4XBTA

Crystal structure of the l74f/m78f/l103v/l114v/i116v/f139v/l147v mutant of leh complexed with (s,s)-cyclohexanediol
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
HHTSKIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFTVFSIDAVETFHIGSSNGLVYTERVDVVRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREVEEAVDLPVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Reshaping an Enzyme Binding Pocket for Enhanced and Inverted Stereoselectivity: Use of Smallest Amino Acid Alphabets in Directed Evolution
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 43
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4xbtA00
3F8HA 3JUMA 4XBTA 2BNGA 3DMCA 2F99A 1EA2A 4L7KA 3GZRA 4J9AA 2R4IA 3FH1A 1W6YA 1JKGA 2GEXA 2GBXB 3FF2A 4HZBB 3S5CA 1OUNA 4HKVB 3EQQB 5CF1A 2I9WA 1DMQA 3GZBA 3CNXA 4I4KA 3OX9A 3JUNA 4STDA 1BUQA 3T8NA 1NDOB 1TP6A 3LYGA 3FF0A 4IIAA 3EBTA 1AR0A 5IG3A 1OCVA 2HMKB 1QMAA 4KVHA 3B4OA 5AEUB 2RCDA 3MG3A 3RGAA 3UNLA 4XBXA 3KZTA 4CDLA 5STDA 1ZO2A 5IF6A 2W2CA 3DXOA 1NU3A 1WQLB 1EG9B 3B4PA 1E3VA 3H51A 4X2HA 3D9RA 4WWUC 1SJWA 1U5OA 3M8CA 3G0KA 1JN5B 3STDA 1TUHA 5IG0A 4R9LA 3NBRA 5IEPA 3FKAA 3Q90A 2INXA 3EN1B 8CHOA 3OWYA 2HMLB 3MHEA 2RFRA 1Q42A 2Z7AA 4J8TA 3ECFA 2OWPA 3F7XA 4WYKA 2YFIB 4XB5A 3T8UA 1IDPA 3F7SA 3GWRA 2PZVA 3NXJA 5D81A 3I0YA 3DM8A 3B8LA 4XBYA 3G8ZA 4K1UA 4R9KA 2GEYA 4HM5B 3ER7A 2BMOB 3NV0B 3B7CA 3JUOA 1JKGB 4XDWA 3SOYA 1A2KA 5AI1A 6STDA 1DMNA 3FLJA 3NUVA 1UUVB 3KKGA 2K54A 4PEJA 3NV0A 1O7WB 1OGXA 3MYTA 3OWSA 3EHCA 5AEWB 4HM0B 5CF2A 1Q40B 3H3HA 3KSPA 4HM2B 4LGQA 1Z1SA 3JUQA 1K41A 4RZMA 5D82A 5CXOA 5DRVA 2Z76A 4HVNA 1W02A 5CLKA 4R1KA 4OUQA 1HKXA 3KE7A 3HX8A 1Q40A 2JQ5A 3EX9A 1VZZA 3GZYB 1E97A 2A15A 3F14A 4HM8B 4Q53A 4LMIA 3EC9A 3A76A 1ULIB 1OHOA 5KP4A 4XM4A 3MG1A 3HK4A 2UX0A 2QGUA 1GS3A 4HJLB 3MG2A 2GXFA 4OVMA 2BMQB 4U13A 2F86B 3FSDA 2HMJB 4WYKB 1STDA 1OHSA 1C7HA 1NWWA 1GY6A 3K0ZA 2QIYA 1OGZA 3EN8A 5IEOA 1O7PB 2IMJA 2Z77A 3RGRA 1O7MB 5JPPA 3VSYA 2F98A 4N3VA 1GYBA 3CU3A 4ORLA 3OWUA 1GY5A 3JUPA 1JB5A 5IERA 1ASKA 3CPOA 5FW5A 3FZWA 1OF5A 4LEHA 1CQSA 1O7GB 1UUWB 5AIFA 2XSOB 2YFLB 5D83A 2XSHB 4GB5A 3VGNA 4HM7B 3EJVA 3SOAA 3CNMA 3OXAA 3DUKA 3MKIA 1GY7A 3NHXA 5G2GA 2GBWB 3G16A 3HZPA 1OHPA 5JPUA 5AIGA 4L8PA 5IENA 1ULJB 4WP5A 1ISKA 1S5AA 4HM6B 3E99A 5CK6A 3UJMA 1W01A 2BMRB 4FCMA 3GZXB 3F40A 3LZAA 1QJGA 5TGNA 4L8OA 3BB9A 2CKFB 5AIIA 3K7CA 2XR8B 2HMOB 7STDA 5IG4A 5HGRA 3F9SA 1O7NB 4HM3B 3ROBA 5IG5A 2CHCA 1E3RA 1W00A 3IPTA 3OV4A 5KP3A 2B1XB 1OPYA 4X2OA 2STDA 1ZX2A 4HM4B 5KP1A 3NM2A 1JB4A 4HZ9B 2XRXB 1OF5B 2RGQA 4K1VA 5BVBA 3GRDA 3F8XA 3EBYA 2B24B 4XDVA 5BXQA 1O7HB 4HM1B 1DMMA 3BLZA 3WMDA 3FGYA 2YFJB 4H3UA 3SEDA 4FCJA 1OH0A 1JB2A 2HMNB 2HMMB 1JN5A 3DZLA 4MJDA 5EVHA 5AIHA 5DREA 3EF8A 3MSOA
chains in the Genus database with same CATH superfamily
2L4VA 3LH4A 3F8HA 3JUMA 1FGOA 1I3IA 4XBTA 2BNGA 1A2PA 1RN1A 3WOFB 4G1MB 2M7OA 2AADA 3GSPA 5M19A 1NB5I 1K734 2O9UX 3DMCA 1DETA 2WOFA 2CW9A 2F99A 2Y74A 4N6MA 2CWVA 4NHFA 4TX4A 1BSEA 1EA2A 1ZGXA 4RBNA 3ZG5A 2MC8A 1QAKA 1DVCA 4L7KA 3GZRA 1VQ83 1RNBA 3NBJA 2RSXA 3WA2X 3KSED 2SARA 4J9AA 1SQWA 2R4IA 4EXRA 3FH1A 1BRIA 1YGEA 4EW5A 6GSPA 3GAXA 1W6YA 1B21A 2O3OA 3NQZA 4BTXA 3NX0A 1YJ93 1PY3A 1JKGA 2GEXA 2GBXB 1FYSA 3FF2A 2WOHA 2CX0A 4FMAA 4HZBB 3X3XA 3WHOA 2OTL3 3S5CA 1G96A 1MWTA 2OQEA 1OUNA 1RTUA 4FMBA 4HKVB 3Q2PA 1MWRA 3EQQB 3ZFZA 1QAFA 4AKYA 4KZ1A 5CF1A 2I9WA 1DMQA 3GZBA 3WDGB 5EEOA 1RGAA 4K61A 1K28A 3CNXA 3N9HA 4I4KA 4EYCA 5ELUA 3OX9A 2BU4A 1FUTA 3JUNA 1QALA 4STDA 5G1KA 3KIIA 2LQVA 3WA3A 1AV4A 1MWUA 3WR2A 4I5QA 1LOWA 1W2B2 1BUQA 2H0GA 3S29A 1NDOB 1TP6A 3T8NA 3LYGA 3NBBA 3FF0A 4IIAA 3EBTA 1AR0A 5IG3A 5M1AA 1OCVA 2HMKB 1STFI 3AHSA 1JNQA 1Q7HA 1YNVX 1QMAA 1TFKA 2XGLA 4LYLB 4N6V0 1GOVA 4ILFA 2W9QA 3VF1A 1LNHA 4KVHA 4WFOA 3B4OA 5AEUB 1CYUA 4N6TA 2RCDA 3S67A 1I0VA 1RGEA 3T0UA 1KD14 3BNCA 1RLSA 1RSNA 3MG3A 4J5GA 1IVUA 3N8BA 3RGAA 2YX9A 4OK0A 1MNLA 3UNLA 1TTOA 1SPUA 3NQYA 2CWUA 4XBXA 2E2TA 1BOXA 1ZS7A 4CPKA 3CCV3 3KZTA 4CDLA 2CC3A 4KFEA 5STDA 3AHWA 1IV7A 1IU7A 1ZO2A 5AYRB 5IF6A 3X3ZA 1U8CB 2W2CA 3DXOA 1NU3A 1BNFA 1W6CA 1WQLB 2CIUA 2P38A 3PCSA 5ELJA 3TDGA 1FGMA 3MSOA 1EG9B 3CCL3 3BIRA 3B4PA 2CFLA 1E3VA 3H51A 4X2HA 3CC43 2OQEC 3UB1A 3D9RA 4WWUC 2L1SA 1SJWA 3EE1A 2D42A 1EUIC 1U5OA 3M8CA 3G0KA 