4XCHA

S-ribosylhomocysteinase from streptococcus suis
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
149
Chain Sequence
LDHTIVKAPYIRLISEEVGPKGDIITNFDIRLIQPNENAMDTAGLHTIEHLLAKLIRQRIDGLIDCSPFGCRTGFHMIMWGKQDSEKIAQVIKSSLEEIAEGITWEDVPGTTIESCGNYKDHSLHSAKEWAKLILSQGISTDAFERKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteine lyase
publication title Crystal Structure of LuxS from Streptococcus suis
rcsb
source organism Streptococcus suis
molecule tags Lyase
total genus 48
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 4xchA00
2FQTA 1JVIA 1J6WA 2FQOA 1YCLA 1VJEA 5E68A 1INNA 1IE0A 1JQWA 1VGXA 1VH2A 1J98A 1J6XA 4XCHA 1JOEA 1J6VA
chains in the Genus database with same CATH superfamily
1WOSA 4GT9A 3S16C 3PO3C 1ZYRA 2B63A 3GTKA 2WB1L 1PJ6A 4LLGA 4KMUA 4ILDA 3S15C 2PA8L 3GEEA 2E2IC 4JK1A 3M4OK 3S2DK 3RZOC 4A3GK 3GTGK 4GTBA 3MMLB 5M5WK 4Q4ZA 3S0XA 4A3KC 2E2IA 1PJ7A 4A3LC 5TMCA 5IYBK 5M5XK 3HOYC 2A6HA 5C4XC 4OINA 3M3YK 2EBBA 5C4JK 2O5IA 4C3JK 4GTEA 1XXAA 4A3BC 1I50C 3AD9C 1ZBSA 3VA7A 3SZZA 3GTMC 3L4JA 1JVIA 2JA8C 4Y7NK 1WQGA 1B4AA 1BGWA 4A3JK 2R92C 1XZPA 3GTMA 2NVYK 4KMHA 4P5BA 4KC6A 2NVXC 2R92A 1RU0A 4Y52K 1IBAA 5M5YK 2JH3A 4RMFA 3I4NC 4BY1K 4QIWL 2NVXA 4QJVA 1O28A 1R9TC 3HKZD 3GDZA 1I6HC 1WCMC 3G4CA 5IOTA 4A3EC 1WORA 1R9TA 3HOZK 2E2IK 1WOOA 3H0GC 3RZOK 4KDDA 1WCMA 5L46A 4BY7C 4XCHA 2JA6C 1Y1WC 3H0GA 2NVTC 2PHCB 4KB4A 5FLMK 2JA6A 1XZQA 3HOWK 1Y1WA 2R93K 4A3BK 1I50K 1O27A 3AQOA 3T01A 2VUMC 2BE5A 1B4BA 1O26A 2VUMA 4ZH4A 2JA7K 2Y3PA 3CQZK 2WAQD 4GTAA 1WQHA 4OIQA 2JA8K 2P8TA 1GE9A 1I3QC 3FKIK 4GTDA 1BS2A 1WQFA 2PMZL 1USMA 1TWHK 1WSRA 5IOSA 2V6TA 3I4NK 4A3MK 4YFKA 5D4DA 4QIWD 3LAJA 2ZUEA 4G0UA 3ADAC 1G51A 4KN7A 1Y1VC 3I4MK 3GTPK 3ERED 4YFXA 3GTOC 1Y1VA 5C44K 3LPXA 2NVTK 4LK0A 4BBSK 1ZXOA 1VJEA 4KMAA 1USOA 3S17K 1BDFA 1TWAC 3BUEA 2B63C 4C3HC 3GTKC 5IYDC 4A3FC 2V6SA 3A8KA 5IP7C 5IP9K 5IYCC 3HOUC 1WOPA 1I3QK 1YNNA 1DD5A 3S1MC 4LQYA 1F9NA 4C2MC 4XLNA 2P5MA 1DCHA 2PMZD 2R7ZC 3N3YA 3S1RK 1XPPA 4DDQA 3GTJC 2R7ZA 