3PEUA 3R3UA 1R4ZA 2BIFA 1NMYA 4JIGA 4MI3A 3RHZA 5BSEA 2AZTA 4RZHA 5BYJA 5DLPA 1R27A 3VVCA 4BB5A 4RDXA 3IOYA 4UNRA 3TRJA 1V43A 2DJ5A 2VH5R 1YJQA 4YS6A 3E03A 2YXEA 4X5OA 2OZKA 4ZDWA 4YUVA 3M1AA 1NJ6A 2UYCA 2CDBA 5BNZA 1T5HX 4FOPA 1TTQB 1Z75A 3CVUA 4NR0A 3G3EA 3LQRA 1PJ2A 5CVVA 2D00A 1XKXA 3OMLA 3P52A 4OY3A 1SU7A 2WYHA 3GLIE 3CVWA 1IXRC 2OXRA 3QX3A 2M6RA 3QEAZ 1KPIA 1R8JA 1CEEA 3ZQKA 2V7QA 2OYCA 1DSSG 3KSUA 3UB2A 5C4IA 5DNVA 1EB8A 3RHFA 3TNYA 4FB5A 2J67A 4I1SA 2GJKA 1AQJA 4FSXA 1SC3A 1PJQA 2VBIA 2DGDA 4WTOA 2FQXA 5K3BA 3AYXB 2GXUA 3K05A 2OBLA 5IWAB 2Q28A 1FFBA 1RJDA 2ONKA 3OLCX 4XLLA 2R6JA 3EIQA 5J2TF 3BAZA 4YTEA 3NBYC 1YCFA 3H65A 4MUKA 1ZD2P 4MVJE 4HDRA 3SC4A 4C76A 4DMHA 3MAJA 4WOJA 5AMXA 5HTOA 1FDVA 1BCSA 1SVOA 4KH0A 3V2UA 4M87A 4BFWA 1UBSB 1RI3A 4D25A 1GAQA 4M22A 1QRDA 4MV8A 2WTXA 2G0NA 2VUTA 3IE1A 1V7QA 3RVLA 1UC9A 1OBOA 3KLMX 2ZRKA 2XTZA 4D43A 3IGFA 3SYLA 4I1UA 3PPWA 3ECSA 3H5AA 1CUIA 1II8B 1N2BA 3ZVLA 2R1TA 3IYLW 3MWFA 2ZITA 2IXGA 3H3FA 1ZD1A 2C07A 1PEYA 2QYTA 4NAHA 4YIKA 5E0OA 1G7CA 4Z7NB 1N6OA 2ZE7A 3GZNA 4FOLA 2V0GA 4M9SA 4J07A 1RPTA 2YNMD 1P19A 1Y81A 4QGFA 3KQHA 3LC0A 2XIQA 3H4MA 3A9WA 4X7RA 1LBHA 4ZAFA 3LOQA 5AKKA 4U6NA 2A9PA 1S89A 1G98A 4LC0A 4Q21A 3RSOA 4P84A 5HDQA 2UVPB 3KSMA 1TYBE 1JG7A 3OM0A 3V4SA 3W6PA 3H42B 4G5YA 1KBQA 3KHSA 4HWRA 4B0PA 5IKPA 1YJXA 2EVWX 3HJHA 1GKLA 2XA1A 1W9MA 4CEIB 2DG2A 2EIHA 3RD5A 5TNXA 1N1DA 5B36A 1IN4A 1ODKA 5GAJA 4FYIA 3KZMA 1RFLA 2B69A 1UPFA 1A04A 1KC1A 2YJGA 3KJQA 1GN9A 5E6RA 2GF2A 2O9JA 1FOEB 1PG5A 1I36A 2IKQA 2UYOA 3L04A 1JQKA 3V4ZA 4IIJF 4IRMA 4C43A 4DQVA 2YYYA 1TJYA 1CVIA 1E69A 3KT6A 2WM3A 4D3FA 1M7BA 5DGTA 5C7LO 2QLMA 1PZHA 4ND1A 4KQJA 1MH9A 2I1VB 5HZKA 3MWKA 4KQCA 1KY4A 3P7MA 4PNHA 3WGGA 2H7XA 4M38A 2GI4A 5CEJA 5ALGA 4BUZA 1U0RA 3WP0A 4G4IA 4B48A 2HT1A 1C7QA 1QZUA 1FP6A 4R8RA 3M5DA 1HF3A 3PRYA 4ODIA 1VECA 4OHOA 5AT1A 1J1UA 1VJCA 1Z18A 3OM8A 4IDQA 4IUCS 2CXUA 1NQXA 6LDHA 4F91B 1XZQA 1A5TA 2NUAA 4RSMA 1WZCA 1CD5A 2G09A 3EZYA 1QQ5A 3PNBA 4C3ZA 5JPCA 5I3CA 1MPTA 5H68A 4DEXA 4RXMA 3BMQB 1L5RA 2FRDA 1UP6A 4P35A 1L5NA 1AMUA 1N2XA 3TSYA 4CCAA 3A6ZA 3VV3A 2XA9A 2Q1UA 5AVXA 3OVMA 2RGNA 4CUJA 2COKA 1KPHA 2GNOA 4MYCA 1TK2A 4R51A 1VZ3A 2GEUA 3OFVA 5DKFA 4WKNA 4HQ0A 3IP1A 2C2KA 2D0IA 3EGXA 4HT3B 3O8CA 2H17A 4NBRA 2FPGA 3RIXA 4L08A 3LHIA 2C2MA 1KERA 3S0JA 4QODA 3RHTA 1A8IA 1C0EA 1FZQA 1VL8A 1C4WA 2GCOB 2HTEA 3MGAA 3BK2A 4M60A 3CVXA 