1JN5B 3STDA 1UI8A 1TUHA 5IG0A 1UDII 3NBRA 4R9LA 5IEPA 3FKAA 3Q90A 2INXA 3EN1B 3FCSB 3IMAB 3SLUA 5I97A 1KQS2 8CHOA 3J7Yd 3CCM3 3X42A 4NPBA 3OWYA 1BRGA 1FGRA 2HMLB 1CYVA 1W6GA 2MF7A 1I8VA 3MHEA 3LTAA 1YHQ3 3CC23 2AAEA 4EC6A 2RFRA 1TRPA 2KF6A 4RNTA 1Q42A 2XFTA 2FGTA 4J5KA 2V1LA 2Z7AA 4J8TA 3ECFA 2WO0A 2OWPA 3F7XA 3CMA3 4BL3A 4WYKA 1TFOA 1UI7A 1W2ZA 1S723 2YFIB 1UGIA 1M1K4 7RNTA 4XB5A 1BRSA 3ALAA 1JZOA 1UUGB 3T8UA 1IDPA 3F7SA 1SIHA 1VQ93 3GWRA 1GSPA 2PZVA 2OOVC 3U1WA 2C10A 2GU3A 3K63A 3NXJA 5G1LA 2P05A 3G713 2E2VA 3I0YA 5D81A 3DM8A 1JJ22 3B8LA 4XBYA 3G8ZA 4K1UA 4R9KA 1KC84 1DYUA 1RMSA 1FW7A 2GEYA 1BANA 3ER7A 2W04A 4HM5B 2BMOB 2K0MA 2C4BA 1N9EA 3B7CA 2KAAA 3JUOA 3NV0B 1JKGB 2UGIA 1M904 4MEIA 2Z6BA 3IJEB 3X3YA 1TU5A 3LTDA 4XDWA 4O2HA 2KF4A 3SOYA 1V57A 1A2KA 5AI1A 1SIIA 1PU4A 3WOEB 6STDA 1DMNA 3FLJA 1RGGA 3D79A 3DY5A 1B2ZA 1IQXA 3NUVA 1LQGC 4KFDA 1VQN3 1UUVB 4KFFA 3KKGA 1VQ53 4HYZA 1JBRA 1I0XA 2K54A 4PEJA 1B3SA 3PYJA 1FZUA 3SVAA 1BNRA 3NV0A 2W56A 1Q824 1O7WB 2RBIA 1FA3A 1I3FA 2XFSA 1OGXA 3CCJ3 1MGRA 2J8XB 3MYTA 1I2EA 3OWSA 3EHCA 5AEWB 4BU4A 3S27A 4HM0B 5CF2A 4ZM8A 1Q40B 3H3HA 3KSPA 1IK3A 3CXC2 1B2MA 4HM2B 1RCKA 4LGQA 3RDEA 1Z1SA 1BSDA 3FG4A 1MGWA 3JUQA 1BSCA 1K41A 1RGHA 5RNTA 3LMLA 1IVWA 1I70A 4RZMA 5D82A 3G4S3 3BU4A 3PGBA 2ZL8A 1QVF2 5CXOA 3K5TA 1BSBA 3LOYA 7GSPA 1IT8A 2Z76A 5DRVA 4HVNA 1W02A 2C11A 1T2IA 4R1KA 5CLKA 1IQ8A 4N6NB 4OUQA 1HKXA 3KE7A 1LQMB 1JRQA 3HX8A 1Q40A 4EV5A 1IVVA 2JQ5A 1GMPA 1RDSA 1VZZA 3EX9A 4BL2A 3GZYB 4FMCA 1KSIA 2OOVA 1KWIA 1W5ZA 1E97A 1Y4KA 2P09A 1YI23 1BUJA 1N5PA 1VQP3 1FGQA 2A15A 3F14A 2IUKA 3DGMA 4HM8B 4QWTA 1BNEA 1A67A 4Q53A 1WNHA 1TIJA 4GSPA 4LMIA 5JBSA 1D6UA 1N8QA 2W0QA 3A76A 1BNSA 2KCDA 3BNDA 3EC9A 1ULIB 2K3DA 4WHAA 4NREA 1OHOA 1R4CA 1B27A 3KFQC 4XM4A 5BU4A 5KP4A 3MG1A 3URPA 3HK4A 2UX0A 2CX1A 2F5WA 3D3LA 3DGLA 1VQK3 2QGUA 1VQQA 1BRNL 3PCRA 1JBSA 2H0HA 1GS3A 4HJLB 2E2UA 3MG2A 2GXFA 1ROVA 3CPW2 4GL6A 4OVMA 2BMQB 2D1WA 4U13A 4RNYA 1RGLA 4N6OB 1GD4A 1YVBI 2F86B 4R80A 1J2BA 3FSDA 2HMJB 4WYKB 1STDA 3L0RA 5EQLA 1OHSA 3RNTA 1YJW3 1C7HA 1MWSA 1NWWA 1GY6A 2UUGC 1BRJA 3JVCA 5A0OB 3K0ZA 1UCIA 2QIYA 1VQ73 1R4YA 1RHLA 1OGZA 3AGNA 3EN8A 1BNGA 2ML5A 4CCVA 2CFKA 2IMJA 1O7PB 1BU4A 1B2UA 1CH0A 2Z77A 2ML6A 5IEOA 4BIRA 2BHMA 3LTCA 3RGRA 1EKMA 3SX1A 1VQM3 1UCLA 3WODG 1O7MB 3FG1A 2CG1A 1WTHA 5JPPA 1N5HA 3CCS3 3V92A 3MPHA 2F98A 3VSYA 4CJNA 2KF5A 4N3VA 1GYBA 1WMPA 3CU3A 4ORLA 3S28A 1V58A 2OTJ3 1JZDA 1GY5A 2CG0A 3JUPA 3OWUA 2KXGA 2ZHXB 3A5EA 2H0IA 3X40A 3I563 1JB5A 1TRQA 1OACA 4BTYA 2Q07A 3D4AA 3I553 2F56A 1DVDA 5IERA 1ASKA 1M1XB 1VQ63 2R41A 3CPOA 1BNIA 4FMDA 3FZWA 5FW5A 1OF5A 1BRHA 3AMOB 1UCJA 4LEHA 1I2GA 1T5YA 2KRTA 1CQSA 1FGTA 1LNIA 1LOYA 1O7GB 1UUWB 2W56B 3HI7A 2XSOB 2YFLB 4GHOA 1Q814 1F8NA 1HU9A 3D5IA 3HIIA 1LOXA 5D83A 1EEJA 2XSHB 4HAAA 3CME3 1CEWI 2W6JH 3G6E3 4GB5A 3VGNA 2RNTA 1IYYA 1M9GA 4HM7B 1X1YA 3LXUX 5AIFA 3EJVA 2JDIH 3SOAA 3CNMA 2F4YA 3FG3A 3OXAA 5FGOA 1YIT3 3DUKA 3MKIA 1A90A 4RNZA 1GY7A 2IYJA 3NHXA 3UL5A 2PNCA 3V98A 5M18A 3AMOA 5G2GA 2QA43 2P0MA 2GBWB 1IT7A 2LYXA 2SBLA 3G16A 2QEX3 1RGCA 1I2FA 3HZPA 1OHPA 3SYUA 1GMQA 5JPUA 1NJI4 3CC73 5AIGA 1QVG2 1TJDA 3AGOA 9RNTA 2BT3A 4L8PA 3EB8A 3DH2A 4KT3B 2W03A 2XH9A 4EV2A 5IENA 3CCE3 2FXTA 1ULJB 1NO3A 1RCLA 1HZ1A 3HIGA 3CCU3 2FNQA 4O8SA 1D6YA 1BAOA 4WP5A 1NNVA 1ISKA 2GU1A 3LT8A 1S5AA 1US1A 4HM6B 3E99A 1AVLA 1L5GB 1T3BA 1LOVA 2F5MA 2IY2A 1DE3A 1YGWA 5CK6A 1ROAA 3UJMA 2CFDA 1W01A 2BMRB 2XEPA 4FCMA 1T2HA 3GZXB 1IV9A 3F40A 2P0XA 4JRFA 3BNEA 3LZAA 1QJGA 2IUJA 5GSPA 1IQYA 1RGFA 1RGKA 5TGNA 4L8OA 2BIRA 3BB9A 1YJN3 3DGYA 1AVKA 3HOHA 2CKFB 5AIIA 3U97A 3K7CA 2XR8B 5LC7A 1W7CA 3QRDA 1RN7A 1YVSA 1VQ43 1RRHA 1Q864 7STDA 5IW9A 5IG4A 5LC6A 3K9MC 2ZDJA 5HGRA 3F9SA 3D5GA 1K8A4 1WMOA 3NM7A 3ZG0A 1RNTA 3Q1CA 1O7NB 4K90B 4BTWA 3V99A 4O3VA 1GOUA 4AKZA 1GOYA 2BO9B 4FCZA 4HM3B 3ROBA 3QK9A 5HOHA 1SARA 2IA7A 5IG5A 1X1XA 1X1WA 4IPBA 3Q3FA 2CHCA 3PS8A 1E3RA 3BNBA 4LSOA 1Q9EA 1GMRA 5BIRA 2W9PA 3LTBA 4JF8A 1W00A 3IPTA 1V74A 4FR9A 3OV4A 4H61A 5KP3A 1B2SA 1BNJA 6RNTA 1UCKA 1AQZA 1BVIA 2Y73A 3PXMA 2KF3A 3X41A 1K9M4 1RN4A 4O02B 1BIRA 1OPYA 2B1XB 4IT7A 1JBTA 4HBRA 2XGNA 4X2OA 1EQKA 1NB3I 1BRKA 2STDA 1UW1A 1ZX2A 3KCHA 1RJOA 3N54B 1BSAA 3UL6A 1MOLA 4HM4B 2CFGA 5KP1A 2WGOA 3NM2A 1JB4A 1BGSA 1UGHI 1D6ZA 2XRXB 1OF5B 2RGQA 3PZWA 4HZ9B 4DKIA 4K1VA 5BVBA 3DGOA 1VQL3 3GRDA 1JV2B 1X1UA 3F8XA 3EBYA 2B24B 1HYFA 1RKYA 3CCQ3 4XDVA 5BXQA 1C54A 1PYLA 1B2XA 1O7HB 4HM1B 1DMMA 1LVNA 1AY7A 2ZA4A 2XF3A 1A2VA 1G02A 3BLZA 3FGYA 4MMZB 2WGQA 3WMDA 3LT9A 3KN4A 1WMNA 2YFJB 1RRLA 4HOHA 4H3UA 1FUWA 1N8R4 3CD63 5AYSC 3DGNA 4N6LA 2GSPA 3SEDA 4FCJA 2CH9A 3CCR3 3MWZA 3O8YA 2CK3H 2CFWA 1OH0A 1N9JA 4MMYB 2CWTA 1JB2A 2HMNB 2HMMB 1GD3A 1PFPA 1W4NA 4R4KA 2OCTA 1YIJ3 4LZIA 1JN5A 1Q7Y4 8RNTA 4EBGA 1LXEA 3DZLA 3SXXA 3OW22 1B20A 4MJDA 5EVHA 2HOHA 1VQO3 5AIHA 5DREA 4AEQA 1G0TA 4N6UA 4MMXB 1IVXA 3EF8A 1FUSA 1LRAA 2HMOB
