4XB8A

Crystal structure of dscam1 isoform 9.44, n-terminal four ig domains (with zinc)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
391
structure length
391
Chain Sequence
QKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVIQSYESEADNEYVIRGNSVVMKCEIPSYVADFVFVDLWLDSEGRNYYPNNAAETDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSKAPTFATASKISSLLGSSSSDIVLLCQAQAFPVPYTRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Down Syndrome Cell Adhesion Molecule, isoform 9.44
publication title Structural basis of Dscam1 homodimerization: Insights into context constraint for protein recognition
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
total genus 66
structure length 391
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xb8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xb8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xb8A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xb8A04
3UJTL 2ZJSH 3EDFA 3QUMB 5GGTL 3SO3C 2G5BB 1OQOA 2X4TA 1GHFL 3BOVA 2ATKB 4WWKB 3QAZB 4Z8FH 1B2WL 3GSXA 1FFPA 3VMOA 1OAKH 4TTDD 5A2IH 1KEGH 3FZUC 4J2XA 1A3RH 4APQD 3ARGD 4LMQI 3TF7C 3UJJL 3K4AA 4J1UB 1WTGT 1QRND 2X1PA 2AXGA 3SQOL 3MV11 1ZHKB 4C56A 3NTCH 1U91A 2FH8A 3T4YA 2VNCA 2EKJA 2GY7B 3T0ED 1XGYL 5BOZG 2ZPKH 2Z4QB 3IFPA 4J3OC 2GSIA 2DRUA 2NW3B 3OR7A 2EKSB 3NN8B 1JHLL 2UYLA 3ARFB 5D2LF 2HKHL 1OTUD 4W70A 1I4FB 3PDOB 4DFIA 3AS0A 3UZVB 3KWWB 1PZ5A 4LNRB 5GS1A 4PJFB 3FJTA 4FRWA 3KPMA 2Z8RA 1RPQA 3MV9B 3QNZA 3O3EB 3G6AB 3O2DA 3RPIA 5IMLB 2M2DA 3BUTA 2VR9A 1HXMB 5KVDL 3KYOA 3KPPB 1W8OA 4OZGA 5E2VH 1OARH 5F96H 4X7TB 4L1HA 3GJEA 3TVMA 2R0ZL 5JDSB 4XX1E 5KS9B 3DROA 2J1KA 5IVXB 4FG6C 2GEEA 3LMJH 1B6DA 1YYLL 3QDMB 5TF1H 1DSFL 4B41A 4YDVB 2BRRH 3U7YH 4ERSH 4ELMF 3MFFB 3OWEA 5DD3H 3IDJA 4JO4H 4ODUA 4HULB 3KHQA 4ZAKA 1YY8B 4YHOL 3V52H 1FLRH 3CFIC 2VITB 4AMKH 4ZS7H 3L5XL 5JNYB 5EU3A 4WHCA 2NY2B 3RUGB 1FCGA 4U1GB 5DD5L 2ZUXA 1HINH 2NY3C 1FGNH 3VJ6A 5EO9B 2FO4B 3N06B 4FQQB 2EDXA 1P6FA 1K2DB 2JB6B 1YN6B 1EJOL 4Y4HC 4IBLT 4U1JA 5KZCD 5FGCB 3FB7A 4YFLF 1KACB 2J88H 5DTFB 5DDHA 5D6CB 1G7JB 4KTEL 2F58H 1TQCB 3DXAD 4LSRH 2D0HA 3VRIB 3I3DA 5ENWA 1TNNA 3IJYB 5CGTA 4FZEL 4X9IA 5EUOF 4YHML 3RNQA 1KF9B 5BOPA 4NUGH 3L3KA 4GQ9L 4P4KB 4J3WA 2D31A 4N1CA 4NKIH 2W92A 1K3ZA 2OX5A 3RL1B 4P5MA 5DUPL 5K9OA 3QUYD 1QFWI 4ZFFA 5E8EB 5CUSH 5I76A 3S35L 5DWUL 1TDQA 5KN5A 1IGFL 1WQVT 5J57B 2AXHA 3PXHA 4JHBA 3RWHB 1FZMA 1A6PA 1AFVH 1JRHL 5IMOB 5F1IB 1TCRA 4MCYA 4HEME 1M7IB 3PP3H 2J8UB 4QXGH 4HJGA 5C86A 1GL4B 2AK4A 1GGUA 4UNUA 3ARVA 1IT9H 2JJUA 5AYUL 1DUZB 3MGTB 3VFUB 4TUKL 2R4RH 1FZJB 4N8CH 2VXUH 2GCYA 1T0NA 4QHNB 1CBVL 2E9BA 4HS8H 4PTTB 1OD7A 1YY9D 1MRFH 4ALAL 3LQAC 3ARDB 1L0QA 1L6ZA 3J7HA 2NY5L 2IANE 3L9RA 1OVZA 3FN0L 3UCRA 4UOW0 3OKLA 2VIRB 4K7PY 3NIDF 2EDLA 5E5UB 2W9EH 1TTGA 2R0LH 2VE6A 4L9LA 3HAEB 4U1NB 4YC2C 4PP1C 4EBQL 4JPKL 4Y1AB 4ODWA 3LV3A 1DUYB 4FMFA 1KSRA 3D1MC 3VRJB 4LKCB 3UC0H 4ZUVA 3WLBB 1NEZB 3S36L 3HPJB 2XTJB 1JP5A 5F3BA 1AR1C 1U8LA 4OJFH 3QEUA 1MIMH 2EH8H 3MRQA 4EJ1C 1CQKA 3R1GL 1JFQL 2B4CC 3W0WB 3SKNA 3AREA 3B9KB 3BX7C 4LLQA 1KPVB 2VDOH 5CP7B 5FGBC 3SJVA 3STZB 4GAJH 2C3VA 4GRWH 1F2XK 1KB5H 1NANH 2FX7H 5J0BA 3WLWD 1FNGA 3DVNA 5CJXA 1ZT1A 3MV7B 5DQDH 4Q9CA 1TFHA 5HDQH 2X70B 1PX3A 5JXAL 1YN7A 1BWWA 3F5WA 5JOEA 3I6LD 5DQ9B 5T1LA 4Y0GA 1CD9B 5DUMH 4G9DB 2X9XA 5F7HA 4GW5B 3W2DL 5KSAC 2IPTL 3WFBH 4RGMB 5LBSH 5DHVB 5FV1L 4BZ1H 3THMH 1LP9E 3A6CH 4JFPB 4XCFH 1JPGB 3J8F7 5C08B 3I6KB 1PY4A 4W81A 4GH7B 4YLQT 1BFOA 5D2LA 5C0GB 4X98B 1P2CA 3VXNB 1G7HB 3TO4A 3LN5B 4I9WD 1FG2B 4P23B 4P2RD 3X3GL 1KTDA 3RQ3A 4KRPB 3LIZL 3O8XB 5HI3C 1XGRB 4WGWB 3V8OA 5SX5H 4CU8A 2I60L 2WWMC 3BAEL 3O3AB 4UMGA 2NY6D 1BM3H 1KTLB 3RP1A 1SY6A 1I85A 3H3BC 5KSBE 4NQDE 5DC0A 5IMMB 4KJYA 2ZOKB 1RJLA 2V17L 3RVVD 3W9EA 3PL6C 1PKOA 3QI9B 4PBVC 4CVZB 3P9MB 2J6EH 3SPVA 3L95B 2BVPA 4UI2A 1MCJA 1TIUA 3NOIA 1CIUA 3MV8E 1SEQH 1CL7L 4NZUL 1C08B 2NZ9D 1I9IL 4UAOC 1UH3A 1JGVL 4MAYA 3B2UC 3VCLB 5GRVL 1XGPA 4HJJH 3TZVB 2DKUA 4OV6F 1AXSA 1JZ4A 4K3EH 4EN3C 1ZGLA 2VZTA 3SBWA 4NWTH 4ZXBD 1FJ1B 2CLRA 1S7XB 5D5ME 3H3PL 1N5YL 1G7QB 4G9FB 4WV1C 4R4NC 5F3HB 5F9WC 5JHLH 1NCCH 4G80A 5M94B 3ZKQD 1EHAA 4HAFA 1NLDH 4M62H 2VLKA 3DGGB 2JJSC 3MLRH 1WLHA 4NP4H 3IF1A 3GMQA 4X4YB 4HUXB 3H7BB 1BBJA 4PJHA 4O9HH 4PG9A 1T20B 3DX9B 2IMMA 4HC1A 5FOJA 3GNMH 3WHE1 1UGNA 5SX4I 2FD6L 4JFZL 2Q3ZA 5E70A 2EYSB 3QHZL 3UO1H 1S5IH 4Y4FC 4HV8B 3LKNB 3FKUS 5I66B 4U1LB 1U3HD 2PR4L 3PWPE 5A40E 2QQLL 3SE4C 2YPLD 3CZJA 1FO0H 3K1KC 2I5YH 4LVNC 4GAFB 1CXHA 3KHOA 2Z92B 5JR1H 3VDBA 2YUZA 3F7RA 1A7OL 5DRXB 4HIIB 1EAPB 5B3JF 3QULA 4AENB 4ZD3L 3FQNB 1WAAE 1CDHA 1KLUB 1U42A 1I7ZB 4ZDHB 1BJ1H 2D7PA 3LEXA 1HK6A 5D7JB 5C0DB 4YPJA 1T5XA 4OUUB 3MUZ1 3VXRD 2DQJH 1CFNB 4WU7A 1H3UA 5HYEA 3ARSA 2QQKL 1GIGL 3C87A 4BSVB 3V6FA 1MFAH 3NZ8B 4M02A 3VFSA 3LEVL 5IFAL 1F11B 1MFCH 3UZQA 3X14B 2VSDA 4NRZA 4JFFD 4ZUWA 1OP3K 5DR5L 1YJDL 3QZWG 4PLNC 2X4NA 1UM6H 5JLZB 5L0QC 3UEZA 3REWB 4YUEH 5SWSD 4Q58C 2C9AA 5KG9A 4PGZA 4M8QB 3FO2A 2PXYB 4J6RL 4OCWH 1KGCE 4P2OA 5C9JB 1Q1JL 3OKYA 5BXFA 4LIQE 3AAZA 4NKOB 3F7YB 