4XBYA

Crystal structure of the l74f/m78v/i80v/l114f mutant of leh complexed with cyclopentene oxide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
144
structure length
144
Chain Sequence
b'IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFTVVSVDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNFSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Reshaping an Enzyme Binding Pocket for Enhanced and Inverted Stereoselectivity: Use of Smallest Amino Acid Alphabets in Directed Evolution
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 39
structure length 144
sequence length 144
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4xbyA00
1NU3A 1QMAA 5AIHA 1GS3A 1O7HB 3NM2A 3HK4A 1OGXA 4HKVB 1A2KA 5AIGA 3JUMA 3F8XA 1E3VA 3GWRA 4FCMA 1W01A 1OCVA 3GZBA 4CDLA 3OV4A 2Z7AA 1CQSA 4L8PA 3UJMA 3FH1A 3KE7A 3DXOA 1W02A 1JN5A 2BNGA 5CLKA 4HM8B 1C7HA 3BLZA 3EHCA 2RFRA 3NHXA 1WQLB 4FCJA 2QGUA 1EG9B 3HX8A 1OH0A 3MYTA 3JUOA 5AEUB 2INXA 1SJWA 4ORLA 3GZYB 3UNLA 5HGRA 4MJDA 5D83A 2UX0A 3EBYA 3F40A 2YFLB 4K1UA 4N3VA 5G2GA 2CHCA 3GZRA 5CXOA 4U13A 1BUQA 3CPOA 2B1XB 3KZTA 3KKGA 4XBYA 1Q40A 2F86B 3CU3A 4XDVA 2BMRB 3DMCA 5IENA 3B4PA 2XRXB 2F98A 1S5AA 1GY7A 5CF2A 3SEDA 4OUQA 1JB5A 1GY6A 3MG2A 1Q40B 3MG1A 1K41A 3MKIA 5IG5A 4WYKA 4LMIA 4WWUC 5D81A 2CKFB 5IEOA 2BMQB 3H51A 4WYKB 5JPUA 1ZX2A 3FF2A 3VGNA 4XBXA 1O7GB 2RCDA 3G0KA 2JQ5A 3FKAA 2GBWB 1JB2A 3H3HA 1GY5A 5IEPA 3OWSA 3I0YA 1W6YA 4STDA 3OWUA 5AIIA 4XBTA 3GRDA 1DMMA 1QJGA 5IG0A 3D9RA 3JUQA 3K0ZA 4HM7B 4GB5A 2W2CA 2R4IA 2XR8B 2GEXA 5KP4A 3ER7A 2I9WA 3LZAA 4HM6B 1Q42A 1ASKA 5CK6A 1U5OA 3MG3A 3IPTA 3F7XA 3F8HA 2QIYA 3F14A 6STDA 3DUKA 1NWWA 5FW5A 4HVNA 3VSYA 5TGNA 4R9KA 3ROBA 2Z77A 2A15A 1EA2A 4HM5B 4OVMA 1ULIB 4H3UA 1O7PB 2BMOB 3EJVA 1O7WB 1OF5A 4HJLB 3FLJA 5STDA 8CHOA 3MHEA 4XB5A 3K7CA 1OHSA 1AR0A 3EQQB 1OF5B 1JB4A 4Q53A 3DM8A 3EN1B 3MSOA 1O7MB 4HM4B 1E3RA 1TP6A 1OPYA 3HZPA 2XSHB 5BXQA 5CF1A 3NXJA 1W00A 1Z1SA 3T8UA 1DMNA 4XDWA 4HM0B 4HM1B 3SOAA 3FSDA 3FZWA 2YFJB 4HM2B 4HZBB 3CNXA 2HMLB 4KVHA 3FGYA 1OGZA 2Z76A 4I4KA 3OWYA 4WP5A 3JUNA 4X2OA 3CNMA 5IG3A 2B24B 5IERA 3KSPA 4K1VA 5AEWB 5AI1A 2HMMB 2PZVA 5KP3A 1ISKA 2OWPA 3RGRA 3FF0A 4R1KA 5KP1A 3NV0A 1DMQA 2IMJA 3NBRA 1OUNA 4XM4A 5IG4A 1NDOB 3T8NA 3NV0B 1UUVB 3F9SA 4HM3B 3OXAA 2YFIB 4L8OA 1HKXA 3WMDA 2HMNB 1JN5B 1E97A 3B7CA 2XSOB 1ULJB 3ECFA 3SOYA 3Q90A 3BB9A 3S5CA 4X2HA 1STDA 2RGQA 3OX9A 3NUVA 3EN8A 1GYBA 3B4OA 1IDPA 7STDA 1VZZA 2HMOB 4J9AA 5D82A 5EVHA 3LYGA 2HMKB 3G16A 2GBXB 5JPPA 5IF6A 1ZO2A 5DRVA 3E99A 1TUHA 4LEHA 4HZ9B 1JKGA 2GEYA 4L7KA 3GZXB 2K54A 3G8ZA 5BVBA 3RGAA 3STDA 3EC9A 2STDA 3EF8A 4IIAA 3EBTA 2HMJB 1JKGB 1O7NB 1OHOA 3DZLA 4PEJA 1OHPA 2GXFA 3F7SA 5AIFA 4J8TA 2F99A 3B8LA 3EX9A 3JUPA 5DREA 1UUWB 4RZMA 3M8CA 4R9LA 4LGQA 3A76A
chains in the Genus database with same CATH superfamily
1NU3A 2L1SA 1FGOA 1QMAA 1IU7A 3AGOA 1GD4A 1LQGC 5AIHA 2P38A 1B20A 4JF8A 1GS3A 1T3BA 1D6UA 2CFWA 1O7HB 3NM2A 3HK4A 1RTUA 1OGXA 5LC6A 1LRAA 1PYLA 1A2PA 4HKVB 1A2KA 1IQ8A 5AIGA 4DKIA 1UI7A 3JUMA 3F8XA 1E3VA 3HI7A 3GWRA 4G1MB 4FCMA 3BNCA 1IQYA 1BIRA 1OCVA 1W01A 1GMRA 1TRQA 1V74A 2AAEA 2RNTA 3GZBA 4J5GA 4CDLA 3OV4A 2Z7AA 1CQSA 3WOFB 4CJNA 3Q2PA 3WA3A 2OTL3 4KFEA 4L8PA 4BIRA 1BANA 1IT8A 2XF3A 4BL2A 2AADA 2F5WA 3BIRA 1MGRA 2P05A 3UJMA 1X1XA 3FH1A 3KCHA 3KE7A 1FZUA 3X3XA 2XGLA 3DXOA 3NX0A 3Q1CA 3PCSA 1W02A 4FCZA 1RJOA 2KAAA 1JN5A 2BNGA 1RGCA 5CLKA 4HM8B 2M7OA 1C7HA 3BLZA 1UCKA 3DGNA 3PYJA 3EHCA 1I0VA 4QWTA 1DYUA 2WOHA 4LZIA 1UDII 2LQVA 4LYLB 3KIIA 2RFRA 2KCDA 3NHXA 1WQLB 1YJ93 2ZHXB 4FCJA 2QGUA 1TFKA 2FNQA 3V98A 1EG9B 1X1UA 2D42A 4J5KA 3HX8A 3NBBA 1OH0A 1WMOA 2P0MA 3MYTA 3JUOA 1LNIA 4EC6A 1I3FA 2WGQA 5AEUB 2INXA 1M1XB 3LT9A 1LOVA 1SJWA 3DGMA 3PS8A 1FGRA 4ORLA 3CME3 4EBGA 3GZYB 3LMLA 4O02B 2OOVA 4EXRA 1BNIA 3PCRA 3UNLA 2CG0A 5HGRA 4IPBA 4MJDA 5LC7A 1VQ63 2UX0A 5D83A 3EBYA 3F40A 5RNTA 2YFLB 1VQQA 4K1UA 1GMPA 2KF5A 4N3VA 1CEWI 5G2GA 1J2BA 2CHCA 1X1WA 3KSED 4AEQA 2H0HA 3GZRA 5CXOA 3WOEB 3WODG 3CPW2 3DGOA 4FR9A 1VQO3 1VQ53 4U13A 2P09A 4O8SA 1VQ83 3FG1A 2F4YA 1UGHI 1LOYA 1BUQA 1Q9EA 1I8VA 1RCLA 1V57A 2B1XB 3CPOA 3KZTA 1M904 3KKGA 4XBYA 1Q40A 2F86B 3CU3A 3D79A 4XDVA 1KC84 2BMRB 3PGBA 2RBIA 4BL3A 3LOYA 3DMCA 5IENA 1RN4A 3LTBA 3UB1A 2ZL8A 3B4PA 2XRXB 2F98A 1S5AA 1V58A 1QVG2 