4XCHA

S-ribosylhomocysteinase from streptococcus suis
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
149
structure length
149
Chain Sequence
b'LDHTIVKAPYIRLISEEVGPKGDIITNFDIRLIQPNENAMDTAGLHTIEHLLAKLIRQRIDGLIDCSPFGCRTGFHMIMWGKQDSEKIAQVIKSSLEEIAEGITWEDVPGTTIESCGNYKDHSLHSAKEWAKLILSQGISTDAFERKPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ribosylhomocysteine lyase
publication title Crystal Structure of LuxS from Streptococcus suis
rcsb
source organism Streptococcus suis
molecule tags Lyase
total genus 48
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 4xchA00
1J98A 1J6WA 2FQOA 1JOEA 1JQWA 1JVIA 2FQTA 5E68A 1YCLA 1VGXA 1IE0A 1J6XA 1VJEA 4XCHA 1INNA 1VH2A 1J6VA
chains in the Genus database with same CATH superfamily
2R92C 3GTMC 2E2IA 3FKIA 3GEIA 4QJVA 2O5IA 4GFQA 1YNJA 2GSUA 4A93C 4BY7K 4C3HC 4LLGA 3GTOC 5IORA 3GTLA 1O28A 1BDFA 3N3YA 1XZPA 3AD9C 4G0VA 2FQTA 4KAWX 1J98A 1F93A 1Y1WC 4OINA 3HOZK 3K7AC 4GTDA 4P5BA 3M3YK 3I4NC 1I50K 2PA8D 3RZOC 4YG2A 4AYBL 5IYCC 3BP3A 1WQGA 2R7ZK 2CFAA 3HOVC 1INNA 1EQRA 1TWCC 4C3JK 4A3IK 1WQFA 4JK1A 5JFEA 3HOXC 2P5MA 1TWFA 3S1RK 4Y52K 2Y3PA 1SFOK 2W7VA 2JA8K 2VUMC 4A3CC 3TFJA 1B4AA 4XLPA 2R7ZA 1WOPA 1VGXA 1EI6A 1EK8A 3AQOA 2GAHC 4A3DC 2E2HA 4KMAA 4A3JC 5FJ8K 5IYDK 1B4BA 4RMFA 4XLNA 3A8IA 4BLBA 2RGRA 3CAGA 1PJ7A 3HOWC 4G0UA 1O2AA 2NVXK 1IL2A 2E2JK 2R93A 2JH3A 3AD7C 3PO2C 1Y1VA 4A3EC 1I3QC 3OEPA 4KMHA 1TWHK 2JA7K 4LQYA 3AD8C 3S14C 1IW7A 5E68A 3M3YC 2P8TA 4G7OA 1I50C 1WSRA 1O29A 1R9TK 3V4GA 4A3BK 3S2HK 4NOIA 3BP8C 1ZVUA 4A3FC 1IQ0A 2A69A 1TWHA 2WAQL 3TFIA 2JA7A 2JA5A 2YU9K 3S2DC 1ZBSA 4Y52C 3RZDK 3S1RC 2WB1L 4A3MK 4A3LK 5L46A 3L4KA 1ZXOA 4QIWL 1R9TA 1XXAA 4P5AA 5IP7C 2PMZL 3DXJA 4XSXA 3HKZD 3GTJK 1J6VA 1IBAA 3H0GK 3A8KA 3N0BA 3S1NC 3LPXA 4A3GC 3GTPC 3S16C 2Y0SL 2NVXC 3EQLA 1BS2A 1I6HC 2E2JC 1J6WA 1WCMC 2XCOA 4WJ4A 1GE9A 3AH5A 4O2DA 3I4MK 3GTMA 1C0AA 3S0XA 2V6SA 3TTGA 1TWAC 2V6UA 5C4XK 1VH2A 1XZQB 2B63C 4KASA 3GTQC 3FHZA 3HOUC 4FZBA 1K83C 5IYBC 1TWGK 1UV7A 4KB2A 4G7HA 1PJ6A 