3P73B 5DK2B 4FZ8H 4YR6B 4YH6A 3CMOL 4DCQA 3V8CA 3V7AG 3FHQA 3KPNB 4XHJC 1IAIM 4RZCB 1GGCH 3GI8H 3W82A 3CXDL 4LQFH 4PYGA 1KPRB 5C07D 1ZLSH 2HT3C 4JCLA 3HB3D 5HGBA 3DPBA 4OBRA 3E3QE 4HS3A 5F1NA 3C6LD 4V2BA 1PX4A 1Y6NR 3QZWA 4UILH 3TT1L 3OJDB 5FKPB 1M6OB 3DUHA 1YPZA 1QA9A 1FFOA 4UV7L 2MOVA 3CSGA 4CMMA 4HUVB 5TE4H 4OCMC 4RMVA 3ULVD 4QHKI 3RVTD 3RY6C 3PIQB 4L29B 7FABH 3Q3GA 3ROLB 3BESR 3F7QA 3JV5A 1XF2A 3WL9A 1OAYH 1MUJA 4TSAH 4YX2L 5FUCC 3VXTA 1IQDB 1A6AA 3SOBH 1U8MA 1BBDH 3DUSA 4IOFD 1MEXH 4Q74A 2DQEH 3HPLA 2FATL 5EFIA 4IRJB 1T6WA 1KLGA 5JPMB 1BZ7A 1QQDA 5CEYB 2HKFL 4GMTH 3VXSB 4P5KA 2LV4A 2BFVH 3UTSB 5BV7L 2GSGA 4HUWA 4HF5H 1KJVA 1VKXB 5H35A 3KLDA 1D6VL 3KR3H 3MRFA 4NQEE 2NY0B 3JWDH 4PJ8D 5L88L 4HGKC 3U36A 1Z9OA 3B5HA 2R0WH 1Q9WA 1KB9J 3PV6A 3M8OH 4YXLL 1MFBH 1PAMA 3DO3A 3U0PB 1TVBB 1CFTA 3ZKMD 2OTWA 4J4PD 4LLYA 4NSKB 1RZIB 1U8QB 3ARXA 1YNLL 1BVZA 5BRZB 1P7QD 1N6QH 1ITBB 2H32A 3K7UA 1ZMYA 1C7TA 1J18A 5JIPA 4C56E 3S7GA 3TBYB 4Y2DB 1P1ZB 4HBQA 3V5DA 3ZSTA 2HTKC 4MJIA 3SDAC 5AWNH 2JB5H 3WN5B 1T1XB 2HJKB 3SGDI 3FO0H 4FFZL 4P5TB 5C0BB 4A6YB 2EDDA 5H2BA 1MLBB 1HWGB 3HNTL 3JV4B 5JW3H 3NAAH 3MODH 4QF1B 1B6UA 4LRNH 4ZTOH 4BSJA 1SVZA 4DVRH 3BJ91 3KJ4B 1TZHA 2RIKA 4OIAA 5IJKC 5HHVH 1OAXL 2APXA 5DVOA 4Q0XL 3VA2C 1V7MH 4HS6B 4MJ5B 4NKQB 1WBZA 3CXHJ 3QO0B 3K46A 4OZGE 5IVZB 5DK0A 1OAUH 3UTQB 2ZUQB 1A4JA 5AAMA 4O58H 3BIAX 5ISZA 2ZCHL 1AR2A 4M43H 2NYYD 3OAYK 3QHTC 2VDQL 3M07A 5MEQA 1YMHA 3VWJD 3QFJA 3VDCA 3PJSB 1S7SB 4N0CC 1NAMH 2IFFH 4PUBL 5E08L 4GXUN 3QXAA 1LK3L 3QWOA 3U46A 5D9SB 6FABH 4TUJB 3KLHC 3GSUA 3OXRA 1YEDB 3TA3D 4HUUA 3IJHA 2HLAB 4MXQC 2R1XB 3HUJE 1WFOA 4L3EE 3MOBL 3TFKD 5I1GH 3LS5H 2C3HA 4ZQKA 2B2XH 4LKXB 4G8GB 1A7RL 4KUCD 1NMAH 4EXKA 4NNYA 5IW6B 4PTUB 1ZSDB 4M3JA 4MNQB 1F4HA 1F4AA 2MPAL 1V3KA 4LCYA 2JK5A 5CMAA 3U9PL 4Y5YC 1A6WL 4PP2A 2QHRH 3RAJH 4QXTB 4EIGB 2ZNXA 1N8ZB 3EYFB 3RWEB 3MJGX 1PJ9A 2D9QB 4PGJA 3ZKSD 4GKZA 1K8DB 5L9DH 4RNRB 1S7RB 2X2YA 5TQ2L 3S34H 1HDMB 4KJPC 5HHMB 1UJ3C 4J3UA 1JL8A 1A1OB 2D7TL 1OAZL 4MD0B 1NL0H 3S5LG 4GUPB 4XHQA 1A22B 3CDFA 1XGTB 2JLLA 1X5GA 4RMUA 2AEQH 1S9XA 1DTUA 1U6AH 3SE8L 4KDTA 3CGTA 3MBXL 4UB0L 2BY3A 2F8OA 3GMLA 1BQLL 3A6OA 3TJHC 4F58H 1G9MH 2EXWD 1A6ZA 5EO1A 2OLDA 4QHLA 5LQBH 1BQHG 3TEUA 3QUKB 3FO9A 3QWRA 3RI5F 2O5YL 3TIEA 4KK9C 3EOAB 1AHWA 3QIUB 4APQA 5DI8A 1QFHA 2AK4E 3VWKC 3GIZL 5EOQH 3BWAB 3NH7L 4JM2F 1X4YA 1RZGA 2QSCH 3LD8C 4P3DA 5IT2L 3BT2H 2P8MA 2UWEA 4F57H 5FF6B 1FV1A 5GS2D 1Z9SA 1NC2B 4FXKB 1E27A 2XG4A 4FP8L 1I9RL 4OD2B 3P9LA 1MPAH 2AJXH 5KVMC 5I16B 4X8JA 5DK3A 4BZ2H 1RZJL 1QSVA 4ELKA 4WUUB 1U41A 3HG1B 3RJDA 3V4VH 4ZPVB 2ITDA 4HK0B 3RDTC 4OQTH 3KYKH 5ALBH 3WJLC 5DJCB 1T0MA 1DANU 3L6FA 3O45A 4ZOCA 1CDUA 3QWQB 4G6FB 1NSNH 1FVEB 1T5WA 4NHCH 1GC1C 1XR8A 3ELAT 2NW2A 4RAVA 1ADQL 5J12B 2IBZY 5DZOA 2E9IA 4NJ9H 3RGVB 1UWEL 1CGSH 1KIQB 3GSRB 3QDHA 5EUKA 1T83A 2VXUL 3F7PC 4HCRH 4KK5C 5CEZE 2FB4H 3VFGL 5F6HJ 3R06A 5I75B 3PHQA 3H9SD 2RJMA 4PY8J 4AL8H 3FFDA 4PJ9D 1RURL 2APVA 2NY1C 4LARH 3H9HB 3SJVE 4Y19D 1G7LA 5CSBA 3O4LD 3SDCD 2PO6D 1EEYA 3RVUC 5F7UA 3NABL 2PYED 3Q6GL 2QSQA 3I02A 2Y1VA 1OCWL 3OKMA 3QXWA 2DLHA 2PETA 4IRSB 1T7YA 5DC9B 3MMEA 1TZGH 3BGFB 5E2TH 3CH1B 2HFFA 4ZUSB 4HX1A 5E5RB 5IROC 4UTBL 2EYTB 5CD3A 5IHZB 1UACL 2NTSP 1YNTA 2R2CA 5DMYA 4ENEC 4TSBL 5D2LE 5HBBA 3PP4L 1HI6A 2HTLC 3PP3K 4BQCA 2EE6A 1I1FA 1MNUH 4FFVD 5JXEC 5FYJE 1WICA 1NCAH 4K8RC 1ZVSA 3ETBF 4OF5A 4HPOH 5E1HB 2IPUK 2BNQD 4QOKD 3L3IA 4Q9RL 4UV4H 3X13A 2Y9RT 1Q0XL 3RU8L 4GG6F 2GTZA 1MCSA 3VFOB 4O5LH 5E8NB 4PRAB 5CCKL 4LU5L 4JB9H 4R4BA 3IXTA 3VE0A 4LHUG 2R2HB 4OF0A 4JGUA 3HKFA 3IAPA 5IQ9A 1NQBA 2ARJA 2CR3A 1KYOK 1YQVL 4OD1H 4XNQA 5BO1L 4NN7B 3MUGA 4JPVL 2XNAA 4FXGB 4G43A 4ELME 5CZXC 1MIEL 2VLLA 1A9BA 1I7UB 2RCSH 2VRAA 3FT3B 4R26L 1DQLH 2FHCA 4TNWF 4N1HB 1XFPA 1CFVL 4X7EC 3FCTB 2CIIB 4ODHL 2N1KA 3PGFH 1ZXQA 3A0OA 4GLRH 5JUEL 3T1FA 3QUXC 2FBJH 3MLTA 1EMTL 2EDJA 4HIXH 1BD2A 1EBPA 3DTXA 4I3RH 1FFNB 3MRKA 1SVCP 3VRLF 1EEZA 1T89A 2OJZL 4XI5C 5EU5B 3D39D 4LSVL 4GKNB 5FYLE 4NM8L 5CBEB 4ODTL 3QQ4B 2IAMD 3X11B 1TETL 2VWEE 4LVEA 2VLKE 5E4IA 4FTVD 3KYNA 3G04A 3C09C 2DD8H 4WI8A 3U1SH 3QQ3A 1XR9B 5I19L 3ARGB 3C8DA 3B6SB 4DJMA 3AY4A 2VDML 4LL9A 4AG4H 4XWOC 4X9FA 1ND0B 1F02I 1NPUA 3BKCL 1QRNB 4KAQL 3HE7B 1FSKC 3P4OA 3VFNA 5BVPL 2DQDL 3G5YB 2YKLL 4MQXC 5JO5B 1WF5A 4CN4A 4DKEL 1T7WA 1ZT7B 3CCHB 3EAKA 1T7ZA 5GGVY 3NA9H 1GOFA 1LK2B 3RL2A 5DMGD 5ESQA 2IH1A 2Q86B 2FL5B 4QCIA 2COQA 4XGZB 1I1CA 5I73B 2E8YA 3RKDC 1JBJA 1JGLL 5DQJA 3F62A 1KN2H 4LCCA 3FQRB 5SX5K 3MYJB 3ECBB 5D1ZD 3HR5A 3TYFA 4PGCB 4YK4B 4JM2A 2IANB 1J1OH 3EFFB 1H3TA 5KOMC 5M7QA 4QTIL 5LWYH 4PLJD 4QYOB 3QIWD 3BKYH 3WYRA 1NMCB 1MCEA 1JTTA 2BOBB 3MQIA 3MCLH 3RWJB 4JHWL 2CLVB 3C2AL 4QGTA 5TJWK 4K3GA 1CE1L 5DD0H 3WIFB 1UXSB 2R56H 2OP4L 1WBXB 3DV6B 2ERJB 3INUL 4PB0H 4ZTPL 4X6DB 4P2RA 5DD1H 4KQ4H 3VFPA 4DN3L 3OV6A 5T3ZH 1XIWA 1T1ZB 4JRYD 5HGDA 4HIJA 4U6HB 1UXWB 3UTTD 1ZWIA 4OV5B 3B9DA 4JRWA 1KIRA 3W5NA 1HQRB 2QBWA 4OSUL 1D5IH 2VXQL 5KAQF 1BEYH 4DGVL 4YQXH 3HI6H 1IC4L 1AGFB 4NZTL 1S9WB 4XCCL 3CZFB 2R2BB 1II4E 4G3YL 3T0BA 4YXKH 3IXAB 1VGEH 