1GY7A 5CF2A 1LNHA 1C54A 3SEDA 1T2HA 1VQK3 4OUQA 2D1WA 1JB5A 1GY6A 3MG2A 1GMQA 3UL5A 1Q40B 2CFKA 1BNRA 1B2UA 3MG1A 5A0OB 1K41A 1NO3A 2V1LA 1YGEA 1K28A 8RNTA 3MKIA 3CD63 3CCV3 1JRQA 4HAAA 4WYKA 5IG5A 3D3LA 1CYVA 2C11A 3IMAB 2KF6A 4LMIA 2K0MA 1JBSA 1ROVA 1T2IA 3AMOA 2YX9A 1G0TA 4WWUC 2XEPA 1MWRA 5D81A 2CKFB 3J7Yd 2CX1A 3D4AA 4BTWA 1WMNA 3WDGB 5IEOA 2BMQB 4N6OB 3H51A 1X1YA 4WYKB 5JPUA 2IY2A 1Q824 1EKMA 4FMDA 1BRSA 2CWTA 4ZM8A 3JVCA 1F8NA 1ZX2A 3FF2A 3VGNA 1BRNL 3S67A 1US1A 3AMOB 1IQXA 1RNTA 1TFOA 4XBXA 1JBRA 1O7GB 1W4NA 2RCDA 3G0KA 2JQ5A 3FKAA 4EYCA 5BU4A 1BVIA 4HOHA 1YHQ3 1Q814 3G713 3I563 2GBWB 1HU9A 1JB2A 1YJN3 3H3HA 4KT3B 1VQ43 2CWVA 1GY5A 5IEPA 1S723 3OWSA 3ALAA 2CWUA 3I0YA 4CPKA 2OTJ3 2L4VA 1W6YA 3X40A 3WA2X 4STDA 3OWUA 1IK3A 5AIIA 1BNFA 4XBTA 3GRDA 1YNVX 3HIGA 3LXUX 1DMMA 3G4S3 1QJGA 1JV2B 2UUGC 3MPHA 5IG0A 3U1WA 3U97A 1WTHA 3I553 2FXTA 3D9RA 3JUQA 3K0ZA 1Q864 4BU4A 4HM7B 1JJ22 1JNQA 1AQZA 4GB5A 2W2CA 2R4IA 5ELJA 2XR8B 4RNZA 2XFSA 3ZG0A 2GEXA 5KP4A 3ER7A 1MWSA 2BT3A 1QALA 2CC3A 2I9WA 4FMBA 2Q07A 3QRDA 3LZAA 2MF7A 1Q42A 1HYFA 4HM6B 4BTXA 1ASKA 5CK6A 1U5OA 3K9MC 3MG3A 3S29A 1RNBA 2W6JH 1BNJA 3IPTA 1AVLA 3F7XA 3F8HA 2IUKA 1STFI 4GHOA 2OQEA 1RGHA 2QIYA 3F14A 3T0UA 6STDA 1ROAA 3A5EA 3L0RA 1GOUA 3AGNA 3S28A 1LVNA 3DUKA 1IV7A 1KQS2 1SQWA 1MOLA 1KWIA 1NWWA 3K63A 3AHSA 4O3VA 5FW5A 4HVNA 1NB5I 3BNDA 1PY3A 2R41A 3CMA3 3VSYA 5TGNA 4R9KA 4K61A 1GSPA 1BOXA 5JBSA 1RGAA 3ROBA 3SXXA 3O8YA 1YI23 1I70A 2Z77A 1FUWA 2A15A 1TIJA 3TDGA 2Y74A 1EA2A 2XFTA 4IT7A 4HM5B 1ULIB 1Y4KA 1N5HA 4OVMA 3X42A 1Q7HA 3G6E3 4H3UA 3BNBA 1K9M4 1K8A4 1Q7Y4 2P0XA 5FGOA 2OOVC 3RDEA 3GAXA 3OW22 1B2XA 1RGFA 5M1AA 1O7PB 3FG4A 2ML6A 1YJW3 2BMOB 3CCU3 1BRKA 5AYSC 1N9EA 3EJVA 3QK9A 3N8BA 2F5MA 1O7WB 1OF5A 1UGIA 1YIJ3 1BNSA 3FLJA 4HJLB 5STDA 1SIIA 2CFGA 4LSOA 8CHOA 3LH4A 3NM7A 3RNTA 3CCE3 3MHEA 1MWUA 4XB5A 3K7CA 1OHSA 1FUSA 5IW9A 3PZWA 3LTDA 5AYRB 1IVXA 1AR0A 1N9JA 1JBTA 2Y73A 1I2FA 3EQQB 2E2TA 1FGQA 1OF5B 1JB4A 4Q53A 3DM8A 3EN1B 3MSOA 1O7MB 1U8CB 2BU4A 4TX4A 4HM4B 2GU1A 1E3RA 1I2GA 1IVVA 1W2B2 1TP6A 1OPYA 3HZPA 1I0XA 2XSHB 5BXQA 1RN7A 1BNEA 3MWZA 5CF1A 3CC73 1FA3A 3CC23 1MNLA 1UI8A 2CX0A 4N6TA 3LT8A 3NXJA 1W00A 1W7CA 5I97A 1Z1SA 1UW1A 1BSBA 1LOWA 2RSXA 1DMNA 4MMXB 4XDWA 1RN1A 4HM0B 3T8UA 3X3YA 4NPBA 5EQLA 4HM1B 2IYJA 4JRFA 3SOAA 3EE1A 1RRLA 1RGEA 2BIRA 3EB8A 3FSDA 1VQ93 3DGYA 1D6YA 1AV4A 2HOHA 1N8QA 2CFLA 3CCQ3 3FZWA 2C10A 4KFFA 2YFJB 3ZFZA 4HM2B 1BSEA 3DGLA 1TU5A 5M18A 2CIUA 1WNHA 4HZBB 1BRJA 4ILFA 3SLUA 3CNXA 1BAOA 2HMLB 1QAFA 4KVHA 1JZOA 1AVKA 4RNYA 1RMSA 2XGNA 3BU4A 1BNGA 3AHWA 1LXEA 4GSPA 3FGYA 2IUJA 1OGZA 2Z76A 3X3ZA 4NREA 4I4KA 3OWYA 4WP5A 3LTAA 3JUNA 2F56A 1QVF2 2ZA4A 2WO0A 3DY5A 3N54B 1VQL3 4N6MA 1YIT3 3DH2A 4X2OA 2CG1A 1W6GA 1RGKA 3CNMA 2Z6BA 5IG3A 2H0IA 1D6ZA 1HZ1A 2B24B 2UGIA 5IERA 3KSPA 2GU3A 2IA7A 4K1VA 1VQN3 2W03A 5AEWB 2O9UX 1IVWA 1ZS7A 5G1KA 4AKZA 5AI1A 2QA43 3D5IA 4N6LA 1W5ZA 7RNTA 2HMMB 3Q3FA 2PZVA 1GD3A 1B21A 1ZGXA 2OWPA 5KP3A 3RGRA 4EV2A 3CCS3 1N8R4 1VQ73 1ISKA 3FF0A 4R1KA 3ZG5A 5KP1A 3V99A 3CXC2 2BO9B 1TRPA 1SIHA 3BNEA 3NV0A 2QEX3 1DMQA 2WOFA 1RDSA 1RSNA 3IJEB 4BTYA 2BHMA 5M19A 1G96A 1W2ZA 1A90A 2IMJA 1NB3I 4I5QA 1FUTA 3NBRA 3NQZA 3SVAA 1OUNA 1OACA 2CK3H 3S27A 1DETA 4XM4A 1LQMB 6RNTA 5IG4A 1NDOB 3GSPA 1SPUA 1IVUA 3T8NA 1FYSA 3NV0B 1UUVB 2FGTA 1I3IA 1AY7A 2K3DA 3F9SA 3WHOA 2GSPA 9RNTA 4HM3B 3OXAA 4R80A 2YFIB 3NBJA 2W9QA 4L8OA 1HKXA 1VQM3 4EW5A 2E2UA 1VQP3 1EQKA 1BRGA 3WMDA 2OQEC 2HMNB 1JN5B 2OCTA 1E97A 1M9GA 2XSOB 1ULJB 1B27A 1BSDA 2C4BA 3B7CA 3ECFA 3HIIA 1KD14 4OK0A 1EUIC 1BUJA 1B2SA 3SOYA 1IT7A 3Q90A 2CH9A 1NNVA 1UCIA 3NQYA 1I2EA 1QAKA 1BSAA 2SBLA 1YGWA 3K5TA 2JDIH 1TJDA 3BB9A 2W56A 3S5CA 4X2HA 1YVSA 2WGOA 1DE3A 4H61A 3V92A 1RCKA 3FCSB 1PFPA 1STDA 1UCLA 2RGQA 3D5GA 1BGSA 3KFQC 3OX9A 3X41A 6GSPA 3NUVA 4MEIA 1R4YA 1RHLA 4EV5A 4WHAA 2ML5A 1WMPA 5GSPA 1SARA 4NHFA 3EN8A 1GYBA 2MC8A 5G1LA 1G02A 4K90B 1PU4A 4MMYB 1BRIA 2W56B 3B4OA 1KSIA 1IDPA 7STDA 1VZZA 1TTOA 2HMOB 4J9AA 5D82A 5EVHA 2H0GA 2W0QA 3LYGA 1IYYA 2HMKB 1CYUA 1FGMA 3LTCA 1K734 1FGTA 4FMCA 3G16A 2GBXB 5JPPA 5IF6A 4HYZA 2KF4A 1YVBI 1M1K4 1ZO2A 3SYUA 4MMZB 2J8XB 1IV9A 2KXGA 3UL6A 4RNTA 4RBNA 1B3SA 1T5YA 5DRVA 3E99A 4HBRA 1RGGA 3CCR3 1TUHA 4KFDA 4LEHA 2CW9A 1CH0A 4HZ9B 3CCM3 1JKGA 2O3OA 2ZDJA 2GEYA 3FG3A 4L7KA 3GZXB 2K54A 3G8ZA 5ELUA 1EEJA 4R4KA 5HOHA 3PXMA 5BVBA 1BSCA 1A2VA 3RGAA 3STDA 2PNCA 2STDA 3EC9A 4AKYA 3CCL3 3EF8A 1N5PA 4IIAA 2W04A 2W9PA 3WR2A 2SARA 3SX1A 3EBTA 1DVDA 2KF3A 2KRTA 1JZDA 4WFOA 3HOHA 1RRHA 4FMAA 1A67A 1UUGB 2HMJB 1JKGB 3VF1A 1GOYA 1O7NB 1OHOA 5EEOA 5BIRA 1GOVA 1B2MA 4CCVA 3DZLA 7GSPA 1RLSA 4GL6A 4KZ1A 4PEJA 1RKYA 1OHPA 4O2HA 2GXFA 1BU4A 1W6CA 3F7SA 4N6UA 5AIFA 1RGLA 1NJI4 4J8TA 1MWTA 3N9HA 2XH9A 2CFDA 2F99A 1UCJA 3URPA 3B8LA 2E2VA 1L5GB 3EX9A 3JUPA 5DREA 1MGWA 2LYXA 1B2ZA 1UUWB 3KN4A 4RZMA 3CC43 1FW7A 1DVCA 1BRHA 1LOXA 3M8CA 4R9LA 4N6V0 4LGQA 3A76A 4N6NB 3CCJ3 1R4CA