chains in the Genus database with same CATH topology
2L4VA 3LH4A 3F8HA 3JUMA 1FGOA 4XBTA 2BNGA 3WOFB 4G1MB 2M7OA 1K734 2O9UX 3DMCA 2WOFA 2CW9A 2F99A 2Y74A 4N6MA 2CWVA 4NHFA 4TX4A 1EA2A 4RBNA 2MC8A 1QAKA 1DVCA 4L7KA 3GZRA 1VQ83 3NBJA 2RSXA 3WA2X 3KSED 4J9AA 1SQWA 2R4IA 4EXRA 3FH1A 1YGEA 3GAXA 1W6YA 2O3OA 3NQZA 4BTXA 3NX0A 1YJ93 1JKGA 2GEXA 2GBXB 3FF2A 2WOHA 4FMAA 4HZBB 3X3XA 2OTL3 3S5CA 1G96A 2OQEA 1OUNA 4FMBA 4HKVB 3Q2PA 3EQQB 1QAFA 4AKYA 4KZ1A 5CF1A 2I9WA 1DMQA 3GZBA 3WDGB 5EEOA 4K61A 1K28A 3CNXA 3N9HA 4I4KA 4EYCA 5ELUA 3OX9A 3JUNA 1QALA 4STDA 3WA3A 3KIIA 2LQVA 1K9M4 1AV4A 1W2B2 1BUQA 3S29A 1NDOB 1TP6A 3T8NA 3LYGA 3NBBA 3FF0A 4IIAA 3EBTA 1AR0A 5IG3A 1OCVA 2HMKB 1STFI 1JNQA 2XGLA 1QMAA 1TFKA 4N6V0 2W9QA 3VF1A 1LNHA 4KVHA 4WFOA 3B4OA 5AEUB 1CYUA 4N6TA 2RCDA 3S67A 3T0UA 1KD14 3BNCA 3MG3A 1IVUA 3N8BA 3RGAA 2YX9A 4OK0A 1MNLA 3UNLA 1SPUA 3NQYA 2CWUA 4XBXA 2E2TA 3CCV3 3KZTA 4CDLA 2CC3A 4KFEA 5STDA 5AYRB 1IV7A 1IU7A 1ZO2A 5IF6A 1NB5I 3X3ZA 1U8CB 2W2CA 3DXOA 1NU3A 1WQLB 1W6CA 2CIUA 2P38A 3PCSA 5ELJA 3TDGA 1FGMA 3MSOA 1EG9B 3B4PA 2CFLA 1E3VA 3H51A 4X2HA 3CC43 2OQEC 3UB1A 3D9RA 4WWUC 1SJWA 3EE1A 2D42A 1U5OA 3M8CA 3G0KA 1JN5B 3STDA 1UI8A 1TUHA 5IG0A 4R9LA 3NBRA 5IEPA 1KQS2 3FKAA 3Q90A 2INXA 3EN1B 3FCSB 3IMAB 3SLUA 5I97A 8CHOA 3J7Yd 3CCM3 3X42A 3OWYA 1FGRA 2HMLB 1CYVA 1W6GA 2MF7A 3MHEA 3LTAA 1YHQ3 3CC23 4EC6A 2RFRA 1Q42A 2XFTA 2FGTA 2V1LA 2Z7AA 4J8TA 3ECFA 2WO0A 2OWPA 3F7XA 3CMA3 4WYKA 1TFOA 1UI7A 1W2ZA 1S723 2YFIB 1M1K4 4XB5A 3ALAA 3T8UA 1IDPA 3F7SA 1SIHA 1VQ93 3GWRA 2PZVA 2OOVC 3U1WA 2C10A 2GU3A 3K63A 3NXJA 2P05A 3G713 2E2VA 3I0YA 5D81A 3DM8A 1JJ22 3B8LA 4XBYA 3G8ZA 4K1UA 4R9KA 1KC84 1DYUA 2GEYA 4HM5B 3ER7A 2W04A 2BMOB 2K0MA 3NV0B 1N9EA 3B7CA 3JUOA 1JKGB 1M904 4MEIA 2Z6BA 3IJEB 3X3YA 1TU5A 3LTDA 4XDWA 4O2HA 3SOYA 1A2KA 5AI1A 1SIIA 1PU4A 3WOEB 6STDA 1DMNA 3FLJA 3DY5A 1IQXA 1VQN3 3NUVA 4KFDA 1UUVB 4KFFA 3KKGA 1VQ53 4HYZA 2K54A 4PEJA 3PYJA 3SVAA 3NV0A 2W56A 1Q824 1O7WB 1FA3A 2XFSA 1OGXA 3CCJ3 3MYTA 3OWSA 3EHCA 5AEWB 3S27A 4HM0B 5CF2A 4ZM8A 1Q40B 3H3HA 3KSPA 1IK3A 3CXC2 4HM2B 4LGQA 3RDEA 1Z1SA 3FG4A 3JUQA 1K41A 3LMLA 1IVWA 4RZMA 5D82A 3G4S3 3PGBA 2ZL8A 1QVF2 5CXOA 3K5TA 3LOYA 1IT8A 2Z76A 5DRVA 4HVNA 1W02A 2C11A 5CLKA 4R1KA 1IQ8A 4N6NB 4OUQA 1HKXA 3KE7A 1JRQA 3HX8A 1Q40A 4EV5A 1IVVA 2JQ5A 3EX9A 1VZZA 3GZYB 4FMCA 1KSIA 2OOVA 1KWIA 1W5ZA 1E97A 1Y4KA 2P09A 1YI23 1N5PA 1VQP3 1FGQA 2A15A 3F14A 2IUKA 3DGMA 4HM8B 4QWTA 1A67A 4Q53A 1WNHA 1TIJA 4LMIA 5JBSA 1D6UA 1N8QA 2W0QA 3A76A 2KCDA 3BNDA 3EC9A 4WHAA 1ULIB 3CCL3 4NREA 1OHOA 1R4CA 3KFQC 4XM4A 5KP4A 3MG1A 3HK4A 2UX0A 3D3LA 3DGLA 1VQK3 2QGUA 3PCRA 1GS3A 4HJLB 2E2UA 3MG2A 2GXFA 1ROVA 3CPW2 4GL6A 4OVMA 2BMQB 2D1WA 4U13A 4RNYA 4N6OB 1GD4A 1YVBI 2F86B 4R80A 1J2BA 3FSDA 2HMJB 4WYKB 1STDA 3L0RA 5EQLA 1OHSA 1YJW3 1C7HA 3JVCA 1NWWA 1GY6A 5A0OB 3K0ZA 2QIYA 1VQ73 1OGZA 3EN8A 2ML5A 4CCVA 2CFKA 2IMJA 1O7PB 2Z77A 5IEOA 2ML6A 2BHMA 3LTCA 3RGRA 1EKMA 3SX1A 1VQM3 3WODG 1O7MB 3FG1A 2CG1A 1WTHA 5JPPA 1N5HA 3CCS3 3V92A 3MPHA 2F98A 3VSYA 4N3VA 1GYBA 1WMPA 3CU3A 4ORLA 3S28A 2OTJ3 2CG0A 1GY5A 3JUPA 3OWUA 2KXGA 3X40A 3I563 1JB5A 4BTYA 1OACA 3I553 2Q07A 1DVDA 5IERA 1ASKA 1M1XB 1VQ63 3CPOA 4FMDA 5FW5A 3FZWA 1OF5A 3AMOB 4LEHA 1T5YA 2KRTA 1CQSA 1FGTA 1O7GB 1UUWB 2W56B 3HI7A 5AIFA 2XSOB 2YFLB 1Q814 1F8NA 1HU9A 3HIIA 1LOXA 5D83A 2XSHB 3CME3 1CEWI 2W6JH 3G6E3 4GB5A 3VGNA 1M9GA 4HM7B 3LXUX 3EJVA 2JDIH 3SOAA 3CNMA 3OXAA 3FG3A 5FGOA 1YIT3 3DUKA 3MKIA 1A90A 4RNZA 1GY7A 3NHXA 3UL5A 2PNCA 3V98A 3AMOA 5G2GA 2QA43 2P0MA 2GBWB 1IT7A 2LYXA 2SBLA 3G16A 2QEX3 3HZPA 1OHPA 5JPUA 1NJI4 3CC73 5AIGA 1QVG2 2BT3A 4L8PA 3EB8A 4EV2A 2W03A 2XH9A 5IENA 3CCE3 2FXTA 1ULJB 1NO3A 