3GTLK 4BLAA 4OIQA 2YU9C 1IE0A 1F7VA 4A3MC 4A3LC 4KARA 1VRQC 4ZH4A 1HI9A 2NVQK 4A3KC 1TWGA 3GTJC 3Q3QA 1F9NA 4Y7NC 2GAGC 3H0GC 4GTAA 2RH6A 2NVTK 1TWFK 4C3IC 4KN4A 3T01A 3MMLB 3CQZA 1JQWA 3ERED 4KMUA 4LK1A 3HOYK 3S1MK 3AQPA 4PABA 3M4OK 2E2HK 3GEEA 4KN7A 3I4MC 2E2IC 3FKIC 2NVYA 1WIHA 5C3EC 4BBRC 5C4XC 5FLMK 2GSOA 5IP9K 2R93K 1F7UA 1Y1VK 2ZUFA 3TFHA 3GTLC 4KB4A 4BBSK 3N0CA 5C44K 1O26A 1I3QA 3GTGA 3VA7A 4XSZA 3PO3K 4GTCA 4C45A 4BXXK 4BY7C 1YX2A 1KQ4A 1VLOA 4YFKA 2JA5K 1WOSA 4X6AK 3HOZC 1TWFC 1PJ5A 2A68A 2EBBA 4BKWA 4MEXA 4WILA 1V5VA 3LAJA 1USMA 2R7ZC 2WB1D 3HOYC 3H3VL 5HL8A 3S1MC 2A6HA 4C3JC 4A3IC 1XPPA 2E2HC 2PMZD 3S1QK 1DCOA 2JA6K 1SFOC 2JA8C 3GTKA 4OIPA 4LJZA 1ISEA 4M1XA 3S15K 1L0WA 1O25A 5CJ9A 5IOSA 5EGEA 1Y1VC 1DCHA 5IYDC 4BY1K 5C44C 4P9SA 2PPBA 2JA6A 2FQOA 4J3NA 2R92K 3GEHA 3GTMK 2XCQA 1YCLA 4YFXA 4GTEA 4BXXC 2A6EA 2BE5A 3GTQA 4A93K 4C3HK 5M5XK 1WORA 1TWHC 2JA7C 2JA5C 3GTOK 4PAAA 4YFNA 2R92A 3FOFA 1ZYRA 1I6VA 3SZZA 4AH6A 5M3FK 3OREA 3A8JA 3SZYA 5IOTA 1Y1WK 4A3BC 1R9TC 3K7AK 4GTLA 3I4NK 3S2HC 1HQMA 3RZOK 5IOQA 1BJTA 2ZUEA 3NUHA 5IYCK 1X31C 5D4DA 3QX3A 3GTOA 3L4JA 3S1QC 1TWCK 3RZDC 1JVIA 4ILDA 3FOEA 3HOXK 1Y1WA 3CQZK 4A3CK 5EGHA 3S15C 4AYBD 1G51A 1O24A 1TWCA 4A3DK 4KDDA 4GTBA 4KM9A 4G0WA 4A3JK 2NVYK 3S17K 2VUMA 4MEYA 3HOWK 4LR2A 2D6FC 5M5YK 5C4JK 3PO2K 4C2MK 4A3EK 1AB4A 1I3QK 3GTGK 3T00A 3S14K 1SMYA 1JOEA 5JVOA 1TWGC 1XXCA 3LAPA 1ZQ1C 2CW0A 1WQHA 4A3FK 1DD5A 1XXBA 4MQ9A 4GTFA 2PA8L 3S2DK 3CQZC 1EFWA 2NVQC 4Q5SA 1I50A 1XZQA 2XCRB 5IP7K 4OIOA 4LK0A 4FM9A 4KM8A 5TMCA 4G7ZA 3JSTA 1IS1A 4LOWA 2NVTC 3H3VD 2NVYC 2WAQD 3S1NK 3GIRA 4A3GK 1SFOA 3GTKK 3S17C 5CHPA 3GTPK 3S16K 4QIWD 5C4JC 1I6HK 4KMDA 1WOOA 3M4OC 1WCMK 4C2MC 4Q4ZA 4QJVB 3GTGC 4KATA 3G4AA 5FLMC 2O5JA 3GTPA 5IP9C 1USOA 1TWAK 2NVXA 2B63K 2PHCB 3GTQK 2R93C 1RU0A 2Y0SD 5TMFA 3HOUK 1J6XA 1K83K 4XCHA 5IYBK 4GZYA 4BBSC 1XZPB 1WCMA 2V6TA 1WSVA 2ZFZA 1YNNA 3OPFA 2GSNA 3PO3C 1TWAA 3ADAC 2B63A 3WODA 2CFAB 2KWAA 3IPJA 1K83A 4A3KK 4GT9A 5TJ3A 5M3MK 4Y7NK 1O27A 4X6AC 2YU9A 1EH1A 4KC6A 4WJ3M 3HKZL 4C3IK 3GTKC 3HXAA 4DDQA 4OIRA 1O2BA 3GTJA 5M5WK 3HOVK 3H0GA 2JA6C 2E2IK 3FKIK 1DCPA 3G4CA 5C3EK 4BBRK 2VUMK 1VJEA 1O2FB 3GSIA 3T02A 4BY1C 1BGWA 3BUEA 3GDZA