1KMHB 3E82A 3G5MA 3VI4B 1IM5A 1IAVA 2ZSAA 4C6RA 1Z8FA 1N25A 1U7DA 3IERA 1OREA 2GKOA 4OV6B 4YWHA 2Z3WA 2H08A 3I6IA 3KR9A 3VYRB 4TL6A 3BH6A 3QXHA 2F1RA 4FGKA 1KY3A 1DE0A 5AW5A 3HFJA 1T9CA 2YMLA 3BXOA 1QHSA 1A2KC 4U7GA 4LGVA 2WHXA 4YRPA 2OHHA 3JWPA 2H1LA 4B9AA 1QVVA 5EZYA 1A27A 1LTQA 2JLSA 1RHRA 2Y1XA 2FY8A 2MYUA 3G9ZA 4HZUA 3L43A 3T4EA 1L1EA 5ALLA 2Z6AA 1Z7EA 5TF0A 4DY4A 2QD1A 4WIAA 4J1NA 5CYFA 4L78A 4CF5A 2HB6A 3ISVA 1MDFA 5JSUA 3PC2A 4OJMX 4YJGA 1MFPA 2O57A 3FLBA 2PKWA 5IAJA 4QU9A 3RUHA 3UGQA 2R62A 1PYGA 4BO5A 1W4LA 2HAEA 3EXEB 3GRFA 4XLZA 1UT5A 1RQNA 3T5MA 3FR7A 1I7DA 4P4SA 3VJRA 1D2AA 3G1TA 2RHCA 3KUDA 4FC7A 4E6EA 2PUGA 1A9PA 1D2GA 1OTHA 2WA1A 3GX1A 4AJPA 4AVYA 1ZJ6A 3BC1A 1P75A 5E8RA 4Z8XA 3FN4A 4O4LB 4TQ9A 4QEZA 1OZ0A 3DNPA 5IAEA 3QWHA 3QKRA 4MVJH 5SY6A 3RS5A 4UAGA 4YI3A 4RPKA 1PL6A 1UK9A 3MWDA 5AVSA 3U3OA 4NQRA 2CSUA 2HL6A 2P8JA 5IVHA 3DE7X 2ZPUA 1O94A 3LLUA 5D86A 3A8TA 4ZK6A 3Q3JB 2MDTA 2Z30A 5EVCA 1CRQA 1OA0A 1XZPA 1GG9A 1YS6A 2GJSA 2XLCA 4GSKA 2FRVA 4I5DA 1OHHA 4J4TA 2NV2B 5FTWA 3KQYA 5HIMA 4BIIA 1OXVA 2JJQA 1LX6A 3K71B 1S2GA 4LFBB 4ND8A 5LN1A 1KJ9A 1V9CA 1X1RA 2RH8A 1O6ZA 1VG8A 1MAAA 3DO5A 3ZBPA 4B76A 4EP1A 5KYUB 1MV5A 4FZRA 4N65A 4MQLA 5CDFA 3SLRA 5GINE 1KZHA 3ZY5A 2JEYA 1A9YA 4LV5B 4PC1A 4WNYA 1JSZA 4L8GA 1KYYA 1IY2A 1ULTA 3KSRA 2MSLA 3ANSA 3L7OA 3O2SB 4N1AA 2WK1A 4GBMA 3TZHA 4GPBA 2YW9A 1L8QA 4O1MA 4XIIA 5AK0A 4JCOA 3DZHA 2EFDB 3MCAA 1PFVA 3KB1A 5EYPA 1GDTA 4GWLA 3FTCA 4IMRA 2JHGA 1X86B 2FX5A 1W1UA 2L69A 1TJ5A 5CYOA 3C6XA 2IUSA 3GRRA 3QXSA 4A8JA 5A5EA 2C59A 2HDHA 4HSGA 1U8UA 1QPBA 1JBQA 3O6VA 1MC5A 2C31A 3IP5A 1LTHR 3S99A 3F6EX 1JLMA 5BRJA 1HFWA 5K2OA 1BTOA 4FOTA 1SBIA 2ZUDA 4ND7A 4RDHA 3WBBA 1RC1A 4S1WA 1WDTA 2O6HA 4TL9A 3TMYA 3B5IA 4QQRA 1SKQA 3I5XA 4RO0A 2HWWA 4Q1EA 1LPAB 1GFSA 4EJMA 2FG5A 3TAXA 4DIOA 5ESRA 5JY6A 4S3MA 3H11B 1GN8A 1S2MA 5KYVA 1Y98A 2FPGB 3OCZA 2FFRA 3OHPA 2NYRA 5KTOA 3ZE9A 4EVIA 5JBNA 4FMCF 4LFAB 2HK9A 5KWIA 2PZEA 3WLOA 5DT9A 3GDOA 1NUAA 3G6KA 4JSYA 4CKCB 2FFQA 4D9EA 3M9WA 5CR9A 2BI7A 3GJTA 5FPQA 1N6PA 3UMJA 4BFLA 2ETXA 3I8OA 4BNUA 1KNXA 4P22A 1MIHA 2VATA 3BE5A 1O03A 1GU0A 1XX6A 4MV5A 1KA9H 1ZGBA 1USGA 2CD9A 2E4ZA 2QN9A 3NASA 2FPWA 4LECA 4MQFB 5L45A 2C4VA 2G4LA 1DIHA 3L9XA 3FWZA 4OA5A 4Q9DA 1BQ3A 5DX1A 5LA6F 4Z3KA 4RVSA 4JI0B 1UJCA 3DVLA 3PE6A 4QG7A 3A4VA 4GUAA 3L79A 1DQYA 5IZCA 1KMNA 3EEFA 3D3WB 1U90A 4UUMA 1FTSA 1U81A 3AFOA 1GAEO 1XELA 