4XBYA

Crystal structure of the l74f/m78v/i80v/l114f mutant of leh complexed with cyclopentene oxide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
144
structure length
144
Chain Sequence
IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFTVVSVDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNFSILGVFQLTEGKITGWRDYFDLREFEEAVDLPLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Reshaping an Enzyme Binding Pocket for Enhanced and Inverted Stereoselectivity: Use of Smallest Amino Acid Alphabets in Directed Evolution
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 39
structure length 144
sequence length 144
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4xbyA00
2PZVA 3HX8A 1ULIB 1ZO2A 5DRVA 4LEHA 4HM8B 1WQLB 2Z76A 5BVBA 3DM8A 5JPPA 3LYGA 5HGRA 3MYTA 5IG0A 4XDWA 4WYKB 3ER7A 3NM2A 3KZTA 3VSYA 4HJLB 7STDA 2F98A 3FLJA 3FGYA 3BLZA 4HKVB 1OF5B 2W2CA 1NU3A 1O7PB 1SJWA 3WMDA 2F86B 3M8CA 2IMJA 3NBRA 2HMOB 4HM2B 2RGQA 2STDA 3F40A 2CKFB 3KE7A 4HM0B 2BMRB 3OWUA 5IF6A 2BMQB 1JB2A 1IDPA 5CK6A 3EF8A 5CF1A 4KVHA 1Z1SA 5KP4A 2F99A 3EHCA 4XBTA 5BXQA 3GZBA 4HM5B 4STDA 3ECFA 4WWUC 2B1XB 2HMJB 3SOYA 3JUPA 2UX0A 1ULJB 1Q40A 4HM7B 2CHCA 1JN5A 3Q90A 3JUMA 5AIHA 3F7XA 4LMIA 4XM4A 1OCVA 3H51A 4N3VA 4RZMA 3T8UA 1O7HB 3MG2A 1OHOA 3GZRA 4R1KA 4J9AA 3BB9A 3E99A 3OWYA 3I0YA 1ISKA 1EA2A 3D9RA 4L8PA 1NDOB 3S5CA 5AIIA 2QIYA 4H3UA 3GZXB 2BNGA 3EBTA 3OX9A 1ASKA 3F9SA 3B4PA 3JUNA 3DZLA 3DUKA 3RGRA 3G16A 3H3HA 4J8TA 2K54A 5D82A 1C7HA 1BUQA 1EG9B 3G0KA 3UNLA 4HM1B 2B24B 3FF0A 4LGQA 5IEOA 5AEUB 3NV0A 4HM4B 2Z7AA 2GBXB 3CNMA 3OV4A 3EN8A 4XB5A 5STDA 5IERA 2GXFA 1STDA 5AIGA 2XSHB 3CNXA 1DMNA 5D83A 1JKGA 1O7WB 2Z77A 3FKAA 4HVNA 3JUOA 4FCJA 1GS3A 2GEYA 2HMMB 4X2HA 3EC9A 2QGUA 4GB5A 3LZAA 3KKGA 5KP1A 2INXA 3RGAA 3T8NA 1UUWB 1E97A 3F8HA 3B7CA 1UUVB 3HK4A 2JQ5A 5CLKA 1GY7A 4K1UA 3EQQB 3SEDA 4I4KA 4Q53A 6STDA 4HM6B 3IPTA 3CPOA 1NWWA 3FH1A 4OVMA 2HMKB 4WYKA 4L8OA 3GWRA 1JB5A 1JB4A 2BMOB 2YFLB 4XBXA 2YFJB 4CDLA 3DXOA 4X2OA 5TGNA 5IG5A 3F8XA 1U5OA 2XRXB 4WP5A 3MG3A 1GY5A 1OF5A 3SOAA 1ZX2A 4OUQA 2GEXA 2GBWB 5IG4A 1DMMA 3STDA 1Q42A 1O7MB 2A15A 1W00A 2XSOB 3FSDA 5KP3A 1OHPA 1W02A 2OWPA 4MJDA 3DMCA 3EJVA 1AR0A 4ORLA 1Q40B 4L7KA 2R4IA 1JN5B 3MSOA 5FW5A 1OGZA 3OXAA 1S5AA 5IEPA 1E3VA 4IIAA 3UJMA 5CF2A 5EVHA 3B4OA 4XBYA 1E3RA 1O7NB 4R9KA 1O7GB 1GYBA 1OGXA 3EN1B 4R9LA 4PEJA 5AIFA 1W01A 1QMAA 3F14A 3JUQA 2RFRA 4FCMA 5D81A 1TUHA 3MHEA 4U13A 5IG3A 1OPYA 5IENA 5DREA 5AEWB 3A76A 5G2GA 4HZBB 3NUVA 3OWSA 3KSPA 1GY6A 3GZYB 4HM3B 3ROBA 3K7CA 4HZ9B 5AI1A 1HKXA 5CXOA 1CQSA 8CHOA 4XDVA 2RCDA 2YFIB 3VGNA 3NXJA 1DMQA 3NHXA 2XR8B 3HZPA 3NV0B 1QJGA 5JPUA 3B8LA 3EX9A 3EBYA 1TP6A 3G8ZA 1A2KA 1W6YA 2I9WA 3K0ZA 3FZWA 1OHSA 2HMLB 1JKGB 3MKIA 1OUNA 3FF2A 4K1VA 2HMNB 1K41A 3CU3A 1OH0A 3GRDA 1VZZA 3F7SA 3MG1A
chains in the Genus database with same CATH superfamily
5ELJA 2PZVA 1EEJA 3HX8A 4N6OB 4R80A 1ULIB 4BIRA 1B20A 3LTCA 1ZO2A 1UI8A 5DRVA 1I2EA 4LEHA 3A5EA 4HM8B 1WQLB 1YGWA 5G1KA 2RSXA 2W6JH 2Z76A 2KF6A 3L0RA 1I3IA 1JZOA 3AMOB 1BVIA 5BVBA 3DM8A 2BIRA 3PXMA 2UUGC 2W04A 3LXUX 5JPPA 1Q824 3LT9A 2C11A 3LYGA 1FUWA 4J5KA 2ML6A 3CPW2 5HGRA 4FCZA 2P38A 3MYTA 4XDWA 5IG0A 4WYKB 1BRJA 2WGQA 3UB1A 4R4KA 3G4S3 1TRPA 2W03A 3ER7A 4ILFA 1WTHA 3X40A 3NM2A 4O8SA 1Q864 3KZTA 2ZHXB 2J8XB 1Q7Y4 4MEIA 1N9JA 2LQVA 2FGTA 2GU1A 3VSYA 4DKIA 2K3DA 2C4BA 4HJLB 1VQO3 7STDA 3N8BA 1RNBA 2F98A 1YJW3 5M18A 3FLJA 4BTYA 3FGYA 3S67A 4LZIA 4CJNA 3BLZA 5JBSA 4N6MA 1DETA 4BU4A 2CC3A 1OF5B 1NB3I 1NU3A 1O7PB 1WMPA 1B2UA 1SJWA 1UW1A 2IA7A 2W2CA 1RGAA 1UCIA 1W6CA 2F86B 1BRKA 3M8CA 3X3XA 1BNGA 1CYVA 1A67A 2IMJA 3X3YA 1UDII 1HZ1A 3O8YA 2SBLA 3NBRA 3EE1A 1FGTA 2F5WA 1BSBA 3KSED 2HMOB 4HM2B 2H0IA 2RGQA 3VF1A 1K28A 2STDA 1VQ63 3F40A 1YIT3 1R4CA 2CKFB 4BL2A 1RCLA 3KE7A 3TDGA 4HM0B 4FMCA 1ZGXA 4EYCA 1V58A 3DY5A 2BMRB 2CK3H 2OCTA 3DGOA 3OWUA 2OQEC 3MWZA 5EQLA 5IF6A 3CCJ3 2BHMA 1N8R4 6RNTA 2BMQB 2KRTA 1W7CA 3BNBA 1JB2A 1KWIA 1MWRA 3ZG5A 2IUKA 1D6ZA 4RNZA 1IDPA 3Q3FA 5CK6A 3N54B 3EF8A 4EV2A 5CF1A 5IW9A 4KVHA 1Z1SA 3CCQ3 5KP4A 2F99A 4RNYA 3EHCA 3MPHA 2OTJ3 1MWTA 2FXTA 1D6YA 1N5PA 2OQEA 3HIGA 3LTAA 1BUJA 3QK9A 1TIJA 4IPBA 1BU4A 1YI23 1GMPA 1T3BA 1BANA 1EKMA 3ALAA 1IVUA 1OACA 4HKVB 3NBJA 5CF2A 4XBTA 3LH4A 3X42A 2Y73A 1B2ZA 5BXQA 1BAOA 1VQQA 