3HIGA 3CCU3 2FNQA 4O8SA 1D6YA 4WP5A 1ISKA 2GU1A 3LT8A 1S5AA 1US1A 4HM6B 3E99A 1AVLA 1L5GB 5CK6A 1ROAA 3UJMA 2CFDA 1W01A 2BMRB 2XEPA 4FCMA 3GZXB 1IV9A 3F40A 2P0XA 4JRFA 3BNEA 3LZAA 1QJGA 2IUJA 1IQYA 5TGNA 4L8OA 3BB9A 1YJN3 1AVKA 2CKFB 5AIIA 3U97A 3K7CA 2XR8B 5LC7A 1W7CA 3QRDA 1RN7A 1VQ43 1RRHA 1Q864 7STDA 5IW9A 5IG4A 5LC6A 3K9MC 2ZDJA 5HGRA 3F9SA 1K8A4 1WMOA 3NM7A 3Q1CA 4K90B 1O7NB 4BTWA 3V99A 4O3VA 4AKZA 2BO9B 4FCZA 4HM3B 3ROBA 3QK9A 5IG5A 2IA7A 4IPBA 2CHCA 3PS8A 1E3RA 3BNBA 4LSOA 2W9PA 3LTBA 4JF8A 1W00A 3IPTA 1V74A 4FR9A 3OV4A 4H61A 5KP3A 2Y73A 3PXMA 3X41A 4O02B 1OPYA 2B1XB 4IT7A 4HBRA 2XGNA 4X2OA 1EQKA 1NB3I 2STDA 1UW1A 1ZX2A 3N54B 1RJOA 3UL6A 1MOLA 4HM4B 2CFGA 5KP1A 2WGOA 3NM2A 1JB4A 4HZ9B 1D6ZA 2XRXB 1OF5B 2RGQA 3PZWA 4K1VA 5BVBA 3DGOA 1VQL3 3GRDA 1JV2B 3F8XA 3EBYA 2B24B 1RKYA 3CCQ3 4XDVA 5BXQA 1O7HB 4HM1B 1DMMA 1LVNA 2XF3A 1A2VA 3BLZA 4MMZB 3FGYA 3WMDA 2WGQA 3LT9A 3KN4A 1WMNA 2YFJB 1RRLA 4H3UA 1FUWA 1N8R4 3CD63 5AYSC 3DGNA 4N6LA 3SEDA 4FCJA 2CH9A 3CCR3 3MWZA 3O8YA 2CK3H 2CFWA 1OH0A 1N9JA 4MMYB 2CWTA 1JB2A 2HMNB 2HMMB 1GD3A 1PFPA 1W4NA 4R4KA 2OCTA 1YIJ3 4LZIA 1JN5A 1Q7Y4 4EBGA 1LXEA 3DZLA 3SXXA 3OW22 4MJDA 5EVHA 1VQO3 5AIHA 5DREA 4AEQA 4N6UA 4MMXB 1IVXA 3EF8A 2HMOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8H A;  3JUM A;  4XBT A;  2BNG A;  3DMC A;  2F99 A;  1EA2 A;  4L7K A;  3GZR A;  4J9A A;  2R4I A;  3FH1 A;  1W6Y A;  1JKG A;  2GEX A;  2GBX B;  3FF2 A;  4HZB B;  3S5C A;  1OUN A;  4HKV B;  3EQQ B;  5CF1 A;  2I9W A;  1DMQ A;  3GZB A;  3CNX A;  4I4K A;  3OX9 A;  3JUN A;  4STD A;  1BUQ A;  3T8N A;  1NDO B;  1TP6 A;  3LYG A;  3FF0 A;  4IIA A;  3EBT A;  1AR0 A;  5IG3 A;  1OCV A;  2HMK B;  1QMA A;  4KVH A;  3B4O A;  5AEU B;  2RCD A;  3MG3 A;  3RGA A;  3UNL A;  4XBX A;  3KZT A;  4CDL A;  5STD A;  1ZO2 A;  5IF6 A;  2W2C A;  3DXO A;  1NU3 A;  1WQL B;  1EG9 B;  3B4P A;  1E3V A;  3H51 A;  4X2H A;  3D9R A;  4WWU C;  1SJW A;  1U5O A;  3M8C A;  3G0K A;  1JN5 B;  3STD A;  1TUH A;  5IG0 A;  4R9L A;  3NBR A;  5IEP A;  3FKA A;  3Q90 A;  2INX A;  3EN1 B;  8CHO A;  3OWY A;  2HML B;  3MHE A;  2RFR A;  1Q42 A;  2Z7A A;  4J8T A;  3ECF A;  2OWP A;  3F7X A;  4WYK A;  2YFI B;  4XB5 A;  3T8U A;  1IDP A;  3F7S A;  3GWR A;  2PZV A;  3NXJ A;  5D81 A;  3I0Y A;  3DM8 A;  3B8L A;  4XBY A;  3G8Z A;  4K1U A;  4R9K A;  2GEY A;  4HM5 B;  3ER7 A;  2BMO B;  3NV0 B;  3B7C A;  3JUO A;  1JKG B;  4XDW A;  3SOY A;  1A2K A;  5AI1 A;  6STD A;  1DMN A;  3FLJ A;  3NUV A;  1UUV B;  3KKG A;  2K54 A;  4PEJ A;  3NV0 A;  1O7W B;  1OGX A;  3MYT A;  3OWS A;  3EHC A;  5AEW B;  4HM0 B;  5CF2 A;  1Q40 B;  3H3H A;  3KSP A;  4HM2 B;  4LGQ A;  1Z1S A;  3JUQ A;  1K41 A;  4RZM A;  5D82 A;  5CXO A;  5DRV A;  2Z76 A;  4HVN A;  1W02 A;  5CLK A;  4R1K A;  4OUQ A;  1HKX A;  3KE7 A;  3HX8 A;  1Q40 A;  2JQ5 A;  3EX9 A;  1VZZ A;  3GZY B;  1E97 A;  2A15 A;  3F14 A;  4HM8 B;  4Q53 A;  4LMI A;  3EC9 A;  3A76 A;  1ULI B;  1OHO A;  5KP4 A;  4XM4 A;  3MG1 A;  3HK4 A;  2UX0 A;  2QGU A;  1GS3 A;  4HJL B;  3MG2 A;  2GXF A;  4OVM A;  2BMQ B;  4U13 A;  2F86 B;  3FSD A;  2HMJ B;  4WYK B;  1STD A;  1OHS A;  1C7H A;  1NWW A;  1GY6 A;  3K0Z A;  2QIY A;  1OGZ A;  3EN8 A;  5IEO A;  1O7P B;  2IMJ A;  2Z77 A;  3RGR A;  1O7M B;  5JPP A;  3VSY A;  2F98 A;  4N3V A;  1GYB A;  3CU3 A;  4ORL A;  3OWU A;  1GY5 A;  3JUP A;  1JB5 A;  5IER A;  1ASK A;  3CPO A;  5FW5 A;  3FZW A;  1OF5 A;  4LEH A;  1CQS A;  1O7G B;  1UUW B;  5AIF A;  2XSO B;  2YFL B;  5D83 A;  2XSH B;  4GB5 A;  3VGN A;  4HM7 B;  3EJV A;  3SOA A;  3CNM A;  3OXA A;  3DUK A;  3MKI A;  1GY7 A;  3NHX A;  5G2G A;  2GBW B;  3G16 A;  3HZP A;  1OHP A;  5JPU A;  5AIG A;  4L8P A;  5IEN A;  1ULJ B;  4WP5 A;  1ISK A;  1S5A A;  4HM6 B;  3E99 A;  5CK6 A;  3UJM A;  1W01 A;  2BMR B;  4FCM A;  3GZX B;  3F40 A;  3LZA A;  1QJG A;  5TGN A;  4L8O A;  3BB9 A;  2CKF B;  5AII A;  3K7C A;  2XR8 B;  2HMO B;  7STD A;  5IG4 A;  5HGR A;  3F9S A;  1O7N B;  4HM3 B;  3ROB A;  5IG5 A;  2CHC A;  1E3R A;  1W00 A;  3IPT A;  3OV4 A;  5KP3 A;  2B1X B;  1OPY A;  4X2O A;  2STD A;  1ZX2 A;  4HM4 B;  5KP1 A;  3NM2 A;  1JB4 A;  4HZ9 B;  2XRX B;  1OF5 B;  2RGQ A;  4K1V A;  5BVB A;  3GRD A;  3F8X A;  3EBY A;  2B24 B;  4XDV A;  5BXQ A;  1O7H B;  4HM1 B;  1DMM A;  3BLZ A;  3WMD A;  3FGY A;  2YFJ B;  4H3U A;  3SED A;  4FCJ A;  1OH0 A;  1JB2 A;  2HMN B;  2HMM B;  1JN5 A;  3DZL A;  4MJD A;  5EVH A;  5AIH A;  5DRE A;  3EF8 A;  3MSO A; 