3WY9A 3X1KA 4PYRA 3I2FA 1RAFA 2DCMA 2ZUWA 1MNQA 4BDTA 4EDFA 3J81k 2J5KA 2O0KA 2P9CA 5EQTA 3VHRA 4YP9A 1J06A 5ER9A 1RVDA 2JRLA 3QWBA 1QFXA 4G37A 3DV0A 3C3PA 1ONSA 2JGKA 2B20A 4RVFA 1W75A 4P6VF 4R05A 1YULA 4MJ3A 2VLIA 1W2GA 1PT5A 3K09A 1JQ3A 4L72A 3M1IA 1UBHS 1GP2A 1LPNA 2IP1A 2R6AA 3TOSA 1NLFA 1THZA 3GT7A 5DM0A 1MEJA 1QV6A 1AGYA 1K2VN 2WPDD 3AO0B 3NHJA 4H1TA 4KV7A 3R7FA 2XIJA 1KQFA 4G85A 3WOVA 5LQJA 1AHHA 4G65A 3V2IA 3WWYA 5A4AA 4BBPA 3EF0A 1W5BA 2FP3A 4GT1A 3SSMA 3HWRA 2WV9A 1SD5A 3T5BA 3H1PA 3KPUA 2CCGA 3OWXA 1EEXB 1X77A 3UHJA 1D0SA 2PJRA 1S3SA 3OHMA 3FRIA 1HUQA 2YS7A 4P38A 2A3NA 3VTKA 1X13A 3OQVA 2ZPAA 3TD6A 1KWKA 1PYOA 3T35A 3TVTA 2BFCB 4ZYUA 1A2OA 4BQOA 1MAHA 1GNTA 4KCGA 2JCGA 1V4NA 1IHOA 2BFWA 4JUDX 2I4RA 4POAA 3EGIA 1L5HA 4PU0A 2ZRCA 2X22A 2O2HA 4YT4A 3D8SA 3F4BA 2Y0PA 1VFNA 3FFWA 4TWZA 1R8YA 5CJJA 4M9RA 3KAQA 1E3QA 2WU3A 1MABB 4PANA 2OTCA 4ZP1A 1UZAA 1GT6A 1VCNA 2ERXA 2O5RA 1DLIA 3SF8A 2XE4A 1JQJC 1FUKA 3MGCA 3DTVA 3HABA 1BE0A 1U0GA 4J1TC 5KDLA 6Q21A 1M1NB 1TEHA 4GR5A 1T6XA 4OOEA 3RU3A 3H4VA 3IQZA 1FXSA 4BLOA 2VHXA 2XUIA 4IJMA 4LXIA 4WA8A 4B32A 1F51E 2UUCB 1XPUA 3LQYA 1G20A 1QYDA 4JLJA 1EVJA 1WO8A 2JGIA 2XCSB 3O4VA 2GNAA 4G1BA 1KNQA 2GILA 2H1HA 2RSLA 3EXIB 4HWTA 4ZVLA 1TTHA 3PZBA 3B78A 2CKDA 2WU1A 3TBFA 4HNSA 5C5IA 4Q5IA 1OXXK 3SZMA 3BN3A 1IEXA 2BT4A 3DFFA 4M55A 2UUAB 4TTQA 1BWPA 4BJ1A 4WCVA 1CUJA 3SYTA 1RAIA 5ALRA 5ALWA 3K9FC 1WVIA 5KVSA 1WP4A 1O08A 3AUYA 1VOTA 3SVTA 3UYLA 2RK6A 1ZMRA 2TS1A 1O96A 5EWJA 1Q1QA 1Z5VA 2W11A 5AKGA 4YT2A 1EH5A 3DF9A 3EMDA 2EL9A 5GM1A 2B0JA 4EYSA 2WF8A 1GQRA 3NDJA 1Z4OA 2WD7A 3QP9A 4IIJA 5HCNA 4JI1B 1Q7EA 4NENB 3U4HA 2QD2A 3B1JA 4I9UA 4DPMA 1U8ZA 2B4RO 3PCTA 1RD4A 1QO0D 2GZAA 2CLIB 1YQQA 1XOIA 3OLQA 1OPXA 3DH0A 3KWMA 3AF3A 3QUQA 4TL8A 5TEVA 4A8TA 4MS1B 1CW2B 4CLDA 4MAFA 1D6MA 4X45A 4I8IA 3BL8A 1NVWQ 3E3OA 1NXQA 2EKZA 2RI6A 3QX7A 4M0PA 3OY7A 1JIJA 1JF8A 4NK5A 1ECJA 2JGDB 1U2RA 2TMKA 4QTTB 1LV8A 1M2OA 2C95A 1AZLA 2QJFA 2Q5IA 3UPDA 3GFPA 2HR1A 1W30A 4NCHA 4PPGA 3VO9A 2HU5A 4R1SA 1IWBB 4HO1X 4ADSG 4KWIA 1RKVA 3I2GA 5CFNA 4R69A 2VDPB 5G02A 3PITA 4UBNA 3ZU2A 3NKVA 4GDMA 1D1PA 1MB2A 2J9FB 2QAGB 3ZE0B 4CPDA 3NB0A 4LHXA 2W58A 3FYTA 3BMXA 4PCAA 3ZV3A 2HEIA 2EARA 1V35A 3A2MA 3CH4B 4M0KA 4JEMA 1U3WA 2IW3A 2QZZA 5DX0A 4AQDA 4LRXA 1NLUA 2W83A 4GPEA 4RVOA 5L6LB 2CDNA 3RTDA 2P1DA 3CU5A 1QHFA 4V0ME 1DMSA 2RAVA 3RBVA 3OIDA 4EENA 3COYA 3ZX4A 5G3YA 