4JY5H 5DUBA 1FORH 1WWAX 5HYSB 4OF6A 3DXAB 3NACL 3SCMB 2Y4SA 2FEEI 2YUVA 4R2GD 4JDVA 1U3ZA 3IDGA 3MRDB 1PEZA 4RFNC 4NN6C 5ICXB 3GK8L 3AXLA 2XN9A 4JRXD 2R69L 3QDGE 2YPKB 3T09A 1MCBA 1LP9B 2DKMA 2GAZB 3ZT7A 2XWJB 5DJ2B 5DRWA 3IAGC 5TH2B 3MBEB 3V7AE 3BZEB 4KRLB 3QUYB 3WKML 4EUPH 4KHTL 4JKPH 2OCFD 5IR1B 3O2VH 4WY7H 4QHMB 1ZT4B 4M6ML 4XZUA 3GI8L 3PQYB 1CLOL 4G8FB 4DZBB 4Y4KD 3N50A 4RFOL 4D9RD 1JGDB 4DGIH 2VAAB 3H42L 3RWCB 4Z7WA 3VA6A 4HD9A 1TMCB 3K0WA 1U58A 5KSBB 4NQDB 2RQ8A 1C16A 4QRTB 2YWZA 1ORQA 1PYWA 5B38A 1MRDH 1QEWB 1IAII 1KB5A 2XWBB 4K9EH 2LAGB 1U3HA 5CSGA 4WHTA 3TC9A 2EYRA 4HKBA 3KPRD 35C8H 1VADB 4QNPE 3MV8B 5DJ8B 5F7EL 3HE6A 4OZFB 1RZ7L 3L7FB 3E3QC 4CMHB 2BDNH 4K71B 4LLDB 4J3SA 2YC1A 4I48B 4LEOA 1DDHB 4HQQL 4UIKH 1A6TA 5D1QC 2D0GA 3MRPB 3AVEA 1T21A 1R3HB 1HCVA 4MJIE 5GRUH 3H9ZA 2G9HA 2NX5E 2HLFC 5E6IC 3VH8A 2H26B 2AGJL 4XNZB 2Z31D 5D5MB 5E5MB 4GBXC 5TE6H 2IMNA 1IILE 4OGZA 5EG6C 4JFFA 5AAWA 5I1DA 1NGWB 4PV9A 5DMIH 1FH5H 2UY7A 5D1XC 4Z6AT 4UTAH 4E41D 4GS7C 5BS0D 1IM9B 4EQ3A 4ZS6D 2NY4D 3KDMA 5SWSA 5HPMA 5KBNC 3QUZC 5EWIH 5E00B 3PF2A 1N4XH 4AJ0A 4CN1A 5C0EA 3NCJL 3K8KA 4Y16D 4CVXB 3ZO0A 3KPSA 5CLTA 5FOBA 3I2CL 4H20H 4OM0L 5ISZE 3KNBB 5GZND 1J86A 4CL7A 2J6EA 2OL3L 4QY8A 3PWPB 5SV4A 2K9UA 2V2WB 3FO1A 1ZA6A 1MRCL 3PWJA 1WZLA 2JTDA 3QDJD 1E28A 1PEWA 5C07A 4N9GB 1EK3A 4D0DA 5L2KD 2ZUWA 1YMMA 3BP7B 3PGDA 3MRLA 3D25A 1XCTA 1OW0A 3OHXB 3L3DA 4X80H 5J6GB 3DMMA 4K3DH 4Q9QH 1HHKA 1B0WA 4MVBD 5ID0B 3EO1B 1AGDB 4JZNA 1EVTC 4NO3B 5INDA 2E6QA 5IESH 3CFBA 2EDTA 3KLSA 5AZ2L 2C26A 1H8NA 2QKIB 4UU9A 4LQ1A 5CKAA 3MYZA 3O41B 4J3XA 3D85B 4YHLH 4E5XA 4H88H 1QNZH 4NQCD 4M1GH 1S78D 1YDPB 1BFVH 5B8CA 2GTWA 5KAQG 1SYVA 3EUUA 4HIHA 4KKLD 4MJ4A 3IDYC 2VQ1B 5FYKE 2CDEB 4N5UA 5GS1C 1DBAH 4DVBA 3VXMA 3EYSL 3O4OB 5CHNB 1FP5A 3O6MH 1ZK9A 4F33B 4YAQA 1YECH 2XIDA 3P4NA 1Z9MA 3OKDB 5I71C 4HXBL 4RQQB 5JHDD 3CFEB 1T03H 1OGAD 3TVMC 1FO0A 1YEIL 4BKLB 1ZEAL 3REVA 5DSCB 2B2XL 4KQ3L 1RHHB 4JDZB 4IOIB 5H37H 1YYMH 2DYPA 1CXKA 3H6JA 3CFDA 1RY7B 3R8QA 2G2RA 3QUML 4NKDA 1D6EA 3O6KH 5TDPB 4BFIA 3ES6A 3TV3H 1LD9A 3ALXA 1X5LA 5CILL 4P46D 3WUZA 4ZAKC 1JWUB 1KC5L 4ZXBB 3T0VA 1J5OL 4PR5A 2P7TB 5IF0A 3P0YH 4HLZG 4R7NA 2UWEE 2YUXA 5DMKB 4U1KB 1TJIH 1NUFA 4H5SB 3KS0H 3VG0H 1HQ4B 5IB4A 3LKPB 1FL5B 1OSPH 4PJAA 4P4RB 3PGCB 5J1AA 4OZ4B 1UWGL 2VC2H 3OF6A 4M93C 2AEQL 1G0DA 2XY2A 4MS8C 2BNUB 3QG6A 4GAYA 3W11C 2X4OA 4WFED 2B20A 4Q2ZB 1NCDL 5DO2C 3WEXA 4OF7A 2X4PA 1C5BH 3EJZD 5A2JH 3CPLB 3EYUH 2YPLB 4XVSH 1XMWA 3TBWA 1F4WH 3DJ9A 1TLKA 4DAGL 4NQEB 5E94A 1P4BH 2X4TB 4K7PL 3IU3A 3FFCA 3ORJA 4KKNA 1A7NH 4O2FB 1ZLUK 1VGKA 1XGQA 3WJJA 1OP5H 4FQXD 4H1LH 3X3FL 1LWRA 5IVOA 2WW8A 3EO9H 4KI5D 2HJFA 3NMEA 3I6GA 1ERNA 4HXAL 1J87A 4JREC 4MMZC 2DL2A 3BI9X 3PABB 2VXTL 3TA3A 3JV6A 2AXGB 2I25N 2PNDA 4M1CC 2DWEA 2FX9H 4R97C 2AJUL 4PJDF 3L3HA 3WD5H 1U91B 3T4YB 1AGBA 4PRPD 5F21B 4BELD 4DKDC 3C5ZC 3IFPB 5A2KH 4XAWH 3WXWL 1N59B 1L7IL 2NR6D 5GSVA 4Y5VC 4EOWL 4QRRD 3OKNB 1FL3B 3OR7B 1AKJD 2VLRA 5I8EA 1DLFL 2XTLA 3IDIA 1A4KA 1KCUH 3MGOA 4PJ5D 3I3EA 4NC1C 1PZ5B 5IW3A 1QFOA 1QSFD 4Z0BL 3KPMB 2FGWH 3IGAB 3ROOA 5I1KH 4TUOB 3QNZB 4UT7H 4NRYB 2IH3B 3OB8A 5E1AA 3GSVA 3RPIB 3X12B 4WUKL 1G1YA 2HVKB 5GJTH 3NVQA 1QZ1A 1N64L 1RIUH 3OGCB 1EXUA 5J11C 3C6LB 5IMKA 1JHTB 3O11B 3GB7A 1FYHB 1RUKH 4JPWH 4KTDH 1RI8A 5SV3A 1DBBL 5FHAL 4XPGH 2BSED 2IBZX 3E2HB 3IDJB 1V3LA 4ODUB 3AREC 3B8SA 1WTLA 3RZCA 4YDIH 2WP3T 4N8PA 4P0DA 3LQZB 2IGFL 1RIHL 4G6MH 3HUJB 3P9WB 4L3EB 2DJUA 3BQUD 4TNVK 1FGVH 2LTQB 3VJ6B 3Q5OA 1KCLA 5MERA 1BF8A 1FFRA 3UROR 4Q6IC 2YRPA 5K59E 3SGEH 4NFDA 3NFNA 5LXGH 4NQVA 3U0TB 5DURD 3FB7B 2ZUYA 5DDHB 2X4QA 3KXFA 4XAKE 3FB8A 5DZNA 1BD2E 1P6AB 3UPRB 5IFHL 4XNMB 5KSUA 5HGAA 3ZYJA 1WZ1H 4NZDA 2UV3A 3ZDYF 4XP4L 4N0UA 1FFQA 4XBGB 1U8KA 4YFLI 3TBSA 5FO7A 3BP5A 3RTQD 3P0VL 2EDBA 5DJ0A 3L3KB 4L5FL 4Z7QF 2W38A 4MQTB 1HHHA 2D31B 5DYOA 3G6JA 5A1AA 1LDPH 5CGMA 4GAGL 1NAMA 3BH9A 2VTFA 5K9OB 5C0RL 5E6YA 4JE4B 4CW1A 2G75B 3TN0A 4NUJA 4L4TD 4PRHD 3GHEH 3OSKA 2NTFB 5DFWH 4PLKD 1I85C 1CZ8L 1GGYA 4G6JL 5IK3A 1I8LC 3EOYG 4C83A 1TTUA 1CLZL 4S1RH 3LAFA 4TPRH 2F5BL 2C7UB 3DLQR 4PJ9A 4Z7OF 4I13B 4G42A 3MOQA 4HJGB 3VXPA 4C55A 2DQUL 4HKZA 2AK4B 2L0DA 1OGTA 4UDUA 1KG0B 5C0CD 4OFYD 1F6LL 2UZIL 1H9VA 4ORGA 4GRLA 3QIBD 1PLGL 5D7IF 3BO8A 2J5LC 4I5BB 1ZHNA 4HFUL 3TYGL 3ARUA 5IB1A 4IJ3B 2F9BT 4ZO7A 5GRVK 3VXOA 5L8LB 3BMVA 1J1PH 1S7VA 3BN3B 4QLRA 3HS0B 3OKLB 5E4EC 5ALCL 5FB8A 4NGHH 3V6ZA 1RSFA 3S3PA 2A38A 3QEQA 1H8SA 3VGHA 1NFKA 3UYPA 1KTKE 3QRGL 5L6YH 3LV3B 5GZOC 2NY7H 1MFDL 1R3IH 5I1HH 1DVFD 3MRGA 4OT1H 5F3BB 5F93C 2B0SH 1IBGH 3GSWA 3MLXL 5D7LD 4OCNC 5FKAA 3MRQB 4GSDL 4L8BA 3V0AC 2XFXA 3VGEA 1FIGH 1KXQE 3B3IA 4LSDA 2NXZC 5I1JH 1XH3B 2LVEA 3WIIL 4P3CH 1ZTXH 5IB2B 3EHBD 4LLQB 3GBNL 1JZ2A 3SJVB 5LKNA 1KULA 3P4MA 2C3VB 5JIKA 1YEJL 4PS4L 3ARRA 5LWYL 1QR1A 3HHRB 3I75B 3KPOA 2FIRT 2X4RA 5IB3A 3ILPA 1QSED 5FO8A 1IAOA 1YN7B 1RVFH 3F58L 3G5VA 5T1LB 1BVKB 3I3BA 4MB4A 1PFCA 5HD8C 1SYSA 2NXYD 3BKJH 3CVHL 1UC6A 2GK2A 4F2MB 1AIFA 2XN9E 1HZHL 2CXGA 5CJ8A 4OQTA 3BISA 3LSOB 1H0DA 3LQAL 4DTGL 2Q8BL 1D3CA 3SDDD 