chains in the Genus database with same CATH topology
1NU3A 1FGOA 1QMAA 1IU7A 5AIHA 1GD4A 2P38A 4JF8A 1GS3A 1D6UA 2CFWA 1O7HB 3NM2A 3HK4A 5LC6A 1OGXA 4HKVB 1A2KA 1IQ8A 5AIGA 1UI7A 3JUMA 3F8XA 1E3VA 3HI7A 3GWRA 4G1MB 4FCMA 3BNCA 1IQYA 1W01A 1OCVA 3GZBA 1V74A 2MC8A 4CDLA 3OV4A 2Z7AA 1CQSA 3WOFB 3WA3A 3Q2PA 2OTL3 4KFEA 4L8PA 1IT8A 2XF3A 2P05A 3UJMA 3FH1A 3KE7A 3X3XA 2XGLA 3DXOA 3NX0A 3Q1CA 3PCSA 1W02A 4FCZA 1RJOA 1JN5A 2BNGA 5CLKA 4HM8B 2M7OA 1C7HA 3BLZA 3DGNA 3PYJA 3EHCA 4QWTA 1DYUA 2WOHA 4LZIA 2LQVA 3KIIA 2RFRA 2KCDA 3NHXA 1WQLB 1YJ93 4FCJA 2QGUA 1TFKA 2FNQA 3V98A 1EG9B 2D42A 3HX8A 3NBBA 1OH0A 1WMOA 2P0MA 3MYTA 3JUOA 4EC6A 2WGQA 5AEUB 2INXA 1M1XB 3LT9A 1SJWA 3DGMA 3PS8A 1FGRA 4ORLA 3CME3 4EBGA 3GZYB 3LMLA 4O02B 2OOVA 4EXRA 3PCRA 3UNLA 2CG0A 5HGRA 4IPBA 4MJDA 5LC7A 1VQ63 2UX0A 5D83A 3EBYA 3F40A 2YFLB 4K1UA 4N3VA 5G2GA 1CEWI 1J2BA 2CHCA 4AEQA 3KSED 3GZRA 5CXOA 3WOEB 3WODG 3CPW2 3DGOA 4FR9A 1VQO3 1VQ53 4U13A 2P09A 4O8SA 1VQ83 3FG1A 1BUQA 3CPOA 2B1XB 3KZTA 1M904 3KKGA 4XBYA 1Q40A 2F86B 3CU3A 1KC84 4XDVA 2BMRB 3PGBA 3LOYA 3DMCA 5IENA 3LTBA 3UB1A 2ZL8A 3B4PA 2XRXB 2F98A 1S5AA 1QVG2 1GY7A 5CF2A 1LNHA 3SEDA 1VQK3 4OUQA 2D1WA 1JB5A 1GY6A 3MG2A 3UL5A 1Q40B 2CFKA 3MG1A 5A0OB 1K41A 1NO3A 2V1LA 1YGEA 1K28A 3MKIA 3CD63 3CCV3 1JRQA 5IG5A 4WYKA 3D3LA 1CYVA 2C11A 3IMAB 4LMIA 2K0MA 1ROVA 3AMOA 2YX9A 4WWUC 2XEPA 5D81A 2CKFB 3J7Yd 4BTWA 1WMNA 3WDGB 5IEOA 2BMQB 4N6OB 3H51A 4WYKB 5JPUA 1Q824 1EKMA 4FMDA 2CWTA 4ZM8A 3JVCA 1F8NA 1ZX2A 3FF2A 3VGNA 3S67A 1US1A 3AMOB 1IQXA 1TFOA 4XBXA 1O7GB 1W4NA 2RCDA 3G0KA 2JQ5A 3FKAA 4EYCA 1YHQ3 1Q814 3G713 3I563 2GBWB 1HU9A 1JB2A 1YJN3 3H3HA 1VQ43 2CWVA 1GY5A 5IEPA 1S723 3OWSA 3ALAA 2CWUA 3I0YA 2OTJ3 2L4VA 1W6YA 3X40A 3WA2X 4STDA 3OWUA 1IK3A 5AIIA 4XBTA 3GRDA 3HIGA 3LXUX 1DMMA 3G4S3 1QJGA 1JV2B 5IG0A 3MPHA 3U1WA 3U97A 1WTHA 3I553 2FXTA 3D9RA 3JUQA 3K0ZA 1Q864 4HM7B 1JJ22 1JNQA 4GB5A 2W2CA 2R4IA 5ELJA 2XR8B 4RNZA 2XFSA 2GEXA 5KP4A 3ER7A 2BT3A 1QALA 2CC3A 2I9WA 4FMBA 2Q07A 3QRDA 3LZAA 2MF7A 1Q42A 4HM6B 4BTXA 1ASKA 5CK6A 1U5OA 3K9MC 3MG3A 3S29A 2W6JH 3IPTA 1AVLA 3F7XA 3F8HA 2IUKA 1STFI 2OQEA 2QIYA 3T0UA 3F14A 6STDA 1ROAA 3L0RA 3S28A 1LVNA 3DUKA 1IV7A 1KQS2 1SQWA 1MOLA 1KWIA 1NWWA 3K63A 4O3VA 5FW5A 4HVNA 1NB5I 3BNDA 3CMA3 3VSYA 5TGNA 4R9KA 4K61A 5JBSA 3ROBA 3SXXA 3O8YA 1YI23 2Z77A 1FUWA 2A15A 1TIJA 3TDGA 2Y74A 1EA2A 2XFTA 4IT7A 4HM5B 1ULIB 1Y4KA 1N5HA 4OVMA 3X42A 3G6E3 4H3UA 3BNBA 1K9M4 1K8A4 1Q7Y4 2P0XA 5FGOA 2OOVC 3RDEA 3GAXA 3OW22 1O7PB 3FG4A 2ML6A 1YJW3 2BMOB 3CCU3 5AYSC 1N9EA 3EJVA 3QK9A 3N8BA 1O7WB 1OF5A 1YIJ3 1EQKA 4HJLB 3FLJA 5STDA 1SIIA 2CFGA 4LSOA 8CHOA 3LH4A 3NM7A 3CCE3 3MHEA 4XB5A 3K7CA 1OHSA 5IW9A 3PZWA 3LTDA 5AYRB 1IVXA 1AR0A 1N9JA 2Y73A 3EQQB 2E2TA 1FGQA 1OF5B 1JB4A 4Q53A 3DM8A 3EN1B 3MSOA 1O7MB 1U8CB 4TX4A 4HM4B 2GU1A 1E3RA 1IVVA 1W2B2 1TP6A 1OPYA 3HZPA 2XSHB 5BXQA 1RN7A 3MWZA 5CF1A 3CC73 1FA3A 3CC23 1MNLA 1UI8A 4N6TA 3LT8A 3NXJA 1W00A 1W7CA 5I97A 1Z1SA 1UW1A 2RSXA 3T8UA 1DMNA 4MMXB 4XDWA 4HM0B 3X3YA 5EQLA 4HM1B 4JRFA 3SOAA 3EE1A 1RRLA 3EB8A 3FSDA 1VQ93 1D6YA 1AV4A 1N8QA 2CFLA 3CCQ3 3FZWA 2C10A 4KFFA 2YFJB 4HM2B 3DGLA 1TU5A 2CIUA 1WNHA 4HZBB 3SLUA 3CNXA 2HMLB 4KVHA 1QAFA 1AVKA 4RNYA 2XGNA 1LXEA 3FGYA 2IUJA 1OGZA 2Z76A 3X3ZA 4NREA 4I4KA 3OWYA 4WP5A 3LTAA 3JUNA 1QVF2 3DY5A 2WO0A 3N54B 1VQL3 4N6MA 1YIT3 4X2OA 2CG1A 1W6GA 3CNMA 2Z6BA 5IG3A 1D6ZA 2B24B 5IERA 3KSPA 2GU3A 2IA7A 4K1VA 1VQN3 2W03A 5AEWB 2O9UX 1IVWA 4AKZA 5AI1A 2QA43 4N6LA 1W5ZA 2HMMB 2PZVA 1GD3A 5KP3A 1ISKA 2OWPA 4EV2A 3RGRA 3CCS3 1N8R4 1VQ73 3FF0A 4R1KA 5KP1A 3V99A 3CXC2 2BO9B 3BNEA 1SIHA 3NV0A 2QEX3 1DMQA 2WOFA 4BTYA 3IJEB 2BHMA 1G96A 1W2ZA 1A90A 2IMJA 1NB3I 