4HYZA 1M904 2D1WA 3I553 1CH0A 3GZBA 4HM5B 4STDA 1RCKA 3ECFA 2XH9A 3FG4A 1MWSA 1LOVA 1QAFA 4WWUC 1B2XA 1LNHA 2B1XB 2HMJB 1TFOA 3WR2A 1B2SA 3SOYA 5EEOA 5RNTA 2PNCA 3HI7A 3JUPA 3WMDA 1RDSA 1TRQA 3WA3A 1A2PA 2UX0A 2XGLA 4MMZB 1ULJB 1K8A4 4QWTA 5FGOA 1Q40A 4HM7B 1B27A 2CHCA 1JN5A 3Q90A 1RGKA 3JUMA 2K0MA 1T2IA 2CFKA 2P0XA 5AIHA 1I8VA 1UCKA 3F7XA 4LMIA 4WFOA 3V92A 1I2GA 4XM4A 6GSPA 1DVDA 1OCVA 2CFWA 1FGQA 3KIIA 4OK0A 1W6GA 1U8CB 1N9EA 4HAAA 3BIRA 1GMQA 3NQZA 1JRQA 1UGHI 3H51A 4EBGA 1K734 4N3VA 4RZMA 4AEQA 3AGOA 1PU4A 3DGMA 3T8UA 1O7HB 1I2FA 2CH9A 2CG0A 1OHOA 2L4VA 3MG2A 3K5TA 3GZRA 3KN4A 3PS8A 3Q2PA 1F8NA 2GSPA 1RGGA 4J9AA 2CFDA 4R1KA 3BB9A 2Q07A 2ML5A 1K9M4 1BSAA 1N8QA 3AHSA 3E99A 3OWYA 3SLUA 2CFGA 1VQ73 3I0YA 1ISKA 1EA2A 3WOEB 3D9RA 4GSPA 4FMAA 1CYUA 4L8PA 3S28A 1IV7A 1NDOB 1BSEA 1LQMB 3EB8A 3X41A 3S5CA 2V1LA 3KFQC 2QIYA 4H3UA 5AIIA 4GL6A 2OTL3 4CPKA 5AYSC 3GZXB 1IK3A 2W56B 2BNGA 1CEWI 2L1SA 1RGEA 3EBTA 3HOHA 3OX9A 2OOVA 3CCL3 1RN7A 2XF3A 1ASKA 1A90A 1FW7A 1LOXA 2GU3A 3B4PA 3F9SA 3KCHA 4K90B 1DVCA 1EQKA 3JUNA 2XEPA 3DZLA 3DUKA 2CG1A 3RGRA 2CWUA 3G16A 3H3HA 1FZUA 1C54A 4J8TA 1BOXA 2K54A 5D82A 4AKZA 4HOHA 1YIJ3 1BRHA 1C7HA 2LYXA 1GOVA 1PYLA 2F56A 1G02A 5M1AA 4GHOA 1IT8A 1YNVX 3OW22 2D42A 2XFTA 1T5YA 3AHWA 3NQYA 2Y74A 1BUQA 2XGNA 1EG9B 3G0KA 3UNLA 1V74A 2CIUA 4HM1B 1B21A 1KSIA 1TTOA 2B24B 1B3SA 3FF0A 2E2TA 4LGQA 1BNRA 5IEOA 1FUSA 5AEUB 1NB5I 3CCV3 3D5GA 3NV0A 4HM4B 4BL3A 2Z7AA 1YJ93 2GBXB 3HIIA 4BTXA 3CNMA 3OV4A 3RDEA 3EN8A 3PCRA 4XB5A 1W2ZA 5STDA 5IERA 1BNSA 2GXFA 4K61A 3CME3 1STDA 5AIGA 2XSHB 1JJ22 1Q9EA 1UCJA 3UL5A 1DE3A 4KT3B 1RRLA 3CNXA 1DMNA 1RGFA 2CWVA 5D83A 3G713 1JKGA 1QVF2 1O7WB 2Z77A 3FKAA 3DGLA 4HVNA 1HU9A 3JUOA 3JVCA 4FCJA 3FG3A 1TJDA 3WA2X 1TFKA 2CX0A 3PGBA 1PFPA 1STFI 3UL6A 1GS3A 2E2UA 4WHAA 2GEYA 2ZL8A 4N6LA 2HMMB 5HOHA 4HBRA 3SX1A 2O9UX 4J5GA 1GSPA 3EC9A 4X2HA 4ZM8A 3URPA 2QGUA 4GB5A 4RNTA 3LZAA 2C10A 1VQ53 3KKGA 5KP1A 1IQYA 1IVXA 1RGCA 2WGOA 3ZFZA 3BNEA 2INXA 3RGAA 7RNTA 3T8NA 5BU4A 5GSPA 1QALA 1M1K4 1LVNA 1I70A 1UUWB 1GD4A 3DH2A 1MGRA 1E97A 3AGNA 3B7CA 3F8HA 3LMLA 1MWUA 1UUVB 1BIRA 1ROAA 1R4YA 2JQ5A 3HK4A 5CLKA 3WDGB 1GY7A 2FNQA 2W9PA 1UI7A 3EQQB 3LTDA 4K1UA 3AMOA 3SEDA 3FG1A 4I4KA 4Q53A 3CCM3 6STDA 1S723 1JBSA 1HYFA 3D5IA 4HM6B 3Q1CA 2JDIH 3IPTA 2WOHA 1FYSA 1SIHA 3CPOA 1NWWA 2KCDA 2M7OA 3FH1A 4OVMA 1UCLA 1NJI4 1IQ8A 1BRSA 1Y4KA 3G6E3 1YGEA 4CCVA 1NNVA 2HMKB 4WYKA 7GSPA 4L8OA 3GWRA 3SYUA 4I5QA 4BTWA 2AAEA 1JB5A 1V57A 1L5GB 1JB4A 3CC73 2BMOB 5M19A 2YFLB 4XBXA 2YFJB 4CDLA 3CCR3 1Q7HA 3DXOA 2KXGA 2BO9B 4X2OA 3WODG 5TGNA 3LOYA 4MMXB 1SPUA 3V99A 5IG5A 2HOHA 1FGMA 2OOVC 1AV4A 3F8XA 1UUGB 4N6V0 1U5OA 1W5ZA 2XRXB 4KFDA 4WP5A 1RKYA 1VQ93 2BT3A 3MG3A 1GY5A 3GSPA 1OF5A 1X1YA 2YX9A 3SOAA 3NM7A 1SARA 3SVAA 3WHOA 1JV2B 2MF7A 2H0GA 1M9GA 1ZX2A 2Z6BA 4OUQA 2GEXA 1RN1A 2GBWB 3LTBA 5IG4A 2P09A 2KF4A 3U1WA 5I97A 1LRAA 1DMMA 3GAXA 3STDA 1KQS2 3I563 1WMOA 1PY3A 1Q42A 1QAKA 2F4YA 1O7MB 2A15A 1RSNA 2E2VA 2MC8A 1IT7A 1SIIA 2CW9A 1WMNA 1N5HA 1RJOA 1ROVA 1RN4A 1X1WA 1IQXA 1W00A 1JBRA 3D3LA 3ZG0A 2XSOB 1JNQA 3FSDA 5KP3A 1OHPA 3CCU3 1W02A 3V98A 3IJEB 1VQN3 2OWPA 4NPBA 5LC6A 4MJDA 1VQ83 3IMAB 2AADA 3DMCA 1BRGA 1AR0A 3EJVA 1RHLA 1BNJA 1LXEA 1TU5A 1RGLA 1JBTA 4ORLA 3BNCA 1GMRA 1Q40B 4L7KA 3CC23 2R4IA 1I0VA 4AKYA 1JN5B 1EUIC 3MSOA 4RBNA 5FW5A 3RNTA 1T2HA 2O3OA 2R41A 1OGZA 1G96A 3K9MC 3OXAA 4KFEA 1Q814 2W9QA 1UGIA 1S5AA 1VQK3 1KC84 5IEPA 2H0HA 1E3VA 4IIAA 1SQWA 1WNHA 2WO0A 3D4AA 3UJMA 1IU7A 5EVHA 4NHFA 4EW5A 1YVBI 2CFLA 2UGIA 3B4OA 1BSCA 4KFFA 4XBYA 1YJN3 3DGYA 1VQL3 1IVVA 1DYUA 1LNIA 1J2BA 1AY7A 1FA3A 4EC6A 2KF3A 3U97A 3BU4A 1YVSA 4EV5A 1X1XA 4EXRA 1E3RA 1QVG2 4MMYB 1O7NB 1ZS7A 1D6UA 4O2HA 3WOFB 2QEX3 4R9KA 1AVLA 1I0XA 1GYBA 1M1XB 1O7GB 1IV9A 1LOYA 1OGXA 2RBIA 2CX1A 1YHQ3 3CC43 3SXXA 1X1UA 3EN1B 4R9LA 4IT7A 4N6TA 1KD14 4PEJA 2SARA 1BNIA 5AIFA 3J7Yd 1A2VA 4KZ1A 1W01A 1GOYA 3FCSB 3CMA3 5BIRA 5A0OB 1RLSA 3NX0A 1QMAA 1FUTA 2ZDJA 3F14A 3X3ZA 3JUQA 1BNFA 2P05A 2RFRA 3T0UA 1IVWA 2WOFA 4FCMA 4N6UA 1US1A 5D81A 1TUHA 5AYRB 3CCS3 1LQGC 1RNTA 3MHEA 3D79A 1VQM3 1LOWA 4U13A 2IUJA 2P0MA 1BNEA 3S27A 1JZDA 2KAAA 3N9HA 5IG3A 3CXC2 1OPYA 1W2B2 5IENA 9RNTA 1RRHA 5DREA 1I3FA 5AEWB 3A76A 2KF5A 5G2GA 4HZBB 2F5MA 2ZA4A 3NUVA 3OWSA 3KSPA 4O3VA 1B2MA 1GY6A 3GZYB 3DGNA 4LSOA 