2AXJA 2VISA 4K23H 5T1MB 5D2LB 1BFOB 4NKMA 4XPTH 5FK9A 1FYTD 5KW9H 3TO4B 2FJFA 3ZHKA 1XEDA 4JQXA 3D39A 1AI1L 1AO7D 3ZTNL 2O5ZL 2IAMA 3HMXL 4KMLB 2APWA 3QG7L 1CDGA 4HCRA 1I1RA 2ICES 4XPBH 2P45B 4K55A 4P2OC 3WNNA 5IGXL 2EDOA 5J9PB 4K94H 3ZE2F 4LDLB 5TF0A 1CR9H 3KLAA 4LASH 4WFFD 4GRWE 3D87B 4QWWD 2V7HB 4RFEA 3W9EB 2D2OA 2GYSA 5FXCH 2IG2L 3P11H 2B4CL 2BVPB 2HJLB 4JM4L 2FIKB 4ELMB 3D2UA 5KVEH 4YHYC 4XTRC 1C1EH 1NCBL 4K8RH 2QR0A 4Y5XC 4U0QB 4O2EB 3BRGC 3JVGC 4MAYB 3QCUH 4UT6H 2JIXD 4WFHE 3QHFH 4ETQB 5DJYA 1DR9A 1XGPB 4YHZL 3VXUD 1JNNH 1AXSB 3MLSL 2F54D 1MCIA 1D5BA 5E8PA 1CL7I 4JHAL 5D1ZA 2CLRB 2P8LB 1GGBL 3H7LA 4LSPH 5GXBB 2VXSH 5IWLA 5F88A 5C09D 2DQCL 4MWFA 2VZOA 2I9LA 3ULUC 2DIBA 5EC2A 3T2NL 3PDDA 4BFBD 2A73A 4X9BA 4G80B 3L3OA 1XCQB 4TRPH 1CICD 1U8PB 2VLKB 1L7TL 2UVFA 2MWCA 3GMQB 4L8DB 2XZQH 1BBJB 3H9SB 1IC1A 4HAGA 5EUOB 1M71B 3HRZA 4ODSL 2EDHA 3KPSE 4MD5A 3O4LB 4WJ5A 3AU1B 4JRYA 1JNLL 1WV7T 5FO9B 1PD6A 5K93A 3UTTA 1XF5A 1JYVA 3CFCH 4JPIA 4ZFGL 1KFAL 2OZ4L 4XMKL 2GITA 4GMSL 5IOPA 5BZDB 2W0FA 3EYQD 2X05A 3UDWA 4RISH 1YMME 1I9JH 5GRWA 1R3JA 3FOMA 3TWCH 2H1PL 2OSLB 1K4DB 2H41A 5CZKA 4YDKL 2P47B 3LEXB 2CJUL 5E8OB 4KROC 1FE8L 1F3DH 2BXYA 5EBWB 1AP2B 4LSUH 3BDYH 2VERN 5BVJB 5MI0C 5D7IA 4X4MA 3V6FB 1QO3A 4HUKB 4AQOA 3F65A 5K9JH 5C2UB 3QCTH 1JYWA 3SQBA 2CDFB 2BNQB 5IJVA 4NRZB 1R6VA 4P3WA 1LO3H 5F9DC 2ZKHH 5JPNB 2X4NB 5SWZD 3UAJC 3K8LA 1PW3A 4FFYL 2PUQT 4LDEB 3VXME 3RWFA 3VG9B 3FO2B 5K9QG 4FOMA 5FCUL 1C5CH 4LSSL 1BVLA 3AFLA 5DT1H 1KEML 2AQ2A 5BXFB 2CDGB 3AAZB 4RWHA 4G5ZL 3VW3H 2BNRD 3C60D 4BA8A 1LO2H 1VPOL 1RFDL 1QPPA 4QXUH 2Y7QA 3EBAA 4LLMB 4M48L 4PB9H 4XVUD 2P5WD 1SJHA 3ZKXB 2DTML 4ZFOL 3ZTJH 4PGBA 1IVLA 2X4SA 4HS3B 1T66C 3KPRA 5F1NB 2FJHB 5TE7H 4ONHA 4I0PD 2WBJA 4N90D 3QZWB 4R7DB 2K1MA 5I1EL 1QNZL 2YD5A 5F70A 1X7QB 4XCNA 5ACLA 2Y25A 2W0PA 2VKXA 4OGXL 3HZVA 3CSYA 1VEOA 5I2IB 4CMMB 2X40A 4EI5B 4S1DC 4LLWA 2DQHL 4YGAB 5DJDA 1F4XL 3GSNL 3RVWD 3N1FC 3QDGB 3A6BH 3Q3GB 1MJ8H 4OCLC 4RGNE 1QTYT 1RMFH 1JI2A 1ZHBB 3DVFA 2X1QA 4TVPL 5I1LA 1MUJB 1DBKL 4PJ7A 3FONA 4A6YL 1A6AB 1IFHL 4CVUA 3DUSB 5GGQL 2AJVH 1AXTH 3U30C 1CQYA 3IFLL 4MGXA 3HPLB 5EFIB 1HEZA 2C4XA 4HIEB 5I1CH 1KENH 1ZHLB 1I8IB 3MR9A 5HHNB 1QQDB 1I8MA 1RUQL 2GSGB 4HUWB 1KJVB 3I9GH 3MRFB 3OAZH 3ZT6A 3HC3H 5LGKA 3MZTA 4JFDA 3FFCE 1Q9WB 4KDTC 5GJSH 3CUPA 2WSKA 3KYMB 3JUZA 1CFTB 1WFUA 4NZRH 3MLUH 4LLYB 4NFCA 5IBUG 1OB1B 3QDJA 1I1AA 4XPHL 3O2WH 4X5WA 4TTDC 4APQC 4M7KL 3RI5K 2H32B 1WISA 1P53A 2ZSVA 4N8VG 2CMRH 2YMXH 3CSBA 4ZYKB 4GT7A 2YD3A 4MJIB 1UYWH 3VFMB 1HNFA 2NX5B 1AJ7L 1UEMA 2APTA 3T0EC 4BJLA 3RWDB 5BQ7A 2W65B 4LVHB 4JZJA 3T3MF 3NIFF 2VLRE 3T08A 4O51A 4KVCL 1OOAA 3DECA 3FTGB 5IEHA 1OTUC 1WBYA 4HHAA 4OCYH 3UX9B 1XGUA 1I7TA 4HT1H 4DGYL 4PJXF 4FQ2L 5KSAA 3MLVL 1MF2H 2ZCKL 1WBZB 1BZQK 2MNUA 3LEYL 4LBEB 43CAA 2PF6A 1WFTA 4OGYL 1D9KD 3BHBB 4L3CA 1X5AA 4KVNH 4UINL 5ECJE 5CZVH 1IMHC 5F71A 5DK0B 2WZPD 1P4IL 3HI1A 3GGWA 2O61A 4H0HB 5ISZB 3D0VA 1J7VR 4KUZH 1OGAA 2DQTH 5KVGL 5L7XH 1FZKB 3O6LH 1UVQA 1F3JA 1T83C 3NFPA 4M5YL 1F2QA 3QXAB 1UENA 3QWOB 3U46B 3TO2B 15C8L 1DP0A 3PDGA 4LEXL 3DX7B 4R2GB 3OXRB 4JFOA 1S8DA 5CWSB 4YHKL 1ZVYA 4JRXB 4G6KL 3AS3A 4MD4A 1FNSH 3OAUL 1CDBA 3MV9D 4ZQKB 2HWZH 4OM1H 2VDLH 4P2QD 3PL6A 4POZD 3BVNA 3OBAA 1OWWA 2DB8A 3GKZA 5IFJB 3RWGB 3HAEH 5CMAB 4LCYB 2JK5B 3JSSA 2A74A 2WWKT 3TNNA 1REIA 4RWYH 2AJYL 4J12A 1A2YA 3KXFE 1MWAH 4QTHA 2HH0H 4Y4KB 3TP4A 1RIUL 3UP1A 1OP5K 4URTB 4PY7A 5MHSE 2VDKL 2X42A 4B7IA 1Z3GH 2KZ1B 4N0UE 2DF3A 4EN3A 5IKCA 5E2JA 2LQRA 2V7NA 4M6NL 1KXVC 2NY2D 1A0QH 3BPNB 4NBYB 4WV1A 5DEFB 5HYJA 1S9XB 2CK0L 1B3JA 1ZANH 5JW4M 3IETA 5CEXA 4Z7UE 3LQMA 3GMLB 1JGUH 1K3IA 1A6ZB 1F4YL 3OL2A 5EO1B 5TFSL 2A0LD 3QFDA 4FQXA 3WFHB 4P59L 3TIEB 1U8NB 1JPTL 2BVQA 1AHWB 3EIFA 1X6LA 3DBXB 4WNQA 4MA8H 1HSAA 2Z31B 1HIML 4Y4FA 4AZ8A 3TNMA 5H37G 4QRSA 3DSNA 2NLJB 4FQJH 5ELIA 3SE4A 2P8MB 4PRPA 3S5LB 2VZVA 4CADB 3PWUA 3P9LB 4TNWK 1YY9C 1I3GH 2FJGA 5GGVL 4JAMB 2HT4D 2EC9T 4PJ5A 1NGZA 2ENYA 3QEQE 1BQHB 1CDCA 1ORSA 3ALPA 4HMCA 4N0YH 2X7LB 3WFCH 1JWSB 4X5XA 1T0MB 1GOHA 1JE6A 2EDWA 3MXWH 1WEJH 3IDMA 5EPMB 5T1DH 5K9KA 3ARQA 1KJMB 5CINH 1EFXB 2N7AA 3CC5B 3GZKA 2CK2A 3MSPA 1I3RB 4MZ2A 4JO2H 4TSCL 2NW2B 2R4SL 5IG7A 3WO3B 4RAVB 5I8KH 1FNEA 1NLBL 3O6FB 5ANMA 3U4BH 3BSZL 4OAWA 5ICZB 1SBSH 5EUKB 3ARDD 1CD8A 1B88A 5BV7B 4PRDA 5HXMA 1J11A 2FCBA 4ONFL 5J56B 4XC1L 2AJSH 1HILA 4TN9A 1Q0YL 2A6JB 3QJFA 4M1DH 5FECB 4ZO9A 3JWOH 4JG0L 4HWZA 1QYGH 1G7LB 3DWTA 2VH5L 2XKNB 3EOBA 2FR4A 1J1PL 4Q9BA 4D0BB 4Y1AD 2Y06L 1V3MA 3BQUA 4IMKC 3VFTB 1A21A 3I02B 4NQCB 3WLWC 4YE4H 3OKMB 3MOAL 5TPWL 1NBYB 2BSRB 1ULVA 2XTJD 1RUPL 1Y0LB 4LCCC 1PBYA 4E42A 4O2CA 2RFXB 5ILTL 4PJDE 2HFFB 4HX1B 5TGBB 1Q9LB 2OR9H 3VI3F 4LPVA 4DKAA 1WFNA 1QFWH 4EIZC 1URLA 1EERB 5GS3A 2C3GA 3B9KD 4NDMA 3HNSL 1LE9A 1MCLA 1RUAL 4LGSB 1MJJB 2WUCH 2YA0A 1A6UH 4I4WA 3PE9A 4JFHD 1IGTA 5FDWA 2X5PA 1EIBA 2NY3D 4BFEA 1R3KB 4J3TA 2V2XA 3RTQA 4WU5A 3MV7D 4OLVH 3C6SA 5MP6H 2X4UA 3UTPD 2AV1A 3GKWL 1F6FB 1T80A 4UT9H 4U1IA 1GC1L 4H1LA 2Z35A 5ITBH 4P46B 5ABDE 5ERWA 1XIWC 5EOTB 2QEJA 2NY6C 2VQUA 2XPGB 3BPLB 4P9HL 