#chains in the Genus database with same CATH topology
 2L4V A;  3LH4 A;  3F8H A;  3JUM A;  1FGO A;  1I3I A;  4XBT A;  2BNG A;  1A2P A;  1RN1 A;  3WOF B;  4G1M B;  2M7O A;  2AAD A;  3GSP A;  5M19 A;  1NB5 I;  1K73 4;  2O9U X;  3DMC A;  1DET A;  2WOF A;  2CW9 A;  2F99 A;  2Y74 A;  4N6M A;  2CWV A;  4NHF A;  4TX4 A;  1BSE A;  1EA2 A;  1ZGX A;  4RBN A;  3ZG5 A;  2MC8 A;  1QAK A;  1DVC A;  4L7K A;  3GZR A;  1VQ8 3;  1RNB A;  3NBJ A;  2RSX A;  3WA2 X;  3KSE D;  2SAR A;  4J9A A;  1SQW A;  2R4I A;  4EXR A;  3FH1 A;  1BRI A;  1YGE A;  4EW5 A;  6GSP A;  3GAX A;  1W6Y A;  1B21 A;  2O3O A;  3NQZ A;  4BTX A;  3NX0 A;  1YJ9 3;  1PY3 A;  1JKG A;  2GEX A;  2GBX B;  1FYS A;  3FF2 A;  2WOH A;  2CX0 A;  4FMA A;  4HZB B;  3X3X A;  3WHO A;  2OTL 3;  3S5C A;  1G96 A;  1MWT A;  2OQE A;  1OUN A;  1RTU A;  4FMB A;  4HKV B;  3Q2P A;  1MWR A;  3EQQ B;  3ZFZ A;  1QAF A;  4AKY A;  4KZ1 A;  5CF1 A;  2I9W A;  1DMQ A;  3GZB A;  3WDG B;  5EEO A;  1RGA A;  4K61 A;  1K28 A;  3CNX A;  3N9H A;  4I4K A;  4EYC A;  5ELU A;  3OX9 A;  2BU4 A;  1FUT A;  3JUN A;  1QAL A;  4STD A;  5G1K A;  3KII A;  2LQV A;  3WA3 A;  1AV4 A;  1MWU A;  3WR2 A;  4I5Q A;  1LOW A;  1W2B 2;  1BUQ A;  2H0G A;  3S29 A;  1NDO B;  1TP6 A;  3T8N A;  3LYG A;  3NBB A;  3FF0 A;  4IIA A;  3EBT A;  1AR0 A;  5IG3 A;  5M1A A;  1OCV A;  2HMK B;  1STF I;  3AHS A;  1JNQ A;  1Q7H A;  1YNV X;  1QMA A;  1TFK A;  2XGL A;  4LYL B;  4N6V 0;  1GOV A;  4ILF A;  2W9Q A;  3VF1 A;  1LNH A;  4KVH A;  4WFO A;  3B4O A;  5AEU B;  1CYU A;  4N6T A;  2RCD A;  3S67 A;  1I0V A;  1RGE A;  3T0U A;  1KD1 4;  3BNC A;  1RLS A;  1RSN A;  3MG3 A;  4J5G A;  1IVU A;  3N8B A;  3RGA A;  2YX9 A;  4OK0 A;  1MNL A;  3UNL A;  1TTO A;  1SPU A;  3NQY A;  2CWU A;  4XBX A;  2E2T A;  1BOX A;  1ZS7 A;  4CPK A;  3CCV 3;  3KZT A;  4CDL A;  2CC3 A;  4KFE A;  5STD A;  3AHW A;  1IV7 A;  1IU7 A;  1ZO2 A;  5AYR B;  5IF6 A;  3X3Z A;  1U8C B;  2W2C A;  3DXO A;  1NU3 A;  1BNF A;  1W6C A;  1WQL B;  2CIU A;  2P38 A;  3PCS A;  5ELJ A;  3TDG A;  1FGM A;  3MSO A;  1EG9 B;  3CCL 3;  3BIR A;  3B4P A;  2CFL A;  1E3V A;  3H51 A;  4X2H A;  3CC4 3;  2OQE C;  3UB1 A;  3D9R A;  4WWU C;  2L1S A;  1SJW A;  3EE1 A;  2D42 A;  1EUI C;  1U5O A;  3M8C A;  3G0K A;  1JN5 B;  3STD A;  1UI8 A;  1TUH A;  5IG0 A;  1UDI I;  3NBR A;  4R9L A;  5IEP A;  3FKA A;  3Q90 A;  2INX A;  3EN1 B;  3FCS B;  3IMA B;  3SLU A;  5I97 A;  1KQS 2;  8CHO A;  3J7Y d;  3CCM 3;  3X42 A;  4NPB A;  3OWY A;  1BRG A;  1FGR A;  2HML B;  1CYV A;  1W6G A;  2MF7 A;  1I8V A;  3MHE A;  3LTA A;  1YHQ 3;  3CC2 3;  2AAE A;  4EC6 A;  2RFR A;  1TRP A;  2KF6 A;  4RNT A;  1Q42 A;  2XFT A;  2FGT A;  4J5K A;  2V1L A;  2Z7A A;  4J8T A;  3ECF A;  2WO0 A;  2OWP A;  3F7X A;  3CMA 3;  4BL3 A;  4WYK A;  1TFO A;  1UI7 A;  1W2Z A;  1S72 3;  2YFI B;  1UGI A;  1M1K 4;  7RNT A;  4XB5 A;  1BRS A;  3ALA A;  1JZO A;  1UUG B;  3T8U A;  1IDP A;  3F7S A;  1SIH A;  1VQ9 3;  3GWR A;  1GSP A;  2PZV A;  2OOV C;  3U1W A;  2C10 A;  2GU3 A;  3K63 A;  3NXJ A;  5G1L A;  2P05 A;  3G71 3;  2E2V A;  3I0Y A;  5D81 A;  3DM8 A;  1JJ2 2;  3B8L A;  4XBY A;  3G8Z A;  4K1U A;  4R9K A;  1KC8 4;  1DYU A;  1RMS A;  1FW7 A;  2GEY A;  1BAN A;  3ER7 A;  2W04 A;  4HM5 B;  2BMO B;  2K0M A;  2C4B A;  1N9E A;  3B7C A;  2KAA A;  3JUO A;  3NV0 B;  1JKG B;  2UGI A;  1M90 4;  4MEI A;  2Z6B A;  3IJE B;  3X3Y A;  1TU5 A;  3LTD A;  4XDW A;  4O2H A;  2KF4 A;  3SOY A;  1V57 A;  1A2K A;  5AI1 A;  1SII A;  1PU4 A;  3WOE B;  6STD A;  1DMN A;  3FLJ A;  1RGG A;  3D79 A;  3DY5 A;  1B2Z A;  1IQX A;  3NUV A;  1LQG C;  4KFD A;  1VQN 3;  1UUV B;  4KFF A;  3KKG A;  1VQ5 3;  4HYZ A;  1JBR A;  1I0X A;  2K54 A;  4PEJ A;  1B3S A;  3PYJ A;  1FZU A;  3SVA A;  1BNR A;  3NV0 A;  2W56 A;  1Q82 4;  1O7W B;  2RBI A;  1FA3 A;  1I3F A;  2XFS A;  1OGX A;  3CCJ 3;  1MGR A;  2J8X B;  3MYT A;  1I2E A;  3OWS A;  3EHC A;  5AEW B;  4BU4 A;  3S27 A;  4HM0 B;  5CF2 A;  4ZM8 A;  1Q40 B;  3H3H A;  3KSP A;  1IK3 A;  3CXC 2;  1B2M A;  4HM2 B;  1RCK A;  4LGQ A;  3RDE A;  1Z1S A;  1BSD A;  3FG4 A;  1MGW A;  3JUQ A;  1BSC A;  1K41 A;  1RGH A;  5RNT A;  3LML A;  1IVW A;  1I70 