4HM3B 3ROBA 2RNTA 1RGHA 3K7CA 4HZ9B 4TX4A 1HKXA 5AI1A 5CXOA 1CQSA 4G1MB 8CHOA 4H61A 4XDVA 2IYJA 2W0QA 2XFSA 4FMDA 2RCDA 2YFIB 3VGNA 3NXJA 1G0TA 1DMQA 2BU4A 2XR8B 1RMSA 3NHXA 3HZPA 3LT8A 3NV0B 4FMBA 5G1LA 1VQP3 4N6NB 1QJGA 3PZWA 3CCE3 1FGOA 4JRFA 2W56A 1GOUA 5JPUA 3B8LA 1W4NA 1GD3A 3QRDA 3S29A 2QA43 3EX9A 3NBBA 1IYYA 1NO3A 1VQ43 3EBYA 1MNLA 4FR9A 1TP6A 3G8ZA 2CWTA 1MGWA 1A2KA 1W6YA 1AQZA 2I9WA 3K0ZA 3FZWA 1AVKA 1OHSA 2HMLB 3BNDA 1JKGB 3MKIA 1BRNL 4JF8A 3PCSA 1BRIA 3K63A 1OUNA 4O02B 3CD63 3PYJA 1BSDA 1RTUA 8RNTA 2IY2A 4NREA 3FF2A 4K1VA 5ELUA 2HMNB 1K41A 1MOLA 3CU3A 1OH0A 1BGSA 3GRDA 5LC7A 4LYLB 1VZZA 1FGRA 3F7SA 3MG1A
chains in the Genus database with same CATH topology
5ELJA 2PZVA 3HX8A 4N6OB 4R80A 1ULIB 3LTCA 1ZO2A 1UI8A 5DRVA 4LEHA 4HM8B 1WQLB 2RSXA 2W6JH 2Z76A 3L0RA 3AMOB 5BVBA 3DM8A 3PXMA 2W04A 3LXUX 5JPPA 1Q824 3LT9A 2C11A 3LYGA 1FUWA 2ML6A 3CPW2 5HGRA 4FCZA 2P38A 3MYTA 4XDWA 5IG0A 4WYKB 2WGQA 3UB1A 4R4KA 3G4S3 2W03A 3ER7A 1WTHA 3X40A 3NM2A 4O8SA 1Q864 3KZTA 1Q7Y4 4MEIA 1N9JA 2LQVA 2FGTA 2GU1A 3VSYA 4HJLB 1VQO3 7STDA 3N8BA 2F98A 1YJW3 3FLJA 4BTYA 3FGYA 3S67A 4LZIA 3BLZA 5JBSA 4N6MA 2CC3A 1OF5B 1NB3I 1NU3A 1O7PB 1WMPA 2IA7A 1SJWA 1UW1A 2W2CA 3WMDA 2F86B 3M8CA 1W6CA 3X3XA 1CYVA 1A67A 2IMJA 3X3YA 3O8YA 2SBLA 3NBRA 3EE1A 1FGTA 3KSED 2HMOB 4HM2B 2RGQA 3VF1A 1K28A 2STDA 1VQ63 3F40A 1YIT3 1R4CA 2CKFB 3KE7A 3TDGA 4HM0B 4FMCA 4EYCA 3DY5A 2BMRB 2CK3H 2OCTA 3DGOA 3OWUA 2OQEC 3MWZA 5EQLA 5IF6A 3CCJ3 2BHMA 1N8R4 2BMQB 2KRTA 1W7CA 3BNBA 1JB2A 1KWIA 2IUKA 1D6ZA 4RNZA 1IDPA 5CK6A 3N54B 3EF8A 4EV2A 5CF1A 5IW9A 4KVHA 1Z1SA 3CCQ3 5KP4A 2F99A 4RNYA 3EHCA 3MPHA 2OTJ3 2FXTA 1D6YA 1N5PA 2OQEA 3HIGA 3LTAA 3QK9A 1TIJA 4IPBA 1YI23 4HKVB 1EKMA 3ALAA 1IVUA 1OACA 3NBJA 4XBTA 3LH4A 3X42A 2Y73A 5BXQA 1M904 4HYZA 2D1WA 3I553 3GZBA 4HM5B 4STDA 3ECFA 2XH9A 3FG4A 1QAFA 4WWUC 1LNHA 2B1XB 2HMJB 1TFOA 3SOYA 5EEOA 2PNCA 3HI7A 3JUPA 3WA3A 2UX0A 2XGLA 4MMZB 1ULJB 1K8A4 4QWTA 5FGOA 1Q40A 4HM7B 2CHCA 1JN5A 3Q90A 3JUMA 2K0MA 2CFKA 2P0XA 5AIHA 3F7XA 4LMIA 4WFOA 3V92A 1DVDA 4XM4A 1OCVA 2CFWA 1FGQA 3KIIA 4OK0A 1W6GA 1U8CB 1N9EA 3NQZA 1JRQA 3H51A 4EBGA 1K734 4N3VA 4RZMA 4AEQA 1PU4A 3DGMA 3T8UA 1O7HB 3PS8A 2CH9A 2CG0A 1OHOA 2L4VA 3MG2A 3K5TA 3GZRA 3KN4A 3Q2PA 4J9AA 1F8NA 4R1KA 2CFDA 3BB9A 2Q07A 2ML5A 1K9M4 1N8QA 3SLUA 1VQ73 3E99A 3OWYA 2CFGA 3I0YA 1ISKA 1EA2A 3WOEB 3D9RA 4FMAA 1CYUA 4L8PA 3S28A 1IV7A 1NDOB 3EB8A 3X41A 3S5CA 2V1LA 3KFQC 2QIYA 4H3UA 5AIIA 4GL6A 2OTL3 5AYSC 3GZXB 1IK3A 2W56B 2BNGA 1CEWI 3EBTA 2OOVA 3OX9A 3CCL3 1RN7A 2XF3A 1ASKA 1A90A 1LOXA 2GU3A 3B4PA 3F9SA 4K90B 1DVCA 1EQKA 3JUNA 2XEPA 3DZLA 3DUKA 2CG1A 3RGRA 2CWUA 3G16A 3H3HA 4J8TA 2K54A 4AKZA 5D82A 1YIJ3 1C7HA 2LYXA 3OW22 1IT8A 2D42A 2XFTA 1T5YA 3NQYA 2Y74A 1BUQA 2XGNA 1EG9B 3G0KA 3UNLA 1V74A 2CIUA 4HM1B 1KSIA 2B24B 3FF0A 2E2TA 4LGQA 5IEOA 5AEUB 1NB5I 3CCV3 3NV0A 4HM4B 2Z7AA 1YJ93 2GBXB 3HIIA 4BTXA 3CNMA 3OV4A 3RDEA 3EN8A 3PCRA 4XB5A 1W2ZA 5STDA 5IERA 2GXFA 4K61A 3CME3 1STDA 5AIGA 2XSHB 1JJ22 3UL5A 1RRLA 3CNXA 1DMNA 2CWVA 5D83A 3G713 1JKGA 1QVF2 1O7WB 2Z77A 3FKAA 3DGLA 4HVNA 1HU9A 3JUOA 3JVCA 4FCJA 3FG3A 3WA2X 1TFKA 3PGBA 1PFPA 1STFI 3UL6A 1GS3A 2E2UA 4WHAA 2GEYA 2ZL8A 4N6LA 2HMMB 4HBRA 3SX1A 2O9UX 4X2HA 3EC9A 4ZM8A 2QGUA 4GB5A 3LZAA 2C10A 1VQ53 3KKGA 5KP1A 1IVXA 1IQYA 2WGOA 3BNEA 2INXA 3RGAA 3T8NA 1QALA 1M1K4 1LVNA 1UUWB 1GD4A 1E97A 3F8HA 3B7CA 3LMLA 1UUVB 1ROAA 2JQ5A 3HK4A 5CLKA 3WDGB 1GY7A 2FNQA 2W9PA 1UI7A 3EQQB 3LTDA 4K1UA 3AMOA 3SEDA 3FG1A 4I4KA 4Q53A 3CCM3 6STDA 1S723 4HM6B 3Q1CA 2JDIH 3IPTA 2WOHA 1SIHA 3CPOA 1NWWA 2KCDA 2M7OA 3FH1A 4OVMA 1NJI4 1IQ8A 1Y4KA 3G6E3 1YGEA 4CCVA 2HMKB 4WYKA 4L8OA 3GWRA 4BTWA 1JB5A 1L5GB 1JB4A 3CC73 2BMOB 2YFLB 4XBXA 2YFJB 4CDLA 3CCR3 3WODG 3DXOA 2KXGA 2BO9B 4X2OA 5TGNA 3LOYA 4MMXB 1SPUA 3V99A 5IG5A 2OOVC 1FGMA 1AV4A 3F8XA 4N6V0 1U5OA 1W5ZA 2XRXB 4KFDA 4WP5A 1RKYA 1VQ93 2BT3A 3MG3A 1GY5A 1OF5A 2YX9A 3SOAA 3NM7A 3SVAA 1JV2B 2MF7A 1M9GA 1ZX2A 2Z6BA 4OUQA 2GEXA 2GBWB 3LTBA 5IG4A 2P09A 3U1WA 5I97A 1DMMA 3GAXA 3STDA 1KQS2 3I563 1WMOA 1Q42A 1QAKA 1O7MB 2A15A 2E2VA 2MC8A 1IT7A 1SIIA 2CW9A 1WMNA 1N5HA 1RJOA 1ROVA 1IQXA 1W00A 3D3LA 2XSOB 1JNQA 3FSDA 5KP3A 1OHPA 3CCU3 1W02A 3V98A 3IJEB 1VQN3 2OWPA 5LC6A 4MJDA 1VQ83 3IMAB 3DMCA 3EJVA 1AR0A 1LXEA 1TU5A 4ORLA 3BNCA 1Q40B 4L7KA 3CC23 2R4IA 