4XBTA

Crystal structure of the l74f/m78f/l103v/l114v/i116v/f139v/l147v mutant of leh complexed with (s,s)-cyclohexanediol
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
b'HHTSKIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFTVFSIDAVETFHIGSSNGLVYTERVDVVRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREVEEAVDLPVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Reshaping an Enzyme Binding Pocket for Enhanced and Inverted Stereoselectivity: Use of Smallest Amino Acid Alphabets in Directed Evolution
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 43
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4xbtA00
1O7HB 2RCDA 3VSYA 4HM6B 3KKGA 3CPOA 4J9AA 1O7GB 3A76A 3KE7A 3H51A 4OVMA 4HM5B 3JUNA 4XM4A 5CLKA 1STDA 3FKAA 4L8OA 1NWWA 4MJDA 3CNXA 3T8NA 2YFIB 3OXAA 1A2KA 3Q90A 5CF2A 4HM8B 1ISKA 5EVHA 2JQ5A 4WYKB 3EF8A 3FF2A 2QIYA 1VZZA 3DXOA 4R9LA 1JKGA 3G8ZA 5STDA 5IENA 3HK4A 3NXJA 1CQSA 3FF0A 3NBRA 4X2OA 2F86B 1QJGA 1GY5A 1Q40A 4GB5A 1AR0A 3OWUA 3UNLA 1W00A 2INXA 1OUNA 3MKIA 5AI1A 3DUKA 5TGNA 4IIAA 3G0KA 1DMMA 3G16A 5D81A 2F99A 3B8LA 3SEDA 3NUVA 2GBXB 3IPTA 3HX8A 3I0YA 4FCMA 1W01A 5DRVA 4I4KA 3SOAA 7STDA 5BXQA 3RGRA 1OF5A 3BLZA 1JB2A 3GZYB 1K41A 3MG1A 2BNGA 3JUPA 4U13A 4XDVA 2I9WA 3NV0B 3GZRA 4HZBB 1UUWB 1OGXA 2RFRA 2HMOB 3MG2A 3UJMA 3E99A 1JB5A 2HMJB 3MSOA 5CXOA 4Q53A 5CF1A 1Q40B 1JN5A 2W2CA 5AEUB 4L8PA 4WP5A 1O7WB 1ULJB 5IG3A 3GWRA 2XRXB 3H3HA 2YFJB 3EN1B 4XB5A 4X2HA 3DZLA 3ROBA 8CHOA 2BMRB 5IG0A 1UUVB 1ZO2A 3KZTA 1O7NB 3OWSA 4N3VA 3FSDA 4PEJA 2HMMB 1TUHA 4STDA 2OWPA 3VGNA 1NDOB 3F7XA 2XSOB 3CU3A 4LMIA 4LEHA 3EQQB 3T8UA 2F98A 1E3VA 3NHXA 4ORLA 1JB4A 1OHSA 1EA2A 5BVBA 1C7HA 1OCVA 3EBTA 2A15A 4KVHA 3JUOA 3EHCA 3EJVA 3JUMA 2YFLB 3MHEA 2XSHB 6STDA 3B7CA 4H3UA 1GY6A 4HKVB 5D82A 1BUQA 2R4IA 4J8TA 1O7PB 1OHOA 2GEYA 4HVNA 2HMNB 2XR8B 5IG5A 3K0ZA 4HM1B 1E97A 1DMNA 3KSPA 4K1UA 4WWUC 4XDWA 2STDA 1ZX2A 1GYBA 1OGZA 4XBTA 3LYGA 3M8CA 1JKGB 4WYKA 5KP4A 3DM8A 3STDA 5D83A 5G2GA 2BMOB 5FW5A 2GXFA 1W02A 3NM2A 3F8HA 2B24B 4RZMA 2GBWB 4OUQA 3F14A 1U5OA 5KP1A 2IMJA 4XBXA 4R1KA 3RGAA 2K54A 1S5AA 3F9SA 4L7KA 2HMKB 1DMQA 2Z76A 1OH0A 3OV4A 3OWYA 3WMDA 1IDPA 1ULIB 2CKFB 5CK6A 5DREA 2GEXA 3DMCA 4LGQA 3EC9A 2Z77A 3FLJA 5IF6A 1OF5B 1HKXA 4FCJA 1OHPA 4HM4B 1W6YA 1WQLB 5HGRA 1E3RA 3B4PA 5AIGA 2BMQB 2B1XB 1Q42A 3BB9A 3F8XA 3LZAA 1O7MB 3NV0A 3HZPA 4HM0B 2QGUA 1Z1SA 3EBYA 4HJLB 4XBYA 3D9RA 5IEPA 1JN5B 3CNMA 5AIFA 3MG3A 3MYTA 2UX0A 4K1VA 3F40A 5JPPA 2PZVA 5KP3A 5AIHA 3ECFA 1SJWA 2RGQA 2HMLB 3GZBA 3B4OA 1GS3A 3GZXB 1EG9B 4HM7B 4HZ9B 5IERA 1NU3A 4HM2B 3EN8A 1QMAA 4CDLA 3SOYA 3FZWA 4R9KA 3GRDA 3OX9A 5JPUA 4HM3B 1ASKA 3JUQA 5IG4A 3K7CA 5AEWB 3F7SA 3EX9A 3S5CA 3ER7A 1GY7A 5AIIA 3FGYA 1TP6A 5IEOA 2Z7AA 2CHCA 1OPYA 3FH1A
chains in the Genus database with same CATH superfamily
4BTYA 3CPW2 1O7HB 2RCDA 1KWIA 1F8NA 1I70A 4LYLB 3SLUA 4LZIA 3VSYA 4HM6B 3KKGA 1MWTA 3CPOA 4FMAA 1Q824 3Q2PA 2ZL8A 1UCKA 1K8A4 2FXTA 4J9AA 3AHSA 1O7GB 1YJN3 4EV2A 1J2BA 4QWTA 4WHAA 1DVDA 3A76A 4N6TA 1BU4A 2MC8A 2GU3A 2OTJ3 2AADA 3I563 2K0MA 3KE7A 3H51A 3DGNA 1EQKA 3CMA3 3O8YA 1IVWA 4OVMA 1YIT3 5M18A 2F56A 5G1KA 1YI23 2CWVA 4HM5B 3WOEB 4O8SA 1N5PA 2CFDA 1RTUA 1MWSA 3JUNA 4XM4A 1BUJA 1Q9EA 5I97A 2P0XA 5CLKA 1STDA 3FKAA 1LNHA 1NWWA 4L8OA 4MJDA 3CC43 3CNXA 3T8NA 2YFIB 3OXAA 1B21A 2OCTA 1A2KA 3LXUX 3Q90A 5CF2A 1Q864 3DGMA 1RSNA 2OOVC 3HOHA 3PCRA 3X42A 1QVF2 1I2FA 4HM8B 1ISKA 1BRGA 2KF6A 3DGLA 5EVHA 2JQ5A 4WYKB 5ELUA 2CG1A 3EF8A 3FF2A 3Q1CA 2QIYA 3TDGA 2C4BA 2LYXA 1I2GA 1VZZA 3ZFZA 3DXOA 3BNBA 4R9LA 3J7Yd 1DE3A 4KFEA 1JKGA 5AYRB 3G8ZA 2QEX3 2GU1A 4HBRA 1RNBA 5STDA 5IENA 1I3IA 2W56A 3HK4A 3NXJA 1CQSA 1PU4A 3LT8A 3PCSA 2E2TA 3FF0A 3NBRA 4X2OA 2F86B 4FCZA 1N8QA 1AVKA 1RRLA 1QJGA 4FMBA 3RDEA 2W9PA 1Q7HA 1GY5A 1I2EA 3G713 1Q40A 2Y74A 4EW5A 4GB5A 1FGQA 3KIIA 3CCU3 1VQ73 4FR9A 3PZWA 5M19A 1AR0A 3WDGB 1MGWA 3OWUA 1T3BA 3UNLA 4BTWA 3HI7A 1WNHA 1EKMA 5A0OB 3NQZA 3WR2A 1W00A 2BT3A 2ZHXB 2INXA 1OUNA 3MKIA 5AI1A 5HOHA 1AV4A 2Z6BA 5M1AA 1KSIA 3DUKA 5TGNA 1GD3A 1LOWA 2XGLA 4IIAA 3G0KA 1DMMA 3G16A 5AYSC 2QA43 2H0GA 1BVIA 5D81A 1YJW3 2WO0A 5EQLA 2F99A 3B8LA 3SEDA 3FCSB 1W7CA 4BL3A 4HAAA 1FUWA 3NUVA 2GBXB 3IPTA 1CEWI 2RBIA 3Q3FA 1RGLA 4KZ1A 2HOHA 3HX8A 3I0YA 4MMXB 3X3YA 1RCKA 4FCMA 1W2B2 1W01A 1JNQA 