4GZYA 3N0BA 2YU9C 4MEYA 3GTJA 4GTLA 5CJ9A 4AYBL 4MQ9A 3S1QC 3PO2C 2YU9A 3RZDC 4BBRK 1TWGC 1IW7A 3GTOK 2W7VA 4G0WA 1TWGA 3BP3A 1EH1A 2E2JC 1K83K 4C3IK 3S2HK 4KB2A 4LR2A 4AH6A 1TWAK 4LJZA 2B63K 3N0CA 5IORA 3GTKK 2ZFZA 3S16K 5IP7K 1TWFC 3NUHA 3PO3K 4PAAA 3GSIA 1XXBA 5E68A 4A3IC 2WB1D 2RH6A 2XCRB 3HXAA 4WJ3M 1TWFA 4BXXC 3S15K 2PA8D 2NVQC 3GTQC 4C2MK 1IE0A 4A3DC 4G7OA 4A3KK 1EI6A 1PJ5A 4A3LK 3GTQA 2JA5C 3S1NC 3A8JA 1INNA 4XSZA 3HOYK 5C4XK 1DCPA 3K7AC 2JA5A 3GIRA 2Y0SL 1IS1A 3H3VL 3S1QK 2CFAB 3PO2K 3Q3QA 2A69A 1F7VA 3HOVC 2A6EA 3GTMK 4FM9A 4XSXA 3GEHA 4KN4A 1VGXA 2R92K 5JVOA 1YX2A 1C0AA 1J98A 2NVXK 4GTCA 3S14C 1O2FB 5JFEA 4QJVB 3T00A 3OEPA 1R9TK 1TWFK 1I6HK 1ISEA 4OIRA 3CAGA 1WCMK 4A3EK 1O29A 3QX3A 4BXXK 2ZUFA 1O2BA 2XCOA 3GTQK 3H0GK 2NVQK 3S2DC 2KWAA 1XXCA 4BY7K 1F93A 1VH2A 4WILA 3GTGC 3OPFA 2JA6K 1Y1WK 4YG2A 3IPJA 2JA5K 3S1NK 1XZQB 2D6FC 5IYBC 4C45A 3GTGA 3AH5A 1F7UA 3TTGA 4O2DA 3M3YC 5C4JC 4C3JC 2Y0SD 1JOEA 2VUMK 3H3VD 1O24A 2RGRA 2FQTA 3HOVK 1J6WA 3BP8C 5HL8A 4Y7NC 3G4AA 4A3JC 4G7HA 1ZQ1C 1SMYA 3TFHA 4BLBA 2E2HC 4Y52C 1WIHA 2E2HA 4PABA 4G0VA 4KM9A 4BY1C 3HKZL 1J6XA 3LAPA 5TJ3A 1IL2A 2FQOA 2V6UA 3HOZC 4KATA 4BKWA 1Y1VK 4KMDA 4XLPA 1TWCC 2GAHC 3V4GA 4LOWA 4OIPA 2CW0A 1TWCA 3JSTA 3GTLC 3OREA 5FLMC 3HOWC 1SFOC 2R93C 2GSOA 4X6AC 3GTLA 4C3HK 3TFIA 4WJ4A 1SFOA 5IYDK 2R93A 4A3FK 5FJ8K 1KQ4A 1EFWA 1O2AA 1I50A 2CFAA 2WAQL 5IYCK 1VLOA 2JA7C 3CQZC 3HOUK 1UV7A 1ZVUA 1X31C 4LK1A 1BJTA 3S1MK 1DCOA 3FKIC 3HOXC 4NOIA 2JA7A 3CQZA 5IOQA 3AQPA 4MEXA 2E2HK 4P5AA 4OIOA 2R7ZK 1EQRA 1I6VA 3FKIA 1TWHC 4KAWX 3FOFA 3GTJK 4A3MC 1TWHA 1EK8A 1YNJA 5M3MK 4A93C 1J6VA 2YU9K 1O25A 3FHZA 4AYBD 3L4KA 4FZBA 3RZDK 1TWGK 3I4MC 2GSNA 3FOEA 3GTPC 5M3FK 1TWCK 5CHPA 3DXJA 4A3CC 1XZPB 5C44C 1IQ0A 3WODA 3SZYA 3GTPA 5C3EC 2E2JK 1VRQC 4BBSC 3GTLK 1SFOK 1L0WA 3S17C 4X6AK 4GTFA 1WSVA 4M1XA 2PPBA 1HI9A 1V5VA 4A3IK 5IP9C 3A8IA 2O5JA 3HOXK 3M4OC 4A3DK 2A68A 4A3GC 1HQMA 3T02A 1I3QA 3S1RC 4YFNA 4J3NA 4G7ZA 3K7AK 4A93K 2XCQA 5TMFA 3AD7C 4GFQA 1YCLA 2GAGC 4BBRC 4A3CK 3GEIA 5C3EK 3AD8C 1AB4A 1K83C 4KASA 4C3IC 4BLAA 2NVYC 3TFJA 3GTOA 5EGEA 4P9SA 3S2HC 5EGHA 3S14K 4KM8A 1K83A 2NVYA 4KARA 4Q5SA 1JQWA 2GSUA 3EQLA 1TWAA