1OTTD 2JELH 3MRBA 3CFKA 1J8KA 3HFML 3IXTB 1P5VA 1J05A 3IDXL 3VE0B 4NT6B 5DGRA 3FL7A 3RJQB 2ARJB 1LEKB 2CLZA 4RX4A 5C08D 3RVVC 4XNQB 5BMFL 5DVKA 5JMRA 1A1NB 1T04A 1IGIL 1LO0H 1DQDL 3DSFH 4NOBA 3SDYL 2VR4A 2ZG2A 4XCEA 4P23D 5DJXB 1JHKH 5GIRA 3CK0L 2AEPH 4KKBD 1H5BA 4NQUA 2NZ9C 5C0CA 2PYFA 3O8XD 5AG8A 3FQXB 1BJ1J 2Q1EA 4HWBH 4TULH 5JOPD 4OFIA 1DQML 1FN4A 1EHLL 2Y36H 4AM0A 4JFYB 1GOGA 5C0FB 2BC4B 4X4XA 1BD2B 3DTXB 5HDLA 1XZ0A 1IGCL 2Q7YA 4ZUUB 1EEZB 4XWGH 2V2TB 1OPGL 1EO8H 4Z0XA 3HNVL 3MRJB 4JQVA 3QI9D 2AEIT 2ARWA 3SDAA 4LHUB 4OLZH 4YNYA 4LASL 1IQWH 1WWWX 1KPUB 5I30H 5GGRA 5A43C 1GPOH 2ZZUT 3ZDYE 3G04B 4H26A 1V7NH 3QQ3B 2XXCB 3LHPH 3U7WH 1DVFA 1C1EL 4K8RL 1DL7H 3TZVD 4Z7QE 2AEWA 2KBGA 5IJKA 4JRYE 3O0RL 4L8SC 3P4OB 4HPYL 4S11A 3DGCR 1U3HC 2ADGA 4G9FD 1U95A 1OSZA 4A2LA 5ICYA 1EDQA 5JQ6H 3G6DH 3HE6C 5D2NC 1AKJB 4ZO6A 4QCIB 3G9VA 4ODXA 2GFBA 4Z7OE 3H2WA 3ZDXF 5T33H 5DQJB 4XP5H 4YO0B 1GAFH 4BK5A 2A77H 1QSFB 5D7KD 1F00I 5T3XH 4U1HA 3TYFB 4JM2B 4NYLB 1MAKA 2YBRB 3LPWA 2HFTA 2H45A 5J4MA 5D7IE 4X4ME 3FB6B 3DRQB 3MXVH 1MHPH 3VFRA 4NRXA 4JN2A 3SDDA 3VFWB 3S88H 4XX1G 3L1OL 5EBLA 1X5JA 1NBQA 3LKRA 1N26A 4FQHA 1I75A 3BGMA 4YIQB 1FYTA 4Y5YA 5E8DH 5KANG 3FB5A 1AO7A 3C08L 1Q72L 1U8JA 3VFPB 3O9WA 1Q94A 1HHJA 5E2UL 1U0QA 4BSWA 4Z7UA 3BPCA 2OTUB 1UADC 5EORH 5D7JD 5GHWL 1ZWIB 3ZZ1A 2XI9A 3GMMA 4DK3A 5J13B 5I15H 3WMSA 3QXUA 1A7QH 1XF3A 3UPAA 1J8HA 1UM4L 3DYOA 1S7QA 2FHFA 2UUDK 2DWDA 5CKGA 3L3JA 3A67H 5FM4A 3P30H 4G8EA 4CBPA 4M7LT 5DURB 2FDBP 3EFDH 1T22A 2AI0H 5DUBB 1RIVH 2B5IC 4KTYA 2EEBA 1GZQB 3D9AH 4FQLH 5DJZB 2JIXA 1FBIH 4N0FA 3IDGB 5EA0L 3VXUA 4GKOA 4ZNEA 3LRGA 1K4CB 4X6FB 1U92A 1G7MA 5DA0B 2XN9B 2F54A 4MJ6A 2LABA 4LLVB 2P5ED 5GSRA 4M3KB 3ULVC 3RVTC 5HVHB 4OCRH 3QXVA 2FWOB 5SX4H 2AK1H 4TOYL 5F9OH 2R9HD 2ZSWA 4PJ7E 2F53A 3B9VA 5B8CC 2R0KH 4HMDA 3WCYA 3H0TA 2MQCA 3HN3A 4LPTA 1G6VK 4PD4J 4MA1B 4FHBD 4MZ3A 2KDGA 5EIVA 5FV2A 4XZUB 1INDL 5FUOL 3RIFF 1IKFH 4PRIA 4IOFC 5T3ZE 4JN1L 2W9DL 3WXVL 1KELH 1N3NA 2KH2B 4RA3A 5L2JA 1E4JA 5ESAA 4D8PB 5I0DA 2QLVB 1G9EA 3QQ9D 4Z76B 5I1AB 3LZFL 4KY1H 3RDTA 3WJLA 1U58B 5C6TH 1A7BA 2NPLX 4JFDE 1VEPA 3PUCA 3EGSA 1ORQB 4PJ8C 4U6TA 3KYAA 4UUJA 1PVHA 4MQ7B 5HHOA 1AQKH 2XA3A 4G7VL 5D96B 3ZE2E 4H8WC 4GG6B 2EO9A 2ZUUA 1TVHA 3QEGH 4ZNCD 4ZFZA 4J4PC 3MJ9H 5T3XD 2CH8A 3DVGA 1RMFL 2YPVH 2IQ9H 1DQJA 2NNAA 2VL5B 1CVSC 1VEMA 3MACH 3PV7A 1AXIB 4IRJD 4OZHF 1BOGA 1JNHA 3VXSD 5D71H 2HVJA 2G9HB 1EUUA 4CJ1A 1TJGL 1EPFA 4ONGH 5H94A 2NY0D 1CG9A 1T4KA 5AEAA 3SE3A 3IVKB 5DD6B 1LEIA 4EI6A 4RGNC 3D48R 2KQMA 4K2UL 1X4XA 2C1OB 4PGDA 5FA4A 4D0CA 3FT2B 1G1CA 1IC7L 1W8NA 5D7LB 2O5XL 5EOCL 3BEVA 1MAMH 1F90L 5I1DB 4KJWD 1U93B 5BRZD 4WTZA 1CFSB 4ZODA 1UB5A 4WFGD 5HPMB 3KDMB 1SJXA 4F7CA 3QPQC 4GKSB 5C0AA 3UBXI 1J0HA 1HHGA 5C0EB 1D5ZA 1YC8A 2A83A 2GI7A 5IV2B 1X5HA 2WUBH 4Y2DD 3KPSB 1PSKH 5FOBB 1CLCA 5I74C 4IM8A 1OGAE 2XZCL 3KPQB 3BPOC 4WGVB 4LIQL 3UBXA 2PTVA 2DI8A 1FAIL 2NYYC 3FO1B 5EZOL 1AQDB 2E3VA 1ZA6B 1I8KB 3VWJC 1E6JH 3JTTB 2FEDC 3HZKA 1JPSH 1NC4D 1E28B 2DS4A 2Y72A 2PN5A 1SJEA 4NHUB 4OLYH 2BX5A 1KN4L 1YMMB 2UZYB 4PJIF 3D25B 4XMPH 4S1SL 2FH6A 1XCTB 3TA3C 2AJZA 3DMMB 4W6YB 1HHKB 4R90H 1NFDA 3TFKC 4KKAD 5HHPA 2BSSA 1MI5D 4JZNB 3WDIA 1GGTA 3GI9H 4LAQL 2HYMA 4AH2B 5HYQA 5DJ6A 1FDLL 3FT4A 2OR8A 4RBPK 5I6XB 2J2ZA 2GTWB 1UA6L 5HHXL 5KVFH 5JOFB 1SYVB 4JKKA 1BGXH 3GSQA 1MCOH 3BFOA 3BH8A 3ZYZA 5GS0H 4G7YH 4E0RA 1RZKL 3VXMB 1LMKA 3IDUA 4R0LB 5ID1B 4KV5E 4AIOA 1ETZB 3MA9H 1ZS8A 3P4NB 2BY1A 1A7PL 1CK0H 3SKJL 3IJSA 4YBQD 4L4VA 5HYJE 4JCMA 5DEGB 4MNQD 3MX0A 1FO0B 4YWGH 4KHXL 3D5OF 4EZMA 3HI5L 2DYPB 5AUMB 4WO4B 3CFDB 4PJGA 3DO7A 2K7PA 2A9NL 2ENSA 5FYKU 1IC5H 4BFIB 3ES6B 4L8CB 1INQB 2EXWC 5HY9B 3QQNA 4WCYH 1LD9B 3EKCA 3T4AB 2IADA 1MWAL 5HHMD 3BZDA 4FN0A 4PR5B 4JVPA 3U7AA 1VA9A 3FQUA 2FLRT 3BIBX 2OK0H 3NCMA 4B5EA 2E6JA 3HC4H 3UJIH 1OP3H 2YZ8A 5C3TA 4XPAL 4MNGA 5IQ7L 2I9TA 3HZYB 3SN6N 1SEBB 1KXTB 4XVTL 3C2SA 3JTSA 2FLBT 5DHYB 2G5BA 5DC4B 4MAUH 1A14L 4LNVA 4YHIB 4LCUA 4WWKA 4GAYB 2E7BA 1NCWH 2OI9C 4JO3H 1WGOA 5LGHL 5D93B 3WEXB 1UM5L 3LKOB 1JK8B 4TVPE 3OKOB 5EULV 4KZDL 1ACYL 1MJUH 3NFSL 2H8PA 2VDNL 1OAQH 1F8TH 1U9KA 1ZHKA 1CTNA 3O2DL 5ANME 4OTXL 2A6IB 3LH2H 2FECL 3KG5A 2YSSB 3CLEH 3MLYL 1PG7W 1AD0A 4X6BB 3IU3B 3FFCB 4W6XB 3IYLW 3TN0C 3LKQB 1NC2D 2Z4QA 3N9GL 4PJBF 3UYRL 1XGQB 2WQRA 4FQJL 4OZGF 25C8L 1FAKT 4X6CF 2NW3A 4UQ2B 2EKSA 3NN8A 3ARFA 2HJFB 4JQIH 2MCG1 4PG2A 1I4FA 3BP6A 4JLRB 3WO4B 1JVKA 3HG1D 4PJ9C 4E9LA 1JN6A 3BYYA 4ACPA 4LNRA 4DEPB 3D3VE 4PJFA 4U1MA 4G6FD 5ITFB 3L3HB 5A3ID 3VU2A 3SDCC 3MV9A 1AGBB 2PO6C 4R9HA 1NGQL 1OM3H 3RWIB 1N7ML 3S6CA 5EU7C 2CPCA 4QRQA 4XNYH 5SWZB 5GSVB 1HNGA 3KPPA 5MEOB 1KJ2H 4ODVL 5I9QB 4X7TA 4OZHA 3VGDA 4HEPG 4GG8B 1DQQA 5JDSA 5FUZL 4O02L 2YZ1A 1S3KL 1J0IA 1UCBH 4N0CD 3MGOB 5KS9A 4LCIH 5IVXA 3E6FB 3SKMB 3QDMA 1S9VB 2GUOB 4YEEA 2RBLA 4W6WB 3NIFE 3MFFA 4D9QE 3ROOB 2ZOLB 3SE9L 3T2OA 1QBMH 4YXHL 2ADJB 1YY8A 4LAJH 3GSVB 2VITA 4F3FA 1A1MB 5JNYA 2A6KB 4HWEH 3RUGA 1PQZB 4FFVC 1DLHB 1XF1A 3MPCA 4PJXE 5FUCE 4OCSL 1G9MC 2FO4A 1UWXK 1K2DA 4XC3L 1YN6A 4IRSD 2NY5C 3I50H 3GB7B 2BVYA 1SQ2N 