1A2BA 1QRSA 3MTEA 4G6ZA 2VK8A 3AUAA 3K70D 1HURA 3RKRA 2C4MA 1FRNA 1WE2A 1D9XA 2A0XA 4W82A 3T7SA 2NUTB 3OHSX 3MGBA 1T1SA 3CB2A 4AS1A 3RW9A 5AKJA 2GPBA 4OHCA 4BGEA 4ZGBA 4JGBA 4U0JA 4LDNA 4YV2A 3IP3A 2QJOA 4IJWA 2R9VA 4F6RB 1ORRA 4JT4A 5FWYA 3HSKA 1N4AA 3J7TA 1XCJA 4MA4A 3AIIA 3B3JA 3DE0X 3UHPA 3GLTA 5D5PA 3VISA 5KQLA 4Y2GA 1U3UA 3WK4A 1T0IA 1T0BA 2Q46A 1YL5A 3OCUA 3TFQA 2IELA 5DM2A 2B8EA 2QD3A 4OQQA 4QWMA 2OZLB 1WXXA 2PL9A 2XKAA 1QJCA 3LA8A 4V0SA 4XR4A 3T15A 3WO0A 3IELA 3VYSB 3KTDA 3PGVA 3BCRA 1EIWA 1RYDA 4HP8A 1ZMOA 4MDEA 1I3OA 2E4UA 4V38A 3V7YA 4F6CA 2YXLA 4ON9A 2EJUA 3O8OA 4B3SB 2IF0A 1R4AA 2F8LA 3KR0A 4PC6A 4FI3C 3F2VA 4UXHA 4WOBA 1G19A 5J1TB 1XB2A 5C81A 8AT1A 2UZ1B 2IS1A 4D8XA 4FEGA 4IG4A 3U9SA 4BNLA 3T61A 4JASB 4OMUA 2WIKA 3IAS1 1ESDA 1OPRA 2OECA 1X7YA 4OLHA 5G2OA 4AECA 4ESVA 3KFLA 4WERA 3H0KA 2WSBA 3OZSA 1QFZA 3OOYA 3A6FA 2IDKA 4FEEA 4IV0A 4GE3A 1RNLA 4NYIQ 5CLLA 5CVUA 4AZ3B 4F4DA 2IODA 3BFKA 2C94A 4R1QA 1Y4SA 2LV8A 1QVZA 1U9CA 4C5CA 1LJ8A 2C1XA 3A4NA 5JNTA 4INPA 2RGWA 3IAM1 3IP6A 3VJMA 1F9EA 1ULAA 3OCYA 1KSFX 4MA0A 3OT4A 2A33A 3G0DA 5ULLA 4B83A 1P6XA 5AVQA 4GAEA 1OGIA 1PW7A 1ODCA 1VLJA 2FPLA 4LISA 5HQJA 1G5PA 9GPBA 5FPYA 1WMFA 5TPWA 4E6PA 1QRUA 2QAIA 3NVMB 4TT3A 1G7TA 2P2CA 1G21A 2WP8J 3DM5A 4PQGA 2Q62A 2GN9A 2CNWD 1HYEA 1I80A 5IT9A 4I9FA 4GBGA 4A8PA 5THXA 1CNEA 1VLLA 2NUAB 2XZLA 1O97C 4TQGA 2NSHA 1EFUA 4HDMA 4V1CB 5IM5A 5AM1A 4R8VA 4QSHA 4B87A 3VPSA 4MGEA 1VFPA 1JMVA 1Z5NA 2PGLA 3C3JA 2E4AA 3O7WA 2VR1A 2YY5A 5CGZA 3AQ4A 3EFHA 3RIGA 4PLTA 4YJFA 3T1NA 3WADA 4BQIA 2GPAA 1EFTA 1G4AE 3FOEC 2I67A 4JVMA 2PU7A 4HB3A 2R48A 2VZEA 1QIDA 1QH0A 3UFBA 2GTPA 2C84A 2FW6A 5F7XA 2F6RA 1TT5A 3Q72A 4MIEA 3CVVA 2H07A 5KWSA 4EY4A 4LJ4A 3I3OA 3G2IA 1JVBA 3BPSA 3P2EA 3TJZA 1XMPA 4CMEC 3CJRA 1KARA 2CB0A 2PRYA 3GJZA 4X71A 4F0JA 3KC2A 4ISCA 3CLVA 3F8SA 4CT4B 5F1YA 4DMCA 3NGMA 4QOIA 2WTNA 4KQGA 2OMKA 1P8JA 1TGYA 3G0HA 2YIMA 2V4MA 3DAFA 3VYWA 1B2LA 4OP1A 3PYMA 3D6AA 3PR2B 5GVSA 2Y1FA 1O94C 3HJBA 4LE1A 3LUHA 1NW9B 1Y6QA 3VAYA 3GQBB 4BQPA 3VSDA 4R5MA 4HXGA 4EJSB 5JBIA 3DULA 2SHKA 3C74A 3EQ9A 4HDOB 3MJCA 3MWLA 3TTVA 4PHGA 3ZBQA 2B1JA 2OCIA 1U2QA 2P4EA 4LPKA 1Y42X 1QF9A 3PHBE 1VL2A 3P9IA 4NCJA 1HYHA 2HV9A 2ZBEA 2ENWA 3HPQA 4YQYA 1QK4A 1K92A 2J6HA 1AUQA 2IWHA 2A1TS 3JALA 3Q7RA 3BCHA 3W5IA 1YU9A 4EG0A 5DOZA 5JU6A 4OI0A 1UXIA 1B16A 4G2NA 1SKAA 3N5CA 2FPUA 3D8TA 4N0PA 5IK2A 4BX9A 1E89A 4M21A 4HUJA 