5DRVA 1DYUA 3K5TA 3AHWA 3N54B 4I4KA 4O3VA 3SOAA 1TU5A 1RGKA 3LOYA 1I8VA 3CME3 1U8CB 7STDA 5BXQA 3RGRA 2J8XB 2KF4A 3CCM3 3EE1A 1MWRA 1L5GB 1OF5A 1LNIA 1MNLA 2IA7A 3IJEB 3BLZA 5GSPA 1JB2A 3U1WA 1FUTA 3GZYB 1K41A 2F5WA 2ML6A 2CC3A 3MG1A 1RKYA 3DY5A 4IPBA 5BU4A 2BNGA 1KQS2 3JUPA 4U13A 1BSBA 3SYUA 4O02B 1VQP3 4XDVA 4N6UA 1KD14 1W2ZA 1B27A 1GMRA 2BIRA 2I9WA 3NV0B 3GZRA 2R41A 3S67A 1RN4A 4HZBB 1UUWB 1OGXA 2XFSA 3N9HA 1JRQA 4LSOA 2RFRA 2HMOB 3ZG0A 2Y73A 3IMAB 1RGFA 2KRTA 3BU4A 3MPHA 4ILFA 2CG0A 1RMSA 2IUKA 3MG2A 1NB5I 1CH0A 4KFDA 7GSPA 3UJMA 1PY3A 3BIRA 6RNTA 1QAFA 3E99A 4GSPA 1BRIA 3T0UA 3X3ZA 4FMCA 1JB5A 2HMJB 1VQ93 5IW9A 3AMOB 3MSOA 3UL6A 1GSPA 5CXOA 4Q53A 2CFLA 5CF1A 1Q40B 2IYJA 1JN5A 1RHLA 1TRQA 3N8BA 1BAOA 1AQZA 2P38A 2W2CA 3CCR3 4MMYB 2H0IA 5LC7A 3KN4A 1M904 2W9QA 4GL6A 5AEUB 4L8PA 2XH9A 2RNTA 3AGNA 4N6NB 4WP5A 1M1K4 1VQN3 1A90A 1YGWA 3UB1A 1O7WB 1UUGB 2LQVA 1ULJB 3KCHA 1US1A 3K63A 1TFKA 2KCDA 2ZA4A 5IG3A 1HYFA 3GWRA 1UCLA 2XRXB 1JZOA 3PYJA 3CC23 3H3HA 4J5GA 1WMOA 2CFWA 2YFJB 1SIIA 1C54A 3EN1B 2ZDJA 3CD63 1BNIA 4XB5A 1BRKA 1IQXA 3CCE3 4X2HA 3AGOA 1IV7A 3DZLA 3ROBA 3LTDA 8CHOA 2BMRB 2M7OA 1MGRA 2IY2A 5IG0A 5LC6A 1NNVA 1UUVB 1Q7Y4 1D6ZA 2KF3A 2XFTA 1ZO2A 3KZTA 4I5QA 1RCLA 2C11A 1O7NB 3LTCA 3OWSA 2GSPA 5FGOA 4N3VA 3FSDA 4PEJA 2HMMB 2P0MA 1TUHA 4STDA 2WGOA 2OWPA 4O2HA 2KF5A 3VGNA 1NDOB 3F7XA 1BNGA 1CYVA 2JDIH 2P09A 4N6MA 1N9JA 3SVAA 3U97A 2D42A 3CCQ3 1KC84 3X40A 2OTL3 2XSOB 1RNTA 3CU3A 4LMIA 4K61A 7RNTA 1AY7A 1X1XA 4LEHA 3CC73 1D6UA 2W03A 1JBSA 3EQQB 3T8UA 1K9M4 4BTXA 1UI7A 2F98A 3A5EA 1E3VA 3NHXA 4ORLA 1IVXA 3BNDA 1JB4A 1DVCA 1OHSA 1EA2A 3D5GA 1GD4A 3CCV3 5BVBA 1TIJA 1LRAA 1C7HA 1I3FA 2CFGA 1OCVA 3EBTA 2A15A 1BIRA 4KVHA 3JUOA 3D4AA 3EHCA 3EJVA 1ZGXA 1A2PA 3JUMA 1I0XA 2YFLB 1G96A 3K9MC 3NBJA 1TFOA 1RJOA 2P05A 3MHEA 1JBTA 1BRNL 1FGTA 2XSHB 6STDA 1M1XB 1BRHA 3B7CA 3V98A 3ZG5A 2OQEA 4H3UA 1R4CA 1N5HA 5G1LA 1GY6A 2CX0A 4HKVB 3QRDA 1IT7A 3WA3A 5D82A 1B2ZA 1IT8A 2CX1A 4TX4A 3GAXA 3CXC2 1BUQA 2R4IA 4J8TA 4CPKA 1O7PB 1OHOA 2WOHA 3BNCA 2GEYA 1D6YA 1FGMA 3URPA 4HVNA 3CCJ3 1YIJ3 2HMNB 1LOYA 2CWUA 4KT3B 2XR8B 1QAKA 2UUGC 5IG5A 3K0ZA 1VQ83 1EUIC 1RLSA 4HM1B 2BO9B 3V92A 1E97A 4JF8A 1I0VA 1G02A 3S27A 3VF1A 3UL5A 3FG1A 1DMNA 3KSPA 4K1UA 4WWUC 4XDWA 2WGQA 3KSED 4JRFA 1YNVX 1R4YA 2BHMA 1RGAA 5BIRA 2STDA 1ZX2A 3D79A 1IV9A 1HU9A 1GYBA 1QVG2 1IU7A 1ROAA 3FG4A 1OGZA 1B2SA 4AKZA 2L1SA 1T5YA 3LH4A 4XBTA 1MOLA 1B2MA 4NPBA 3D3LA 3LYGA 3M8CA 3WODG 1CYUA 1JKGB 4WYKA 9RNTA 5KP4A 1BNJA 4K90B 4MMZB 3DGOA 3DM8A 3STDA 5D83A 2OOVA 1GOVA 5G2GA 3RNTA 4KFFA 2BMOB 3HIIA 2GXFA 1LXEA 1BGSA 1W02A 2W56B 3NM2A 5FW5A 3F8HA 3WHOA 2B24B 2V1LA 4RZMA 1UCJA 3HIGA 1BSEA 2GBWB 1YHQ3 2XF3A 4OUQA 3S28A 5RNTA 3F14A 2IUJA 1WMNA 2SBLA 1SPUA 3BNEA 4DKIA 1U5OA 3MWZA 1JV2B 1V74A 2F5MA 1A2VA 1PFPA 5KP1A 3NM7A 2F4YA 2OQEC 2IMJA 3NX0A 1NB3I 2CW9A 4XBXA 1SARA 3CCS3 4R1KA 3RGAA 2K54A 2FGTA 1Y4KA 1VQM3 1AVLA 1S5AA 4CCVA 3F9SA 4L7KA 1X1UA 2HMKB 1DMQA 2Z76A 1BOXA 1OH0A 3S29A 2ML5A 1BNSA 3OV4A 1VQO3 1S723 1UGIA 1TJDA 3OWYA 2L4VA 4N6OB 3WMDA 4RNTA 4EYCA 3WOFB 1B2XA 1IDPA 1ULIB 1JBRA 2CKFB 4J5KA 1QALA 4EXRA 5CK6A 5DREA 4AEQA 2GEXA 3DMCA 1YVBI 1X1WA 4LGQA 5ELJA 2E2VA 3EC9A 1RGGA 4N6LA 1ZS7A 1UI8A 1OACA 1BNFA 2Z77A 1V58A 3FLJA 4GHOA 5IF6A 3G6E3 1YJ93 1M9GA 1HKXA 1OF5B 1BRSA 1TTOA 1VQ53 1GMPA 1RGEA 4FCJA 1W6CA 1OHPA 2W04A 4HM4B 4BIRA 1W6YA 1GOYA 2PNCA 3WA2X 1BRJA 2O3OA 1WQLB 1BNRA 2RSXA 3OW22 1LVNA 1TRPA 2CH9A 5HGRA 3JVCA 1X1YA 3G4S3 2CWTA 1W4NA 1E3RA 3B4PA 1STFI 5AIGA 1W5ZA 2BMQB 3V99A 1FGOA 1ROVA 2B1XB 1Q42A 1RGHA 1MWUA 1YVSA 2C10A 2K3DA 3BB9A 3F8XA 3LZAA 1O7MB 1IVUA 4NREA 3NV0A 3HZPA 2O9UX 2YX9A 3L0RA 2AAEA 1GOUA 4H61A 4R4KA 4HM0B 2XGNA 2QGUA 1Z1SA 3EBYA 1T2HA 4RNYA 1VQ43 4HJLB 3DH2A 1EEJA 3FG3A 6GSPA 4XBYA 1WMPA 1K28A 1SIHA 3KFQC 3D9RA 1WTHA 4EBGA 1BSDA 5IEPA 3I553 1JN5B 3CNMA 5AIFA 3SX1A 2W6JH 1BSAA 4WFOA 3MG3A 1JJ22 3AMOA 1V57A 3MYTA 4MEIA 4NHFA 2UX0A 1UCIA 1FUSA 1BNEA 3PS8A 4BL2A 1Q814 4K1VA 3NBBA 1B2UA 1LQGC 2FNQA 2SARA 3F40A 5JPPA 2PZVA 5KP3A 1N9EA 3PGBA 4IT7A 3ECFA 4R80A 5AIHA 1SJWA 4ZM8A 1IK3A 2RGQA 1VQQA 2Q07A 3PXMA 2HMLB 1GMQA 3GZBA 1N8R4 1A67A 1IQ8A 2CK3H 3B4OA 1GS3A 1BSCA 1LOXA 4G1MB 4AKYA 2E2UA 3GZXB 4N6V0 1EG9B 4FMDA 4HM7B 1YGEA 3GSPA 4HZ9B 2CFKA 1NO3A 3LTBA 5IERA 3NQYA 8RNTA 1VQL3 1IYYA 1G0TA 1NU3A 1B3SA 1IQYA 1RN7A 5JBSA 1LQMB 2WOFA 4HM2B 5EEOA 3EN8A 1QMAA 4CDLA 3ALAA 3SXXA 4RBNA 2MF7A 3SOYA 4EV5A 1FYSA 3FZWA 1BANA 1RGCA 1RDSA 4R9KA 1UW1A 1DETA 3GRDA 1RRHA 3OX9A 5JPUA 4EC6A 1RN1A 4HM3B 1UGHI 1FZUA 1FGRA 1K734 1W6GA 1UDII 4HOHA 1ASKA 1T2IA 2XEPA 3JUQA 4HYZA 4RNZA 4CJNA 2H0HA 1VQ63 4OK0A 5IG4A 3X41A 3QK9A 3LTAA 2CIUA 2W0QA 2D1WA 2UGIA 3EB8A 4BU4A 3K7CA 1NJI4 5AEWB 3F7SA 3EX9A 3S5CA 2KXGA 1FW7A 1IVVA 3ER7A 1GY7A 5AIIA 1PYLA 2KAAA 3FGYA 1VQK3 3X3XA 1TP6A 1SQWA 3LMLA 2BU4A 3D5IA 1HZ1A 3CCL3 3LT9A 1FA3A 1LOVA 1JZDA 5IEOA 2Z7AA 1B20A 2CHCA 3DGYA 1OPYA 3FH1A