2DQGL 4JG1H 5DTFA 4OIIH 5D6CA 2LU7A 4HG4K 1G7JA 2OL3B 3RZCB 1P9MC 1AC6A 1JGEA 1TJHL 3V0WL 4MJ2A 3MREB 4U6XB 4G6AD 3K3QA 3ZL4H 1YEFL 1MQKH 5ADOH 4FQIH 1G7IB 3IJYA 1QRKA 3NIGE 5C0CE 1MJ7H 5DZLA 1HXYB 5D8JL 3NGBB 5ETUB 3WS3B 5D72H 3LS4H 4F15C 1MH5B 3NFNB 4P4KA 4I3SL 1JI1A 2OM5A 4NQVB 2X9WA 2X10A 2DBLH 2Q8AH 1VFBA 4MA7H 1PG7H 2C1PB 3RL1A 3KXFB 3TJHD 3B2VH 3VGGA 2CO7B 3MRCB 5JA9A 3FRUB 1O7VA 4NN5B 3QP3A 4U0RB 5E8EA 1G9NC 5D1QA 5KSUB 3WHXB 5KJRH 3LRHA 2NMSA 1L9MA 3RWHA 2YK1L 5IMOA 2DDQL 4N0UB 1TQBC 1YZZA 3OAYH 5F1IA 1K6QH 5FO7B 1BAFL 4XPFH 3T0XA 1LVEA 1M7IA 4XCYA 3OTTA 4R3SB 2PCPB 1NGPL 1AE6H 1NCUA 2IAMC 5DYOB 4GBXA 3UTZB 2ZCLL 3VFUA 3GBML 1DUZA 3MGTA 1CDIA 4M7ZC 1SM3L 1NAMB 1JMZA 1T3FA 3ARTA 3BH9B 4AEHH 2DM2A 5BJTB 1GCFA 5FHBH 4NUJB 3ARBB 1CF8L 1DCLA 5D1XA 4OF8A 4PTTA 1H3PH 2R23B 3DRTA 5EH1A 4C83B 3QUZA 2G60L 2P49B 5C7XL 5CEZL 1RULH 2VIRA 1V05A 1F58L 3O81A 4N0RA 1BMGA 4F7MA 4HKZB 4KJQD 1JTPA 3CMGA 1OGTB 3HAEA 4U1NA 4X7SL 1UKSA 3CU7A 3WFEH 4Y1AA 5GISL 1BLNA 1DUYA 4GRLB 3N85H 3VRJA 1MWAA 3BO8B 3WLBA 3HPJA 1T2QL 1GPOL 4YDLC 3VXOB 4FNLL 2EICA 5D1ZC 1X5YA 3LCYA 4AEEA 2V5RA 3HE7D 4XP9H 5IWLC 5CJQL 3IB4A 1SBBA 5LCVL 3W0WA 1D9KB 4PLJC 5B4MD 2WLZA 1NBVL 2YOCA 3QEQB 3QIWC 3V6BR 4HZLA 2R29L 5I1IH 4LSQL 12E8H 1KPVA 5CP7A 3FAXA 3STZA 1I9EA 4DUXA 4LHJB 5JDJA 1LE5A 1OL0A 1E6OH 3MRGB 1QLEH 4OD3H 5T5FH 1SMAA 2X70A 3V79C 1EGJH 1G0YR 2FGZA 3G6DL 4L8BB 1PG7X 1DE4B 2C4FU 3DX8B 4JO1L 1VFOA 5FYJL 4OZFH 5DQ9A 2XFXB 4KU1A 5HVGB 1QBAA 2IAND 3RA7H 4XNXH 2EH7L 4P2QB 1SY6L 2F5AH 2DQIH 1J8HE 1MCKA 4PJBA 4S1QH 3P4MB 4JFPA 3PWNB 2CIKB 1JPGA 3V4UL 3RVXC 1DBJL 3I6KA 3KPOB 4X6CA 2FZ3A 3B9AA 3UDWC 1FC2D 2X4RB 5C0GA 3ILPB 4X98A 4DKFH 1A3LH 2A9ML 2VDPL 3LN5A 4AEIH 1S9YB 2KPNA 3E6HB 4MHHI 1IAOB 2DLFH 3BW9B 2MCPL 3S88L 3G5VB 4U3HA 3S4SB 3O8XA 4YDJB 5HGHB 1QLFA 1SYSB 5AYQA 4LLUA 4ZNEE 4PJDB 4Y2OA 5FM5M 4BQ9A 1H15A 1G6RH 3VXQB 5B21A 4NWUL 1E4XI 1KTLA 3W5MA 1MELA 3VD5A 1LDSA 2J4WL 5IMMA 2B8OT 1CGYA 3BZ4A 4TQEL 2VISB 3FMGL 5I8OH 4NKMB 2F53E 3S96A 4BYHA 3VI3E 3WS6C 2QADC 1CXFA 2BVOA 3QI9A 3P9MA 3L95A 5E2WL 4O4YL 4U7MA 5CZXD 3D69A 4PRIE 2R2EB 1JZ7A 1C08A 3KJ6L 1NUGA 5FYLL 1F13A 3S37H 3RNKB 3SCMD 5DRNB 5KTEH 4Y4KC 4XP6H 3GHBH 5BCAA 4AIZB 2AABL 4OCXH 2R8SH 4PJHF 3TZVA 2HRPL 4LFHD 2B1AL 5J06A 4RFEB 5HI5C 4HC1L 3GRWH 5HHOE 1EEQA 2L7JA 4JZOB 1S7XA 1MREL 2CKBH 4LVOB 2DQFA 3MBED 1MCWM 1YJDC 2CGRL 4XI5D 4AYFA 3TCLB 2XRAH 4QKXB 3SO3B 4G9FA 5GRJL 5F3HA 2QR0B 3OZ9H 2E27H 4OI7A 2WBJC 2ZP0T 2ICEB 1EJ6A 1QKZL 3PQYD 5EN2A 4OLUL 1CN4A 3V6OC 4X4YA 2X89D 4HKXA 1RZ8A 1RU9L 3IFNL 3TH3T 3MNZB 5JIIA 1T20A 3DX9A 5T1KB 3FRPA 4NQDD 4K3JL 1IARB 3MLZL 5F88B 2EYSA 4MQXD 5EIQA 3C5ZA 4HV8A 4KWUA 1C12A 3LKNA 5I66A 4U1LA 1ITCA 5BW7C 5JIHA 3U4EB 3L3OB 4Y5VA 3CAFA 3MV8D 3RY5A 1ZV5A 4OKDA 3F8UB 1QFUL 1AQKL 4QRPA 2XZAL 2F19H 5LAXB 1K5NB 2Q3AA 5C0AE 2VN7A 5DRXA 1DZBA 4P9ML 4ZS6C 2NY4C 1HKLH 3HRZB 2PKDA 3M1BB 4M6AA 1J0YA 4AENA 1LO4L 1DEEA 4DQOL 2ADFH 4MD5B 1RD6A 5ACMA 4ZDHA 1KCVH 1AD9A 4YHNA 2D03H 4Y16C 5C2BH 5C0DA 5EU4B 2Q7NA 5ADPL 2Y07H 5GZNC 3QCVL 3Q1SL 3LDBC 3E8UH 1S9KC 5MENE 5IOPB 1SJVA 3NZ8A 1WIUA 1MFEL 2W0FB 5I0ZA 3LOWA 4HWBA 2ADIA 1I1AC 4NNPH 3LN4A 4R8WH 2EDNA 3D0LA 3S37X 3RBSA 1IM9D 1WSST 4FA8A 1QR4A 1NFDE 4H25B 4M8QA 1YEKL 5GGUB 2PXYA 4RMQA 3QPXH 1MHCB 3TIDA 2GJ6E 3HMWL 3KS0J 5C9JA 1YPZF 5E95B 3ZDXE 4NKOA 5D7IB 2NY3B 1GGIH 4JZJC 2XICA 4YR6A 3PNWA 3PWPD 4OB5H 4JEGB 5IJVB 1BIHA 3HZMB 3KPNA 4Q6IA 4Y4HB 3OR6A 3WIHH 1BJ8A 1IAIH 4IDLA 1WC7A 3O3UN 2ICWJ 1FRGH 3ULUL 4KKLC 3ULUF 1KJ3L 3RWFB 3BP4A 2BJML 4HH8A 1NMBL 1BVLB 3CNKA 3CVIL 1HH6B 3OJDA 5FKPA 4OLXH 3OKKA 4MMXC 5EDXA 1VCAA 3WFDL 1NJ9B 5IBTL 1M7XA 2XQBL 5TQ0L 4L4VE 2ZG3A 2A1WL 4K9EC 4GXVH 4HUVA 2Y7QB 4YZFE 3DV4B 4R90L 4XNUH 1R0AL 3OJVC 2GIYA 2ORBL 4L29A 1SJHB 4M7LH 4NJAH 3ROLA 3D85D 5J6HB 4PGBB 4Z78B 1BFTA 4I2XB 4XBEH 1ZA3B 2AV7B 1T0PB 2X9YA 3BE1H 2DLGA 2WBWB 5I18L 1IQDA 2K3TA 2BOCB 1T2JA 4XCNB 3VI4E 1YEEL 2ED8A 4QNPF 3ZE1F 3HZVB 2XKSA 1JNJA 1I8LA 4NQSA 1WIPA 1KGCD 8FABB 3B83A 4IRJA 4LLWB 2DLEA 3KPLB 1XAUA 3UTSA 4M7JL 4B0MM 4MNGE 2YD4A 4QRUA 4I77H 1F6AA 3T8XB 4K7FB 3V4PH 4N1EA 1HHIB 1RZFL 4CAGA 1DBML 2EXYD 3CVHB 4GW1B 3GBLA 3FONB 3U0PA 1BOYA 2P1YA 1IZJA 2CUIA 2YRLA 5A16A 1P4LA 3DI3B 2FBOJ 3BKML 4NSKA 1RZIA 1BECA 1U8QA 4NM4L 3MR9B 1I3VA 2VKWA 4UDTB 1I8MB 3NPSB 4FQCH 3EJZC 4EVNB 1S7WB 5EU6A 5EIIA 3ULVH 2H9GB 4YC2B 3TBYA 2B1HL 2EE9A 1WJ3A 2HLFD 1P1ZA 4NCC1 4MNHB 4KPHH 5IM7B 1BFSA 1MCPH 4R4FL 3WN5A 2HJKA 1QBLH 1MOEA 5KOVC 4WI9A 2ZG1A 4P5TA 5C0BA 4LCWA 5IHUL 4RGOH 4FQXC 1OTSD 3K2UH 1KCRL 4KI5C 4EDWL 1R5VB 1A5FH 4IDJL 4O00A 3AROA 4WEBL 2YA2A 3MLWL 2VDRL 4PJFE 1B4JL 5DLMH 4IRZL 4FXLA 2WP3O 3QISA 1W72H 3OPZL 3VMNA 4HS6A 4MJ5A 2FSEB 4LSTL 4FABH 1YEGL 3QO0A 4NQED 4I18C 4OZHE 3MV01 1J1XL 4H8WH 4O51B 1TENA 1AY1H 4Z95H 5IVXE 2JCCF 3PJSA 1S7SA 3QDME 1PKQE 4HHAB 2F74A 1XGUB 4MXWL 5IBUB 5C0ND 5KSAB 2VXVH 4PRNA 4AQ1B 3VD3A 1YEDA 5D70L 4XVJH 4PLOB 5FYKL 3UXFA 3T77B 5LGJB 4N8VB 2M26A 3CLFL 4S2SB 3RUGE 4C56D 5J1SC 1KBGH 1CU4H 3HI1B 4JR9L 3GGWB 4G8GA 2O61B 5E9DA 5IW6A 5CJOH 4PTUA 2P24B 4MNQA 3EYVA 4NZJA 1UVQB 1F3JB 