3NBRA 3NQZA 3SVAA 1OUNA 1OACA 2CK3H 3S27A 4XM4A 5IG4A 1NDOB 1SPUA 1IVUA 3T8NA 3NV0B 1UUVB 2FGTA 3F9SA 4HM3B 3OXAA 4R80A 2YFIB 3NBJA 2W9QA 4L8OA 1HKXA 1VQM3 1VQP3 2E2UA 3WMDA 2OQEC 2HMNB 1JN5B 2OCTA 1E97A 1M9GA 2XSOB 1ULJB 3B7CA 3HIIA 1KD14 3ECFA 4OK0A 3SOYA 1IT7A 3Q90A 2CH9A 3NQYA 1QAKA 2SBLA 3K5TA 2JDIH 3BB9A 2W56A 3S5CA 4X2HA 2WGOA 4H61A 3V92A 3FCSB 1PFPA 1STDA 2RGQA 3KFQC 3X41A 3OX9A 3NUVA 4MEIA 4EV5A 4WHAA 2ML5A 1WMPA 4NHFA 3EN8A 1GYBA 4K90B 1PU4A 4MMYB 2W56B 3B4OA 1KSIA 1IDPA 7STDA 1VZZA 2HMOB 4J9AA 5D82A 5EVHA 2W0QA 3LYGA 2HMKB 1CYUA 1FGMA 3LTCA 1K734 1FGTA 4FMCA 3G16A 2GBXB 5JPPA 5IF6A 4HYZA 1YVBI 1M1K4 1ZO2A 4MMZB 3UL6A 1IV9A 2KXGA 4RBNA 1T5YA 5DRVA 3E99A 4HBRA 3CCR3 1TUHA 4KFDA 4LEHA 2CW9A 3CCM3 4HZ9B 1JKGA 2O3OA 2ZDJA 2GEYA 3FG3A 4L7KA 3GZXB 2K54A 3G8ZA 5ELUA 4R4KA 3PXMA 5BVBA 3RGAA 1A2VA 3STDA 3CCL3 2PNCA 2STDA 3EC9A 4AKYA 3EF8A 1N5PA 4IIAA 2W04A 2W9PA 3SX1A 3EBTA 1DVDA 2KRTA 4WFOA 1RRHA 4FMAA 1A67A 2HMJB 1JKGB 3VF1A 1O7NB 1OHOA 5EEOA 4CCVA 3DZLA 4GL6A 4KZ1A 4PEJA 1RKYA 1OHPA 4O2HA 2GXFA 3F7SA 1W6CA 4N6UA 5AIFA 1NJI4 4J8TA 3N9HA 2XH9A 2CFDA 2F99A 3B8LA 2E2VA 1L5GB 3EX9A 3JUPA 5DREA 2LYXA 3CC43 1UUWB 3KN4A 4RZMA 1DVCA 1LOXA 3M8CA 4R9LA 4N6V0 4LGQA 3A76A 4N6NB 3CCJ3 1R4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU3 A;  1QMA A;  5AIH A;  1GS3 A;  1O7H B;  3NM2 A;  3HK4 A;  1OGX A;  4HKV B;  1A2K A;  5AIG A;  3JUM A;  3F8X A;  1E3V A;  3GWR A;  4FCM A;  1W01 A;  1OCV A;  3GZB A;  4CDL A;  3OV4 A;  2Z7A A;  1CQS A;  4L8P A;  3UJM A;  3FH1 A;  3KE7 A;  3DXO A;  1W02 A;  1JN5 A;  2BNG A;  5CLK A;  4HM8 B;  1C7H A;  3BLZ A;  3EHC A;  2RFR A;  3NHX A;  1WQL B;  4FCJ A;  2QGU A;  1EG9 B;  3HX8 A;  1OH0 A;  3MYT A;  3JUO A;  5AEU B;  2INX A;  1SJW A;  4ORL A;  3GZY B;  3UNL A;  5HGR A;  4MJD A;  5D83 A;  2UX0 A;  3EBY A;  3F40 A;  2YFL B;  4K1U A;  4N3V A;  5G2G A;  2CHC A;  3GZR A;  5CXO A;  4U13 A;  1BUQ A;  3CPO A;  2B1X B;  3KZT A;  3KKG A;  4XBY A;  1Q40 A;  2F86 B;  3CU3 A;  4XDV A;  2BMR B;  3DMC A;  5IEN A;  3B4P A;  2XRX B;  2F98 A;  1S5A A;  1GY7 A;  5CF2 A;  3SED A;  4OUQ A;  1JB5 A;  1GY6 A;  3MG2 A;  1Q40 B;  3MG1 A;  1K41 A;  3MKI A;  5IG5 A;  4WYK A;  4LMI A;  4WWU C;  5D81 A;  2CKF B;  5IEO A;  2BMQ B;  3H51 A;  4WYK B;  5JPU A;  1ZX2 A;  3FF2 A;  3VGN A;  4XBX A;  1O7G B;  2RCD A;  3G0K A;  2JQ5 A;  3FKA A;  2GBW B;  1JB2 A;  3H3H A;  1GY5 A;  5IEP A;  3OWS A;  3I0Y A;  1W6Y A;  4STD A;  3OWU A;  5AII A;  4XBT A;  3GRD A;  1DMM A;  1QJG A;  5IG0 A;  3D9R A;  3JUQ A;  3K0Z A;  4HM7 B;  4GB5 A;  2W2C A;  2R4I A;  2XR8 B;  2GEX A;  5KP4 A;  3ER7 A;  2I9W A;  3LZA A;  4HM6 B;  1Q42 A;  1ASK A;  5CK6 A;  1U5O A;  3MG3 A;  3IPT A;  3F7X A;  3F8H A;  2QIY A;  3F14 A;  6STD A;  3DUK A;  1NWW A;  5FW5 A;  4HVN A;  3VSY A;  5TGN A;  4R9K A;  3ROB A;  2Z77 A;  2A15 A;  1EA2 A;  4HM5 B;  4OVM A;  1ULI B;  4H3U A;  1O7P B;  2BMO B;  3EJV A;  1O7W B;  1OF5 A;  4HJL B;  3FLJ A;  5STD A;  8CHO A;  3MHE A;  4XB5 A;  3K7C A;  1OHS A;  1AR0 A;  3EQQ B;  1OF5 B;  1JB4 A;  4Q53 A;  3DM8 A;  3EN1 B;  3MSO A;  1O7M B;  4HM4 B;  1E3R A;  1TP6 A;  1OPY A;  3HZP A;  2XSH B;  5BXQ A;  5CF1 A;  3NXJ A;  1W00 A;  1Z1S A;  3T8U A;  1DMN A;  4XDW A;  4HM0 B;  4HM1 B;  3SOA A;  3FSD A;  3FZW A;  2YFJ B;  4HM2 B;  4HZB B;  3CNX A;  2HML B;  4KVH A;  3FGY A;  1OGZ A;  2Z76 A;  4I4K A;  3OWY A;  4WP5 A;  3JUN A;  4X2O A;  3CNM A;  5IG3 A;  2B24 B;  5IER A;  3KSP A;  4K1V A;  5AEW B;  5AI1 A;  2HMM B;  2PZV A;  5KP3 A;  1ISK A;  2OWP A;  3RGR A;  3FF0 A;  4R1K A;  5KP1 A;  3NV0 A;  1DMQ A;  2IMJ A;  3NBR A;  1OUN A;  4XM4 A;  5IG4 A;  1NDO B;  3T8N A;  3NV0 B;  1UUV B;  3F9S A;  4HM3 B;  3OXA A;  2YFI B;  4L8O A;  1HKX A;  3WMD A;  2HMN B;  1JN5 B;  1E97 A;  3B7C A;  2XSO B;  1ULJ B;  3ECF A;  3SOY A;  3Q90 A;  3BB9 A;  3S5C A;  4X2H A;  1STD A;  2RGQ A;  3OX9 A;  3NUV A;  3EN8 A;  1GYB A;  3B4O A;  1IDP A;  7STD A;  1VZZ A;  2HMO B;  4J9A A;  5D82 A;  5EVH A;  3LYG A;  2HMK B;  3G16 A;  2GBX B;  5JPP A;  5IF6 A;  1ZO2 A;  5DRV A;  3E99 A;  1TUH A;  4LEH A;  4HZ9 B;  1JKG A;  2GEY A;  4L7K A;  3GZX B;  2K54 A;  3G8Z A;  5BVB A;  3RGA A;  3STD A;  3EC9 A;  2STD A;  3EF8 A;  4IIA A;  3EBT A;  2HMJ B;  1JKG B;  1O7N B;  1OHO A;  3DZL A;  4PEJ A;  1OHP A;  2GXF A;  3F7S A;  5AIF A;  4J8T A;  2F99 A;  3B8L A;  3EX9 A;  3JUP A;  5DRE A;  1UUW B;  4RZM A;  3M8C A;  4R9L A;  4LGQ A;  3A76 A; 
