4XDVA

Crystal structure of the l74f/m78v/i80v/l114f mutant of leh complexed with cyclohexanediol
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
143
structure length
143
Chain Sequence
IEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGFFTVVSVDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNFSILGVFQLTEGKITGWRDYFDLREFEEAVDLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reshaping an Enzyme Binding Pocket for Enhanced and Inverted Stereoselectivity: Use of Smallest Amino Acid Alphabets in Directed Evolution
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
molecule keywords Limonene-1,2-epoxide hydrolase
total genus 39
structure length 143
sequence length 143
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2014-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4xdvA00
1JN5B 4HM4B 3K0ZA 1W00A 4R9LA 3JUOA 2BMQB 4STDA 5IF6A 1VZZA 3DUKA 2GBWB 4HM7B 4U13A 4X2HA 3VGNA 1JB2A 2OWPA 3B4PA 4J9AA 5CLKA 2R4IA 5KP4A 1JN5A 2YFLB 5AIGA 1OF5A 3RGRA 3LYGA 5CK6A 5D83A 3EQQB 4HZBB 3CNMA 1O7GB 3FF0A 1SJWA 2XSHB 4XM4A 2GBXB 8CHOA 2F86B 1E97A 3IPTA 3ECFA 4OUQA 4LEHA 1NWWA 1OF5B 5DREA 5TGNA 5CF2A 2Z77A 1ZO2A 1O7PB 1GS3A 3A76A 1E3VA 1OUNA 1GYBA 1NU3A 1TP6A 2QIYA 1ULIB 3G8ZA 3GZRA 4N3VA 5FW5A 6STDA 1O7NB 1O7WB 1K41A 3DXOA 3EJVA 3FLJA 4FCMA 4HJLB 4XBXA 3NXJA 3DM8A 5JPPA 3MG2A 1GY6A 1EG9B 4I4KA 3JUPA 4XB5A 3WMDA 1BUQA 3HK4A 4HVNA 3NHXA 1E3RA 3NV0B 3ER7A 4L8PA 4RZMA 3D9RA 4WYKA 3ROBA 5IERA 4IIAA 3OWUA 1DMQA 2CKFB 2GXFA 3GZBA 3GWRA 3M8CA 3BLZA 3K7CA 3F8XA 1C7HA 5BVBA 1AR0A 3H51A 4KVHA 5AI1A 4HM8B 1JB5A 4K1UA 2BNGA 2QGUA 3F9SA 3F8HA 5HGRA 1WQLB 2XRXB 1UUVB 1JKGA 3KKGA 3MKIA 1IDPA 3F40A 4GB5A 4HM5B 5AEWB 4HM6B 1OH0A 1OGXA 1OHSA 2PZVA 4HZ9B 1HKXA 5AIHA 3NUVA 2HMOB 3HX8A 1JB4A 1QMAA 3KZTA 2K54A 3MG1A 2I9WA 3FZWA 2GEYA 3FGYA 2BMOB 3GZYB 4H3UA 3FF2A 3MYTA 3UNLA 4HM1B 5IG3A 3DZLA 3JUQA 4HM0B 3CNXA 3OXAA 3E99A 4XBYA 2HMJB 1Z1SA 5AIIA 1GY5A 3B4OA 2UX0A 3VSYA 4LGQA 1OPYA 4OVMA 