chains in the Genus database with same CATH topology
4BTYA 3CPW2 1O7HB 2RCDA 1KWIA 1F8NA 3VSYA 3SLUA 4LZIA 4HM6B 3KKGA 4FMAA 3CPOA 1Q824 3Q2PA 2ZL8A 1K8A4 2FXTA 4J9AA 1O7GB 1YJN3 4EV2A 1J2BA 4QWTA 4WHAA 1DVDA 3A76A 4N6TA 2MC8A 2GU3A 2OTJ3 3I563 2K0MA 3KE7A 3H51A 3DGNA 1EQKA 3CMA3 3O8YA 1IVWA 4OVMA 1YIT3 1YI23 2CWVA 4HM5B 3WOEB 4O8SA 1N5PA 2CFDA 3JUNA 4XM4A 5I97A 2P0XA 5CLKA 1STDA 3FKAA 1LNHA 1NWWA 4L8OA 4MJDA 3CC43 3CNXA 3T8NA 2YFIB 3OXAA 2OCTA 1A2KA 3LXUX 3Q90A 5CF2A 1Q864 3DGMA 2OOVC 3X42A 3PCRA 1QVF2 4HM8B 1ISKA 3DGLA 5EVHA 2JQ5A 4WYKB 5ELUA 2CG1A 3EF8A 3FF2A 3Q1CA 2QIYA 3TDGA 2LYXA 1VZZA 3DXOA 3BNBA 4R9LA 3J7Yd 4KFEA 1JKGA 5AYRB 3G8ZA 2QEX3 2GU1A 4HBRA 5STDA 5IENA 3HK4A 2W56A 3NXJA 1CQSA 1PU4A 3LT8A 3PCSA 2E2TA 3FF0A 3NBRA 4X2OA 2F86B 4FCZA 1N8QA 1AVKA 1RRLA 1QJGA 4FMBA 3RDEA 2W9PA 1GY5A 3G713 1Q40A 2Y74A 4GB5A 1FGQA 3KIIA 3CCU3 1VQ73 4FR9A 3PZWA 1AR0A 3WDGB 3OWUA 3UNLA 4BTWA 3HI7A 1WNHA 1EKMA 5A0OB 3NQZA 1W00A 2BT3A 2INXA 1OUNA 3MKIA 5AI1A 1AV4A 2Z6BA 1KSIA 3DUKA 5TGNA 1GD3A 4IIAA 2XGLA 2QA43 3G0KA 1DMMA 3G16A 5AYSC 5D81A 1YJW3 2WO0A 5EQLA 2F99A 3B8LA 3SEDA 3FCSB 1W7CA 1FUWA 3NUVA 2GBXB 3IPTA 1CEWI 4KZ1A 4MMXB 3HX8A 3I0YA 3X3YA 4FCMA 1W2B2 1W01A 1JNQA 5DRVA 1DYUA 3K5TA 3N54B 4I4KA 4O3VA 3SOAA 1TU5A 3LOYA 3CME3 1U8CB 7STDA 5BXQA 3RGRA 3CCM3 3EE1A 1L5GB 1OF5A 1MNLA 2IA7A 3IJEB 3BLZA 1JB2A 3U1WA 3GZYB 1K41A 2ML6A 2CC3A 3MG1A 1RKYA 3DY5A 4IPBA 1KQS2 2BNGA 3JUPA 4U13A 1VQP3 4O02B 4XDVA 4N6UA 1KD14 1W2ZA 2I9WA 3NV0B 3S67A 3GZRA 4HZBB 1UUWB 1OGXA 2XFSA 3N9HA 1JRQA 4LSOA 2RFRA 2HMOB 2Y73A 3IMAB 2KRTA 3MPHA 2CG0A 2IUKA 3MG2A 1NB5I 4KFDA 3UJMA 1QAFA 3E99A 3T0UA 3X3ZA 4FMCA 1JB5A 2HMJB 1VQ93 5IW9A 3AMOB 3MSOA 3UL6A 5CXOA 4Q53A 2CFLA 5CF1A 1Q40B 1JN5A 3N8BA 2W2CA 3CCR3 2P38A 4MMYB 5LC7A 3KN4A 1M904 2W9QA 4GL6A 5AEUB 4L8PA 2XH9A 4N6NB 4WP5A 1M1K4 1VQN3 1A90A 3UB1A 1O7WB 2LQVA 1ULJB 1US1A 3K63A 1TFKA 2KCDA 5IG3A 3GWRA 2XRXB 3PYJA 3CC23 3H3HA 1WMOA 2CFWA 2YFJB 1SIIA 3EN1B 2ZDJA 3CD63 4XB5A 3CCE3 1IQXA 4X2HA 3DZLA 1IV7A 3ROBA 3LTDA 8CHOA 2BMRB 2M7OA 5IG0A 5LC6A 1UUVB 1Q7Y4 1D6ZA 2XFTA 1ZO2A 3KZTA 2C11A 1O7NB 3LTCA 3OWSA 5FGOA 4N3VA 3FSDA 4PEJA 2HMMB 2P0MA 1TUHA 4STDA 2WGOA 2OWPA 4O2HA 3VGNA 1NDOB 3F7XA 4EC6A 1CYVA 2JDIH 2P09A 4N6MA 1N9JA 3SVAA 3U97A 2D42A 3CCQ3 1KC84 3X40A 2OTL3 2XSOB 3CU3A 4LMIA 4K61A 4LEHA 3CC73 1D6UA 2W03A 3EQQB 3T8UA 1K9M4 4BTXA 1UI7A 2F98A 1E3VA 3NHXA 4ORLA 1IVXA 3BNDA 1JB4A 1DVCA 1OHSA 1EA2A 1GD4A 3CCV3 5BVBA 1TIJA 1C7HA 2CFGA 1OCVA 3EBTA 2A15A 4KVHA 3JUOA 3EHCA 3EJVA 3JUMA 2YFLB 1G96A 3K9MC 3NBJA 1TFOA 1RJOA 2P05A 3MHEA 1FGTA 2XSHB 6STDA 1M1XB 3B7CA 3V98A 2OQEA 4H3UA 1R4CA 1N5HA 1GY6A 4HKVB 3QRDA 1IT7A 3WA3A 5D82A 1IT8A 4TX4A 1BUQA 3GAXA 3CXC2 2R4IA 4J8TA 1O7PB 1OHOA 2WOHA 3BNCA 2GEYA 1D6YA 1FGMA 4HVNA 3CCJ3 1YIJ3 2HMNB 2CWUA 2XR8B 1QAKA 5IG5A 1VQ83 3K0ZA 3V92A 4HM1B 2BO9B 1E97A 4JF8A 3VF1A 3S27A 3UL5A 3FG1A 1DMNA 3KSPA 4K1UA 4WWUC 4XDWA 2WGQA 3KSED 4JRFA 2BHMA 2STDA 1ZX2A 1IV9A 1HU9A 1GYBA 1QVG2 1IU7A 1ROAA 3FG4A 1OGZA 4AKZA 1T5YA 3LH4A 4XBTA 1MOLA 3D3LA 3LYGA 3M8CA 3WODG 1CYUA 1JKGB 4WYKA 5KP4A 4K90B 4MMZB 3DGOA 3DM8A 3STDA 5D83A 2OOVA 5G2GA 4KFFA 2BMOB 3HIIA 2GXFA 1LXEA 1W02A 2W56B 5FW5A 3NM2A 3F8HA 2B24B 2V1LA 4RZMA 3HIGA 2GBWB 1YHQ3 2XF3A 4OUQA 3S28A 3F14A 2IUJA 1WMNA 2SBLA 1SPUA 3BNEA 1U5OA 3MWZA 1JV2B 1V74A 5KP1A 1A2VA 1PFPA 3NM7A 2OQEC 2IMJA 3NX0A 1NB3I 2CW9A 4XBXA 3CCS3 4R1KA 3RGAA 2K54A 2FGTA 1Y4KA 1VQM3 1AVLA 1S5AA 4CCVA 3F9SA 4L7KA 2HMKB 1DMQA 2Z76A 1OH0A 3S29A 2ML5A 3OV4A 1VQO3 1S723 3OWYA 2L4VA 4N6OB 3WMDA 4EYCA 3WOFB 1IDPA 1ULIB 2CKFB 1QALA 4EXRA 5CK6A 5DREA 4AEQA 2GEXA 3DMCA 1YVBI 5ELJA 4LGQA 2E2VA 3EC9A 4N6LA 1UI8A 1OACA 