4AKYA 1JN5B 3MSOA 4RBNA 5FW5A 2O3OA 3K9MC 1OGZA 1G96A 3OXAA 4KFEA 1Q814 2W9QA 1VQK3 1S5AA 1KC84 5IEPA 1E3VA 4IIAA 1SQWA 1WNHA 2WO0A 3UJMA 5CF2A 1IU7A 5EVHA 4NHFA 1YVBI 2CFLA 3B4OA 1YJN3 4KFFA 4XBYA 1VQL3 1IVVA 1DYUA 1J2BA 1FA3A 4EC6A 3U97A 4EV5A 4EXRA 1E3RA 1QVG2 4MMYB 1O7NB 4O2HA 1D6UA 3WOFB 2QEX3 4R9KA 1AVLA 1M1XB 1GYBA 1O7GB 1IV9A 1YHQ3 1OGXA 3CC43 3SXXA 3EN1B 4R9LA 4IT7A 4N6TA 1KD14 4PEJA 5AIFA 3J7Yd 1A2VA 4KZ1A 1W01A 3FCSB 3CMA3 5A0OB 3NX0A 1QMAA 2ZDJA 3F14A 3X3ZA 3JUQA 2P05A 2RFRA 3T0UA 1IVWA 2WOFA 4FCMA 4N6UA 1US1A 5D81A 1TUHA 5AYRB 3CCS3 3MHEA 1VQM3 4U13A 2IUJA 2P0MA 3S27A 3CXC2 3N9HA 5IG3A 1OPYA 1W2B2 5IENA 1RRHA 5DREA 5AEWB 3A76A 5G2GA 4HZBB 3NUVA 3OWSA 4O3VA 3KSPA 1GY6A 3GZYB 3DGNA 4LSOA 4HM3B 3ROBA 3K7CA 4HZ9B 4TX4A 1HKXA 5AI1A 5CXOA 1CQSA 4G1MB 8CHOA 4H61A 4XDVA 2W0QA 2XFSA 4FMDA 2RCDA 2YFIB 3VGNA 3NXJA 1DMQA 3NHXA 2XR8B 3HZPA 3LT8A 3NV0B 4FMBA 1VQP3 4N6NB 1QJGA 3PZWA 3CCE3 1FGOA 4JRFA 2W56A 5JPUA 3B8LA 1W4NA 1GD3A 3QRDA 3S29A 2QA43 3EX9A 3NBBA 1NO3A 1VQ43 3EBYA 1MNLA 4FR9A 1TP6A 3G8ZA 2CWTA 1A2KA 1W6YA 2I9WA 3K0ZA 3FZWA 1AVKA 1OHSA 2HMLB 3BNDA 1JKGB 3MKIA 4JF8A 3PCSA 3K63A 1OUNA 4O02B 3CD63 3PYJA 4NREA 3FF2A 4K1VA 5ELUA 2HMNB 1K41A 1MOLA 3CU3A 1OH0A 3GRDA 5LC7A 1VZZA 1FGRA 3F7SA 3MG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZV A;  3HX8 A;  1ULI B;  1ZO2 A;  5DRV A;  4LEH A;  4HM8 B;  1WQL B;  2Z76 A;  5BVB A;  3DM8 A;  5JPP A;  3LYG A;  5HGR A;  3MYT A;  5IG0 A;  4XDW A;  4WYK B;  3ER7 A;  3NM2 A;  3KZT A;  3VSY A;  4HJL B;  7STD A;  2F98 A;  3FLJ A;  3FGY A;  3BLZ A;  4HKV B;  1OF5 B;  2W2C A;  1NU3 A;  1O7P B;  1SJW A;  3WMD A;  2F86 B;  3M8C A;  2IMJ A;  3NBR A;  2HMO B;  4HM2 B;  2RGQ A;  2STD A;  3F40 A;  2CKF B;  3KE7 A;  4HM0 B;  2BMR B;  3OWU A;  5IF6 A;  2BMQ B;  1JB2 A;  1IDP A;  5CK6 A;  3EF8 A;  5CF1 A;  4KVH A;  1Z1S A;  5KP4 A;  2F99 A;  3EHC A;  4XBT A;  5BXQ A;  3GZB A;  4HM5 B;  4STD A;  3ECF A;  4WWU C;  2B1X B;  2HMJ B;  3SOY A;  3JUP A;  2UX0 A;  1ULJ B;  1Q40 A;  4HM7 B;  2CHC A;  1JN5 A;  3Q90 A;  3JUM A;  5AIH A;  3F7X A;  4LMI A;  4XM4 A;  1OCV A;  3H51 A;  4N3V A;  4RZM A;  3T8U A;  1O7H B;  3MG2 A;  1OHO A;  3GZR A;  4R1K A;  4J9A A;  3BB9 A;  3E99 A;  3OWY A;  3I0Y A;  1ISK A;  1EA2 A;  3D9R A;  4L8P A;  1NDO B;  3S5C A;  5AII A;  2QIY A;  4H3U A;  3GZX B;  2BNG A;  3EBT A;  3OX9 A;  1ASK A;  3F9S A;  3B4P A;  3JUN A;  3DZL A;  3DUK A;  3RGR A;  3G16 A;  3H3H A;  4J8T A;  2K54 A;  5D82 A;  1C7H A;  1BUQ A;  1EG9 B;  3G0K A;  3UNL A;  4HM1 B;  2B24 B;  3FF0 A;  4LGQ A;  5IEO A;  5AEU B;  3NV0 A;  4HM4 B;  2Z7A A;  2GBX B;  3CNM A;  3OV4 A;  3EN8 A;  4XB5 A;  5STD A;  5IER A;  2GXF A;  1STD A;  5AIG A;  2XSH B;  3CNX A;  1DMN A;  5D83 A;  1JKG A;  1O7W B;  2Z77 A;  3FKA A;  4HVN A;  3JUO A;  4FCJ A;  1GS3 A;  2GEY A;  2HMM B;  4X2H A;  3EC9 A;  2QGU A;  4GB5 A;  3LZA A;  3KKG A;  5KP1 A;  2INX A;  3RGA A;  3T8N A;  1UUW B;  1E97 A;  3F8H A;  3B7C A;  1UUV B;  3HK4 A;  2JQ5 A;  5CLK A;  1GY7 A;  4K1U A;  3EQQ B;  3SED A;  4I4K A;  4Q53 A;  6STD A;  4HM6 B;  3IPT A;  3CPO A;  1NWW A;  3FH1 A;  4OVM A;  2HMK B;  4WYK A;  4L8O A;  3GWR A;  1JB5 A;  1JB4 A;  2BMO B;  2YFL B;  4XBX A;  2YFJ B;  4CDL A;  3DXO A;  4X2O A;  5TGN A;  5IG5 A;  3F8X A;  1U5O A;  2XRX B;  4WP5 A;  3MG3 A;  1GY5 A;  1OF5 A;  3SOA A;  1ZX2 A;  4OUQ A;  2GEX A;  2GBW B;  5IG4 A;  1DMM A;  3STD A;  1Q42 A;  1O7M B;  2A15 A;  1W00 A;  2XSO B;  3FSD A;  5KP3 A;  1OHP A;  1W02 A;  2OWP A;  4MJD A;  3DMC A;  3EJV A;  1AR0 A;  4ORL A;  1Q40 B;  4L7K A;  2R4I A;  1JN5 B;  3MSO A;  5FW5 A;  1OGZ A;  3OXA A;  1S5A A;  5IEP A;  1E3V A;  4IIA A;  3UJM A;  5CF2 A;  5EVH A;  3B4O A;  4XBY A;  1E3R A;  1O7N B;  4R9K A;  1O7G B;  1GYB A;  1OGX A;  3EN1 B;  4R9L A;  4PEJ A;  5AIF A;  1W01 A;  1QMA A;  3F14 A;  3JUQ A;  2RFR A;  4FCM A;  5D81 A;  1TUH A;  3MHE A;  4U13 A;  5IG3 A;  1OPY A;  5IEN A;  5DRE A;  5AEW B;  3A76 A;  5G2G A;  4HZB B;  3NUV A;  3OWS A;  3KSP A;  1GY6 A;  3GZY B;  4HM3 B;  3ROB A;  3K7C A;  4HZ9 B;  5AI1 A;  1HKX A;  5CXO A;  1CQS A;  8CHO A;  4XDV A;  2RCD A;  2YFI B;  3VGN A;  3NXJ A;  1DMQ A;  3NHX A;  2XR8 B;  3HZP A;  3NV0 B;  1QJG A;  5JPU A;  3B8L A;  3EX9 A;  3EBY A;  1TP6 A;  3G8Z A;  1A2K A;  1W6Y A;  2I9W A;  3K0Z A;  3FZW A;  1OHS A;  2HML B;  1JKG B;  3MKI A;  1OUN A;  3FF2 A;  4K1V A;  2HMN B;  1K41 A;  3CU3 A;  1OH0 A;  3GRD A;  1VZZ A;  3F7S A;  3MG1 A; 