#chains in the Genus database with same CATH topology
 1NU3 A;  2L1S A;  1FGO A;  1QMA A;  1IU7 A;  3AGO A;  1GD4 A;  1LQG C;  5AIH A;  2P38 A;  1B20 A;  4JF8 A;  1GS3 A;  1T3B A;  1D6U A;  2CFW A;  1O7H B;  3NM2 A;  3HK4 A;  1RTU A;  1OGX A;  5LC6 A;  1LRA A;  1PYL A;  1A2P A;  4HKV B;  1A2K A;  1IQ8 A;  5AIG A;  4DKI A;  1UI7 A;  3JUM A;  3F8X A;  1E3V A;  3HI7 A;  3GWR A;  4G1M B;  4FCM A;  3BNC A;  1IQY A;  1BIR A;  1OCV A;  1W01 A;  1GMR A;  1TRQ A;  1V74 A;  2AAE A;  2RNT A;  3GZB A;  4J5G A;  4CDL A;  3OV4 A;  2Z7A A;  1CQS A;  3WOF B;  4CJN A;  3Q2P A;  3WA3 A;  2OTL 3;  4KFE A;  4L8P A;  4BIR A;  1BAN A;  1IT8 A;  2XF3 A;  4BL2 A;  2AAD A;  2F5W A;  3BIR A;  1MGR A;  2P05 A;  3UJM A;  1X1X A;  3FH1 A;  3KCH A;  3KE7 A;  1FZU A;  3X3X A;  2XGL A;  3DXO A;  3NX0 A;  3Q1C A;  3PCS A;  1W02 A;  4FCZ A;  1RJO A;  2KAA A;  1JN5 A;  2BNG A;  1RGC A;  5CLK A;  4HM8 B;  2M7O A;  1C7H A;  3BLZ A;  1UCK A;  3DGN A;  3PYJ A;  3EHC A;  1I0V A;  4QWT A;  1DYU A;  2WOH A;  4LZI A;  1UDI I;  2LQV A;  4LYL B;  3KII A;  2RFR A;  2KCD A;  3NHX A;  1WQL B;  1YJ9 3;  2ZHX B;  4FCJ A;  2QGU A;  1TFK A;  2FNQ A;  3V98 A;  1EG9 B;  1X1U A;  2D42 A;  4J5K A;  3HX8 A;  3NBB A;  1OH0 A;  1WMO A;  2P0M A;  3MYT A;  3JUO A;  1LNI A;  4EC6 A;  1I3F A;  2WGQ A;  5AEU B;  2INX A;  1M1X B;  3LT9 A;  1LOV A;  1SJW A;  3DGM A;  3PS8 A;  1FGR A;  4ORL A;  3CME 3;  4EBG A;  3GZY B;  3LML A;  4O02 B;  2OOV A;  4EXR A;  1BNI A;  3PCR A;  3UNL A;  2CG0 A;  5HGR A;  4IPB A;  4MJD A;  5LC7 A;  1VQ6 3;  2UX0 A;  5D83 A;  3EBY A;  3F40 A;  5RNT A;  2YFL B;  1VQQ A;  4K1U A;  1GMP A;  2KF5 A;  4N3V A;  1CEW I;  5G2G A;  1J2B A;  2CHC A;  1X1W A;  3KSE D;  4AEQ A;  2H0H A;  3GZR A;  5CXO A;  3WOE B;  3WOD G;  3CPW 2;  3DGO A;  4FR9 A;  1VQO 3;  1VQ5 3;  4U13 A;  2P09 A;  4O8S A;  1VQ8 3;  3FG1 A;  2F4Y A;  1UGH I;  1LOY A;  1BUQ A;  1Q9E A;  1I8V A;  1RCL A;  1V57 A;  2B1X B;  3CPO A;  3KZT A;  1M90 4;  3KKG A;  4XBY A;  1Q40 A;  2F86 B;  3CU3 A;  3D79 A;  4XDV A;  1KC8 4;  2BMR B;  3PGB A;  2RBI A;  4BL3 A;  3LOY A;  3DMC A;  5IEN A;  1RN4 A;  3LTB A;  3UB1 A;  2ZL8 A;  3B4P A;  2XRX B;  2F98 A;  1S5A A;  1V58 A;  1QVG 2;  1GY7 A;  5CF2 A;  1LNH A;  1C54 A;  3SED A;  1T2H A;  1VQK 3;  4OUQ A;  2D1W A;  1JB5 A;  1GY6 A;  3MG2 A;  1GMQ A;  3UL5 A;  1Q40 B;  2CFK A;  1BNR A;  1B2U A;  3MG1 A;  5A0O B;  1K41 A;  1NO3 A;  2V1L A;  1YGE A;  1K28 A;  8RNT A;  3MKI A;  3CD6 3;  3CCV 3;  1JRQ A;  4HAA A;  4WYK A;  5IG5 A;  3D3L A;  1CYV A;  2C11 A;  3IMA B;  2KF6 A;  4LMI A;  2K0M A;  1JBS A;  1ROV A;  1T2I A;  3AMO A;  2YX9 A;  1G0T A;  4WWU C;  2XEP A;  1MWR A;  5D81 A;  2CKF B;  3J7Y d;  2CX1 A;  3D4A A;  4BTW A;  1WMN A;  3WDG B;  5IEO A;  2BMQ B;  4N6O B;  3H51 A;  1X1Y A;  4WYK B;  5JPU A;  2IY2 A;  1Q82 4;  1EKM A;  4FMD A;  1BRS A;  2CWT A;  4ZM8 A;  3JVC A;  1F8N A;  1ZX2 A;  3FF2 A;  3VGN A;  1BRN L;  3S67 A;  1US1 A;  3AMO B;  1IQX A;  1RNT A;  1TFO A;  4XBX A;  1JBR A;  1O7G B;  1W4N A;  2RCD A;  3G0K A;  2JQ5 A;  3FKA A;  4EYC A;  5BU4 A;  1BVI A;  4HOH A;  1YHQ 3;  1Q81 4;  3G71 3;  3I56 3;  2GBW B;  1HU9 A;  1JB2 A;  1YJN 3;  3H3H A;  4KT3 B;  1VQ4 3;  2CWV A;  1GY5 A;  5IEP A;  1S72 3;  3OWS A;  3ALA A;  2CWU A;  3I0Y A;  4CPK A;  2OTJ 3;  2L4V A;  1W6Y A;  3X40 A;  3WA2 X;  4STD A;  3OWU A;  1IK3 A;  5AII A;  1BNF A;  4XBT A;  3GRD A;  1YNV X;  3HIG A;  3LXU X;  1DMM A;  3G4S 3;  1QJG A;  1JV2 B;  2UUG C;  3MPH A;  5IG0 A;  3U1W A;  3U97 A;  1WTH A;  3I55 3;  2FXT A;  3D9R A;  3JUQ A;  3K0Z A;  1Q86 4;  4BU4 A;  4HM7 B;  1JJ2 2;  1JNQ A;  1AQZ A;  4GB5 A;  2W2C A;  2R4I A;  5ELJ A;  2XR8 B;  4RNZ A;  2XFS A;  3ZG0 A;  2GEX A;  5KP4 A;  3ER7 A;  1MWS A;  2BT3 A;  1QAL A;  2CC3 A;  2I9W A;  4FMB A;  2Q07 A;  3QRD A;  3LZA A;  2MF7 A;  1Q42 A;  1HYF A;  4HM6 B;  4BTX A;  1ASK A;  5CK6 A;  1U5O A;  3K9M C;  3MG3 A;  3S29 A;  1RNB A;  2W6J H;  1BNJ A;  3IPT A;  1AVL A;  3F7X A;  3F8H A;  2IUK A;  1STF I;  4GHO A;  2OQE A;  1RGH A;  2QIY A;  3F14 A;  3T0U A;  6STD A;  1ROA A;  3A5E A;  3L0R A;  1GOU A;  3AGN