2Z77A 1YJ93 3FLJA 5IF6A 3G6E3 1M9GA 1HKXA 1OF5B 1VQ53 4FCJA 1W6CA 1OHPA 2W04A 4HM4B 1W6YA 2PNCA 3WA2X 2O3OA 1WQLB 2RSXA 3OW22 1LVNA 2CH9A 5HGRA 3JVCA 3G4S3 2CWTA 1W4NA 1E3RA 3B4PA 1STFI 5AIGA 1W5ZA 2BMQB 3V99A 1FGOA 1ROVA 2B1XB 1Q42A 2C10A 3BB9A 3F8XA 3LZAA 1O7MB 1IVUA 4NREA 3NV0A 3HZPA 2O9UX 2YX9A 3L0RA 4H61A 4R4KA 4HM0B 2XGNA 2QGUA 1Z1SA 3EBYA 4RNYA 1VQ43 4HJLB 3FG3A 4XBYA 1WMPA 1K28A 1SIHA 3KFQC 3D9RA 1WTHA 4EBGA 5IEPA 3I553 1JN5B 3CNMA 5AIFA 3SX1A 2W6JH 4WFOA 3MG3A 1JJ22 3AMOA 3MYTA 4MEIA 4NHFA 2UX0A 3PS8A 1Q814 4K1VA 3NBBA 2FNQA 3F40A 5JPPA 2PZVA 5KP3A 1N9EA 3PGBA 4IT7A 3ECFA 4R80A 5AIHA 1SJWA 4ZM8A 1IK3A 2RGQA 2Q07A 3PXMA 2HMLB 1A67A 3GZBA 1N8R4 1IQ8A 2CK3H 3B4OA 1GS3A 1LOXA 4G1MB 4AKYA 2E2UA 3GZXB 4N6V0 1EG9B 4FMDA 4HM7B 1YGEA 4HZ9B 2CFKA 1NO3A 3LTBA 5IERA 3NQYA 1VQL3 1NU3A 1IQYA 5JBSA 1RN7A 2WOFA 4HM2B 5EEOA 3EN8A 1QMAA 4CDLA 3ALAA 3SXXA 4RBNA 2MF7A 3SOYA 4EV5A 3FZWA 4R9KA 1UW1A 3GRDA 1RRHA 3OX9A 5JPUA 4HM3B 1FGRA 1K734 1W6GA 1ASKA 3JUQA 2XEPA 4HYZA 4RNZA 1VQ63 4OK0A 5IG4A 3X41A 3QK9A 3LTAA 2CIUA 2W0QA 2D1WA 3EB8A 3K7CA 1NJI4 5AEWB 3F7SA 3EX9A 3S5CA 2KXGA 1IVVA 3ER7A 1GY7A 5AIIA 3FGYA 1VQK3 3X3XA 1TP6A 1SQWA 3LMLA 3CCL3 3LT9A 1FA3A 5IEOA 2Z7AA 2CHCA 1OPYA 3FH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7H B;  2RCD A;  3VSY A;  4HM6 B;  3KKG A;  3CPO A;  4J9A A;  1O7G B;  3A76 A;  3KE7 A;  3H51 A;  4OVM A;  4HM5 B;  3JUN A;  4XM4 A;  5CLK A;  1STD A;  3FKA A;  4L8O A;  1NWW A;  4MJD A;  3CNX A;  3T8N A;  2YFI B;  3OXA A;  1A2K A;  3Q90 A;  5CF2 A;  4HM8 B;  1ISK A;  5EVH A;  2JQ5 A;  4WYK B;  3EF8 A;  3FF2 A;  2QIY A;  1VZZ A;  3DXO A;  4R9L A;  1JKG A;  3G8Z A;  5STD A;  5IEN A;  3HK4 A;  3NXJ A;  1CQS A;  3FF0 A;  3NBR A;  4X2O A;  2F86 B;  1QJG A;  1GY5 A;  1Q40 A;  4GB5 A;  1AR0 A;  3OWU A;  3UNL A;  1W00 A;  2INX A;  1OUN A;  3MKI A;  5AI1 A;  3DUK A;  5TGN A;  4IIA A;  3G0K A;  1DMM A;  3G16 A;  5D81 A;  2F99 A;  3B8L A;  3SED A;  3NUV A;  2GBX B;  3IPT A;  3HX8 A;  3I0Y A;  4FCM A;  1W01 A;  5DRV A;  4I4K A;  3SOA A;  7STD A;  5BXQ A;  3RGR A;  1OF5 A;  3BLZ A;  1JB2 A;  3GZY B;  1K41 A;  3MG1 A;  2BNG A;  3JUP A;  4U13 A;  4XDV A;  2I9W A;  3NV0 B;  3GZR A;  4HZB B;  1UUW B;  1OGX A;  2RFR A;  2HMO B;  3MG2 A;  3UJM A;  3E99 A;  1JB5 A;  2HMJ B;  3MSO A;  5CXO A;  4Q53 A;  5CF1 A;  1Q40 B;  1JN5 A;  2W2C A;  5AEU B;  4L8P A;  4WP5 A;  1O7W B;  1ULJ B;  5IG3 A;  3GWR A;  2XRX B;  3H3H A;  2YFJ B;  3EN1 B;  4XB5 A;  4X2H A;  3DZL A;  3ROB A;  8CHO A;  2BMR B;  5IG0 A;  1UUV B;  1ZO2 A;  3KZT A;  1O7N B;  3OWS A;  4N3V A;  3FSD A;  4PEJ A;  2HMM B;  1TUH A;  4STD A;  2OWP A;  3VGN A;  1NDO B;  3F7X A;  2XSO B;  3CU3 A;  4LMI A;  4LEH A;  3EQQ B;  3T8U A;  2F98 A;  1E3V A;  3NHX A;  4ORL A;  1JB4 A;  1OHS A;  1EA2 A;  5BVB A;  1C7H A;  1OCV A;  3EBT A;  2A15 A;  4KVH A;  3JUO A;  3EHC A;  3EJV A;  3JUM A;  2YFL B;  3MHE A;  2XSH B;  6STD A;  3B7C A;  4H3U A;  1GY6 A;  4HKV B;  5D82 A;  1BUQ A;  2R4I A;  4J8T A;  1O7P B;  1OHO A;  2GEY A;  4HVN A;  2HMN B;  2XR8 B;  5IG5 A;  3K0Z A;  4HM1 B;  1E97 A;  1DMN A;  3KSP A;  4K1U A;  4WWU C;  4XDW A;  2STD A;  1ZX2 A;  1GYB A;  1OGZ A;  4XBT A;  3LYG A;  3M8C A;  1JKG B;  4WYK A;  5KP4 A;  3DM8 A;  3STD A;  5D83 A;  5G2G A;  2BMO B;  5FW5 A;  2GXF A;  1W02 A;  3NM2 A;  3F8H A;  2B24 B;  4RZM A;  2GBW B;  4OUQ A;  3F14 A;  1U5O A;  5KP1 A;  2IMJ A;  4XBX A;  4R1K A;  3RGA A;  2K54 A;  1S5A A;  3F9S A;  4L7K A;  2HMK B;  1DMQ A;  2Z76 A;  1OH0 A;  3OV4 A;  3OWY A;  3WMD A;  1IDP A;  1ULI B;  2CKF B;  5CK6 A;  5DRE A;  2GEX A;  3DMC A;  4LGQ A;  3EC9 A;  2Z77 A;  3FLJ A;  5IF6 A;  1OF5 B;  1HKX A;  4FCJ A;  1OHP A;  4HM4 B;  1W6Y A;  1WQL B;  5HGR A;  1E3R A;  3B4P A;  5AIG A;  2BMQ B;  2B1X B;  1Q42 A;  3BB9 A;  3F8X A;  3LZA A;  1O7M B;  3NV0 A;  3HZP A;  4HM0 B;  2QGU A;  1Z1S A;  3EBY A;  4HJL B;  4XBY A;  3D9R A;  5IEP A;  1JN5 B;  3CNM A;  5AIF A;  3MG3 A;  3MYT A;  2UX0 A;  4K1V A;  3F40 A;  5JPP A;  2PZV A;  5KP3 A;  5AIH A;  3ECF A;  1SJW A;  2RGQ A;  2HML B;  3GZB A;  3B4O A;  1GS3 A;  3GZX B;  1EG9 B;  4HM7 B;  4HZ9 B;  5IER A;  1NU3 A;  4HM2 B;  3EN8 A;  1QMA A;  4CDL A;  3SOY A;  3FZW A;  4R9K A;  3GRD A;  3OX9 A;  5JPU A;  4HM3 B;  1ASK A;  3JUQ A;  5IG4 A;  3K7C A;  5AEW B;  3F7S A;  3EX9 A;  3S5C A;  3ER7 A;  1GY7 A;  5AII A;  3FGY A;  1TP6 A;  5IEO A;  2Z7A A;  2CHC A;  1OPY A;  3FH1 A; 