#chains in the Genus database with same CATH topology
 5ELJ A;  2PZV A;  1EEJ A;  3HX8 A;  4N6O B;  4R80 A;  1ULI B;  4BIR A;  1B20 A;  3LTC A;  1ZO2 A;  1UI8 A;  5DRV A;  1I2E A;  4LEH A;  3A5E A;  4HM8 B;  1WQL B;  1YGW A;  5G1K A;  2RSX A;  2W6J H;  2Z76 A;  2KF6 A;  3L0R A;  1I3I A;  1JZO A;  3AMO B;  1BVI A;  5BVB A;  3DM8 A;  2BIR A;  3PXM A;  2UUG C;  2W04 A;  3LXU X;  5JPP A;  1Q82 4;  3LT9 A;  2C11 A;  3LYG A;  1FUW A;  4J5K A;  2ML6 A;  3CPW 2;  5HGR A;  4FCZ A;  2P38 A;  3MYT A;  4XDW A;  5IG0 A;  4WYK B;  1BRJ A;  2WGQ A;  3UB1 A;  4R4K A;  3G4S 3;  1TRP A;  2W03 A;  3ER7 A;  4ILF A;  1WTH A;  3X40 A;  3NM2 A;  4O8S A;  1Q86 4;  3KZT A;  2ZHX B;  2J8X B;  1Q7Y 4;  4MEI A;  1N9J A;  2LQV A;  2FGT A;  2GU1 A;  3VSY A;  4DKI A;  2K3D A;  2C4B A;  4HJL B;  1VQO 3;  7STD A;  3N8B A;  1RNB A;  2F98 A;  1YJW 3;  5M18 A;  3FLJ A;  4BTY A;  3FGY A;  3S67 A;  4LZI A;  4CJN A;  3BLZ A;  5JBS A;  4N6M A;  1DET A;  4BU4 A;  2CC3 A;  1OF5 B;  1NB3 I;  1NU3 A;  1O7P B;  1WMP A;  1B2U A;  1SJW A;  1UW1 A;  2IA7 A;  2W2C A;  1RGA A;  1UCI A;  1W6C A;  2F86 B;  1BRK A;  3M8C A;  3X3X A;  1BNG A;  1CYV A;  1A67 A;  2IMJ A;  3X3Y A;  1UDI I;  1HZ1 A;  3O8Y A;  2SBL A;  3NBR A;  3EE1 A;  1FGT A;  2F5W A;  1BSB A;  3KSE D;  2HMO B;  4HM2 B;  2H0I A;  2RGQ A;  3VF1 A;  1K28 A;  2STD A;  1VQ6 3;  3F40 A;  1YIT 3;  1R4C A;  2CKF B;  4BL2 A;  1RCL A;  3KE7 A;  3TDG A;  4HM0 B;  4FMC A;  1ZGX A;  4EYC A;  1V58 A;  3DY5 A;  2BMR B;  2CK3 H;  2OCT A;  3DGO A;  3OWU A;  2OQE C;  3MWZ A;  5EQL A;  5IF6 A;  3CCJ 3;  2BHM A;  1N8R 4;  6RNT A;  2BMQ B;  2KRT A;  1W7C A;  3BNB A;  1JB2 A;  1KWI A;  1MWR A;  3ZG5 A;  2IUK A;  1D6Z A;  4RNZ A;  1IDP A;  3Q3F A;  5CK6 A;  3N54 B;  3EF8 A;  4EV2 A;  5CF1 A;  5IW9 A;  4KVH A;  1Z1S A;  3CCQ 3;  5KP4 A;  2F99 A;  4RNY A;  3EHC A;  3MPH A;  2OTJ 3;  1MWT A;  2FXT A;  1D6Y A;  1N5P A;  2OQE A;  3HIG A;  3LTA A;  1BUJ A;  3QK9 A;  1TIJ A;  4IPB A;  1BU4 A;  1YI2 3;  1GMP A;  1T3B A;  1BAN A;  1EKM A;  3ALA A;  1IVU A;  1OAC A;  4HKV B;  3NBJ A;  5CF2 A;  4XBT A;  3LH4 A;  3X42 A;  2Y73 A;  1B2Z A;  5BXQ A;  1BAO A;  1VQQ A;  4HYZ A;  1M90 4;  2D1W A;  3I55 3;  1CH0 A;  3GZB A;  4HM5 B;  4STD A;  1RCK A;  3ECF A;  2XH9 A;  3FG4 A;  1MWS A;  1LOV A;  1QAF A;  4WWU C;  1B2X A;  1LNH A;  2B1X B;  2HMJ B;  1TFO A;  3WR2 A;  1B2S A;  3SOY A;  5EEO A;  5RNT A;  2PNC A;  3HI7 A;  3JUP A;  3WMD A;  1RDS A;  1TRQ A;  3WA3 A;  1A2P A;  2UX0 A;  2XGL A;  4MMZ B;  1ULJ B;  1K8A 4;  4QWT A;  5FGO A;  1Q40 A;  4HM7 B;  1B27 A;  2CHC A;  1JN5 A;  3Q90 A;  1RGK A;  3JUM A;  2K0M A;  1T2I A;  2CFK A;  2P0X A;  5AIH A;  1I8V A;  1UCK A;  3F7X A;  4LMI A;  4WFO A;  3V92 A;  1I2G A;  4XM4 A;  6GSP A;  1DVD A;  1OCV A;  2CFW A;  1FGQ A;  3KII A;  4OK0 A;  1W6G A;  1U8C B;  1N9E A;  4HAA A;  3BIR A;  1GMQ A;  3NQZ A;  1JRQ A;  1UGH I;  3H51 A;  4EBG A;  1K73 4;  4N3V A;  4RZM A;  4AEQ A;  3AGO A;  1PU4 A;  3DGM A;  3T8U A;  1O7H B;  1I2F A;  2CH9 A;  2CG0 A;  1OHO A;  2L4V A;  3MG2 A;  3K5T A;  3GZR A;  3KN4 A;  3PS8 A;  3Q2P A;  1F8N A;  2GSP A;  1RGG A;  4J9A A;  2CFD A;  4R1K A;  3BB9 A;  2Q07 A;  2ML5 A;  1K9M 4;  1BSA A;  1N8Q A;  3AHS A;  3E99 A;  3OWY A;  3SLU A;  2CFG A;  1VQ7 3;  3I0Y A;  1ISK A;  1EA2 A;  3WOE B;  3D9R A;  4GSP A;  4FMA A;  1CYU A;  4L8P A;  3S28 A;  1IV7 A;  1NDO B;  1BSE A;  1LQM B;  3EB8 A;  3X41 A;  3S5C A;  2V1L A;  3KFQ C;  2QIY A;  4H3U A;  5AII A;  4GL6 A;  2OTL 3;  4CPK A;  5AYS C;  3GZX B;  1IK3 A;  2W56 B;  2BNG A;  1CEW I;  2L1S A;  1RGE A;  3EBT A;  3HOH A;  3OX9 A;  2OOV A;  3CCL 3;  1RN7 A;  2XF3 A;  1ASK A;  1A90 A;  1FW7 A;  1LOX A;  2GU3 A;  3B4P A;  3F9S A;  3KCH A;  4K90 B;  1DVC A;  1EQK A;  3JUN A;  2XEP A;  3DZL A;  3DUK A;  2CG1 A;  3RGR A;  2CWU A;  3G16 A;  3H3H A;  1FZU A;  1C54 A;  4J8T A;  1BOX A;  2K54 A;  5D82 A;  4AKZ A;  4HOH A;  1YIJ 3;  1BRH A;  1C7H A;  2LYX A;  1GOV A;  1PYL A;  2F56 A;  1G02 A;  5M1A A;  4GHO A;  1IT8 A;  1YNV X;  3OW2 2;  2D42 A;  2XFT A;  1T5Y A;  3AHW A;  3NQY A;  2Y74 A;  1BUQ A;  2XGN