4ZREA 5JARA 1JB9A 2O54A 4KRXA 5BWCA 4YAUA 2DBRA 2Q9CA 1Q0UA 2H51A 3EGOA 3HVIA 2EU8A 5IG2A 2Z08A 3OFKA 2F8MA 3CV3A 1QNLA 3VMMA 4E4RA 1UZMA 4MV0A 4FDAA 3IHKA 3O93A 4DUZB 3CUKA 3K9CA 3R20A 4HPXB 1CJSA 1CR2A 4C4XA 1R9MA 1IH8A 1RYNA 2A92A 3WIOA 3GLGA 1AE1A 1Y3CE 4PQFA 4AKTA 4EGCB 3EGVA 3URMA 1E63A 1E9EA 3PQ5A 3TIVA 1CIPA 3A3NA 3AL2A 3UF0A 1U3DA 2XDQB 4MKXA 1VL0A 1TRHA 2QBYB 5LD2B 1F8FA 5F7OA 1D4ZA 2QMOA 2H9AA 1FNBA 2GA8A 4PNZA 3WL6A 2F9MA 4NBVA 4D0RA 1AJEA 5ALTA 3F6SA 4HAOA 4DJDC 3I39X 2X3FA 4V0KA 2XQKA 2A58A 1D8TA 4HF7A 4FTWA 3TW4A 1PQWA 3IH5A 5B12A 1FMFA 2RDMA 3SG0A 1WZ2A 4NZNA 4NQZA 5L4LA 5IBPA 1CEYA 4KQIA 4MVJP 5KX5F 3ZJYA 2K6GA 5DXJA 1CLEA 1T6NA 3VC2A 5FUQA 3DQPA 3HZHA 4EG8A 1LLFA 3WWZA 4E2YA 2ZTVA 4EUKA 1U1CA 1FFSA 3REOA 1K3UB 2WWRA 3UWSA 4TMVA 2Z3VA 2ZYHA 1XQWA 4W5HA 4BDSA 1C4XA 3ECAA 3IO3A 4R0VA 5ISMA 2NWQA 2O5VA 1Z08A 4MVWA 4OAQA 3NQ41 3PD0A 5A3JA 3P5BA 1CY6A 4ZVVA 2OHVA 3L4BC 3U4IA 4P8RA 1Z5UA 2P4HX 4RVHA 4XH9B 1R4MA 2ZYTX 5K0EA 3SC2A 1NV8A 1KI1A 3CTPA 4IUBS 4YMHA 2RGRA 3IDQA 2EIXA 3ASZA 2Z8ZA 4FNOA 3EYAA 3KJNA 4HD8A 3VDXA 3F8WA 1EHCA 4RH0A 3RS9A 4EHAA 5FDFA 1HDOA 2GK3A 4W4TA 4PO3X 5HFNA 5BNWA 3E18A 3MHPA 5JHHB 2JLRA 2BTQB 1N6LA 1T2AA 3EPRA 3QLVA 1GPBA 4OB7A 3LJKA 4CE6A 5IZCC 3U40A 3LXRA 3OP1A 4MVJF 4P3XA 1ZKDA 3PUJA 1OV4A 4OHPA 4YROA 3PWSA 1CQIB 4LVCA 1FYFA 5C7YA 3SLGA 3CURA 4OMFG 4RAQA 5CT6A 1Y7TA 2X6QA 2NVUB 2Q6KA 5D3KA 1ZGGA 3PCXA 1DC8A 1SCKA 2B61A 3GVPA 4HR7A 4IQ0A 4NY1A 4QVKA 4ZICA 4DGQA 3E27A 2QT1A 2X6TA 3B53X 4HNRA 1WNTA 2ZYIA 4JC4A 4QUBA 1SBZA 3E22B 4BNNA 4U5QA 3OT5A 2CBZA 1VPLA 4QOSA 3UICA 2P77A 1VJGA 4DBLE 1M75A 1XFAA 4KACA 4LCBA 5AK4A 4QUGA 1YFLA 5BP7A 4LZLA 4AJEA 1BEZA 3PQ4A 3T7EA 1XZIA 4LBVA 4YHBA 2HA6A 4AZWA 3UKOA 5D51S 4IQ4A 4WXMA 3WYAA 5LR6A 1C9KA 2GJ4A 3FPFA 4F1JA 3OO1A 4ZQEA 3I2IA 3LP8A 3PXCX 5AVZA 4GI5A 4XB6B 1W5TA 3U1VA 3V5NA 5MFZA 4QLBA 1KMQA 2R3SA 4RLFA 1C7JA 5BRNA 1X14A 1TCCA 3WGYA 5JJIA 4J0CA 4QG3A 2Y1DA 1EBUA 3SYKA 1Z4QA 3F9CA 3MT9A 2PT6A 1UP7A 1ESEA 4UOQA 1JDZA 2RIRA 4EHKA 3BQNB 4NYJR 2V45A 3T3OA 3AB8A 1HM5A 3WLAA 2ILVA 1C9JA 4GLLA 2QX8A 4YECA 3RYFB 4BKRA 3CE6A 3LCRA 2GASA 4CMAA 2O52A 1JIXA 2ZSKA 2VP0A 4MW1A 4B33A 1DOAA 2XRZA 1L5WA 1W0KD 3TGLA 2EF0A 3PYXA 4PRZA 5AVYA 2VF8A 1Z6XA 3LFTA 1P29A 1FYEA 5HKKA 3JAMA 3VR0A 4JT8A 2JASA 3GEEA 4BCDA 4K2AA 5BPFA 4ZO8A 1V6CA 2PVCA 4PWYA 5BT9A 1YF3A 2J0UA 2B6NA 2J3IA 3R40A 3DMTA 3EFOB 3FPKA 4CUZA 