#chains in the Genus database with same CATH topology
 4BTY A;  3CPW 2;  1O7H B;  2RCD A;  1KWI A;  1F8N A;  1I70 A;  4LYL B;  3SLU A;  4LZI A;  3VSY A;  4HM6 B;  3KKG A;  1MWT A;  3CPO A;  4FMA A;  1Q82 4;  3Q2P A;  2ZL8 A;  1UCK A;  1K8A 4;  2FXT A;  4J9A A;  3AHS A;  1O7G B;  1YJN 3;  4EV2 A;  1J2B A;  4QWT A;  4WHA A;  1DVD A;  3A76 A;  4N6T A;  1BU4 A;  2MC8 A;  2GU3 A;  2OTJ 3;  2AAD A;  3I56 3;  2K0M A;  3KE7 A;  3H51 A;  3DGN A;  1EQK A;  3CMA 3;  3O8Y A;  1IVW A;  4OVM A;  1YIT 3;  5M18 A;  2F56 A;  5G1K A;  1YI2 3;  2CWV A;  4HM5 B;  3WOE B;  4O8S A;  1N5P A;  2CFD A;  1RTU A;  1MWS A;  3JUN A;  4XM4 A;  1BUJ A;  1Q9E A;  5I97 A;  2P0X A;  5CLK A;  1STD A;  3FKA A;  1LNH A;  1NWW A;  4L8O A;  4MJD A;  3CC4 3;  3CNX A;  3T8N A;  2YFI B;  3OXA A;  1B21 A;  2OCT A;  1A2K A;  3LXU X;  3Q90 A;  5CF2 A;  1Q86 4;  3DGM A;  1RSN A;  2OOV C;  3HOH A;  3PCR A;  3X42 A;  1QVF 2;  1I2F A;  4HM8 B;  1ISK A;  1BRG A;  2KF6 A;  3DGL A;  5EVH A;  2JQ5 A;  4WYK B;  5ELU A;  2CG1 A;  3EF8 A;  3FF2 A;  3Q1C A;  2QIY A;  3TDG A;  2C4B A;  2LYX A;  1I2G A;  1VZZ A;  3ZFZ A;  3DXO A;  3BNB A;  4R9L A;  3J7Y d;  1DE3 A;  4KFE A;  1JKG A;  5AYR B;  3G8Z A;  2QEX 3;  2GU1 A;  4HBR A;  1RNB A;  5STD A;  5IEN A;  1I3I A;  2W56 A;  3HK4 A;  3NXJ A;  1CQS A;  1PU4 A;  3LT8 A;  3PCS A;  2E2T A;  3FF0 A;  3NBR A;  4X2O A;  2F86 B;  4FCZ A;  1N8Q A;  1AVK A;  1RRL A;  1QJG A;  4FMB A;  3RDE A;  2W9P A;  1Q7H A;  1GY5 A;  1I2E A;  3G71 3;  1Q40 A;  2Y74 A;  4EW5 A;  4GB5 A;  1FGQ A;  3KII A;  3CCU 3;  1VQ7 3;  4FR9 A;  3PZW A;  5M19 A;  1AR0 A;  3WDG B;  1MGW A;  3OWU A;  1T3B A;  3UNL A;  4BTW A;  3HI7 A;  1WNH A;  1EKM A;  5A0O B;  3NQZ A;  3WR2 A;  1W00 A;  2BT3 A;  2ZHX B;  2INX A;  1OUN A;  3MKI A;  5AI1 A;  5HOH A;  1AV4 A;  2Z6B A;  5M1A A;  1KSI A;  3DUK A;  5TGN A;  1GD3 A;  1LOW A;  2XGL A;  4IIA A;  3G0K A;  1DMM A;  3G16 A;  5AYS C;  2QA4 3;  2H0G A;  1BVI A;  5D81 A;  1YJW 3;  2WO0 A;  5EQL A;  2F99 A;  3B8L A;  3SED A;  3FCS B;  1W7C A;  4BL3 A;  4HAA A;  1FUW A;  3NUV A;  2GBX B;  3IPT A;  1CEW I;  2RBI A;  3Q3F A;  1RGL A;  4KZ1 A;  2HOH A;  3HX8 A;  3I0Y A;  4MMX B;  3X3Y A;  1RCK A;  4FCM A;  1W2B 2;  1W01 A;  1JNQ A;  5DRV A;  1DYU A;  3K5T A;  3AHW A;  3N54 B;  4I4K A;  4O3V A;  3SOA A;  1TU5 A;  1RGK A;  3LOY A;  1I8V A;  3CME 3;  1U8C B;  7STD A;  5BXQ A;  3RGR A;  2J8X B;  2KF4 A;  3CCM 3;  3EE1 A;  1MWR A;  1L5G B;  1OF5 A;  1LNI A;  1MNL A;  2IA7 A;  3IJE B;  3BLZ A;  5GSP A;  1JB2 A;  3U1W A;  1FUT A;  3GZY B;  1K41 A;  2F5W A;  2ML6 A;  2CC3 A;  3MG1 A;  1RKY A;  3DY5 A;  4IPB A;  5BU4 A;  2BNG A;  1KQS 2;  3JUP A;  4U13 A;  1BSB A;  3SYU A;  4O02 B;  1VQP 3;  4XDV A;  4N6U A;  1KD1 4;  1W2Z A;  1B27 A;  1GMR A;  2BIR A;  2I9W A;  3NV0 B;  3GZR A;  2R41 A;  3S67 A;  1RN4 A;  4HZB B;  1UUW B;  1OGX A;  2XFS A;  3N9H A;  1JRQ A;  4LSO A;  2RFR A;  2HMO B;  3ZG0 A;  2Y73 A;  3IMA B;  1RGF A;  2KRT A;  3BU4 A;  3MPH A;  4ILF A;  2CG0 A;  1RMS A;  2IUK A;  3MG2 A;  1NB5 I;  1CH0 A;  4KFD A;  7GSP A;  3UJM A;  1PY3 A;  3BIR A;  6RNT A;  1QAF A;  3E99 A;  4GSP A;  1BRI A;  3T0U A;  3X3Z A;  4FMC A;  1JB5 A;  2HMJ B;  1VQ9 3;  5IW9 A;  3AMO B;  3MSO A;  3UL6 A;  1GSP A;  5CXO A;  4Q53 A;  2CFL A;  5CF1 A;  1Q40 B;  2IYJ A;  1JN5 A;  1RHL A;  1TRQ A;  3N8B A;  1BAO A;  1AQZ A;  2P38 A;  2W2C A;  3CCR 3;  4MMY B;  2H0I A;  5LC7 A;  3KN4 A;  1M90 4;  2W9Q A;  4GL6 A;  5AEU B;  4L8P A;  2XH9 A;  2RNT A;  3AGN A;  4N6N B;  4WP5 A;  1M1K 4;  1VQN 3;  1A90 A;  1YGW A;  3UB1 A;  1O7W B;  1UUG B;  2LQV A;  1ULJ B;  3KCH A;  1US1 A;  3K63 A;  1TFK A;  2KCD A;  2ZA4 A;  5IG3 A;  1HYF A;  3GWR A;  1UCL A;  2XRX B;  1JZO A;  3PYJ A;  3CC2 3;  3H3H A;  4J5G A;  1WMO A;  2CFW A;  2YFJ B;  1SII A;  1C54 A;  3EN1 B;  2ZDJ A;  3CD6 3;  1BNI A;  4XB5 A;  1BRK A;  1IQX A;  3CCE 3;  4X2H A;  3AGO A;  1IV7 A;  3DZL A;  3ROB A;  3LTD A;  8CHO A;  2BMR B;  2M7O A;  1MGR A;  2IY2 A;  5IG0 A;  5LC6 A;  1NNV A;  1UUV B;  1Q7Y 4;  1D6Z A;  2KF3 A;  2XFT A;  1ZO2 A;  3KZT A;  4I5Q A;  1RCL A;  2C11 A;  1O7N B;  3LTC