A;  4RZM A;  5D82 A;  3G4S 3;  3BU4 A;  3PGB A;  2ZL8 A;  1QVF 2;  5CXO A;  3K5T A;  1BSB A;  3LOY A;  7GSP A;  1IT8 A;  2Z76 A;  5DRV A;  4HVN A;  1W02 A;  2C11 A;  1T2I A;  4R1K A;  5CLK A;  1IQ8 A;  4N6N B;  4OUQ A;  1HKX A;  3KE7 A;  1LQM B;  1JRQ A;  3HX8 A;  1Q40 A;  4EV5 A;  1IVV A;  2JQ5 A;  1GMP A;  1RDS A;  1VZZ A;  3EX9 A;  4BL2 A;  3GZY B;  4FMC A;  1KSI A;  2OOV A;  1KWI A;  1W5Z A;  1E97 A;  1Y4K A;  2P09 A;  1YI2 3;  1BUJ A;  1N5P A;  1VQP 3;  1FGQ A;  2A15 A;  3F14 A;  2IUK A;  3DGM A;  4HM8 B;  4QWT A;  1BNE A;  1A67 A;  4Q53 A;  1WNH A;  1TIJ A;  4GSP A;  4LMI A;  5JBS A;  1D6U A;  1N8Q A;  2W0Q A;  3A76 A;  1BNS A;  2KCD A;  3BND A;  3EC9 A;  1ULI B;  2K3D A;  4WHA A;  4NRE A;  1OHO A;  1R4C A;  1B27 A;  3KFQ C;  4XM4 A;  5BU4 A;  5KP4 A;  3MG1 A;  3URP A;  3HK4 A;  2UX0 A;  2CX1 A;  2F5W A;  3D3L A;  3DGL A;  1VQK 3;  2QGU A;  1VQQ A;  1BRN L;  3PCR A;  1JBS A;  2H0H A;  1GS3 A;  4HJL B;  2E2U A;  3MG2 A;  2GXF A;  1ROV A;  3CPW 2;  4GL6 A;  4OVM A;  2BMQ B;  2D1W A;  4U13 A;  4RNY A;  1RGL A;  4N6O B;  1GD4 A;  1YVB I;  2F86 B;  4R80 A;  1J2B A;  3FSD A;  2HMJ B;  4WYK B;  1STD A;  3L0R A;  5EQL A;  1OHS A;  3RNT A;  1YJW 3;  1C7H A;  1MWS A;  1NWW A;  1GY6 A;  2UUG C;  1BRJ A;  3JVC A;  5A0O B;  3K0Z A;  1UCI A;  2QIY A;  1VQ7 3;  1R4Y A;  1RHL A;  1OGZ A;  3AGN A;  3EN8 A;  1BNG A;  2ML5 A;  4CCV A;  2CFK A;  2IMJ A;  1O7P B;  1BU4 A;  1B2U A;  1CH0 A;  2Z77 A;  2ML6 A;  5IEO A;  4BIR A;  2BHM A;  3LTC A;  3RGR A;  1EKM A;  3SX1 A;  1VQM 3;  1UCL A;  3WOD G;  1O7M B;  3FG1 A;  2CG1 A;  1WTH A;  5JPP A;  1N5H A;  3CCS 3;  3V92 A;  3MPH A;  2F98 A;  3VSY A;  4CJN A;  2KF5 A;  4N3V A;  1GYB A;  1WMP A;  3CU3 A;  4ORL A;  3S28 A;  1V58 A;  2OTJ 3;  1JZD A;  1GY5 A;  2CG0 A;  3JUP A;  3OWU A;  2KXG A;  2ZHX B;  3A5E A;  2H0I A;  3X40 A;  3I56 3;  1JB5 A;  1TRQ A;  1OAC A;  4BTY A;  2Q07 A;  3D4A A;  3I55 3;  2F56 A;  1DVD A;  5IER A;  1ASK A;  1M1X B;  1VQ6 3;  2R41 A;  3CPO A;  1BNI A;  4FMD A;  3FZW A;  5FW5 A;  1OF5 A;  1BRH A;  3AMO B;  1UCJ A;  4LEH A;  1I2G A;  1T5Y A;  2KRT A;  1CQS A;  1FGT A;  1LNI A;  1LOY A;  1O7G B;  1UUW B;  2W56 B;  3HI7 A;  2XSO B;  2YFL B;  4GHO A;  1Q81 4;  1F8N A;  1HU9 A;  3D5I A;  3HII A;  1LOX A;  5D83 A;  1EEJ A;  2XSH B;  4HAA A;  3CME 3;  1CEW I;  2W6J H;  3G6E 3;  4GB5 A;  3VGN A;  2RNT A;  1IYY A;  1M9G A;  4HM7 B;  1X1Y A;  3LXU X;  5AIF A;  3EJV A;  2JDI H;  3SOA A;  3CNM A;  2F4Y A;  3FG3 A;  3OXA A;  5FGO A;  1YIT 3;  3DUK A;  3MKI A;  1A90 A;  4RNZ A;  1GY7 A;  2IYJ A;  3NHX A;  3UL5 A;  2PNC A;  3V98 A;  5M18 A;  3AMO A;  5G2G A;  2QA4 3;  2P0M A;  2GBW B;  1IT7 A;  2LYX A;  2SBL A;  3G16 A;  2QEX 3;  1RGC A;  1I2F A;  3HZP A;  1OHP A;  3SYU A;  1GMQ A;  5JPU A;  1NJI 4;  3CC7 3;  5AIG A;  1QVG 2;  1TJD A;  3AGO A;  9RNT A;  2BT3 A;  4L8P A;  3EB8 A;  3DH2 A;  4KT3 B;  2W03 A;  2XH9 A;  4EV2 A;  5IEN A;  3CCE 3;  2FXT A;  1ULJ B;  1NO3 A;  1RCL A;  1HZ1 A;  3HIG A;  3CCU 3;  2FNQ A;  4O8S A;  1D6Y A;  1BAO A;  4WP5 A;  1NNV A;  1ISK A;  2GU1 A;  3LT8 A;  1S5A A;  1US1 A;  4HM6 B;  3E99 A;  1AVL A;  1L5G B;  1T3B A;  1LOV A;  2F5M A;  2IY2 A;  1DE3 A;  1YGW A;  5CK6 A;  1ROA A;  3UJM A;  2CFD A;  1W01 A;  2BMR B;  2XEP A;  4FCM A;  1T2H A;  3GZX B;  1IV9 A;  3F40 A;  2P0X A;  4JRF A;  3BNE A;  3LZA A;  1QJG A;  2IUJ A;  5GSP A;  1IQY A;  1RGF A;  1RGK A;  5TGN A;  4L8O A;  2BIR A;  3BB9 A;  1YJN 3;  3DGY A;  1AVK A;  3HOH A;  2CKF B;  5AII A;  3U97 A;  3K7C A;  2XR8 B;  5LC7 A;  1W7C A;  3QRD A;  1RN7 A;  1YVS A;  1VQ4 3;  1RRH A;  1Q86 4;  7STD A;  5IW9 A;  5IG4 A;  5LC6 A;  3K9M C;  2ZDJ A;  5HGR A;  3F9S A;  3D5G A;  1K8A 4;  1WMO A;  3NM7 A;  3ZG0 A;  1RNT A;  3Q1C A;  1O7N B;  4K90 B;  4BTW A;  3V99 A;  4O3V A;  1GOU A;  4AKZ A;  1GOY A;  2BO9 B;  4FCZ A;  4HM3 B;  3ROB A;  3QK9 A;  5HOH A;  1SAR A;  2IA7 A;  5IG5 A;  1X1X A;  1X1W A;  4IPB A;  3Q3F A;  2CHC A;  3PS8 A;  1E3R A;  3BNB A;  4LSO A;  1Q9E A;  1GMR A;  5BIR A;  2W9P A;  3LTB A;  4JF8 A;  1W00 A;  3IPT A;  1V74 A;  4FR9 A;  3OV4 A;  4H61 A;  5KP3 A;  1B2S A;  1BNJ A;  6RNT A;  1UCK A;  1AQZ A;  1BVI A;  2Y73 A;  3PXM A;  2KF3 A;  3X41 A;  1K9M 4;  1RN4 A;  4O02 B;  1BIR A;  1OPY A;  2B1X B;  