A;  1EG9 B;  3G0K A;  3UNL A;  1V74 A;  2CIU A;  4HM1 B;  1B21 A;  1KSI A;  1TTO A;  2B24 B;  1B3S A;  3FF0 A;  2E2T A;  4LGQ A;  1BNR A;  5IEO A;  1FUS A;  5AEU B;  1NB5 I;  3CCV 3;  3D5G A;  3NV0 A;  4HM4 B;  4BL3 A;  2Z7A A;  1YJ9 3;  2GBX B;  3HII A;  4BTX A;  3CNM A;  3OV4 A;  3RDE A;  3EN8 A;  3PCR A;  4XB5 A;  1W2Z A;  5STD A;  5IER A;  1BNS A;  2GXF A;  4K61 A;  3CME 3;  1STD A;  5AIG A;  2XSH B;  1JJ2 2;  1Q9E A;  1UCJ A;  3UL5 A;  1DE3 A;  4KT3 B;  1RRL A;  3CNX A;  1DMN A;  1RGF A;  2CWV A;  5D83 A;  3G71 3;  1JKG A;  1QVF 2;  1O7W B;  2Z77 A;  3FKA A;  3DGL A;  4HVN A;  1HU9 A;  3JUO A;  3JVC A;  4FCJ A;  3FG3 A;  1TJD A;  3WA2 X;  1TFK A;  2CX0 A;  3PGB A;  1PFP A;  1STF I;  3UL6 A;  1GS3 A;  2E2U A;  4WHA A;  2GEY A;  2ZL8 A;  4N6L A;  2HMM B;  5HOH A;  4HBR A;  3SX1 A;  2O9U X;  4J5G A;  1GSP A;  3EC9 A;  4X2H A;  4ZM8 A;  3URP A;  2QGU A;  4GB5 A;  4RNT A;  3LZA A;  2C10 A;  1VQ5 3;  3KKG A;  5KP1 A;  1IQY A;  1IVX A;  1RGC A;  2WGO A;  3ZFZ A;  3BNE A;  2INX A;  3RGA A;  7RNT A;  3T8N A;  5BU4 A;  5GSP A;  1QAL A;  1M1K 4;  1LVN A;  1I70 A;  1UUW B;  1GD4 A;  3DH2 A;  1MGR A;  1E97 A;  3AGN A;  3B7C A;  3F8H A;  3LML A;  1MWU A;  1UUV B;  1BIR A;  1ROA A;  1R4Y A;  2JQ5 A;  3HK4 A;  5CLK A;  3WDG B;  1GY7 A;  2FNQ A;  2W9P A;  1UI7 A;  3EQQ B;  3LTD A;  4K1U A;  3AMO A;  3SED A;  3FG1 A;  4I4K A;  4Q53 A;  3CCM 3;  6STD A;  1S72 3;  1JBS A;  1HYF A;  3D5I A;  4HM6 B;  3Q1C A;  2JDI H;  3IPT A;  2WOH A;  1FYS A;  1SIH A;  3CPO A;  1NWW A;  2KCD A;  2M7O A;  3FH1 A;  4OVM A;  1UCL A;  1NJI 4;  1IQ8 A;  1BRS A;  1Y4K A;  3G6E 3;  1YGE A;  4CCV A;  1NNV A;  2HMK B;  4WYK A;  7GSP A;  4L8O A;  3GWR A;  3SYU A;  4I5Q A;  4BTW A;  2AAE A;  1JB5 A;  1V57 A;  1L5G B;  1JB4 A;  3CC7 3;  2BMO B;  5M19 A;  2YFL B;  4XBX A;  2YFJ B;  4CDL A;  3CCR 3;  1Q7H A;  3DXO A;  2KXG A;  2BO9 B;  4X2O A;  3WOD G;  5TGN A;  3LOY A;  4MMX B;  1SPU A;  3V99 A;  5IG5 A;  2HOH A;  1FGM A;  2OOV C;  1AV4 A;  3F8X A;  1UUG B;  4N6V 0;  1U5O A;  1W5Z A;  2XRX B;  4KFD A;  4WP5 A;  1RKY A;  1VQ9 3;  2BT3 A;  3MG3 A;  1GY5 A;  3GSP A;  1OF5 A;  1X1Y A;  2YX9 A;  3SOA A;  3NM7 A;  1SAR A;  3SVA A;  3WHO A;  1JV2 B;  2MF7 A;  2H0G A;  1M9G A;  1ZX2 A;  2Z6B A;  4OUQ A;  2GEX A;  1RN1 A;  2GBW B;  3LTB A;  5IG4 A;  2P09 A;  2KF4 A;  3U1W A;  5I97 A;  1LRA A;  1DMM A;  3GAX A;  3STD A;  1KQS 2;  3I56 3;  1WMO A;  1PY3 A;  1Q42 A;  1QAK A;  2F4Y A;  1O7M B;  2A15 A;  1RSN A;  2E2V A;  2MC8 A;  1IT7 A;  1SII A;  2CW9 A;  1WMN A;  1N5H A;  1RJO A;  1ROV A;  1RN4 A;  1X1W A;  1IQX A;  1W00 A;  1JBR A;  3D3L A;  3ZG0 A;  2XSO B;  1JNQ A;  3FSD A;  5KP3 A;  1OHP A;  3CCU 3;  1W02 A;  3V98 A;  3IJE B;  1VQN 3;  2OWP A;  4NPB A;  5LC6 A;  4MJD A;  1VQ8 3;  3IMA B;  2AAD A;  3DMC A;  1BRG A;  1AR0 A;  3EJV A;  1RHL A;  1BNJ A;  1LXE A;  1TU5 A;  1RGL A;  1JBT A;  4ORL A;  3BNC A;  1GMR A;  1Q40 B;  4L7K A;  3CC2 3;  2R4I A;  1I0V A;  4AKY A;  1JN5 B;  1EUI C;  3MSO A;  4RBN A;  5FW5 A;  3RNT A;  1T2H A;  2O3O A;  2R41 A;  1OGZ A;  1G96 A;  3K9M C;  3OXA A;  4KFE A;  1Q81 4;  2W9Q A;  1UGI A;  1S5A A;  1VQK 3;  1KC8 4;  5IEP A;  2H0H A;  1E3V A;  4IIA A;  1SQW A;  1WNH A;  2WO0 A;  3D4A A;  3UJM A;  1IU7 A;  5EVH A;  4NHF A;  4EW5 A;  1YVB I;  2CFL A;  2UGI A;  3B4O A;  1BSC A;  4KFF A;  4XBY A;  1YJN 3;  3DGY A;  1VQL 3;  1IVV A;  1DYU A;  1LNI A;  1J2B A;  1AY7 A;  1FA3 A;  4EC6 A;  2KF3 A;  3U97 A;  3BU4 A;  1YVS A;  4EV5 A;  1X1X A;  4EXR A;  1E3R A;  1QVG 2;  4MMY B;  1O7N B;  1ZS7 A;  1D6U A;  4O2H A;  3WOF B;  2QEX 3;  4R9K A;  1AVL A;  1I0X A;  1GYB A;  1M1X B;  1O7G B;  1IV9 A;  1LOY A;  1OGX A;  2RBI A;  2CX1 A;  1YHQ 3;  3CC4 3;  3SXX A;  1X1U A;  3EN1 B;  4R9L A;  4IT7 A;  4N6T A;  1KD1 4;  4PEJ A;  2SAR A;  1BNI A;  5AIF A;  3J7Y d;  1A2V A;  4KZ1 A;  1W01 A;  1GOY A;  3FCS B;  3CMA 3;  5BIR A;  5A0O B;  1RLS A;  3NX0 A;  1QMA A;  1FUT A;  2ZDJ A;  3F14 A;  3X3Z A;  3JUQ A;  1BNF A;  2P05 A;  2RFR A;  3T0U A;  1IVW A;  2WOF A;  4FCM A;  4N6U A;  1US1 A;  5D81 A;  1TUH A;  5AYR B;  3CCS 3;  1LQG C;  1RNT A;  3MHE A;  3D79 A;  1VQM 3;  1LOW A;  4U13 A;  2IUJ A;  2P0M A;  1BNE A;  3S27 A;  1JZD A;  2KAA A;  3N9H A;  5IG3 A;  3CXC 2;  1OPY A;  1W2B 