3D4OA 1CHNA 4J91A 1IZZA 3QU9A 4OSEA 2J09A 2M98A 1ZJ4A 4J90A 3AX6A 4URXR 2RD2A 3K16A 2EFYA 4F2GA 5DCWA 3FB4A 4MUEA 2Q3DA 4NMWA 3VAZA 2G88A 1Z0UA 2Q8NA 1K75A 3IUQA 1P4SA 3KSZO 4FXPA 4JBLA 3T5DA 1D2RA 3I12A 1BKDR 4RQAA 1RM0A 4NCBA 4DRXB 3FHLA 4RM2A 4Y2SA 4YMGA 2BV3A 3T12A 3CEAA 1JG3A 3P9SA 4Y1RB 5DBHX 2HRQA 2QN6A 1KAHA 4ZYXA 2HA4A 2SCUA 3I9LA 5AP9A 3RG2A 421PA 1YKGA 3ZDDA 1OLUA 4OH7A 1N57A 1UMCA 3A36A 1F7UA 3LVRE 3ND5A 5D1HA 5JIBA 4QOJA 4J0QA 2ZYAA 4CJXA 1JFFA 2PFGA 4UXIA 1REQA 1Z2PX 4O4JB 5FBKA 2FMHA 5JZOA 4URVR 1U98A 2GEBA 3TXXA 1UDXA 4FE4A 4J1QA 4JS0A 1OAKA 4CM3A 2X1VA 2IE8A 2FMUA 2HRDA 2BEJA 2W6MA 1YBVA 4G1EB 1ZESA 1T3HA 1TJ4A 2XZTA 3LKVA 3O4RA 4M8NE 2CXPA 3MK31 1DFIA 4JY7A 3GT4A 5DXFA 1OXKB 3OPNA 2FK7A 4MPRA 4X90A 1JTVA 1AF7A 5TQ0B 5D6NA 5AUQA 3UV3A 4TXMA 2D1YA 4RGYA 2CSXA 1HE5A 2QWXA 2WTEA 3KPJA 2WJYA 4HWSA 4KW7A 1TAHA 4L8WB 1XLTC 6ADHA 1UFVA 4F8YA 1LLUA 2H5EA 1X8LA 4G0UA 3QIAA 3B6JA 2HEGA 3HADA 4LDPA 5EPOA 4G5XA 3CJTA 5DYIA 1K8RA 2NN3C 1O6CA 4X8HA 3SSNA 4Q4CA 1M34A 1D1QA 5A4IS 3FI0A 2O0MA 4FQ7A 2J3LA 5DW3A 5GPBA 2RGUA 4MRRA 4L85A 3GN1A 1KJJA 3A1VA 5DV9A 1JJAA 2QTHA 3WRYA 3UJBA 4Z7JA 4PHTA 2CMGA 3AB7A 1U2TA 4JZYA 2AN3A 5K1ZA 1ADCA 2PGNA 3FGOA 3WQQA 4GX5A 3DB2A 4AM8A 2AC4A 4C0XA 2X9LA 4QYWA 2JJ1D 1RP1A 4PZZA 3S40A 1YS1X 4KO8A 3ZJVA 1BOFA 5KC9A 4R0MA 1ECFA 1T5TA 1VHTA 3QEMB 4IKOA 3O38A 4YRQA 4CZ2A 5HZGA 1EXNA 3OZCA 1DC3A 2OD7A 3RIEA 3E35A 1UANA 5EKDA 1GNQA 1P39A 1X7XB 2QPAA 1IAQA 4YA6A 4N76A 1JAZA 3EQ7A 4WECA 1L7XA 3CPSA 4OB8A 4WBNF 1PTJA 1QTNA 4V0LA 5FPSA 2V7EA 3L7AA 3HYTA 3BIJA 5TDHA 3W5JA 2PXCA 1I51A 3HB1A 4E70A 1WXHA 3RAPR 2JS7A 2I2WA 1TAGA 1NXTA 4RFVA 4WLUA 2P4SA 2Q0QA 5K05A 2G71A 1W6RA 4A0HA 4HLQB 1YD7A 3KOYA 5JVDA 2X0FA 4OUDA 3STWA 4YT8A 3D2AA 1V45E 1YASA 3AOEC 4MEBA 3T9DA 4NBTA 5BSGA 4ZCTA 2XR1A 4J6FA 4HLUA 4Q16A 4UVEA 1P31A 3HDQA 4WFJA 4DA7A 1K1EA 3BK1A 3CH6A 3ONEA 2AG1A 4EAAA 5LQKA 2R44A 1ZH2A 3V7NA 4TRNA 4CKXA 2QTZA 1B23P 2EZ8A 3G2LA 4BPBA 4ZRMA 1NRIA 4YQZA 2L82A 1Z17A 3GUVA 4NBUA 4OI2A 4PVDA 1BA3A 4Q4JB 5EHQA 3UAVA 3PXDA 3ZH9B 1EUDA 2NU6B 3SYRA 2ORIA 3OAAD 1ZJZA 3Q15C 4GX0A 4LYYA 3AG5A 3QE0A 3QYJA 2FB9A 4EJ6A 3TR6A 3IX7A 1U99A 2IF2A 2PK3A 5L7WA 2ODEA 1DIRA 2SNIE 1Q3HA 4ATNA 1LI5A 2FPIB 3K92A 3AJEA 1AKEA 4BV9A 1V5FA 3GFTA 1H2WA 1KDYA 4BNVA 2OO5C 2VYQA 3RUFA 1LNQA 1OLXA 2PMCA 1J97A 4BKQA 4ENPA 1U8XX 2BC9A 2XB6A 1JR6A 2P65A 5KEIA 1X74A 3AWIA 2QL9A 4D9MA 5AHOA 