chains in the Genus database with same CATH topology
1J98A 1J6WA 2FQOA 1JOEA 1JQWA 1JVIA 2FQTA 5E68A 1YCLA 1VGXA 1IE0A 1J6XA 1VJEA 4XCHA 1INNA 1VH2A 1J6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J98 A;  1J6W A;  2FQO A;  1JOE A;  1JQW A;  1JVI A;  2FQT A;  5E68 A;  1YCL A;  1VGX A;  1IE0 A;  1J6X A;  1VJE A;  4XCH A;  1INN A;  1VH2 A;  1J6V A; 
#chains in the Genus database with same CATH topology
 2R92 C;  3GTM C;  2E2I A;  3FKI A;  3GEI A;  4QJV A;  2O5I A;  4GFQ A;  1YNJ A;  2GSU A;  4A93 C;  4BY7 K;  4C3H C;  4LLG A;  3GTO C;  5IOR A;  3GTL A;  1O28 A;  1BDF A;  3N3Y A;  1XZP A;  3AD9 C;  4G0V A;  2FQT A;  4KAW X;  1J98 A;  1F93 A;  1Y1W C;  4OIN A;  3HOZ K;  3K7A C;  4GTD A;  4P5B A;  3M3Y K;  3I4N C;  1I50 K;  2PA8 D;  3RZO C;  4YG2 A;  4AYB L;  5IYC C;  3BP3 A;  1WQG A;  2R7Z K;  2CFA A;  3HOV C;  1INN A;  1EQR A;  1TWC C;  4C3J K;  4A3I K;  1WQF A;  4JK1 A;  5JFE A;  3HOX C;  2P5M A;  1TWF A;  3S1R K;  4Y52 K;  2Y3P A;  1SFO K;  2W7V A;  2JA8 K;  2VUM C;  4A3C C;  3TFJ A;  1B4A A;  4XLP A;  2R7Z A;  1WOP A;  1VGX A;  1EI6 A;  1EK8 A;  3AQO A;  2GAH C;  4A3D C;  2E2H A;  4KMA A;  4A3J C;  5FJ8 K;  5IYD K;  1B4B A;  4RMF A;  4XLN A;  3A8I A;  4BLB A;  2RGR A;  3CAG A;  1PJ7 A;  3HOW C;  4G0U A;  1O2A A;  2NVX K;  1IL2 A;  2E2J K;  2R93 A;  2JH3 A;  3AD7 C;  3PO2 C;  1Y1V A;  4A3E C;  1I3Q C;  3OEP A;  4KMH A;  1TWH K;  2JA7 K;  4LQY A;  3AD8 C;  3S14 C;  1IW7 A;  5E68 A;  3M3Y C;  2P8T A;  4G7O A;  1I50 C;  1WSR A;  1O29 A;  1R9T K;  3V4G A;  4A3B K;  3S2H K;  4NOI A;  3BP8 C;  1ZVU A;  4A3F C;  1IQ0 A;  2A69 A;  1TWH A;  2WAQ L;  3TFI A;  2JA7 A;  2JA5 A;  2YU9 K;  3S2D C;  1ZBS A;  4Y52 C;  3RZD K;  3S1R C;  2WB1 L;  4A3M K;  4A3L K;  5L46 A;  3L4K A;  1ZXO A;  4QIW L;  1R9T A;  1XXA A;  4P5A A;  5IP7 C;  2PMZ L;  3DXJ A;  