4IT7 A;  1JBT A;  4HBR A;  2XGN A;  4X2O A;  1EQK A;  1NB3 I;  1BRK A;  2STD A;  1UW1 A;  1ZX2 A;  3KCH A;  1RJO A;  3N54 B;  1BSA A;  3UL6 A;  1MOL A;  4HM4 B;  2CFG A;  5KP1 A;  2WGO A;  3NM2 A;  1JB4 A;  1BGS A;  1UGH I;  1D6Z A;  2XRX B;  1OF5 B;  2RGQ A;  3PZW A;  4HZ9 B;  4DKI A;  4K1V A;  5BVB A;  3DGO A;  1VQL 3;  3GRD A;  1JV2 B;  1X1U A;  3F8X A;  3EBY A;  2B24 B;  1HYF A;  1RKY A;  3CCQ 3;  4XDV A;  5BXQ A;  1C54 A;  1PYL A;  1B2X A;  1O7H B;  4HM1 B;  1DMM A;  1LVN A;  1AY7 A;  2ZA4 A;  2XF3 A;  1A2V A;  1G02 A;  3BLZ A;  3FGY A;  4MMZ B;  2WGQ A;  3WMD A;  3LT9 A;  3KN4 A;  1WMN A;  2YFJ B;  1RRL A;  4HOH A;  4H3U A;  1FUW A;  1N8R 4;  3CD6 3;  5AYS C;  3DGN A;  4N6L A;  2GSP A;  3SED A;  4FCJ A;  2CH9 A;  3CCR 3;  3MWZ A;  3O8Y A;  2CK3 H;  2CFW A;  1OH0 A;  1N9J A;  4MMY B;  2CWT A;  1JB2 A;  2HMN B;  2HMM B;  1GD3 A;  1PFP A;  1W4N A;  4R4K A;  2OCT A;  1YIJ 3;  4LZI A;  1JN5 A;  1Q7Y 4;  8RNT A;  4EBG A;  1LXE A;  3DZL A;  3SXX A;  3OW2 2;  1B20 A;  4MJD A;  5EVH A;  2HOH A;  1VQO 3;  5AIH A;  5DRE A;  4AEQ A;  1G0T A;  4N6U A;  4MMX B;  1IVX A;  3EF8 A;  1FUS A;  1LRA A;  2HMO B; 
#chains in the Genus database with same CATH homology
 2L4V A;  3LH4 A;  3F8H A;  3JUM A;  1FGO A;  4XBT A;  2BNG A;  3WOF B;  4G1M B;  2M7O A;  1K73 4;  2O9U X;  3DMC A;  2WOF A;  2CW9 A;  2F99 A;  2Y74 A;  4N6M A;  2CWV A;  4NHF A;  4TX4 A;  1EA2 A;  4RBN A;  2MC8 A;  1QAK A;  1DVC A;  4L7K A;  3GZR A;  1VQ8 3;  3NBJ A;  2RSX A;  3WA2 X;  3KSE D;  4J9A A;  1SQW A;  2R4I A;  4EXR A;  3FH1 A;  1YGE A;  3GAX A;  1W6Y A;  2O3O A;  3NQZ A;  4BTX A;  3NX0 A;  1YJ9 3;  1JKG A;  2GEX A;  2GBX B;  3FF2 A;  2WOH A;  4FMA A;  4HZB B;  3X3X A;  2OTL 3;  3S5C A;  1G96 A;  2OQE A;  1OUN A;  4FMB A;  4HKV B;  3Q2P A;  3EQQ B;  1QAF A;  4AKY A;  4KZ1 A;  5CF1 A;  2I9W A;  1DMQ A;  3GZB A;  3WDG B;  5EEO A;  4K61 A;  1K28 A;  3CNX A;  3N9H A;  4I4K A;  4EYC A;  5ELU A;  3OX9 A;  3JUN A;  1QAL A;  4STD A;  3WA3 A;  3KII A;  2LQV A;  1K9M 4;  1AV4 A;  1W2B 2;  1BUQ A;  3S29 A;  1NDO B;  1TP6 A;  3T8N A;  3LYG A;  3NBB A;  3FF0 A;  4IIA A;  3EBT A;  1AR0 A;  5IG3 A;  1OCV A;  2HMK B;  1STF I;  1JNQ A;  2XGL A;  1QMA A;  1TFK A;  4N6V 0;  2W9Q A;  3VF1 A;  1LNH A;  4KVH A;  4WFO A;  3B4O A;  5AEU B;  1CYU A;  4N6T A;  2RCD A;  3S67 A;  3T0U A;  1KD1 4;  3BNC A;  3MG3 A;  1IVU A;  3N8B A;  3RGA A;  2YX9 A;  4OK0 A;  1MNL A;  3UNL A;  1SPU A;  3NQY A;  2CWU A;  4XBX A;  2E2T A;  3CCV 3;  3KZT A;  4CDL A;  2CC3 A;  4KFE A;  5STD A;  5AYR B;  1IV7 A;  1IU7 A;  1ZO2 A;  5IF6 A;  1NB5 I;  3X3Z A;  1U8C B;  2W2C A;  3DXO A;  1NU3 A;  1WQL B;  1W6C A;  2CIU A;  2P38 A;  3PCS A;  5ELJ A;  3TDG A;  1FGM A;  3MSO A;  1EG9 B;  3B4P A;  2CFL A;  1E3V A;  3H51 A;  4X2H A;  3CC4 3;  2OQE C;  3UB1 A;  3D9R A;  4WWU C;  1SJW A;  3EE1 A;  2D42 A;  1U5O A;  3M8C A;  3G0K A;  1JN5 B;  3STD A;  1UI8 A;  1TUH A;  5IG0 A;  4R9L A;  3NBR A;  5IEP A;  1KQS 2;  3FKA A;  3Q90 A;  2INX A;  3EN1 B;  3FCS B;  3IMA B;  3SLU A;  5I97 A;  8CHO A;  3J7Y d;  3CCM 3;  3X42 A;  3OWY A;  1FGR A;  2HML B;  1CYV A;  1W6G A;  2MF7 A;  3MHE A;  3LTA A;  1YHQ 3;  3CC2 3;  4EC6 A;  2RFR A;  1Q42 A;  2XFT A;  2FGT A;  2V1L A;  2Z7A A;  4J8T A;  3ECF A;  2WO0 A;  2OWP A;  3F7X A;  3CMA 3;  4WYK A;  1TFO A;  1UI7 A;  1W2Z A;  1S72 3;  2YFI B;  1M1K 4;  4XB5 A;  3ALA A;  3T8U A;  1IDP A;  3F7S A;  1SIH A;  1VQ9 3;  3GWR A;  2PZV A;  2OOV C;  3U1W A;  2C10 A;  2GU3 A;  3K63 A;  3NXJ A;  2P05 A;  3G71 3;  2E2V A;  3I0Y A;  5D81 A;  3DM8 A;  1JJ2 2;  3B8L A;  4XBY A;  3G8Z A;  4K1U A;  4R9K A;  1KC8 4;  1DYU A;  2GEY A;  4HM5 B;  3ER7 A;  2W04 A;  2BMO B;  2K0M A;  3NV0 B;  1N9E A;  3B7C A;  3JUO A;  1JKG B;  1M90 4;  4MEI A;  2Z6B A;  3IJE B;  3X3Y A;  1TU5 A;  3LTD A;  4XDW A;  4O2H A;  3SOY A;  1A2K A;  5AI1 A;  1SII A;  1PU4 A;  3WOE B;  6STD A;  1DMN A;  3FLJ A;  3DY5 A;  1IQX A;  1VQN 3;  3NUV A;  4KFD A;  1UUV B;  4KFF A;  3KKG A;  1VQ5 3;  4HYZ A;  2K54 A;  4PEJ A;  3PYJ A;  3SVA A;  3NV0 A;  2W56 A;  1Q82 4;  1O7W B;  1FA3 A;  2XFS A;  1OGX A;  3CCJ 3;  3MYT A;  3OWS A;  3EHC A;  5AEW B;  3S27 A;  4HM0 B;  5CF2 A;  4ZM8 A;  1Q40 B;  3H3H A;  3KSP A;  1IK3 A;  3CXC 2;  4HM2 B;  4LGQ A;  