2;  5IEN A;  9RNT A;  1RRH A;  5DRE A;  1I3F A;  5AEW B;  3A76 A;  2KF5 A;  5G2G A;  4HZB B;  2F5M A;  2ZA4 A;  3NUV A;  3OWS A;  3KSP A;  4O3V A;  1B2M A;  1GY6 A;  3GZY B;  3DGN A;  4LSO A;  4HM3 B;  3ROB A;  2RNT A;  1RGH A;  3K7C A;  4HZ9 B;  4TX4 A;  1HKX A;  5AI1 A;  5CXO A;  1CQS A;  4G1M B;  8CHO A;  4H61 A;  4XDV A;  2IYJ A;  2W0Q A;  2XFS A;  4FMD A;  2RCD A;  2YFI B;  3VGN A;  3NXJ A;  1G0T A;  1DMQ A;  2BU4 A;  2XR8 B;  1RMS A;  3NHX A;  3HZP A;  3LT8 A;  3NV0 B;  4FMB A;  5G1L A;  1VQP 3;  4N6N B;  1QJG A;  3PZW A;  3CCE 3;  1FGO A;  4JRF A;  2W56 A;  1GOU A;  5JPU A;  3B8L A;  1W4N A;  1GD3 A;  3QRD A;  3S29 A;  2QA4 3;  3EX9 A;  3NBB A;  1IYY A;  1NO3 A;  1VQ4 3;  3EBY A;  1MNL A;  4FR9 A;  1TP6 A;  3G8Z A;  2CWT A;  1MGW A;  1A2K A;  1W6Y A;  1AQZ A;  2I9W A;  3K0Z A;  3FZW A;  1AVK A;  1OHS A;  2HML B;  3BND A;  1JKG B;  3MKI A;  1BRN L;  4JF8 A;  3PCS A;  1BRI A;  3K63 A;  1OUN A;  4O02 B;  3CD6 3;  3PYJ A;  1BSD A;  1RTU A;  8RNT A;  2IY2 A;  4NRE A;  3FF2 A;  4K1V A;  5ELU A;  2HMN B;  1K41 A;  1MOL A;  3CU3 A;  1OH0 A;  1BGS A;  3GRD A;  5LC7 A;  4LYL B;  1VZZ A;  1FGR A;  3F7S A;  3MG1 A; 
#chains in the Genus database with same CATH homology
 5ELJ A;  2PZV A;  3HX8 A;  4N6O B;  4R80 A;  1ULI B;  3LTC A;  1ZO2 A;  1UI8 A;  5DRV A;  4LEH A;  4HM8 B;  1WQL B;  2RSX A;  2W6J H;  2Z76 A;  3L0R A;  3AMO B;  5BVB A;  3DM8 A;  3PXM A;  2W04 A;  3LXU X;  5JPP A;  1Q82 4;  3LT9 A;  2C11 A;  3LYG A;  1FUW A;  2ML6 A;  3CPW 2;  5HGR A;  4FCZ A;  2P38 A;  3MYT A;  4XDW A;  5IG0 A;  4WYK B;  2WGQ A;  3UB1 A;  4R4K A;  3G4S 3;  2W03 A;  3ER7 A;  1WTH A;  3X40 A;  3NM2 A;  4O8S A;  1Q86 4;  3KZT A;  1Q7Y 4;  4MEI A;  1N9J A;  2LQV A;  2FGT A;  2GU1 A;  3VSY A;  4HJL B;  1VQO 3;  7STD A;  3N8B A;  2F98 A;  1YJW 3;  3FLJ A;  4BTY A;  3FGY A;  3S67 A;  4LZI A;  3BLZ A;  5JBS A;  4N6M A;  2CC3 A;  1OF5 B;  1NB3 I;  1NU3 A;  1O7P B;  1WMP A;  2IA7 A;  1SJW A;  1UW1 A;  2W2C A;  3WMD A;  2F86 B;  3M8C A;  1W6C A;  3X3X A;  1CYV A;  1A67 A;  2IMJ A;  3X3Y A;  3O8Y A;  2SBL A;  3NBR A;  3EE1 A;  1FGT A;  3KSE D;  2HMO B;  4HM2 B;  2RGQ A;  3VF1 A;  1K28 A;  2STD A;  1VQ6 3;  3F40 A;  1YIT 3;  1R4C A;  2CKF B;  3KE7 A;  3TDG A;  4HM0 B;  4FMC A;  4EYC A;  3DY5 A;  2BMR B;  2CK3 H;  2OCT A;  3DGO A;  3OWU A;  2OQE C;  3MWZ A;  5EQL A;  5IF6 A;  3CCJ 3;  2BHM A;  1N8R 4;  2BMQ B;  2KRT A;  1W7C A;  3BNB A;  1JB2 A;  1KWI A;  2IUK A;  1D6Z A;  4RNZ A;  1IDP A;  5CK6 A;  3N54 B;  3EF8 A;  4EV2 A;  5CF1 A;  5IW9 A;  4KVH A;  1Z1S A;  3CCQ 3;  5KP4 A;  2F99 A;  4RNY A;  3EHC A;  3MPH A;  2OTJ 3;  2FXT A;  1D6Y A;  1N5P A;  2OQE A;  3HIG A;  3LTA A;  3QK9 A;  1TIJ A;  4IPB A;  1YI2 3;  4HKV B;  1EKM A;  3ALA A;  1IVU A;  1OAC A;  3NBJ A;  4XBT A;  3LH4 A;  3X42 A;  2Y73 A;  5BXQ A;  1M90 4;  4HYZ A;  2D1W A;  3I55 3;  3GZB A;  4HM5 B;  4STD A;  3ECF A;  2XH9 A;  3FG4 A;  1QAF A;  4WWU C;  1LNH A;  2B1X B;  2HMJ B;  1TFO A;  3SOY A;  5EEO A;  2PNC A;  3HI7 A;  3JUP A;  3WA3 A;  2UX0 A;  2XGL A;  4MMZ B;  1ULJ B;  1K8A 4;  4QWT A;  5FGO A;  1Q40 A;  4HM7 B;  2CHC A;  1JN5 A;  3Q90 A;  3JUM A;  2K0M A;  2CFK A;  2P0X A;  5AIH A;  3F7X A;  4LMI A;  4WFO A;  3V92 A;  1DVD A;  4XM4 A;  1OCV A;  2CFW A;  1FGQ A;  3KII A;  4OK0 A;  1W6G A;  1U8C B;  1N9E A;  3NQZ A;  1JRQ A;  3H51 A;  4EBG A;  1K73 4;  4N3V A;  4RZM A;  4AEQ A;  1PU4 A;  3DGM A;  3T8U A;  1O7H B;  3PS8 A;  2CH9 A;  2CG0 A;  1OHO A;  2L4V A;  3MG2 A;  3K5T A;  3GZR A;  3KN4 A;  3Q2P A;  4J9A A;  1F8N A;  4R1K A;  2CFD A;  3BB9 A;  2Q07 A;  2ML5 A;  1K9M 4;  1N8Q A;  3SLU A;  1VQ7 3;  3E99 A;  3OWY A;  2CFG A;  3I0Y A;  1ISK A;  1EA2 A;  3WOE B;  3D9R A;  4FMA A;  1CYU A;  4L8P A;  3S28 A;  1IV7 A;  1NDO B;  3EB8 A;  3X41 A;  3S5C A;  2V1L A;  3KFQ C;  2QIY A;  4H3U A;  5AII A;  4GL6 A;  2OTL 3;  5AYS C;  3GZX B;  1IK3 A;  2W56 B;  2BNG A;  1CEW I;  3EBT A;  2OOV A;  3OX9 A;  3CCL 3;  1RN7 A;  2XF3 A;  1ASK A;  1A90 A;  1LOX A;  2GU3 A;  3B4P A;  3F9S A;  4K90 B;  1DVC A;  1EQK A;  3JUN A;  2XEP A;  3DZL A;  3DUK A;  2CG1 A;  3RGR A;  2CWU A;  3G16 A;  3H3H A;  4J8T A;  2K54 A;  4AKZ A;  5D82 A;  1YIJ 3;  1C7H A;  2LYX A;  3OW2 2;  1IT8 A;  2D42 A;  2XFT A;  1T5Y A;  3NQY A;  2Y74 