4XSX A;  3HKZ D;  3GTJ K;  1J6V A;  1IBA A;  3H0G K;  3A8K A;  3N0B A;  3S1N C;  3LPX A;  4A3G C;  3GTP C;  3S16 C;  2Y0S L;  2NVX C;  3EQL A;  1BS2 A;  1I6H C;  2E2J C;  1J6W A;  1WCM C;  2XCO A;  4WJ4 A;  1GE9 A;  3AH5 A;  4O2D A;  3I4M K;  3GTM A;  1C0A A;  3S0X A;  2V6S A;  3TTG A;  1TWA C;  2V6U A;  5C4X K;  1VH2 A;  1XZQ B;  2B63 C;  4KAS A;  3GTQ C;  3FHZ A;  3HOU C;  4FZB A;  1K83 C;  5IYB C;  1TWG K;  1UV7 A;  4KB2 A;  4G7H A;  1PJ6 A;  3GTL K;  4BLA A;  4OIQ A;  2YU9 C;  1IE0 A;  1F7V A;  4A3M C;  4A3L C;  4KAR A;  1VRQ C;  4ZH4 A;  1HI9 A;  2NVQ K;  4A3K C;  1TWG A;  3GTJ C;  3Q3Q A;  1F9N A;  4Y7N C;  2GAG C;  3H0G C;  4GTA A;  2RH6 A;  2NVT K;  1TWF K;  4C3I C;  4KN4 A;  3T01 A;  3MML B;  3CQZ A;  1JQW A;  3ERE D;  4KMU A;  4LK1 A;  3HOY K;  3S1M K;  3AQP A;  4PAB A;  3M4O K;  2E2H K;  3GEE A;  4KN7 A;  3I4M C;  2E2I C;  3FKI C;  2NVY A;  1WIH A;  5C3E C;  4BBR C;  5C4X C;  5FLM K;  2GSO A;  5IP9 K;  2R93 K;  1F7U A;  1Y1V K;  2ZUF A;  3TFH A;  3GTL C;  4KB4 A;  4BBS K;  3N0C A;  5C44 K;  1O26 A;  1I3Q A;  3GTG A;  3VA7 A;  4XSZ A;  3PO3 K;  4GTC A;  4C45 A;  4BXX K;  4BY7 C;  1YX2 A;  1KQ4 A;  1VLO A;  4YFK A;  2JA5 K;  1WOS A;  4X6A K;  3HOZ C;  1TWF C;  1PJ5 A;  2A68 A;  2EBB A;  4BKW A;  4MEX A;  4WIL A;  1V5V A;  3LAJ A;  1USM A;  2R7Z C;  2WB1 D;  3HOY C;  3H3V L;  5HL8 A;  3S1M C;  2A6H A;  4C3J C;  4A3I C;  1XPP A;  2E2H C;  2PMZ D;  3S1Q K;  1DCO A;  2JA6 K;  1SFO C;  2JA8 C;  3GTK A;  4OIP A;  4LJZ A;  1ISE A;  4M1X A;  3S15 K;  1L0W A;  1O25 A;  5CJ9 A;  5IOS A;  5EGE A;  1Y1V C;  1DCH A;  5IYD C;  4BY1 K;  5C44 C;  4P9S A;  2PPB A;  2JA6 A;  2FQO A;  4J3N A;  2R92 K;  3GEH A;  3GTM K;  2XCQ A;  1YCL A;  4YFX A;  4GTE A;  4BXX C;  2A6E A;  2BE5 A;  3GTQ A;  4A93 K;  4C3H K;  5M5X K;  1WOR A;  1TWH C;  2JA7 C;  2JA5 C;  3GTO K;  4PAA A;  4YFN A;  2R92 A;  3FOF A;  1ZYR A;  1I6V A;  3SZZ A;  4AH6 A;  5M3F K;  3ORE A;  3A8J A;  3SZY A;  5IOT A;  1Y1W K;  4A3B C;  1R9T C;  3K7A K;  4GTL A;  3I4N