chains in the Genus database with same CATH topology
2FQTA 1JVIA 1J6WA 2FQOA 1YCLA 1VJEA 5E68A 1INNA 1IE0A 1JQWA 1VGXA 1VH2A 1J98A 1J6XA 4XCHA 1JOEA 1J6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQT A;  1JVI A;  1J6W A;  2FQO A;  1YCL A;  1VJE A;  5E68 A;  1INN A;  1IE0 A;  1JQW A;  1VGX A;  1VH2 A;  1J98 A;  1J6X A;  4XCH A;  1JOE A;  1J6V A; 
#chains in the Genus database with same CATH topology
 1WOS A;  4GT9 A;  3S16 C;  3PO3 C;  1ZYR A;  2B63 A;  3GTK A;  2WB1 L;  1PJ6 A;  4LLG A;  4KMU A;  4ILD A;  3S15 C;  2PA8 L;  3GEE A;  2E2I C;  4JK1 A;  3M4O K;  3S2D K;  3RZO C;  4A3G K;  3GTG K;  4GTB A;  3MML B;  5M5W K;  4Q4Z A;  3S0X A;  4A3K C;  2E2I A;  1PJ7 A;  4A3L C;  5TMC A;  5IYB K;  5M5X K;  3HOY C;  2A6H A;  5C4X C;  4OIN A;  3M3Y K;  2EBB A;  5C4J K;  2O5I A;  4C3J K;  4GTE A;  1XXA A;  4A3B C;  1I50 C;  3AD9 C;  1ZBS A;  3VA7 A;  3SZZ A;  3GTM C;  3L4J A;  1JVI A;  2JA8 C;  4Y7N K;  1WQG A;  1B4A A;  1BGW A;  4A3J K;  2R92 C;  1XZP A;  3GTM A;  2NVY K;  4KMH A;  4P5B A;  4KC6 A;  2NVX C;  2R92 A;  1RU0 A;  4Y52 K;  1IBA A;  5M5Y K;  2JH3 A;  4RMF A;  3I4N C;  4BY1 K;  4QIW L;  2NVX A;  4QJV A;  1O28 A;  1R9T C;  3HKZ D;  3GDZ A;  1I6H C;  1WCM C;  3G4C A;  5IOT A;  4A3E C;  1WOR A;  1R9T A;  3HOZ K;  2E2I K;  1WOO A;  3H0G C;  3RZO K;  4KDD A;  1WCM A;  5L46 A;  4BY7 C;  4XCH A;  2JA6 C;  1Y1W C;  3H0G A;  2NVT C;  2PHC B;  4KB4 A;  5FLM K;  2JA6 A;  1XZQ A;  3HOW K;  1Y1W A;  2R93 K;  4A3B K;  1I50 K;  1O27 A;  3AQO A;  3T01 A;  2VUM C;  2BE5 A;  1B4B A;  1O26 A;  2VUM A;  4ZH4 A;  2JA7 K;  2Y3P A;  3CQZ K;  2WAQ D;  4GTA A;  1WQH A;  4OIQ A;  2JA8 K;  2P8T A;  1GE9 A;  1I3Q C;  3FKI K;  4GTD A;  1BS2 A;  1WQF A;  2PMZ L;  1USM A;  1TWH K;  1WSR A;  5IOS A;  2V6T A;  3I4N K;  4A3M K;  4YFK A;  5D4D A;  4QIW D;  3LAJ A;  2ZUE A;  4G0U