1RZJC 3MJ9A 3WSQL 5FGCE 1NAKH 3ZHDA 2BVEA 3BXNB 1KCSL 4FQ1L 2IALB 1IGMH 2GHWB 3T65A 4KMTL 1YNKL 1QLRA 3EYFA 3RWEA 4M6OL 1K8DA 4U6VL 2P5EB 4MD4B 4RNRA 1BF2A 3ZMRA 1HDMA 1INEL 3PL6B 2P8PB 3BQUC 3IDNB 1F45A 3BVNB 2G5RA 4PJIE 3TVMD 2A74B 1C8PA 4GUPA 4DN4H 2EDRA 4XP1L 4U6YB 1XGTA 3TNNB 1UB6B 1TPXC 1VFAB 4Y5XA 1A2YB 4UAOB 1CLYL 2UWEF 3GJFK 3JVGA 1D5XB 1E4WL 3SGJA 2EDEA 4JFEA 2XV6B 5FA3A 1FPTH 4PY7B 3TT3H 3L5HA 2AP2A 4WW2C 2XA8L 4ZAKD 1OLLA 4JVUA 4TTGA 4EN3B 3QYCA 2CQVA 3NZHH 1FL6B 2DIJA 3QIUA 4L3ED 1CD0A 2YD8A 3UJTH 4XH2B 5GGTH 3MO1A 4WV1B 3RTQC 1VENA 1GHFH 3BWAA 5F9WB 4Z5RA 4ZUTA 4BH8A 2VLJE 5CEXB 5ADOL 1B2WH 2AKRA 4RAUB 2MQ0A 1NC2A 4FXKA 1P7KA 3FOLB 3RBGA 3IU4L 4UIMB 2FX8L 2QTEA 3UJJH 3QFDB 4PLKC 4MS8D 1BX2B 5I16A 1E0OB 3SQOH 2BVQB 1KB9K 1X9QA 4WUUA 4M5ZL 4U7SA 5IW1B 4WNQB 3U82B 5DO2D 4ZPVA 4ZFOB 1XGYH 4Y4FB 5D7SH 3C5JA 5DJCA 2C3XA 4NNXB 3U0WL 1H5BC 1FVEA 3C5SA 4LVNB 1JHLH 2RR3A 2HKHH 3QIBC 3JXAA 1MCDA 4BFGA 4D9LL 1X5FA 3RGVA 4A2MA 1A6VL 3GSNB 4DW2L 3GSRA 4JDTL 2AQ3A 3W0WE 5D6DA 4LMQE 1ORSB 4JQVC 4X5XB 5K9KB 1CXLA 3IDMB 5KVDH 2VN4A 2AK4D 4MLSA 4KC3B 4V1DA 3PHOA 4ISVB 2R0ZH 5EZIL 4IMLB 5IG7B 2KZWA 1YEHL 4W4NA 2GJZB 5ANMB 2HFGL 1NC4B 3WNLA 2ZJSL 4XXCC 5GS2H 1J9CT 1DSFH 1DVFC 2X44D 4IIQC 5L0QB 4WHYH 3UPCA 3CXHK 4F7PB 4P49A 4Z8FL 3CH1A 4YHOH 4ZUSA 3WDJA 2EYTA 1OAKL 3L5XH 1KEGL 1A3RL 1MI5B 5F7FA 4PJBE 3GM8A 5DD5H 5IHZA 3EHBC 5FCSH 4JY6A 2FR4B 4QHUA 3D3VB 4X6CE 3RIAF 1EJOH 1RK0B 1ZLWK 3NTCL 3CFJB 3HR6A 3GMRA 2ZPKL 4L4JA 3GUTB 5FEBA 5KANI 3V2AR 4PIRF 4KTEH 3HCVB 2GK0B 5SWQA 3MRIA 2NXYC 5K59F 5CEZD 3F6IA 1D7FA 1E6OL 2ICWB 3VFOA 5E8NA 3R0NA 4FZEH 4PRAA 3ARED 4YHMH 4NDMB 3SJVD 3SDDC 2R2HA 4GQ9H 4I4WB 1ZLUH 2JCCA 5FDWB 5F7WC 5F6IC 7CGTA 3RGHA 5DUPH 2DQIL 2W60A 4FXGA 4S1QL 5E2VL 1OARL 2X4UB 5F96L 4PJXB 3O9WC 1L0YA 2EZ0D 3ZLQC 3S35H 4U1IB 3FT3A 5DWUH 1IGFH 4JJ5B 5T1LD 1EA9C 3V0VB 2IWGA 1JYNA 1JRHH 3MRNB 4F7EB 3LMJL 5TF1L 3MRBB 2BRRL 4X99A 2ESVA 1P84J 3CFKB 3U7YL 4ERSL 4TYUA 1I7RA 4N9OB 3DOSA 5DD3L 2MKWA 4JO4L 4Z77B 4QWWC 5AYUH 1G6RL 4TUKH 1TTFA 3V52L 1FLRL 4AMKL 2E9JA 4ZS7L 4CDHA 2WINA 2BVUA 3TO4D 1QBBA 1CBVH 2VR5A 1HINL 1KJ2A 3PWVA 1FGNL 5CBEA 1IGYB 5GIRB 2VAJA 3QQ4A 5FYJD 2PYFB 4ALAH 3MNVA 2NY5H 4F9PC 4M8VA 5CD5D 2F15A 2AERT 4Y88A 1QSZA 4PJCF 3FN0H 2EIZB 1XR9A 2J88L 4X4XB 3ARGA 1FVDA 3B6SA 4JJHA 2F58L 4LSRL 1QRNA 4EBQH 4JPKH 3QJHB 4Z0XB 3FQWB 3SDAB 3G5YA 1VERA 4Q7DA 3ARPA 2A6DA 3T0EA 3S36H 5CS7A 4LF3B 2XQYG 1ZT7A 3CCHA 4K07A 4QRPE 4NUGL 1CICC 5C0JA 5IP4A 4NKIL 4MAYD 3R1GH 1JFQH 4XGZA 4NC1E 4ZSOA 5CUSL 1QACA 4KI1A 1G9NH 1CT8B 3MYJA 2H2SD 3ECBA 3F12A 9CGTA 1AFVL 5FGRA 2IANA 3HA0A 3ZE0F 1JV5B 1X4ZA 3DARA 4QYOA 5LVEA 1HYRC 2ADGB 2B39A 2YXFA 1OSZB 4HZAA 4QXGL 1R24B 1KNOA 5ICYB 3DUUB 1NDMB 2CLVA 3QNYA 5FYLD 4CU7A 3K1DA 5INCA 1IT9L 5JXAH 3BEWB 2R4RL 2I26N 3EYQC 1AGEA 4N8CL 3OXSB 2VLKD 3WIFA 1CVRA 3BGAA 1WBXA 3DV6A 3S35X 2AJ3B 3W2DH 4U2ZA 4X6DA 3ZT5A 2IPTH 4HS8L 1MRFL 4C4KO 4YBLC 5GRZA 4GXUM 1J12A 3U6RB 3K4DA 3ISWA 3SE3C 3VFRB 1UXWA 3RX8A 2W9EL 4OV5A 4UNVA 2BCKB 2MHAA 1HQRA 2R0LL 3BWUC 2BY0A 4RIRA 3X3GH 1IZKA 3LIZH 3V7MA 2D03L 1AGFA 4FQHB 1S9WA 2DKSA 2AVGA 4PPTA 4Y5YB 3CZFA 2R2BA 2I60H 2FHBA 4PV8B 3UC0L 3BAEH 1UH2A 4K94C 1U8JB 1ZE3C 3IXAA 2DM7A 4ONOA 1H3VA 1ZGLM 5F7LB 5HI4C 4OJFL 1HSBB 3DXAA 1MIML 2EH8L 5EOCJ 2V5TA 2V17H 4WDIB 5I8CB 1FIEA 4FMKA 1UJ3B 3GMMB 2XT1B 4HGWB 3MRDA 3C60C 5ICXA 1W0VB 1IEAB 1H3XA 2AAVA 4Z7WF 1CL7H 4NZUH 1S7QB 3DIFA 1LP9A 2VDOL 3HRPA 2GAZA 4NO0B 4XVUC 2XWJA 4GAJL 3L3JB 1I9IH 3S36X 4GRWF 1JGVH 4G8EB 2Q87A 1KB5L 5TH2A 1BP3B 2FX7L 4LPXA 4HKJA 5MEPA 2QV2A 3QUYA 5T3XE 5HVFB 2WMPA 5DQDL 5HDQL 5IR1A 4I0PC 2SEBB 1ZT4A 2LE9A 4EDXA 5F9JB 3PQYA 4KK8D 4MSWB 4N0FB 4XXDB 5DUML 5L8KB 2F8VA 1JGDA 3H3PH 1N5YH 4MJ6B 3UTSE 1CS6A 2MFNA 3WFBL 3VWKB 5GSRB 5LBSL 3RWCA 2YEZA 4BZ1L 3RVWC 3THML 3GJFB 3A6CL 3P77B 4XCFL 1CFQB 5KSBA 4LGRB 2GT9B 4QRTA 2ZSWB 2F53B 4RCAA 3H0TB 4ZMAT 4XTRD 2H6PB 1EGJA 3L7EA 4OZFA 1N3NB 3BDXA 2Q76B 4IS6B 3WBDA 1G84A 2FD6H 4LLDA 4JFZH 2HP4A 3QHZH 4X0KA 1DDHA 3VDAA 2VZ1A 1BM3L 5KSVA 4EI5D 3RDTB 5EU6E 2PR4H 3QB7C 3MRPA 4HMEA 2QQLH 1R3HA 5CGYD 5EO0A 3QDGD 3VGAC 5FM5O 1CDJA 5C0BE 4LCWE 4U1SB 1FVCB 2J6EL 4MCZA 4PJHE 1A7OH 1JYXA 3MJ8A 1SEQL 4ZFZB 4ZD3H 3DVGB 3NCYP 1ZGLP 3MA7B 1DQJB 2NNAB 4I0CC 1N2RB 1G6RA 1NGWA 3BUYA 5F6HI 3C8HA 4KKCD 5IBLC 3QT2A 2YS4A 2NY1B 4HJJL 4PY8I 2HVJB 2QQKH 1GIGH 4K3EL 5E7BA 2CUMA 4YGVA 1BZ9A 1UEYA 4NWTL 4OFVA 3LEVH 5IFAH 3AB0C 3N1GC 4PJCA 4EI6B 3EDEA 3JUYA 5DR5H 4IMKA 1YJDH 3KNBA 4PGDB 5FA4B 4D0CB 5EBMA 4JGJA 2WWKO 3ULVF 2D7MA 2V2WA 4WWKC 5JHLL 3MJ6A 1NCCL 1FNHA 1OD9A 3QAZC 4J6RH 3VMPA 1OLZA 1NLDL 1Q1JH 4M62L 3GMPB 4NPYB 3MLRL 4NP4L 3QA3B 4N9GA 1N0XH 5C0AB 2YD7A 4O9HL 1HHGB 2IPUG 3CMOH 3OHXA 4KROD 3GRWA 3GNML 1JPFA 4G8GE 4MJID 1D9KC 5E9DE 2NX5D 2CKBA 3UO1L 1S5IL 3EO1A 3MRHB 1AGCB 3CXDH 3S3SA 1IAKB 4NO3A 3ZYIA 1FO0L 5MENB 2QKIA 2I5YL 3O41A 3TT1H 3ARFC 1NBZB 3D85A 3ZDZF 1SJEB 4PG2C 2K7QA 1I1YB 5JR1L 4UV7H 2CDEA 1EAJA 4GOSA 1UFUA 1T1YB 2HN7B 4GFTB 4XMLH 5CLWA 2GJ6B 3GMOA 5CHNA 3DHJA 2XZZA 3C9NB 4FS0A 2OMBA 2DQJL 3OKDA 3V5KA 5ISZD 3EJYC 4RQQA 