3T9EA 2H4XA 4MI9A 5KMGB 2H5JA 3WB1A 4Y1RA 1Z07A 1IJEA 3VR5H 4IH1A 2WJ6A 1R0WA 2CFOA 5B4TA 4R7ZA 5ECDA 3D0OA 1YXMA 1U11A 1YB6A 1SUAA 1JJIA 2H7CA 1SB9A 5KU7A 2WTUA 1XDZA 3FVWA 3ISJA 1KDZA 2QVBA 3ZZ1A 1Z7GA 2GN2A 3K4PA 3QUBA 4C0KA 5JWOA 1A0OA 2MJLA 1GTMA 4HY3A 1SCAA 3F1KA 4KREA 2YV3A 3LUFA 1IJFA 3TQFA 4PR3A 1GA4A 4WJLA 1SC9A 1YUMA 2R6CA 3W04A 4DL9A 4AY6A 3F90A 4N6OA 2UYHA 1S8NA 1JECA 1Z6TA 2IXBA 3QPAA 1YRHA 1RCUA 3C4VA 3E05A 4ZO6A 2NO4A 1BZYA 2OC4A 1FTWA 1SKBA 4G09A 1AKMA 5TT0A 1KFCB 1F8UA 1NFRA 2Y0EA 3I72A 1FEZA 3LBHA 2J9RA 4RGBA 4XGKA 4MWSA 3WDLA 5HPYB 1BXGB 2PBZA 4P33A 1JV2B 2JGAA 2HIGA 4L6AA 3BILA 3R7BA 3IVGA 4AN0A 2CMHA 2ZRLA 5KTSA 1RXVA 5G3ZA 1VSUA 1WHSA 1Y7PA 1V7PC 3L6BA 1OGJA 3H2GA 3PDUA 5DTQA 5JSKA 4JITA 3K94A 4YCDA 1VPTA 1F60A 4TMYA 3GA5A 5F5NA 3C97A 4FDVA 4TLLB 5BVGA 1U2EA 3AR9A 1JEJA 1J8YF 1G5RA 3JR7A 2IQ5A 1N8SA 4BWFB 3OQNA 2QVZX 3ZCXA 4AXBA 1V8DA 4G0NA 3RH0A 2HZ7A 3ODPA 5B7NA 3TECE 5C31A 4W1RA 4Q19A 4IFIA 4MMXB 4O5AA 1M5RA 3VKHA 1QLHA 3RBAA 1G4UR 2D5IA 2FUKA 3QSGA 3W9UA 1C1XA 1XBTA 2BUAA 2N1MA 2I54A 5I7AA 3W6ZA 1QC5A 3OSUA 4W5RA 2X1MA 2YWXA 1K68A 2X2OA 2YWBA 1X42A 3I30X 3FUXA 2EFEB 2PBFA 2HTFA 1HT3A 2A4MA 3AR3A 2DX7A 5CA1A 4D8YA 1N92A 1NXWA 4RMJA 3KXPA 4OQFA 1HE8B 1AURA 4F45A 3OE4A 4OXIA 4UUPA 1QIKA 1E7QA 2V54A 3QXJA 2AEEA 2I65A 4N9WA 4NENA 1RJWA 3BMNB 3E1KA 4IIEA 3IOCA 4EKGA 3OFSA 1JWAB 1ZCAA 2V58A 1SM4A 2GPWA 4TLCA 1M1XB 3OQJA 3HA3A 5DF1A 3TTUA 5LP1A 3ZWWA 2G3YA 4KN6A 1FLVA 2PTGA 3D81A 3N7TA 2H48A 3GLHA 4HNQA 4KIWA 1U02A 2XRMA 1RDFA 2YUIA 3PLNA 5A6SB 1CR0A 2FPIA 2DQ4A 2Z2IA 1B6TA 4GRAA 1X1DA 4KGZA 4LK3A 4S1VA 4ZAYA 5FWAA 4RA6A 3SPXA 3K09C 4AICA 4YQFA 1DRKA 1TYAE 3D6HA 4CQJA 4ZYLA 4NSNA 2A78A 2I7XA 3HDTA 4HFRA 3EA4A 4YAEA 1W0JA 2F43A 2XMPA 3LUDA 4ZI3A 3PTAA 3TRDA 2HLPA 4EFLA 5DMHA 3Q8KA 4TXJA 4CG3A 3SQOA 1K08A 1KEVA 4C0LA 4LRYA 1GNPA 4DMGA 5IUJC 1ULUA 2C7OA 1LK7A 5EINA 4LF4B 3CC8A 2G77B 3L6CA 4PPYA 2Q3EA 5EZ5A 4MTLA 4MB0A 3SF8B 2HPVA 3WA6A 2KLHA 3QEBZ 3CY6A 5CFQA 4MDHA 3ZW7A 1B8UA 4G63A 2ZT7A 4Y2XA 4BEBA 1NJGA 5F52A 4DNXA 5T3UA 5DXAA 2F62A 4MI1A 3TWOA 3UT5B 2AL7A 2GEVA 2QJRA 2BBTA 4QUKA 1UM9B 1MDBA 1ZINA 3M6VA 3MBKA 1KOLA 1JQEA 2C0QA 1C1XB 2UXBB 1HZJA 1Y3AA 5F2KA 4KQFA 3EGWA 2QORA 3MJVA 4BFZA 4YFVA 4HNHA 1FP2A 1OE0A 1QJ4A 2FMFA 4JXJA 4QXAA 4ZU3A 5BT8A 5L3QB 2VZ8A 4RZ3A 1Q1BA 3M4JA 1BEEA 1QZXA 3A9UA 1Y5MA 4LK2A 4Q9IA 5F4ZA 1E9RA 2I4TA 5E6UB 3A1FA 3M2PA 