A;  3ADA C;  1G51 A;  4KN7 A;  1Y1V C;  3I4M K;  3GTP K;  3ERE D;  4YFX A;  3GTO C;  1Y1V A;  5C44 K;  3LPX A;  2NVT K;  4LK0 A;  4BBS K;  1ZXO A;  1VJE A;  4KMA A;  1USO A;  3S17 K;  1BDF A;  1TWA C;  3BUE A;  2B63 C;  4C3H C;  3GTK C;  5IYD C;  4A3F C;  2V6S A;  3A8K A;  5IP7 C;  5IP9 K;  5IYC C;  3HOU C;  1WOP A;  1I3Q K;  1YNN A;  1DD5 A;  3S1M C;  4LQY A;  1F9N A;  4C2M C;  4XLN A;  2P5M A;  1DCH A;  2PMZ D;  2R7Z C;  3N3Y A;  3S1R K;  1XPP A;  4DDQ A;  3GTJ C;  2R7Z A;  4GZY A;  3N0B A;  2YU9 C;  4MEY A;  3GTJ A;  4GTL A;  5CJ9 A;  4AYB L;  4MQ9 A;  3S1Q C;  3PO2 C;  2YU9 A;  3RZD C;  4BBR K;  1TWG C;  1IW7 A;  3GTO K;  2W7V A;  4G0W A;  1TWG A;  3BP3 A;  1EH1 A;  2E2J C;  1K83 K;  4C3I K;  3S2H K;  4KB2 A;  4LR2 A;  4AH6 A;  1TWA K;  4LJZ A;  2B63 K;  3N0C A;  5IOR A;  3GTK K;  2ZFZ A;  3S16 K;  5IP7 K;  1TWF C;  3NUH A;  3PO3 K;  4PAA A;  3GSI A;  1XXB A;  5E68 A;  4A3I C;  2WB1 D;  2RH6 A;  2XCR B;  3HXA A;  4WJ3 M;  1TWF A;  4BXX C;  3S15 K;  2PA8 D;  2NVQ C;  3GTQ C;  4C2M K;  1IE0 A;  4A3D C;  4G7O A;  4A3K K;  1EI6 A;  1PJ5 A;  4A3L K;  3GTQ A;  2JA5 C;  3S1N C;  3A8J A;  1INN A;  4XSZ A;  3HOY K;  5C4X K;  1DCP A;  3K7A C;  2JA5 A;  3GIR A;  2Y0S L;  1IS1 A;  3H3V L;  3S1Q K;  2CFA B;  3PO2 K;  3Q3Q A;  2A69 A;  1F7V A;  3HOV C;  2A6E A;  3GTM K;  4FM9 A;  4XSX A;  3GEH A;  4KN4 A;  1VGX A;  2R92 K;  5JVO A;  1YX2 A;  1C0A A;  1J98 A;  2NVX K;  4GTC A;  3S14 C;  1O2F B;  5JFE A;  4QJV B;  3T00 A;  3OEP A;  1R9T K;  1TWF K;  1I6H K;  1ISE A;  4OIR A;  3CAG A;  1WCM K;  4A3E K;  1O29 A;  3QX3 A;  4BXX K;  2ZUF A;  1O2B A;  2XCO A;  3GTQ K;  3H0G K;  2NVQ K;  3S2D C;  2KWA A;  1XXC A;  4BY7 K;  1F93 A;  1VH2 A;  4WIL A;  3GTG C;  3OPF A;  2JA6 K;  1Y1W K;  4YG2 A;  3IPJ A;  2JA5 K;  3S1N K;  1XZQ B;  2D6F C;  5IYB C;  4C45 A;  3GTG A;  3AH5 A;  1F7U A;  3TTG A;  4O2D A;  3M3Y C;  5C4J C;  4C3J C;  2Y0S D;  1JOE A;  2VUM K;  3H3V D;  1O24 A;  2RGR A;  2FQT A;  3HOV K;  1J6W A;  3BP8 C;  5HL8 A;  