A;  3S28 A;  1LVN A;  3DUK A;  1IV7 A;  1KQS 2;  1SQW A;  1MOL A;  1KWI A;  1NWW A;  3K63 A;  3AHS A;  4O3V A;  5FW5 A;  4HVN A;  1NB5 I;  3BND A;  1PY3 A;  2R41 A;  3CMA 3;  3VSY A;  5TGN A;  4R9K A;  4K61 A;  1GSP A;  1BOX A;  5JBS A;  1RGA A;  3ROB A;  3SXX A;  3O8Y A;  1YI2 3;  1I70 A;  2Z77 A;  1FUW A;  2A15 A;  1TIJ A;  3TDG A;  2Y74 A;  1EA2 A;  2XFT A;  4IT7 A;  4HM5 B;  1ULI B;  1Y4K A;  1N5H A;  4OVM A;  3X42 A;  1Q7H A;  3G6E 3;  4H3U A;  3BNB A;  1K9M 4;  1K8A 4;  1Q7Y 4;  2P0X A;  5FGO A;  2OOV C;  3RDE A;  3GAX A;  3OW2 2;  1B2X A;  1RGF A;  5M1A A;  1O7P B;  3FG4 A;  2ML6 A;  1YJW 3;  2BMO B;  3CCU 3;  1BRK A;  5AYS C;  1N9E A;  3EJV A;  3QK9 A;  3N8B A;  2F5M A;  1O7W B;  1OF5 A;  1UGI A;  1YIJ 3;  1BNS A;  3FLJ A;  4HJL B;  5STD A;  1SII A;  2CFG A;  4LSO A;  8CHO A;  3LH4 A;  3NM7 A;  3RNT A;  3CCE 3;  3MHE A;  1MWU A;  4XB5 A;  3K7C A;  1OHS A;  1FUS A;  5IW9 A;  3PZW A;  3LTD A;  5AYR B;  1IVX A;  1AR0 A;  1N9J A;  1JBT A;  2Y73 A;  1I2F A;  3EQQ B;  2E2T A;  1FGQ A;  1OF5 B;  1JB4 A;  4Q53 A;  3DM8 A;  3EN1 B;  3MSO A;  1O7M B;  1U8C B;  2BU4 A;  4TX4 A;  4HM4 B;  2GU1 A;  1E3R A;  1I2G A;  1IVV A;  1W2B 2;  1TP6 A;  1OPY A;  3HZP A;  1I0X A;  2XSH B;  5BXQ A;  1RN7 A;  1BNE A;  3MWZ A;  5CF1 A;  3CC7 3;  1FA3 A;  3CC2 3;  1MNL A;  1UI8 A;  2CX0 A;  4N6T A;  3LT8 A;  3NXJ A;  1W00 A;  1W7C A;  5I97 A;  1Z1S A;  1UW1 A;  1BSB A;  1LOW A;  2RSX A;  1DMN A;  4MMX B;  4XDW A;  1RN1 A;  4HM0 B;  3T8U A;  3X3Y A;  4NPB A;  5EQL A;  4HM1 B;  2IYJ A;  4JRF A;  3SOA A;  3EE1 A;  1RRL A;  1RGE A;  2BIR A;  3EB8 A;  3FSD A;  1VQ9 3;  3DGY A;  1D6Y A;  1AV4 A;  2HOH A;  1N8Q A;  2CFL A;  3CCQ 3;  3FZW A;  2C10 A;  4KFF A;  2YFJ B;  3ZFZ A;  4HM2 B;  1BSE A;  3DGL A;  1TU5 A;  5M18 A;  2CIU A;  1WNH A;  4HZB B;  1BRJ A;  4ILF A;  3SLU A;  3CNX A;  1BAO A;  2HML B;  1QAF A;  4KVH A;  1JZO A;  1AVK A;  4RNY A;  1RMS A;  2XGN A;  3BU4 A;  1BNG A;  3AHW A;  1LXE A;  4GSP A;  3FGY A;  2IUJ A;  1OGZ A;  2Z76 A;  3X3Z A;  4NRE A;  4I4K A;  3OWY A;  4WP5 A;  3LTA A;  3JUN A;  2F56 A;  1QVF 2;  2ZA4 A;  2WO0 A;  3DY5 A;  3N54 B;  1VQL 3;  4N6M A;  1YIT 3;  3DH2 A;  4X2O A;  2CG1 A;  1W6G A;  1RGK A;  3CNM A;  2Z6B A;  5IG3 A;  2H0I A;  1D6Z A;  1HZ1 A;  2B24 B;  2UGI A;  5IER A;  3KSP A;  2GU3 A;  2IA7 A;  4K1V A;  1VQN 3;  2W03 A;  5AEW B;  2O9U X;  1IVW A;  1ZS7 A;  5G1K A;  4AKZ A;  5AI1 A;  2QA4 3;  3D5I A;  4N6L A;  1W5Z A;  7RNT A;  2HMM B;  3Q3F A;  2PZV A;  1GD3 A;  1B21 A;  1ZGX A;  2OWP A;  5KP3 A;  3RGR A;  4EV2 A;  3CCS 3;  1N8R 4;  1VQ7 3;  1ISK A;  3FF0 A;  4R1K A;  3ZG5 A;  5KP1 A;  3V99 A;  3CXC 2;  2BO9 B;  1TRP A;  1SIH A;  3BNE A;  3NV0 A;  2QEX 3;  1DMQ A;  2WOF A;  1RDS A;  1RSN A;  3IJE B;  4BTY A;  2BHM A;  5M19 A;  1G96 A;  1W2Z A;  1A90 A;  2IMJ A;  1NB3 I;  4I5Q A;  1FUT A;  3NBR A;  3NQZ A;  3SVA A;  1OUN A;  1OAC A;  2CK3 H;  3S27 A;  1DET A;  4XM4 A;  1LQM B;  6RNT A;  5IG4 A;  1NDO B;  3GSP A;  1SPU A;  1IVU A;  3T8N A;  1FYS A;  3NV0 B;  1UUV B;  2FGT A;  1I3I A;  1AY7 A;  2K3D A;  3F9S A;  3WHO A;  2GSP A;  9RNT A;  4HM3 B;  3OXA A;  4R80 A;  2YFI B;  3NBJ A;  2W9Q A;  4L8O A;  1HKX A;  1VQM 3;  4EW5 A;  2E2U A;  1VQP 3;  1EQK A;  1BRG A;  3WMD A;  2OQE C;  2HMN B;  1JN5 B;  2OCT A;  1E97 A;  1M9G A;  2XSO B;  1ULJ B;  1B27 A;  1BSD A;  2C4B A;  3B7C A;  3ECF A;  3HII A;  1KD1 4;  4OK0 A;  1EUI C;  1BUJ A;  1B2S A;  3SOY A;  1IT7 A;  3Q90 A;  2CH9 A;  1NNV A;  1UCI A;  3NQY A;  1I2E A;  1QAK A;  1BSA A;  2SBL A;  1YGW A;  3K5T A;  2JDI H;  1TJD A;  3BB9 A;  2W56 A;  3S5C A;  4X2H A;  1YVS A;  2WGO A;  1DE3 A;  4H61 A;  3V92 A;  1RCK A;  3FCS B;  1PFP A;  1STD A;  1UCL A;  2RGQ A;  3D5G A;  1BGS A;  3KFQ C;  3OX9 A;  3X41 A;  6GSP A;  3NUV A;  4MEI A;  1R4Y A;  1RHL A;  4EV5 A;  4WHA A;  2ML5 A;  1WMP A;  5GSP A;  1SAR A;  4NHF A;  3EN8 A;  1GYB A;  2MC8 A;  5G1L A;  1G02 A;  4K90 B;  1PU4 A;  4MMY B;  1BRI A;  2W56 B;  3B4O A;  1KSI A;  1IDP A;  7STD A;  1VZZ A;  1TTO A;  2HMO B;  4J9A A;  5D82 A;  5EVH A;  2H0G A;  2W0Q A;  3LYG A;  1IYY A;  2HMK B;  1CYU A;  1FGM A;  3LTC A;  1K73 4;  1FGT A;  4FMC A;  3G16 A;  2GBX B;  5JPP A;  5IF6 A;  4HYZ A;  2KF4 A;  1YVB I;  1M1K 4;  1ZO2 A;  3SYU A;  