3RU9A 5C1BA 2HBQA 1N0IA 2K2WA 1E2KA 4KX3A 3RC7A 4QEKA 4K8OA 4RXUA 4CKWB 4YMLA 1XE3A 3ZE6A 2I6QA 3G2QA 1T35A 4LMRA 3DT6A 2IYTA 4OLBA 4B79A 1WMDA 3VTAA 2ZJ5A 4FM9A 5CYPA 3PUYA 4UM7A 1WU7A 5IDYA 4N0DA 1TQDA 1EUQA 3DBHA 4Q3LA 3C15C 5B1IA 3WAJA 1K8QA 1WDMA 3DEYX 1S2LA 1E3MA 2AOTB 1US8B 4OJTA 2YVQA 2QXYA 3SBOA 3ZX5A 3RJZA 2BRUA 4A6DA 1ISGA 3OH8A 3LLSA 1OA1A 1ECPA 4P81A 5HVNA 2BHNA 4EQZA 3P32A 4QBHA 3NHUA 4HQ6A 4TRRA 3CNLA 3MFQA 4UEWA 2E85A 3M9LA 3T3GA 3VZRA 3GJQA 4M36A 1EWQA 4Z86A 3LXXA 4W5JA 1Y8AA 3Q6NA 1DV2A 1XCOA 2FSIA 1YCGA 2GK7A 2HLDA 2YHSA 3DWEX 4G5SA 4PCLA 3H6GA 1ECGA 2JNWA 4MQMA 4E5YA 4YUZA 1KJNA 1TECE 2FVXA 3HI6A 4INOA 1VKJA 5ITZA 2VCHA 3OLZA 3C3AA 5KREA 4OX9B 4MV3A 1GYQA 3D6MA 3SKYA 4QGAA 4DIBA 1PD1A 4QBFA 2H9YA 2ID4A 1NI4A 4LWZA 4UTOA 1VCHA 4D80A 2OD9A 4BFSA 4HGQA 1DBSA 1N2GA 2VQDA 3U9TA 1X70A 1ZC4A 4IVPA 2WFLB 5DJ5A 5FLKA 4EPTA 4QQ8A 3H75A 3GJRA 3EULA 3LWNA 2OPBA 1RAHA 1ISIA 4GLBA 4WJKB 2EP5A 4IHJF 4LTMA 5ICEA 2OOSA 3DA8A 4PX3A 2PL5A 1YOBA 3P1JA 4XX1A 3HL0A 2JG3A 1GCGA 2OGTA 1RI1A 2ZIXA 3GVHA 3OTWA 5LPNA 4Q4AB 1XA3A 3H84A 4PIMA 3PX2A 3PPXA 1QHYA 4IFBA 3GT3A 2PSJA 3VAAA 4AJHA 4LEIA 4C3UA 5DWDA 2FWMX 3AERA 1QFJA 1WV0A 2UZ0A 4Z0TA 2C8LA 3DT9A 2NTEA 5EUQB 4WJZA 3W4KA 2VCEA 1DJPA 3PQDA 4WKBA 1G8HA 3B51X 1E61A 1UJ6A 3DLPX 2R5FA 1JSCA 4ARIA 1GPYA 1IIBA 3IT0A 1A97A 3ZJUA 2UZIR 3RQSA 1A71A 1X2EA 3G8CA 3CVJA 3WR5A 4DIUA 4DR5B 3VDRA 3ZG6A 4TLBA 5B3AA 2DFKB 4L22A 2J0VA 2I76A 1U2DA 2UVQA 4UM5A 2ONYA 4PZPA 3AZQA 3TUJC 5IANA 4XFJA 2CUTA 4IMIB 1U7UA 3RC3A 5CG1A 1J7KA 2QP3A 4DWWA 5CM9C 3IIKA 1CQZA 1NNSA 4H3HB 1QONA 3BKWA 4N0QA 4OF4A 1G291 2OO3A 2JK1A 2CXXA 4I9GA 3VOSA 4CKEA 4D45A 4NXNB 5D6OA 1SXJE 1IBRA 3IPXA 2HHJA 2Y27A 1CS0A 3H2IA 3TTXA 5BWNA 5KPJA 1NZFA 2KSQA 3F3YA 3BD6A 3PIRA 3UCFA 3ZNNA 1DBRA 3ENVA 4DR6B 2BD0A 3C98A 4GNRA 2O1SA 5E6RB 2BFAA 3RK4A 4EEKA 2WC1A 3ECCA 4LF6B 2FLWA 1C3OB 4WXRA 2FSPA 1K7CA 1XYYA 4GGPA 5TQJA 2CLLB 2LKCA 2OXFA 3ANNA 3H2JA 5CT9A 4DV0B 3C7TA 1WAMA 3WHPA 2X1LA 3CRMA 2YJTD 1ESMA 1T9AA 3RS3A 3UN1A 4ENVA 2YXBA 1C2TA 2JLQA 2QUIA 3AOEA 4MTCA 4V0OA 2VQFB 16PKA 3FHTA 3IOBA 1YOVB 2B78A 3LKBA 3KXIA 1C4OA 3GYGA 3L8DA 3LPCA 3M1YA 1SU8A 5DCLA 5F7ZA 2ONJA 4X20B 1UXGA 1JMYA 1EXMA 1I2ZA 2FZ4A 1HTBA 2HREA 5L51A 1GAXA 3F98A 4TV9B 1YZUA 4EHHA 1W25A 2R47A 3KM0A 3NTXA 4KDCA 3F96A 2DFLA 2QTFA 3VZQA 5SYNA 4F97A 1TM7E 4U3JA 4ZCLA 2H1IA 4GO1A 1KAOA 2BMWA 3IOEA 5G1PA 5KZMB 1IE3A