A;  3OWS A;  2GSP A;  5FGO A;  4N3V A;  3FSD A;  4PEJ A;  2HMM B;  2P0M A;  1TUH A;  4STD A;  2WGO A;  2OWP A;  4O2H A;  2KF5 A;  3VGN A;  1NDO B;  3F7X A;  1BNG A;  1CYV A;  2JDI H;  2P09 A;  4N6M A;  1N9J A;  3SVA A;  3U97 A;  2D42 A;  3CCQ 3;  1KC8 4;  3X40 A;  2OTL 3;  2XSO B;  1RNT A;  3CU3 A;  4LMI A;  4K61 A;  7RNT A;  1AY7 A;  1X1X A;  4LEH A;  3CC7 3;  1D6U A;  2W03 A;  1JBS A;  3EQQ B;  3T8U A;  1K9M 4;  4BTX A;  1UI7 A;  2F98 A;  3A5E A;  1E3V A;  3NHX A;  4ORL A;  1IVX A;  3BND A;  1JB4 A;  1DVC A;  1OHS A;  1EA2 A;  3D5G A;  1GD4 A;  3CCV 3;  5BVB A;  1TIJ A;  1LRA A;  1C7H A;  1I3F A;  2CFG A;  1OCV A;  3EBT A;  2A15 A;  1BIR A;  4KVH A;  3JUO A;  3D4A A;  3EHC A;  3EJV A;  1ZGX A;  1A2P A;  3JUM A;  1I0X A;  2YFL B;  1G96 A;  3K9M C;  3NBJ A;  1TFO A;  1RJO A;  2P05 A;  3MHE A;  1JBT A;  1BRN L;  1FGT A;  2XSH B;  6STD A;  1M1X B;  1BRH A;  3B7C A;  3V98 A;  3ZG5 A;  2OQE A;  4H3U A;  1R4C A;  1N5H A;  5G1L A;  1GY6 A;  2CX0 A;  4HKV B;  3QRD A;  1IT7 A;  3WA3 A;  5D82 A;  1B2Z A;  1IT8 A;  2CX1 A;  4TX4 A;  3GAX A;  3CXC 2;  1BUQ A;  2R4I A;  4J8T A;  4CPK A;  1O7P B;  1OHO A;  2WOH A;  3BNC A;  2GEY A;  1D6Y A;  1FGM A;  3URP A;  4HVN A;  3CCJ 3;  1YIJ 3;  2HMN B;  1LOY A;  2CWU A;  4KT3 B;  2XR8 B;  1QAK A;  2UUG C;  5IG5 A;  3K0Z A;  1VQ8 3;  1EUI C;  1RLS A;  4HM1 B;  2BO9 B;  3V92 A;  1E97 A;  4JF8 A;  1I0V A;  1G02 A;  3S27 A;  3VF1 A;  3UL5 A;  3FG1 A;  1DMN A;  3KSP A;  4K1U A;  4WWU C;  4XDW A;  2WGQ A;  3KSE D;  4JRF A;  1YNV X;  1R4Y A;  2BHM A;  1RGA A;  5BIR A;  2STD A;  1ZX2 A;  3D79 A;  1IV9 A;  1HU9 A;  1GYB A;  1QVG 2;  1IU7 A;  1ROA A;  3FG4 A;  1OGZ A;  1B2S A;  4AKZ A;  2L1S A;  1T5Y A;  3LH4 A;  4XBT A;  1MOL A;  1B2M A;  4NPB A;  3D3L A;  3LYG A;  3M8C A;  3WOD G;  1CYU A;  1JKG B;  4WYK A;  9RNT A;  5KP4 A;  1BNJ A;  4K90 B;  4MMZ B;  3DGO A;  3DM8 A;  3STD A;  5D83 A;  2OOV A;  1GOV A;  5G2G A;  3RNT A;  4KFF A;  2BMO B;  3HII A;  2GXF A;  1LXE A;  1BGS A;  1W02 A;  2W56 B;  3NM2 A;  5FW5 A;  3F8H A;  3WHO A;  2B24 B;  2V1L A;  4RZM A;  1UCJ A;  3HIG A;  1BSE A;  2GBW B;  1YHQ 3;  2XF3 A;  4OUQ A;  3S28 A;  5RNT A;  3F14 A;  2IUJ A;  1WMN A;  2SBL A;  1SPU A;  3BNE A;  4DKI A;  1U5O A;  3MWZ A;  1JV2 B;  1V74 A;  2F5M A;  1A2V A;  1PFP A;  5KP1 A;  3NM7 A;  2F4Y A;  2OQE C;  2IMJ A;  3NX0 A;  1NB3 I;  2CW9 A;  4XBX A;  1SAR A;  3CCS 3;  4R1K A;  3RGA A;  2K54 A;  2FGT A;  1Y4K A;  1VQM 3;  1AVL A;  1S5A A;  4CCV A;  3F9S A;  4L7K A;  1X1U A;  2HMK B;  1DMQ A;  2Z76 A;  1BOX A;  1OH0 A;  3S29 A;  2ML5 A;  1BNS A;  3OV4 A;  1VQO 3;  1S72 3;  1UGI A;  1TJD A;  3OWY A;  2L4V A;  4N6O B;  3WMD A;  4RNT A;  4EYC A;  3WOF B;  1B2X A;  1IDP A;  1ULI B;  1JBR A;  2CKF B;  4J5K A;  1QAL A;  4EXR A;  5CK6 A;  5DRE A;  4AEQ A;  2GEX A;  3DMC A;  1YVB I;  1X1W A;  4LGQ A;  5ELJ A;  2E2V A;  3EC9 A;  1RGG A;  4N6L A;  1ZS7 A;  1UI8 A;  1OAC A;  1BNF A;  2Z77 A;  1V58 A;  3FLJ A;  4GHO A;  5IF6 A;  3G6E 3;  1YJ9 3;  1M9G A;  1HKX A;  1OF5 B;  1BRS A;  1TTO A;  1VQ5 3;  1GMP A;  1RGE A;  4FCJ A;  1W6C A;  1OHP A;  2W04 A;  4HM4 B;  4BIR A;  1W6Y A;  1GOY A;  2PNC A;  3WA2 X;  1BRJ A;  2O3O A;  1WQL B;  1BNR A;  2RSX A;  3OW2 2;  1LVN A;  1TRP A;  2CH9 A;  5HGR A;  3JVC A;  1X1Y A;  3G4S 3;  2CWT A;  1W4N A;  1E3R A;  3B4P A;  1STF I;  5AIG A;  1W5Z A;  2BMQ B;  3V99 A;  1FGO A;  1ROV A;  2B1X B;  1Q42 A;  1RGH A;  1MWU A;  1YVS A;  2C10 A;  2K3D A;  3BB9 A;  3F8X A;  3LZA A;  1O7M B;  1IVU A;  4NRE A;  3NV0 A;  3HZP A;  2O9U X;  2YX9 A;  3L0R A;  2AAE A;  1GOU A;  4H61 A;  4R4K A;  4HM0 B;  2XGN A;  2QGU A;  1Z1S A;  3EBY A;  1T2H A;  4RNY A;  1VQ4 3;  4HJL B;  3DH2 A;  1EEJ A;  3FG3 A;  6GSP A;  4XBY A;  1WMP A;  1K28 A;  1SIH A;  3KFQ C;  3D9R A;  1WTH A;  4EBG A;  1BSD A;  5IEP A;  3I55 3;  1JN5 B;  3CNM A;  5AIF A;  3SX1 A;  2W6J H;  1BSA A;  4WFO A;  3MG3 A;  1JJ2 2;  3AMO A;  1V57 A;  3MYT A;  4MEI A;  4NHF A;  2UX0 A;  1UCI A;  1FUS A;  1BNE A;  3PS8 A;  4BL2 A;  1Q81 4;  4K1V A;  3NBB A;  1B2U A;  1LQG C;  2FNQ A;  2SAR A;  3F40 A;  5JPP A;  2PZV A;  5KP3 A;  1N9E A;  3PGB A;  4IT7 A;  3ECF A;  4R80 A;  5AIH A;  1SJW A;  4ZM8 A;  1IK3 A;  2RGQ A;  1VQQ A;  2Q07 A;  3PXM A;  2HML B;  1GMQ A;  