4MMZ B;  2J8X B;  1IV9 A;  2KXG A;  3UL6 A;  4RNT A;  4RBN A;  1B3S A;  1T5Y A;  5DRV A;  3E99 A;  4HBR A;  1RGG A;  3CCR 3;  1TUH A;  4KFD A;  4LEH A;  2CW9 A;  1CH0 A;  4HZ9 B;  3CCM 3;  1JKG A;  2O3O A;  2ZDJ A;  2GEY A;  3FG3 A;  4L7K A;  3GZX B;  2K54 A;  3G8Z A;  5ELU A;  1EEJ A;  4R4K A;  5HOH A;  3PXM A;  5BVB A;  1BSC A;  1A2V A;  3RGA A;  3STD A;  2PNC A;  2STD A;  3EC9 A;  4AKY A;  3CCL 3;  3EF8 A;  1N5P A;  4IIA A;  2W04 A;  2W9P A;  3WR2 A;  2SAR A;  3SX1 A;  3EBT A;  1DVD A;  2KF3 A;  2KRT A;  1JZD A;  4WFO A;  3HOH A;  1RRH A;  4FMA A;  1A67 A;  1UUG B;  2HMJ B;  1JKG B;  3VF1 A;  1GOY A;  1O7N B;  1OHO A;  5EEO A;  5BIR A;  1GOV A;  1B2M A;  4CCV A;  3DZL A;  7GSP A;  1RLS A;  4GL6 A;  4KZ1 A;  4PEJ A;  1RKY A;  1OHP A;  4O2H A;  2GXF A;  1BU4 A;  1W6C A;  3F7S A;  4N6U A;  5AIF A;  1RGL A;  1NJI 4;  4J8T A;  1MWT A;  3N9H A;  2XH9 A;  2CFD A;  2F99 A;  1UCJ A;  3URP A;  3B8L A;  2E2V A;  1L5G B;  3EX9 A;  3JUP A;  5DRE A;  1MGW A;  2LYX A;  1B2Z A;  1UUW B;  3KN4 A;  4RZM A;  3CC4 3;  1FW7 A;  1DVC A;  1BRH A;  1LOX A;  3M8C A;  4R9L A;  4N6V 0;  4LGQ A;  3A76 A;  4N6N B;  3CCJ 3;  1R4C A; 
#chains in the Genus database with same CATH homology
 1NU3 A;  1FGO A;  1QMA A;  1IU7 A;  5AIH A;  1GD4 A;  2P38 A;  4JF8 A;  1GS3 A;  1D6U A;  2CFW A;  1O7H B;  3NM2 A;  3HK4 A;  5LC6 A;  1OGX A;  4HKV B;  1A2K A;  1IQ8 A;  5AIG A;  1UI7 A;  3JUM A;  3F8X A;  1E3V A;  3HI7 A;  3GWR A;  4G1M B;  4FCM A;  3BNC A;  1IQY A;  1W01 A;  1OCV A;  3GZB A;  1V74 A;  2MC8 A;  4CDL A;  3OV4 A;  2Z7A A;  1CQS A;  3WOF B;  3WA3 A;  3Q2P A;  2OTL 3;  4KFE A;  4L8P A;  1IT8 A;  2XF3 A;  2P05 A;  3UJM A;  3FH1 A;  3KE7 A;  3X3X A;  2XGL A;  3DXO A;  3NX0 A;  3Q1C A;  3PCS A;  1W02 A;  4FCZ A;  1RJO A;  1JN5 A;  2BNG A;  5CLK A;  4HM8 B;  2M7O A;  1C7H A;  3BLZ A;  3DGN A;  3PYJ A;  3EHC A;  4QWT A;  1DYU A;  2WOH A;  4LZI A;  2LQV A;  3KII A;  2RFR A;  2KCD A;  3NHX A;  1WQL B;  1YJ9 3;  4FCJ A;  2QGU A;  1TFK A;  2FNQ A;  3V98 A;  1EG9 B;  2D42 A;  3HX8 A;  3NBB A;  1OH0 A;  1WMO A;  2P0M A;  3MYT A;  3JUO A;  4EC6 A;  2WGQ A;  5AEU B;  2INX A;  1M1X B;  3LT9 A;  1SJW A;  3DGM A;  3PS8 A;  1FGR A;  4ORL A;  3CME 3;  4EBG A;  3GZY B;  3LML A;  4O02 B;  2OOV A;  4EXR A;  3PCR A;  3UNL A;  2CG0 A;  5HGR A;  4IPB A;  4MJD A;  5LC7 A;  1VQ6 3;  2UX0 A;  5D83 A;  3EBY A;  3F40 A;  2YFL B;  4K1U A;  4N3V A;  5G2G A;  1CEW I;  1J2B A;  2CHC A;  4AEQ A;  3KSE D;  3GZR A;  5CXO A;  3WOE B;  3WOD G;  3CPW 2;  3DGO A;  4FR9 A;  1VQO 3;  1VQ5 3;  4U13 A;  2P09 A;  4O8S A;  1VQ8 3;  3FG1 A;  1BUQ A;  3CPO A;  2B1X B;  3KZT A;  1M90 4;  3KKG A;  4XBY A;  1Q40 A;  2F86 B;  3CU3 A;  1KC8 4;  4XDV A;  2BMR B;  3PGB A;  3LOY A;  3DMC A;  5IEN A;  3LTB A;  3UB1 A;  2ZL8 A;  3B4P A;  2XRX B;  2F98 A;  1S5A A;  1QVG 2;  1GY7 A;  5CF2 A;  1LNH A;  3SED A;  1VQK 3;  4OUQ A;  2D1W A;  1JB5 A;  1GY6 A;  3MG2 A;  3UL5 A;  1Q40 B;  2CFK A;  3MG1 A;  5A0O B;  1K41 A;  1NO3 A;  2V1L A;  1YGE A;  1K28 A;  3MKI A;  3CD6 3;  3CCV 3;  1JRQ A;  5IG5 A;  4WYK A;  3D3L A;  1CYV A;  2C11 A;  3IMA B;  4LMI A;  2K0M A;  1ROV A;  3AMO A;  2YX9 A;  4WWU C;  2XEP A;  5D81 A;  2CKF B;  3J7Y d;  4BTW A;  1WMN A;  3WDG B;  5IEO A;  2BMQ B;  4N6O B;  3H51 A;  4WYK B;  5JPU A;  1Q82 4;  1EKM A;  4FMD A;  2CWT A;  4ZM8 A;  3JVC A;  1F8N A;  1ZX2 A;  3FF2 A;  3VGN A;  3S67 A;  1US1 A;  3AMO B;  1IQX A;  1TFO A;  4XBX A;  1O7G B;  1W4N A;  2RCD A;  3G0K A;  2JQ5 A;  3FKA A;  4EYC A;  1YHQ 3;  1Q81 4;  3G71 3;  3I56 3;  2GBW B;  1HU9 A;  1JB2 A;  1YJN 3;  3H3H A;  1VQ4 3;  2CWV A;  1GY5 A;  5IEP A;  1S72 3;  3OWS A;  3ALA A;  2CWU A;  3I0Y A;  2OTJ 3;  2L4V A;  1W6Y A;  3X40 A;  3WA2 X;  4STD A;  3OWU A;  1IK3 A;  5AII A;  4XBT A;  3GRD A;  3HIG A;  3LXU X;  1DMM A;  3G4S 3;  1QJG A;  1JV2 B;  5IG0 A;  3MPH A;  3U1W A;  3U97 A;  1WTH A;  3I55 3;  2FXT A;  3D9R A;  3JUQ A;  3K0Z A;  1Q86 4;  4HM7 B;  1JJ2 2;  1JNQ A;  4GB5 A;  2W2C A;  2R4I A;  5ELJ A;  2XR8 B;  4RNZ A;  2XFS A;  2GEX A;  5KP4 A;  3ER7 A;  2BT3 A;  1QAL A;  2CC3 A;  2I9W A;  4FMB A;  2Q07 A;  3QRD A;  3LZA A;  2MF7 A;  1Q42 A;  4HM6 B;  4BTX A;  1ASK A;  5CK6 A;  1U5O A;  3K9M C;  3MG3 A;  3S29 A;  2W6J H;  3IPT A;  1AVL A;  