3RDE A;  1Z1S A;  3FG4 A;  3JUQ A;  1K41 A;  3LML A;  1IVW A;  4RZM A;  5D82 A;  3G4S 3;  3PGB A;  2ZL8 A;  1QVF 2;  5CXO A;  3K5T A;  3LOY A;  1IT8 A;  2Z76 A;  5DRV A;  4HVN A;  1W02 A;  2C11 A;  5CLK A;  4R1K A;  1IQ8 A;  4N6N B;  4OUQ A;  1HKX A;  3KE7 A;  1JRQ A;  3HX8 A;  1Q40 A;  4EV5 A;  1IVV A;  2JQ5 A;  3EX9 A;  1VZZ A;  3GZY B;  4FMC A;  1KSI A;  2OOV A;  1KWI A;  1W5Z A;  1E97 A;  1Y4K A;  2P09 A;  1YI2 3;  1N5P A;  1VQP 3;  1FGQ A;  2A15 A;  3F14 A;  2IUK A;  3DGM A;  4HM8 B;  4QWT A;  1A67 A;  4Q53 A;  1WNH A;  1TIJ A;  4LMI A;  5JBS A;  1D6U A;  1N8Q A;  2W0Q A;  3A76 A;  2KCD A;  3BND A;  3EC9 A;  4WHA A;  1ULI B;  3CCL 3;  4NRE A;  1OHO A;  1R4C A;  3KFQ C;  4XM4 A;  5KP4 A;  3MG1 A;  3HK4 A;  2UX0 A;  3D3L A;  3DGL A;  1VQK 3;  2QGU A;  3PCR A;  1GS3 A;  4HJL B;  2E2U A;  3MG2 A;  2GXF A;  1ROV A;  3CPW 2;  4GL6 A;  4OVM A;  2BMQ B;  2D1W A;  4U13 A;  4RNY A;  4N6O B;  1GD4 A;  1YVB I;  2F86 B;  4R80 A;  1J2B A;  3FSD A;  2HMJ B;  4WYK B;  1STD A;  3L0R A;  5EQL A;  1OHS A;  1YJW 3;  1C7H A;  3JVC A;  1NWW A;  1GY6 A;  5A0O B;  3K0Z A;  2QIY A;  1VQ7 3;  1OGZ A;  3EN8 A;  2ML5 A;  4CCV A;  2CFK A;  2IMJ A;  1O7P B;  2Z77 A;  5IEO A;  2ML6 A;  2BHM A;  3LTC A;  3RGR A;  1EKM A;  3SX1 A;  1VQM 3;  3WOD G;  1O7M B;  3FG1 A;  2CG1 A;  1WTH A;  5JPP A;  1N5H A;  3CCS 3;  3V92 A;  3MPH A;  2F98 A;  3VSY A;  4N3V A;  1GYB A;  1WMP A;  3CU3 A;  4ORL A;  3S28 A;  2OTJ 3;  2CG0 A;  1GY5 A;  3JUP A;  3OWU A;  2KXG A;  3X40 A;  3I56 3;  1JB5 A;  4BTY A;  1OAC A;  3I55 3;  2Q07 A;  1DVD A;  5IER A;  1ASK A;  1M1X B;  1VQ6 3;  3CPO A;  4FMD A;  5FW5 A;  3FZW A;  1OF5 A;  3AMO B;  4LEH A;  1T5Y A;  2KRT A;  1CQS A;  1FGT A;  1O7G B;  1UUW B;  2W56 B;  3HI7 A;  5AIF A;  2XSO B;  2YFL B;  1Q81 4;  1F8N A;  1HU9 A;  3HII A;  1LOX A;  5D83 A;  2XSH B;  3CME 3;  1CEW I;  2W6J H;  3G6E 3;  4GB5 A;  3VGN A;  1M9G A;  4HM7 B;  3LXU X;  3EJV A;  2JDI H;  3SOA A;  3CNM A;  3OXA A;  3FG3 A;  5FGO A;  1YIT 3;  3DUK A;  3MKI A;  1A90 A;  4RNZ A;  1GY7 A;  3NHX A;  3UL5 A;  2PNC A;  3V98 A;  3AMO A;  5G2G A;  2QA4 3;  2P0M A;  2GBW B;  1IT7 A;  2LYX A;  2SBL A;  3G16 A;  2QEX 3;  3HZP A;  1OHP A;  5JPU A;  1NJI 4;  3CC7 3;  5AIG A;  1QVG 2;  2BT3 A;  4L8P A;  3EB8 A;  4EV2 A;  2W03 A;  2XH9 A;  5IEN A;  3CCE 3;  2FXT A;  1ULJ B;  1NO3 A;  3HIG A;  3CCU 3;  2FNQ A;  4O8S A;  1D6Y A;  4WP5 A;  1ISK A;  2GU1 A;  3LT8 A;  1S5A A;  1US1 A;  4HM6 B;  3E99 A;  1AVL A;  1L5G B;  5CK6 A;  1ROA A;  3UJM A;  2CFD A;  1W01 A;  2BMR B;  2XEP A;  4FCM A;  3GZX B;  1IV9 A;  3F40 A;  2P0X A;  4JRF A;  3BNE A;  3LZA A;  1QJG A;  2IUJ A;  1IQY A;  5TGN A;  4L8O A;  3BB9 A;  1YJN 3;  1AVK A;  2CKF B;  5AII A;  3U97 A;  3K7C A;  2XR8 B;  5LC7 A;  1W7C A;  3QRD A;  1RN7 A;  1VQ4 3;  1RRH A;  1Q86 4;  7STD A;  5IW9 A;  5IG4 A;  5LC6 A;  3K9M C;  2ZDJ A;  5HGR A;  3F9S A;  1K8A 4;  1WMO A;  3NM7 A;  3Q1C A;  4K90 B;  1O7N B;  4BTW A;  3V99 A;  4O3V A;  4AKZ A;  2BO9 B;  4FCZ A;  4HM3 B;  3ROB A;  3QK9 A;  5IG5 A;  2IA7 A;  4IPB A;  2CHC A;  3PS8 A;  1E3R A;  3BNB A;  4LSO A;  2W9P A;  3LTB A;  4JF8 A;  1W00 A;  3IPT A;  1V74 A;  4FR9 A;  3OV4 A;  4H61 A;  5KP3 A;  2Y73 A;  3PXM A;  3X41 A;  4O02 B;  1OPY A;  2B1X B;  4IT7 A;  4HBR A;  2XGN A;  4X2O A;  1EQK A;  1NB3 I;  2STD A;  1UW1 A;  1ZX2 A;  3N54 B;  1RJO A;  3UL6 A;  1MOL A;  4HM4 B;  2CFG A;  5KP1 A;  2WGO A;  3NM2 A;  1JB4 A;  4HZ9 B;  1D6Z A;  2XRX B;  1OF5 B;  2RGQ A;  3PZW A;  4K1V A;  5BVB A;  3DGO A;  1VQL 3;  3GRD A;  1JV2 B;  3F8X A;  3EBY A;  2B24 B;  1RKY A;  3CCQ 3;  4XDV A;  5BXQ A;  1O7H B;  4HM1 B;  1DMM A;  1LVN A;  2XF3 A;  1A2V A;  3BLZ A;  4MMZ B;  3FGY A;  3WMD A;  2WGQ A;  3LT9 A;  3KN4 A;  1WMN A;  2YFJ B;  1RRL A;  4H3U A;  1FUW A;  1N8R 4;  3CD6 3;  5AYS C;  3DGN A;  4N6L A;  3SED A;  4FCJ A;  2CH9 A;  3CCR 3;  3MWZ A;  3O8Y A;  2CK3 H;  2CFW A;  1OH0 A;  1N9J A;  4MMY B;  2CWT A;  1JB2 A;  2HMN B;  2HMM B;  1GD3 A;  1PFP A;  1W4N A;  4R4K A;  2OCT A;  1YIJ 3;  4LZI A;  1JN5 A;  1Q7Y 4;  4EBG A;  1LXE A;  3DZL A;  3SXX A;  3OW2 2;  4MJD A;  5EVH A;  1VQO 3;  5AIH A;  5DRE A;  4AEQ A;  4N6U A;  4MMX B;  1IVX A;  3EF8 A;  2HMO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...