3GZB A;  1N8R 4;  1A67 A;  1IQ8 A;  2CK3 H;  3B4O A;  1GS3 A;  1BSC A;  1LOX A;  4G1M B;  4AKY A;  2E2U A;  3GZX B;  4N6V 0;  1EG9 B;  4FMD A;  4HM7 B;  1YGE A;  3GSP A;  4HZ9 B;  2CFK A;  1NO3 A;  3LTB A;  5IER A;  3NQY A;  8RNT A;  1VQL 3;  1IYY A;  1G0T A;  1NU3 A;  1B3S A;  1IQY A;  1RN7 A;  5JBS A;  1LQM B;  2WOF A;  4HM2 B;  5EEO A;  3EN8 A;  1QMA A;  4CDL A;  3ALA A;  3SXX A;  4RBN A;  2MF7 A;  3SOY A;  4EV5 A;  1FYS A;  3FZW A;  1BAN A;  1RGC A;  1RDS A;  4R9K A;  1UW1 A;  1DET A;  3GRD A;  1RRH A;  3OX9 A;  5JPU A;  4EC6 A;  1RN1 A;  4HM3 B;  1UGH I;  1FZU A;  1FGR A;  1K73 4;  1W6G A;  1UDI I;  4HOH A;  1ASK A;  1T2I A;  2XEP A;  3JUQ A;  4HYZ A;  4RNZ A;  4CJN A;  2H0H A;  1VQ6 3;  4OK0 A;  5IG4 A;  3X41 A;  3QK9 A;  3LTA A;  2CIU A;  2W0Q A;  2D1W A;  2UGI A;  3EB8 A;  4BU4 A;  3K7C A;  1NJI 4;  5AEW B;  3F7S A;  3EX9 A;  3S5C A;  2KXG A;  1FW7 A;  1IVV A;  3ER7 A;  1GY7 A;  5AII A;  1PYL A;  2KAA A;  3FGY A;  1VQK 3;  3X3X A;  1TP6 A;  1SQW A;  3LML A;  2BU4 A;  3D5I A;  1HZ1 A;  3CCL 3;  3LT9 A;  1FA3 A;  1LOV A;  1JZD A;  5IEO A;  2Z7A A;  1B20 A;  2CHC A;  3DGY A;  1OPY A;  3FH1 A; 
#chains in the Genus database with same CATH homology
 4BTY A;  3CPW 2;  1O7H B;  2RCD A;  1KWI A;  1F8N A;  3VSY A;  3SLU A;  4LZI A;  4HM6 B;  3KKG A;  4FMA A;  3CPO A;  1Q82 4;  3Q2P A;  2ZL8 A;  1K8A 4;  2FXT A;  4J9A A;  1O7G B;  1YJN 3;  4EV2 A;  1J2B A;  4QWT A;  4WHA A;  1DVD A;  3A76 A;  4N6T A;  2MC8 A;  2GU3 A;  2OTJ 3;  3I56 3;  2K0M A;  3KE7 A;  3H51 A;  3DGN A;  1EQK A;  3CMA 3;  3O8Y A;  1IVW A;  4OVM A;  1YIT 3;  1YI2 3;  2CWV A;  4HM5 B;  3WOE B;  4O8S A;  1N5P A;  2CFD A;  3JUN A;  4XM4 A;  5I97 A;  2P0X A;  5CLK A;  1STD A;  3FKA A;  1LNH A;  1NWW A;  4L8O A;  4MJD A;  3CC4 3;  3CNX A;  3T8N A;  2YFI B;  3OXA A;  2OCT A;  1A2K A;  3LXU X;  3Q90 A;  5CF2 A;  1Q86 4;  3DGM A;  2OOV C;  3X42 A;  3PCR A;  1QVF 2;  4HM8 B;  1ISK A;  3DGL A;  5EVH A;  2JQ5 A;  4WYK B;  5ELU A;  2CG1 A;  3EF8 A;  3FF2 A;  3Q1C A;  2QIY A;  3TDG A;  2LYX A;  1VZZ A;  3DXO A;  3BNB A;  4R9L A;  3J7Y d;  4KFE A;  1JKG A;  5AYR B;  3G8Z A;  2QEX 3;  2GU1 A;  4HBR A;  5STD A;  5IEN A;  3HK4 A;  2W56 A;  3NXJ A;  1CQS A;  1PU4 A;  3LT8 A;  3PCS A;  2E2T A;  3FF0 A;  3NBR A;  4X2O A;  2F86 B;  4FCZ A;  1N8Q A;  1AVK A;  1RRL A;  1QJG A;  4FMB A;  3RDE A;  2W9P A;  1GY5 A;  3G71 3;  1Q40 A;  2Y74 A;  4GB5 A;  1FGQ A;  3KII A;  3CCU 3;  1VQ7 3;  4FR9 A;  3PZW A;  1AR0 A;  3WDG B;  3OWU A;  3UNL A;  4BTW A;  3HI7 A;  1WNH A;  1EKM A;  5A0O B;  3NQZ A;  1W00 A;  2BT3 A;  2INX A;  1OUN A;  3MKI A;  5AI1 A;  1AV4 A;  2Z6B A;  1KSI A;  3DUK A;  5TGN A;  1GD3 A;  4IIA A;  2XGL A;  2QA4 3;  3G0K A;  1DMM A;  3G16 A;  5AYS C;  5D81 A;  1YJW 3;  2WO0 A;  5EQL A;  2F99 A;  3B8L A;  3SED A;  3FCS B;  1W7C A;  1FUW A;  3NUV A;  2GBX B;  3IPT A;  1CEW I;  4KZ1 A;  4MMX B;  3HX8 A;  3I0Y A;  3X3Y A;  4FCM A;  1W2B 2;  1W01 A;  1JNQ A;  5DRV A;  1DYU A;  3K5T A;  3N54 B;  4I4K A;  4O3V A;  3SOA A;  1TU5 A;  3LOY A;  3CME 3;  1U8C B;  7STD A;  5BXQ A;  3RGR A;  3CCM 3;  3EE1 A;  1L5G B;  1OF5 A;  1MNL A;  2IA7 A;  3IJE B;  3BLZ A;  1JB2 A;  3U1W A;  3GZY B;  1K41 A;  2ML6 A;  2CC3 A;  3MG1 A;  1RKY A;  3DY5 A;  4IPB A;  1KQS 2;  2BNG A;  3JUP A;  4U13 A;  1VQP 3;  4O02 B;  4XDV A;  4N6U A;  1KD1 4;  1W2Z A;  2I9W A;  3NV0 B;  3S67 A;  3GZR A;  4HZB B;  1UUW B;  1OGX A;  2XFS A;  3N9H A;  1JRQ A;  4LSO A;  2RFR A;  2HMO B;  2Y73 A;  3IMA B;  2KRT A;  3MPH A;  2CG0 A;  2IUK A;  3MG2 A;  1NB5 I;  4KFD A;  3UJM A;  1QAF A;  3E99 A;  3T0U A;  3X3Z A;  4FMC A;  1JB5 A;  2HMJ B;  1VQ9 3;  5IW9 A;  3AMO B;  3MSO A;  3UL6 A;  5CXO A;  4Q53 A;  2CFL A;  5CF1 A;  1Q40 B;  1JN5 A;  3N8B A;  2W2C A;  3CCR 3;  2P38 A;  4MMY B;  5LC7 A;  3KN4 A;  1M90 4;  2W9Q A;  4GL6 A;  5AEU B;  4L8P A;  2XH9 A;  4N6N B;  4WP5 A;  1M1K 4;  1VQN 3;  1A90 A;  3UB1 A;  1O7W B;  2LQV A;  1ULJ B;  1US1 A;  3K63 A;  1TFK A;  2KCD A;  5IG3 A;  3GWR A;  2XRX B;  3PYJ A;  3CC2 3;  3H3H A;  1WMO A;  2CFW A;  2YFJ B;  1SII A;  3EN1 B;  2ZDJ A;  3CD6 3;  4XB5 A;  3CCE 3;  1IQX A;  4X2H A;  3DZL A;  1IV7 A;  3ROB A;  3LTD A;  8CHO A;  2BMR B;  2M7O A;  5IG0 A;  5LC6 A;  1UUV B;  1Q7Y 4;  1D6Z A;  