3F7X A;  3F8H A;  2IUK A;  1STF I;  2OQE A;  2QIY A;  3T0U A;  3F14 A;  6STD A;  1ROA A;  3L0R A;  3S28 A;  1LVN A;  3DUK A;  1IV7 A;  1KQS 2;  1SQW A;  1MOL A;  1KWI A;  1NWW A;  3K63 A;  4O3V A;  5FW5 A;  4HVN A;  1NB5 I;  3BND A;  3CMA 3;  3VSY A;  5TGN A;  4R9K A;  4K61 A;  5JBS A;  3ROB A;  3SXX A;  3O8Y A;  1YI2 3;  2Z77 A;  1FUW A;  2A15 A;  1TIJ A;  3TDG A;  2Y74 A;  1EA2 A;  2XFT A;  4IT7 A;  4HM5 B;  1ULI B;  1Y4K A;  1N5H A;  4OVM A;  3X42 A;  3G6E 3;  4H3U A;  3BNB A;  1K9M 4;  1K8A 4;  1Q7Y 4;  2P0X A;  5FGO A;  2OOV C;  3RDE A;  3GAX A;  3OW2 2;  1O7P B;  3FG4 A;  2ML6 A;  1YJW 3;  2BMO B;  3CCU 3;  5AYS C;  1N9E A;  3EJV A;  3QK9 A;  3N8B A;  1O7W B;  1OF5 A;  1YIJ 3;  1EQK A;  4HJL B;  3FLJ A;  5STD A;  1SII A;  2CFG A;  4LSO A;  8CHO A;  3LH4 A;  3NM7 A;  3CCE 3;  3MHE A;  4XB5 A;  3K7C A;  1OHS A;  5IW9 A;  3PZW A;  3LTD A;  5AYR B;  1IVX A;  1AR0 A;  1N9J A;  2Y73 A;  3EQQ B;  2E2T A;  1FGQ A;  1OF5 B;  1JB4 A;  4Q53 A;  3DM8 A;  3EN1 B;  3MSO A;  1O7M B;  1U8C B;  4TX4 A;  4HM4 B;  2GU1 A;  1E3R A;  1IVV A;  1W2B 2;  1TP6 A;  1OPY A;  3HZP A;  2XSH B;  5BXQ A;  1RN7 A;  3MWZ A;  5CF1 A;  3CC7 3;  1FA3 A;  3CC2 3;  1MNL A;  1UI8 A;  4N6T A;  3LT8 A;  3NXJ A;  1W00 A;  1W7C A;  5I97 A;  1Z1S A;  1UW1 A;  2RSX A;  3T8U A;  1DMN A;  4MMX B;  4XDW A;  4HM0 B;  3X3Y A;  5EQL A;  4HM1 B;  4JRF A;  3SOA A;  3EE1 A;  1RRL A;  3EB8 A;  3FSD A;  1VQ9 3;  1D6Y A;  1AV4 A;  1N8Q A;  2CFL A;  3CCQ 3;  3FZW A;  2C10 A;  4KFF A;  2YFJ B;  4HM2 B;  3DGL A;  1TU5 A;  2CIU A;  1WNH A;  4HZB B;  3SLU A;  3CNX A;  2HML B;  4KVH A;  1QAF A;  1AVK A;  4RNY A;  2XGN A;  1LXE A;  3FGY A;  2IUJ A;  1OGZ A;  2Z76 A;  3X3Z A;  4NRE A;  4I4K A;  3OWY A;  4WP5 A;  3LTA A;  3JUN A;  1QVF 2;  3DY5 A;  2WO0 A;  3N54 B;  1VQL 3;  4N6M A;  1YIT 3;  4X2O A;  2CG1 A;  1W6G A;  3CNM A;  2Z6B A;  5IG3 A;  1D6Z A;  2B24 B;  5IER A;  3KSP A;  2GU3 A;  2IA7 A;  4K1V A;  1VQN 3;  2W03 A;  5AEW B;  2O9U X;  1IVW A;  4AKZ A;  5AI1 A;  2QA4 3;  4N6L A;  1W5Z A;  2HMM B;  2PZV A;  1GD3 A;  5KP3 A;  1ISK A;  2OWP A;  4EV2 A;  3RGR A;  3CCS 3;  1N8R 4;  1VQ7 3;  3FF0 A;  4R1K A;  5KP1 A;  3V99 A;  3CXC 2;  2BO9 B;  3BNE A;  1SIH A;  3NV0 A;  2QEX 3;  1DMQ A;  2WOF A;  4BTY A;  3IJE B;  2BHM A;  1G96 A;  1W2Z A;  1A90 A;  2IMJ A;  1NB3 I;  3NBR A;  3NQZ A;  3SVA A;  1OUN A;  1OAC A;  2CK3 H;  3S27 A;  4XM4 A;  5IG4 A;  1NDO B;  1SPU A;  1IVU A;  3T8N A;  3NV0 B;  1UUV B;  2FGT A;  3F9S A;  4HM3 B;  3OXA A;  4R80 A;  2YFI B;  3NBJ A;  2W9Q A;  4L8O A;  1HKX A;  1VQM 3;  1VQP 3;  2E2U A;  3WMD A;  2OQE C;  2HMN B;  1JN5 B;  2OCT A;  1E97 A;  1M9G A;  2XSO B;  1ULJ B;  3B7C A;  3HII A;  1KD1 4;  3ECF A;  4OK0 A;  3SOY A;  1IT7 A;  3Q90 A;  2CH9 A;  3NQY A;  1QAK A;  2SBL A;  3K5T A;  2JDI H;  3BB9 A;  2W56 A;  3S5C A;  4X2H A;  2WGO A;  4H61 A;  3V92 A;  3FCS B;  1PFP A;  1STD A;  2RGQ A;  3KFQ C;  3X41 A;  3OX9 A;  3NUV A;  4MEI A;  4EV5 A;  4WHA A;  2ML5 A;  1WMP A;  4NHF A;  3EN8 A;  1GYB A;  4K90 B;  1PU4 A;  4MMY B;  2W56 B;  3B4O A;  1KSI A;  1IDP A;  7STD A;  1VZZ A;  2HMO B;  4J9A A;  5D82 A;  5EVH A;  2W0Q A;  3LYG A;  2HMK B;  1CYU A;  1FGM A;  3LTC A;  1K73 4;  1FGT A;  4FMC A;  3G16 A;  2GBX B;  5JPP A;  5IF6 A;  4HYZ A;  1YVB I;  1M1K 4;  1ZO2 A;  4MMZ B;  3UL6 A;  1IV9 A;  2KXG A;  4RBN A;  1T5Y A;  5DRV A;  3E99 A;  4HBR A;  3CCR 3;  1TUH A;  4KFD A;  4LEH A;  2CW9 A;  3CCM 3;  4HZ9 B;  1JKG A;  2O3O A;  2ZDJ A;  2GEY A;  3FG3 A;  4L7K A;  3GZX B;  2K54 A;  3G8Z A;  5ELU A;  4R4K A;  3PXM A;  5BVB A;  3RGA A;  1A2V A;  3STD A;  3CCL 3;  2PNC A;  2STD A;  3EC9 A;  4AKY A;  3EF8 A;  1N5P A;  4IIA A;  2W04 A;  2W9P A;  3SX1 A;  3EBT A;  1DVD A;  2KRT A;  4WFO A;  1RRH A;  4FMA A;  1A67 A;  2HMJ B;  1JKG B;  3VF1 A;  1O7N B;  1OHO A;  5EEO A;  4CCV A;  3DZL A;  4GL6 A;  4KZ1 A;  4PEJ A;  1RKY A;  1OHP A;  4O2H A;  2GXF A;  3F7S A;  1W6C A;  4N6U A;  5AIF A;  1NJI 4;  4J8T A;  3N9H A;  2XH9 A;  2CFD A;  2F99 A;  3B8L A;  2E2V A;  1L5G B;  3EX9 A;  3JUP A;  5DRE A;  2LYX A;  3CC4 3;  1UUW B;  3KN4 A;  4RZM A;  1DVC A;  1LOX A;  3M8C A;  4R9L A;  4N6V 0;  4LGQ A;  3A76 A;  4N6N B;  3CCJ 3;  1R4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...