K;  3S2H C;  1HQM A;  3RZO K;  5IOQ A;  1BJT A;  2ZUE A;  3NUH A;  5IYC K;  1X31 C;  5D4D A;  3QX3 A;  3GTO A;  3L4J A;  3S1Q C;  1TWC K;  3RZD C;  1JVI A;  4ILD A;  3FOE A;  3HOX K;  1Y1W A;  3CQZ K;  4A3C K;  5EGH A;  3S15 C;  4AYB D;  1G51 A;  1O24 A;  1TWC A;  4A3D K;  4KDD A;  4GTB A;  4KM9 A;  4G0W A;  4A3J K;  2NVY K;  3S17 K;  2VUM A;  4MEY A;  3HOW K;  4LR2 A;  2D6F C;  5M5Y K;  5C4J K;  3PO2 K;  4C2M K;  4A3E K;  1AB4 A;  1I3Q K;  3GTG K;  3T00 A;  3S14 K;  1SMY A;  1JOE A;  5JVO A;  1TWG C;  1XXC A;  3LAP A;  1ZQ1 C;  2CW0 A;  1WQH A;  4A3F K;  1DD5 A;  1XXB A;  4MQ9 A;  4GTF A;  2PA8 L;  3S2D K;  3CQZ C;  1EFW A;  2NVQ C;  4Q5S A;  1I50 A;  1XZQ A;  2XCR B;  5IP7 K;  4OIO A;  4LK0 A;  4FM9 A;  4KM8 A;  5TMC A;  4G7Z A;  3JST A;  1IS1 A;  4LOW A;  2NVT C;  3H3V D;  2NVY C;  2WAQ D;  3S1N K;  3GIR A;  4A3G K;  1SFO A;  3GTK K;  3S17 C;  5CHP A;  3GTP K;  3S16 K;  4QIW D;  5C4J C;  1I6H K;  4KMD A;  1WOO A;  3M4O C;  1WCM K;  4C2M C;  4Q4Z A;  4QJV B;  3GTG C;  4KAT A;  3G4A A;  5FLM C;  2O5J A;  3GTP A;  5IP9 C;  1USO A;  1TWA K;  2NVX A;  2B63 K;  2PHC B;  3GTQ K;  2R93 C;  1RU0 A;  2Y0S D;  5TMF A;  3HOU K;  1J6X A;  1K83 K;  4XCH A;  5IYB K;  4GZY A;  4BBS C;  1XZP B;  1WCM A;  2V6T A;  1WSV A;  2ZFZ A;  1YNN A;  3OPF A;  2GSN A;  3PO3 C;  1TWA A;  3ADA C;  2B63 A;  3WOD A;  2CFA B;  2KWA A;  3IPJ A;  1K83 A;  4A3K K;  4GT9 A;  5TJ3 A;  5M3M K;  4Y7N K;  1O27 A;  4X6A C;  2YU9 A;  1EH1 A;  4KC6 A;  4WJ3 M;  3HKZ L;  4C3I K;  3GTK C;  3HXA A;  4DDQ A;  4OIR A;  1O2B A;  3GTJ A;  5M5W K;  3HOV K;  3H0G A;  2JA6 C;  2E2I K;  3FKI K;  1DCP A;  3G4C A;  5C3E K;  4BBR K;  2VUM K;  1VJE A;  1O2F B;  3GSI A;  3T02 A;  4BY1 C;  1BGW A;  3BUE A;  3GDZ A; 
#chains in the Genus database with same CATH homology
 1J98 A;  1J6W A;  2FQO A;  1JOE A;  1JQW A;  1JVI A;  2FQT A;  5E68 A;  1YCL A;  1VGX A;  1IE0 A;  1J6X A;  1VJE A;  4XCH A;  1INN A;  1VH2 A;  1J6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...