2XFT A;  1ZO2 A;  3KZT A;  2C11 A;  1O7N B;  3LTC A;  3OWS A;  5FGO A;  4N3V A;  3FSD A;  4PEJ A;  2HMM B;  2P0M A;  1TUH A;  4STD A;  2WGO A;  2OWP A;  4O2H A;  3VGN A;  1NDO B;  3F7X A;  4EC6 A;  1CYV A;  2JDI H;  2P09 A;  4N6M A;  1N9J A;  3SVA A;  3U97 A;  2D42 A;  3CCQ 3;  1KC8 4;  3X40 A;  2OTL 3;  2XSO B;  3CU3 A;  4LMI A;  4K61 A;  4LEH A;  3CC7 3;  1D6U A;  2W03 A;  3EQQ B;  3T8U A;  1K9M 4;  4BTX A;  1UI7 A;  2F98 A;  1E3V A;  3NHX A;  4ORL A;  1IVX A;  3BND A;  1JB4 A;  1DVC A;  1OHS A;  1EA2 A;  1GD4 A;  3CCV 3;  5BVB A;  1TIJ A;  1C7H A;  2CFG A;  1OCV A;  3EBT A;  2A15 A;  4KVH A;  3JUO A;  3EHC A;  3EJV A;  3JUM A;  2YFL B;  1G96 A;  3K9M C;  3NBJ A;  1TFO A;  1RJO A;  2P05 A;  3MHE A;  1FGT A;  2XSH B;  6STD A;  1M1X B;  3B7C A;  3V98 A;  2OQE A;  4H3U A;  1R4C A;  1N5H A;  1GY6 A;  4HKV B;  3QRD A;  1IT7 A;  3WA3 A;  5D82 A;  1IT8 A;  4TX4 A;  1BUQ A;  3GAX A;  3CXC 2;  2R4I A;  4J8T A;  1O7P B;  1OHO A;  2WOH A;  3BNC A;  2GEY A;  1D6Y A;  1FGM A;  4HVN A;  3CCJ 3;  1YIJ 3;  2HMN B;  2CWU A;  2XR8 B;  1QAK A;  5IG5 A;  1VQ8 3;  3K0Z A;  3V92 A;  4HM1 B;  2BO9 B;  1E97 A;  4JF8 A;  3VF1 A;  3S27 A;  3UL5 A;  3FG1 A;  1DMN A;  3KSP A;  4K1U A;  4WWU C;  4XDW A;  2WGQ A;  3KSE D;  4JRF A;  2BHM A;  2STD A;  1ZX2 A;  1IV9 A;  1HU9 A;  1GYB A;  1QVG 2;  1IU7 A;  1ROA A;  3FG4 A;  1OGZ A;  4AKZ A;  1T5Y A;  3LH4 A;  4XBT A;  1MOL A;  3D3L A;  3LYG A;  3M8C A;  3WOD G;  1CYU A;  1JKG B;  4WYK A;  5KP4 A;  4K90 B;  4MMZ B;  3DGO A;  3DM8 A;  3STD A;  5D83 A;  2OOV A;  5G2G A;  4KFF A;  2BMO B;  3HII A;  2GXF A;  1LXE A;  1W02 A;  2W56 B;  5FW5 A;  3NM2 A;  3F8H A;  2B24 B;  2V1L A;  4RZM A;  3HIG A;  2GBW B;  1YHQ 3;  2XF3 A;  4OUQ A;  3S28 A;  3F14 A;  2IUJ A;  1WMN A;  2SBL A;  1SPU A;  3BNE A;  1U5O A;  3MWZ A;  1JV2 B;  1V74 A;  5KP1 A;  1A2V A;  1PFP A;  3NM7 A;  2OQE C;  2IMJ A;  3NX0 A;  1NB3 I;  2CW9 A;  4XBX A;  3CCS 3;  4R1K A;  3RGA A;  2K54 A;  2FGT A;  1Y4K A;  1VQM 3;  1AVL A;  1S5A A;  4CCV A;  3F9S A;  4L7K A;  2HMK B;  1DMQ A;  2Z76 A;  1OH0 A;  3S29 A;  2ML5 A;  3OV4 A;  1VQO 3;  1S72 3;  3OWY A;  2L4V A;  4N6O B;  3WMD A;  4EYC A;  3WOF B;  1IDP A;  1ULI B;  2CKF B;  1QAL A;  4EXR A;  5CK6 A;  5DRE A;  4AEQ A;  2GEX A;  3DMC A;  1YVB I;  5ELJ A;  4LGQ A;  2E2V A;  3EC9 A;  4N6L A;  1UI8 A;  1OAC A;  2Z77 A;  1YJ9 3;  3FLJ A;  5IF6 A;  3G6E 3;  1M9G A;  1HKX A;  1OF5 B;  1VQ5 3;  4FCJ A;  1W6C A;  1OHP A;  2W04 A;  4HM4 B;  1W6Y A;  2PNC A;  3WA2 X;  2O3O A;  1WQL B;  2RSX A;  3OW2 2;  1LVN A;  2CH9 A;  5HGR A;  3JVC A;  3G4S 3;  2CWT A;  1W4N A;  1E3R A;  3B4P A;  1STF I;  5AIG A;  1W5Z A;  2BMQ B;  3V99 A;  1FGO A;  1ROV A;  2B1X B;  1Q42 A;  2C10 A;  3BB9 A;  3F8X A;  3LZA A;  1O7M B;  1IVU A;  4NRE A;  3NV0 A;  3HZP A;  2O9U X;  2YX9 A;  3L0R A;  4H61 A;  4R4K A;  4HM0 B;  2XGN A;  2QGU A;  1Z1S A;  3EBY A;  4RNY A;  1VQ4 3;  4HJL B;  3FG3 A;  4XBY A;  1WMP A;  1K28 A;  1SIH A;  3KFQ C;  3D9R A;  1WTH A;  4EBG A;  5IEP A;  3I55 3;  1JN5 B;  3CNM A;  5AIF A;  3SX1 A;  2W6J H;  4WFO A;  3MG3 A;  1JJ2 2;  3AMO A;  3MYT A;  4MEI A;  4NHF A;  2UX0 A;  3PS8 A;  1Q81 4;  4K1V A;  3NBB A;  2FNQ A;  3F40 A;  5JPP A;  2PZV A;  5KP3 A;  1N9E A;  3PGB A;  4IT7 A;  3ECF A;  4R80 A;  5AIH A;  1SJW A;  4ZM8 A;  1IK3 A;  2RGQ A;  2Q07 A;  3PXM A;  2HML B;  1A67 A;  3GZB A;  1N8R 4;  1IQ8 A;  2CK3 H;  3B4O A;  1GS3 A;  1LOX A;  4G1M B;  4AKY A;  2E2U A;  3GZX B;  4N6V 0;  1EG9 B;  4FMD A;  4HM7 B;  1YGE A;  4HZ9 B;  2CFK A;  1NO3 A;  3LTB A;  5IER A;  3NQY A;  1VQL 3;  1NU3 A;  1IQY A;  5JBS A;  1RN7 A;  2WOF A;  4HM2 B;  5EEO A;  3EN8 A;  1QMA A;  4CDL A;  3ALA A;  3SXX A;  4RBN A;  2MF7 A;  3SOY A;  4EV5 A;  3FZW A;  4R9K A;  1UW1 A;  3GRD A;  1RRH A;  3OX9 A;  5JPU A;  4HM3 B;  1FGR A;  1K73 4;  1W6G A;  1ASK A;  3JUQ A;  2XEP A;  4HYZ A;  4RNZ A;  1VQ6 3;  4OK0 A;  5IG4 A;  3X41 A;  3QK9 A;  3LTA A;  2CIU A;  2W0Q A;  2D1W A;  3EB8 A;  3K7C A;  1NJI 4;  5AEW B;  3F7S A;  3EX9 A;  3S5C A;  2KXG A;  1IVV A;  3ER7 A;  1GY7 A;  5AII A;  3FGY A;  1VQK 3;  3X3X A;  1TP6 A;  1SQW A;  3LML A;  3CCL 3;  3LT9 A;  1FA3 A;  5IEO A;  2Z7A A;  2CHC A;  1OPY A;  3FH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...