A;  1BUQ A;  2XGN A;  1EG9 B;  3G0K A;  3UNL A;  1V74 A;  2CIU A;  4HM1 B;  1KSI A;  2B24 B;  3FF0 A;  2E2T A;  4LGQ A;  5IEO A;  5AEU B;  1NB5 I;  3CCV 3;  3NV0 A;  4HM4 B;  2Z7A A;  1YJ9 3;  2GBX B;  3HII A;  4BTX A;  3CNM A;  3OV4 A;  3RDE A;  3EN8 A;  3PCR A;  4XB5 A;  1W2Z A;  5STD A;  5IER A;  2GXF A;  4K61 A;  3CME 3;  1STD A;  5AIG A;  2XSH B;  1JJ2 2;  3UL5 A;  1RRL A;  3CNX A;  1DMN A;  2CWV A;  5D83 A;  3G71 3;  1JKG A;  1QVF 2;  1O7W B;  2Z77 A;  3FKA A;  3DGL A;  4HVN A;  1HU9 A;  3JUO A;  3JVC A;  4FCJ A;  3FG3 A;  3WA2 X;  1TFK A;  3PGB A;  1PFP A;  1STF I;  3UL6 A;  1GS3 A;  2E2U A;  4WHA A;  2GEY A;  2ZL8 A;  4N6L A;  2HMM B;  4HBR A;  3SX1 A;  2O9U X;  4X2H A;  3EC9 A;  4ZM8 A;  2QGU A;  4GB5 A;  3LZA A;  2C10 A;  1VQ5 3;  3KKG A;  5KP1 A;  1IVX A;  1IQY A;  2WGO A;  3BNE A;  2INX A;  3RGA A;  3T8N A;  1QAL A;  1M1K 4;  1LVN A;  1UUW B;  1GD4 A;  1E97 A;  3F8H A;  3B7C A;  3LML A;  1UUV B;  1ROA A;  2JQ5 A;  3HK4 A;  5CLK A;  3WDG B;  1GY7 A;  2FNQ A;  2W9P A;  1UI7 A;  3EQQ B;  3LTD A;  4K1U A;  3AMO A;  3SED A;  3FG1 A;  4I4K A;  4Q53 A;  3CCM 3;  6STD A;  1S72 3;  4HM6 B;  3Q1C A;  2JDI H;  3IPT A;  2WOH A;  1SIH A;  3CPO A;  1NWW A;  2KCD A;  2M7O A;  3FH1 A;  4OVM A;  1NJI 4;  1IQ8 A;  1Y4K A;  3G6E 3;  1YGE A;  4CCV A;  2HMK B;  4WYK A;  4L8O A;  3GWR A;  4BTW A;  1JB5 A;  1L5G B;  1JB4 A;  3CC7 3;  2BMO B;  2YFL B;  4XBX A;  2YFJ B;  4CDL A;  3CCR 3;  3WOD G;  3DXO A;  2KXG A;  2BO9 B;  4X2O A;  5TGN A;  3LOY A;  4MMX B;  1SPU A;  3V99 A;  5IG5 A;  2OOV C;  1FGM A;  1AV4 A;  3F8X A;  4N6V 0;  1U5O A;  1W5Z A;  2XRX B;  4KFD A;  4WP5 A;  1RKY A;  1VQ9 3;  2BT3 A;  3MG3 A;  1GY5 A;  1OF5 A;  2YX9 A;  3SOA A;  3NM7 A;  3SVA A;  1JV2 B;  2MF7 A;  1M9G A;  1ZX2 A;  2Z6B A;  4OUQ A;  2GEX A;  2GBW B;  3LTB A;  5IG4 A;  2P09 A;  3U1W A;  5I97 A;  1DMM A;  3GAX A;  3STD A;  1KQS 2;  3I56 3;  1WMO A;  1Q42 A;  1QAK A;  1O7M B;  2A15 A;  2E2V A;  2MC8 A;  1IT7 A;  1SII A;  2CW9 A;  1WMN A;  1N5H A;  1RJO A;  1ROV A;  1IQX A;  1W00 A;  3D3L A;  2XSO B;  1JNQ A;  3FSD A;  5KP3 A;  1OHP A;  3CCU 3;  1W02 A;  3V98 A;  3IJE B;  1VQN 3;  2OWP A;  5LC6 A;  4MJD A;  1VQ8 3;  3IMA B;  3DMC A;  3EJV A;  1AR0 A;  1LXE A;  1TU5 A;  4ORL A;  3BNC A;  1Q40 B;  4L7K A;  3CC2 3;  2R4I A;  4AKY A;  1JN5 B;  3MSO A;  4RBN A;  5FW5 A;  2O3O A;  3K9M C;  1OGZ A;  1G96 A;  3OXA A;  4KFE A;  1Q81 4;  2W9Q A;  1VQK 3;  1S5A A;  1KC8 4;  5IEP A;  1E3V A;  4IIA A;  1SQW A;  1WNH A;  2WO0 A;  3UJM A;  5CF2 A;  1IU7 A;  5EVH A;  4NHF A;  1YVB I;  2CFL A;  3B4O A;  1YJN 3;  4KFF A;  4XBY A;  1VQL 3;  1IVV A;  1DYU A;  1J2B A;  1FA3 A;  4EC6 A;  3U97 A;  4EV5 A;  4EXR A;  1E3R A;  1QVG 2;  4MMY B;  1O7N B;  4O2H A;  1D6U A;  3WOF B;  2QEX 3;  4R9K A;  1AVL A;  1M1X B;  1GYB A;  1O7G B;  1IV9 A;  1YHQ 3;  1OGX A;  3CC4 3;  3SXX A;  3EN1 B;  4R9L A;  4IT7 A;  4N6T A;  1KD1 4;  4PEJ A;  5AIF A;  3J7Y d;  1A2V A;  4KZ1 A;  1W01 A;  3FCS B;  3CMA 3;  5A0O B;  3NX0 A;  1QMA A;  2ZDJ A;  3F14 A;  3X3Z A;  3JUQ A;  2P05 A;  2RFR A;  3T0U A;  1IVW A;  2WOF A;  4FCM A;  4N6U A;  1US1 A;  5D81 A;  1TUH A;  5AYR B;  3CCS 3;  3MHE A;  1VQM 3;  4U13 A;  2IUJ A;  2P0M A;  3S27 A;  3CXC 2;  3N9H A;  5IG3 A;  1OPY A;  1W2B 2;  5IEN A;  1RRH A;  5DRE A;  5AEW B;  3A76 A;  5G2G A;  4HZB B;  3NUV A;  3OWS A;  4O3V A;  3KSP A;  1GY6 A;  3GZY B;  3DGN A;  4LSO A;  4HM3 B;  3ROB A;  3K7C A;  4HZ9 B;  4TX4 A;  1HKX A;  5AI1 A;  5CXO A;  1CQS A;  4G1M B;  8CHO A;  4H61 A;  4XDV A;  2W0Q A;  2XFS A;  4FMD A;  2RCD A;  2YFI B;  3VGN A;  3NXJ A;  1DMQ A;  3NHX A;  2XR8 B;  3HZP A;  3LT8 A;  3NV0 B;  4FMB A;  1VQP 3;  4N6N B;  1QJG A;  3PZW A;  3CCE 3;  1FGO A;  4JRF A;  2W56 A;  5JPU A;  3B8L A;  1W4N A;  1GD3 A;  3QRD A;  3S29 A;  2QA4 3;  3EX9 A;  3NBB A;  1NO3 A;  1VQ4 3;  3EBY A;  1MNL A;  4FR9 A;  1TP6 A;  3G8Z A;  2CWT A;  1A2K A;  1W6Y A;  2I9W A;  3K0Z A;  3FZW A;  1AVK A;  1OHS A;  2HML B;  3BND A;  1JKG B;  3MKI A;  4JF8 A;  3PCS A;  3K63 A;  1OUN A;  4O02 B;  3CD6 3;  3PYJ A;  4NRE A;  3FF2 A;  4K1V A;  5ELU A;  2HMN B;  1K41 A;  1MOL A;  3CU3 A;  1OH0 A;  3GRD A;  5LC7 A;  1VZZ A;  1FGR A;  3F7S A;  3MG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...