4Y7N C;  3G4A A;  4A3J C;  4G7H A;  1ZQ1 C;  1SMY A;  3TFH A;  4BLB A;  2E2H C;  4Y52 C;  1WIH A;  2E2H A;  4PAB A;  4G0V A;  4KM9 A;  4BY1 C;  3HKZ L;  1J6X A;  3LAP A;  5TJ3 A;  1IL2 A;  2FQO A;  2V6U A;  3HOZ C;  4KAT A;  4BKW A;  1Y1V K;  4KMD A;  4XLP A;  1TWC C;  2GAH C;  3V4G A;  4LOW A;  4OIP A;  2CW0 A;  1TWC A;  3JST A;  3GTL C;  3ORE A;  5FLM C;  3HOW C;  1SFO C;  2R93 C;  2GSO A;  4X6A C;  3GTL A;  4C3H K;  3TFI A;  4WJ4 A;  1SFO A;  5IYD K;  2R93 A;  4A3F K;  5FJ8 K;  1KQ4 A;  1EFW A;  1O2A A;  1I50 A;  2CFA A;  2WAQ L;  5IYC K;  1VLO A;  2JA7 C;  3CQZ C;  3HOU K;  1UV7 A;  1ZVU A;  1X31 C;  4LK1 A;  1BJT A;  3S1M K;  1DCO A;  3FKI C;  3HOX C;  4NOI A;  2JA7 A;  3CQZ A;  5IOQ A;  3AQP A;  4MEX A;  2E2H K;  4P5A A;  4OIO A;  2R7Z K;  1EQR A;  1I6V A;  3FKI A;  1TWH C;  4KAW X;  3FOF A;  3GTJ K;  4A3M C;  1TWH A;  1EK8 A;  1YNJ A;  5M3M K;  4A93 C;  1J6V A;  2YU9 K;  1O25 A;  3FHZ A;  4AYB D;  3L4K A;  4FZB A;  3RZD K;  1TWG K;  3I4M C;  2GSN A;  3FOE A;  3GTP C;  5M3F K;  1TWC K;  5CHP A;  3DXJ A;  4A3C C;  1XZP B;  5C44 C;  1IQ0 A;  3WOD A;  3SZY A;  3GTP A;  5C3E C;  2E2J K;  1VRQ C;  4BBS C;  3GTL K;  1SFO K;  1L0W A;  3S17 C;  4X6A K;  4GTF A;  1WSV A;  4M1X A;  2PPB A;  1HI9 A;  1V5V A;  4A3I K;  5IP9 C;  3A8I A;  2O5J A;  3HOX K;  3M4O C;  4A3D K;  2A68 A;  4A3G C;  1HQM A;  3T02 A;  1I3Q A;  3S1R C;  4YFN A;  4J3N A;  4G7Z A;  3K7A K;  4A93 K;  2XCQ A;  5TMF A;  3AD7 C;  4GFQ A;  1YCL A;  2GAG C;  4BBR C;  4A3C K;  3GEI A;  5C3E K;  3AD8 C;  1AB4 A;  1K83 C;  4KAS A;  4C3I C;  4BLA A;  2NVY C;  3TFJ A;  3GTO A;  5EGE A;  4P9S A;  3S2H C;  5EGH A;  3S14 K;  4KM8 A;  1K83 A;  2NVY A;  4KAR A;  4Q5S A;  1JQW A;  2GSU A;  3EQL A;  1TWA A; 
#chains in the Genus database with same CATH homology
 2FQT A;  1JVI A;  1J6W A;  2FQO A;  1YCL A;  1VJE A;  5E68 A;  1INN A;  1IE0 A;  1JQW A;  1VGX A;  1VH2 A;  1J98 A;  1J6X A;  4XCH A;  1JOE A;  1J6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...