4XVJL 4IHOA 5DRZA 4YX2H 1MFAL 1K85A 1L6XA 2HMID 5JA8B 5DSCA 4HW6A 1MFCL 1RHHA 4JDZA 1YPZE 4JFEE 1QD0A 2I07B 5HJ3B 2FATH 3GSQB 1UM6L 1T66D 5E6ZA 2LU4A 4PJAF 5TDPA 4YUEL 4E0RB 3QUXB 5B38G 4KK6D 5BV7H 2OXHA 4OCWL 1UZ6E 2YXMA 2Z93B 1D6VH 5L88H 4ZXBA 1QP1A 1ZS8B 4BQ8A 2NY2C 3IJSB 4U1GC 2MKLC 4L4VB 1WZMA 3ULUE 1KIPB 4FZ8L 2P7TA 4YXLH 2E6PA 4MDIA 4U1KA 4LOUD 3DO7B 1GGCL 4H5SA 3C09B 3MROB 1YNLH 4OI8A 2GW5A 4LQFL 1HQ4A 3LKPA 1FL5A 1ZLSL 4P4RA 2A0LC 3VH8G 1TQCC 2BNUA 3VFVB 4WUUE 2R1WB 4UILL 3MJ7A 2DL9A 4U49A 4ZOAA 1FSKB 4L8SA 1IGJA 4Q2ZA 2OR7A 2LFGA 5BZWB 4FFZH 5TE4L 2HFEA 4X7FC 4Q97A 4OLEA 2YPLA 4P4KC 1WWCA 3HNTH 5CFHA 2I9TB 4PRBB 3ZE1E 7FABL 3WIHA 1JF5A 5D2NA 3JTSB 4NQEA 4KUCF 1OAYL 2AXFA 4NO2B 4LCUB 4O2FA 4TSAL 2V9TA 1X6NA 1OAXH 2W59A 3SOBL 5IUSA 4RMWA 3QWRD 1BBDL 4Q0XH 1MEXL 2HT4C 3ILQC 2DQEL 1IL1A 2DN7A 4B50A 2H8PB 4V1DE 3VXRA 4GMTL 2ZCHH 2BFVL 3PABA 2JJTA 2VDQH 2Z8VC 4HF5L 2EC8A 3KR3L 3JWDL 2ZWLT 1AD0B 1S7UA 2MJWA 4PUBH 5E08H 1LK3H 2R0WL 5D7SL 4OZIF 3M8OL 1N59A 1MFBL 3DHMA 3OKNA 2EIDA 3ARDC 1FL3A 2XWTA 3EYOB 4KDWA 3MOBH 3BP6B 2FECI 3DETC 1N6QL 1JN6B 1A7RH 1LO5A 4Y8DC 4X6EA 4U1MB 3IGAA 1EFXD 2DTSA 4JKMA 3RHWK 2MPAH 3QFJE 4TUOA 5F72S 4NRYA 1R5WB 2IH3A 3X17A 3U9PH 2UY6A 2H2PD 3X12A 1A6WH 1BJMA 2LU3A 5AWNL 4QRQB 2JB5L 3O6FD 6CGTA 1DANT 2HVKA 3FO0L 3M17B 4OZHB 4CNIB 2E7LA 4DZ8B 2XTJC 4XBPA 5DVLA 3BD5A 3OGCA 1DQQB 3IRPX 4MLIA 3C6LA 5JW3L 3B4NA 1JHTA 3O11A 1M7DA 2PW2A 3MODL 1UG9A 3NAAL 5TQ2H 4LRNL 3BIKB 1PKQB 2WIMA 3G5ZA 4I8DA 4ZTOL 4LLAA 4DVRL 4RFNB 3D18B 3QEHA 4NN6B 2D7TH 1OAZH 5HHVL 3B9KC 2VO5A 5ACZB 2ZUTA 2JCCE 1N5AB 3LQZA 1JF1A 1V7ML 5EC1B 2E7HA 4F3FB 3HUJA 4L3EA 3SE8H 5DJAB 3MBXH 4UB0H 1OAUL 1BQLH 5DS8A 3AC0A 4O58L 1TZIB 5F1KC 1W0WA 3ZKND 4M43L 3O3DB 1NCTA 1Z5LA 3G6JF 2WV3A 1NDGB 3L5WB 2O5YH 1NAML 2IFFL 3U0TA 2ESVE 4H0GA 5CJ5A 2OJEB 1OTTC 6FABL 3BN9D 4WEMB 4RGMC 3GIZH 3UPRA 2Z0BA 1JGEB 1MY5A 2J3SA 4XNMA 3NH7H 3B5TA 43C9B 1OF2B 1W72A 2X41A 1FZOB 5IT2H 1FNLA 4WW1A 4HH9A 3LS5L 4PJ8A 4XBGA 5HYIA 5AD0B 5I1GL 4RDQF 1NMAL 4FP8H 1I9RH 2IF7A 4P23C 4KKBC 4KRPC 2R15A 2X1WL 1DN0A 3O8XC 4PJIB 2YHGA 1RZJH 3SKOB 4J4PA 1VFBB 4MDJA 4Y7MA 4TVSa 2QHRL 3RAJL 2G75A 1P7QA 4PJEF 2NTFA 5D1QB 1B0RB 1QRNE 4DK6A 5F7MC 5L9DL 3AMLA 3S34L 3T0EE 5E6IB 5IIEB 3QI9C 2C7UA 2IEPA 4XCYB 1ADQH 4WEUD 1CD1A 2J8OA 4GBXB 1NL0L 2FYYA 1UWEH 1KG0A 2DJSA 1T3FB 1T1WB 5GQBA 2VLJB 5EZLB 3VFGH 1U6AL 4ZSOE 2P44B 3BZFA 3W39A 5D1XB 3IFOB 4GRMB 4I5BA 4U3XA 1UKQA 2F8XC 4F58L 1RURH 1G9ML 4GS7B 3DRTB 3TZVC 1Q9OB 3JWOC 4XAKD 1BD2D 1S5HA 3QUZB 5LQBL 4UQ3B 3AUVA 3HS0A 3O3BB 3NABH 3NPSC 4F7MB 3Q6GH 4LK4A 4LHUD 1OCWH 5LG1A 5EOQL 4LHQB 4H0IA 4N5ED 5GRYA 2V9RA 4W4OC 1BLNB 2QSCL 3VWJA 3BT2L 1U2CA 1MWAB 3GSXB 1FFPB 1MHEA 4X6DE 4UTBH 4F57L 3IKKA 4CN6A 4L9DA 2Y6SD 1MPAL 1W0YT 2AJXL 4HLJA 1UACH 4BZ2L 4C59B 4TSBH 1X3DA 3PP4H 3QBTB 4C56B 1XH3A 1VB9A 2Z8WC 3V4VL 4HZLB 5GGTA 3FN3A 1X5KA 4OQTL 1G9NL 5IB2A 3KYKL 5ALBL 4TNVF 2GSIB 2FNBA 1NSNL 1IE5A 3LY6A 3QSKB 4NHCL 3T2QA 1LE5B 3I75A 2UYLB 4Q9RH 4R6UA 1Q0XH 3RU8H 5F44A 4POYA 3JWNC 5CCKH 3DXAE 3IDYB 4LU5H 4NJ9L 2EEAA 5GS1B 1CGSL 4DUWA 1BVKA 4HCRL 4JM2D 3RZWA 2FB4L 1UT9A 5D7JC 1YQVH 5BO1H 1HN1A 4F2MA 4NC0B 4FFWD 4AL8L 4JPVH 1W2KT 4XB7A 4OZIA 3KYOB 3LSOA 4LARL 4PJBB 5I71B 4OZGB 5J3HC 1MIEH 3GJEB 3TVMB 3T0WA 4X6CB 3G08A 2FZ3B 1WZKA 4R26H 4WHYG 5T1MA 4NC2B 3DROB 1RV6X 2BSTA 1CFVH 4ODHH 5JUEH 4ZOEA 1H8OA 3PQYE 1EMTH 1T7XA 1QLFB 3Q6FA 2PXYC 1TZGL 5E2TL 4LLUB 4ZAKB 1H3GA 1WITA 1H15B 1XIWD 4JFXA 1U8OA 3F7VA 5J9PA 4Z7NF 4HJ0D 5EU3B 4JY4A 5IEKA 2OJZH 4LSVH 4NM8H 2O93L 4ODTH 3BZ4B 3SGKC 1TETH 2V7HA 3S96B 2BVOB 2XY1A 1RJZA 2R9HC 4U1JB 1CGVA 4GW4A 3MCKA 2HJLA 1MNUL 2FIKA 3D69B 5I19H 1NCAL 4ELMA 3C8KA 4HPOL 4CJ0A 4M93B 2VDMH 5JW4Q 4O2EA 4RDQG 3BKCH 4KAQH 2ZUVA 4UV4L 4AT6A 2NCMA 4ETQA 5EBGA 5BVPH 1WCBA 2DQDH 5ENWB 2YKLH 3QQ9C 4O5LL 2XN9D 1U8HA 4JB9L 4QHKJ 4F9LA 1DFBH 4DKEH 3RNQB 3CIQA 2P8LA 2DLTA 2DQFB 4OD1L 1SMOA 4P5MB 3W9DA 3ZSSA 1MLCA 1JGLH 4ZFFB 2RCSL 5I76B 1MSPA 5KN5B 1DQLL 1XCQA 5CIPH 1U8PA 5EN2B 1FZMB 3B8YA 3MNWA 4L8DA 4QTIH 5TDNA 2W0KA 4HKXB 3H9SA 1RZ8B 3PGFL 4IRJC 1TCRB 2WM0A 3P2TA 4MCYB 1M71A 5EUOA 3TBTA 4JREB 1VDGA 2FBJL 4HIXL 4Y19A 4I3RL 3C2AH 4JHWH 4R97B 4PJCE 3O4LA 1CE1H 2NY0C 2YN5A 1B9ZA 2HT2D 2PO6A 3AU1A 3SDCA 5FO9A 2GCYB 3C5ZB 1T0NB 1C12B 2OP4H 1JRHI 3GMNA 5DFVD 2PYEA 3INUH 4ZTPH 2DM4A 3FQTA 4PJEA 4Y5VB 3RKPA 3I6LE 3HE6D 2QSVA 4DN3H 4QRPB 3L9RB 5BZDA 1U3YA 4KJWC 4HFWA 2DD8L 3U1SL 4WFHD 4PREA 4XB8A 2E8ZA 5JW5A 2IQAA 1DEEB 2OSLA 2VXQH 2VE6B 4L9LB 4OSUH 4AG4L 1K4DA 4DGVH 1IC4H 1AD9B 5E8OA 4YHNB 4Y2DC 3LN9A 4NZTH 4ODWB 1J0ZA 5EBWA 1AP2A 4XCCH 2UVEA 3WN5C 4I9WE 5F9AC 4ZUVB 5BVJA 1XF4A 4P2RE 4G3YH 4P5TC 5J11B 1U8LB 2CDFA 3NA9L 2BNQA 2ADIB 3NACH 3QEUB 4QOKA 3ZE0E 1BQSA 3LN4B 5JPNA 3D0LB 4WRLA 3KJ4C 3GK8H 2VYRE 1U8IA 3SKNB 1KN2L 1Q8MA 3AREB 2R69H 3TIDB 1P9MA 3DURA 3S98A 4KKAC 2JE8A 1J1OL 3KPSD 2CDGA 1N0XL 2IC2A 3BKYL 1FNGB 1KT2A 2ZUQC 3DVNB 1ZT1B 3PNWB 3WKMH 4KHTH 4LLMA 3MCLL 3PWLA 1KV3A 4Q6IB 1CXEA 4M6MH 3OR6B 3F5WB 4UOW1 2D9CA 5DD0L 1ACZA 1WC7B 1CLOH 1EEUA 2R56L 4HLZH 4RFOH 4PB0L 3MZGB 4PJ7F 3H42H