3EBYA 4FCJA 2JQ5A 1GY7A 2B1XB 3FKAA 3EF8A 3H3HA 3NV0A 2W2CA 3EX9A 3MHEA 2F99A 1OGZA 2RCDA 3MSOA 3CU3A 4WYKB 5IEPA 2STDA 2RFRA 5AEUB 4WWUC 3EHCA 3CPOA 3DMCA 1Q40A 4WP5A 3STDA 5BXQA 2GEXA 5JPUA 1STDA 4PEJA 1CQSA 2IMJA 3EN1B 3LZAA 4ORLA 2A15A 1ISKA 1ASKA 3G0KA 2INXA 4HM3B 4Q53A 3EC9A 5IENA 4CDLA 1JKGB 5CF1A 1W6YA 4L7KA 4R1KA 5CXOA 1DMMA 1ULJB 3S5CA 3SEDA 3SOAA 5IG5A 3Q90A 1OHPA 3F7SA 2Z76A 1W02A 3JUNA 5DRVA 1O7MB 3FH1A 2BMRB 3G16A 4HKVB 3OWSA 3FSDA 3SOYA 1TUHA 3KE7A 3OV4A 5AIFA 3UJMA 3MG3A 2HMMB 3GRDA 3T8NA 2CHCA 4R9KA 3B8LA 4HM2B 3EN8A 5EVHA 4LMIA 4X2OA 3EBTA 3HZPA 3NM2A 2Z7AA 5IG0A 2B24B 2HMNB 4XDWA 4J8TA 3NBRA 2XSOB 3BB9A 3I0YA 4K1VA 2XR8B 5IEOA 3RGAA 1DMNA 5IG4A 4MJDA 1EA2A 1Q42A 1U5OA 5D82A 7STDA 1OCVA 5G2GA 1A2KA 3KSPA 3OX9A 2RGQA 3GZXB 3JUMA 5STDA 4XDVA 2HMKB 2HMLB 5KP3A 1UUWB 4XBTA 1W01A 2YFJB 2YFIB 5D81A 3T8UA 1S5AA 5KP1A 1Q40B 1QJGA 2F98A 3B7CA 4L8OA 1OHOA 1ZX2A 1NDOB 3OWYA 3F7XA 1O7HB 3F14A
chains in the Genus database with same CATH superfamily
1BAOA 1JN5B 3CCS3 1YI23 4O8SA 2JDIH 1TFKA 3ZG0A 1FGTA 3VGNA 1KWIA 3PCSA 1SQWA 1TTOA 2M7OA 2OWPA 5CLKA 1JN5A 2YFLB 1OF5A 1F8NA 1UDII 1RGEA 2XEPA 5D83A 1VQO3 1Y4KA 2CK3H 1JZDA 4XM4A 2OCTA 2F86B 3IMAB 3ECFA 4N6LA 1RNBA 1NWWA 1OF5B 5TGNA 4MEIA 4ZM8A 2KCDA 9RNTA 4QWTA 1IQYA 3KSED 5GSPA 1E3VA 1TP6A 1UCKA 2UGIA 3D3LA 1ULIB 5FW5A 1RHLA 2KF4A 1O7WB 1K41A 4EYCA 4XBXA 1D6UA 4FCMA 3DY5A 3K9MC 4HYZA 1LOVA 2Q07A 3RNTA 1G0TA 1VQ73 4L8PA 1MWRA 4WYKA 1B21A 1WMNA 3D9RA 5LC7A 5EQLA 3RDEA 1X1UA 1JBSA 2GXFA 3EE1A 3GWRA 1QVF2 2BIRA 4N6OB 2CFLA 1W5ZA 2OTL3 4LZIA 1RGLA 1KC84 3PS8A 1JB5A 2W9QA 4K1UA 1FA3A 2KXGA 5HGRA 3KKGA 3F40A 2O9UX 3CPW2 2F5WA 2CG1A 2BU4A 1OH0A 1AQZA 3NUVA 4JF8A 3HX8A 4NREA 1TJDA 1LQMB 1RJOA 1I70A 2IUKA 2BMOB 3UNLA 3FF2A 2KRTA 2FGTA 1LRAA 1IK3A 1JZOA 2BO9B 1M904 2WGOA 1GY5A 3VSYA 2XGNA 4OVMA 4FCJA 5RNTA 1GY7A 2P0XA 3H3HA 5AIFA 1EQKA 3MHEA 7GSPA 6RNTA 2QA43 2H0GA 2L4VA 3EHCA 3DMCA 3SLUA 4EC6A 4RNTA 1I8VA 4BU4A 5BXQA 1STDA 1WNHA 1MGWA 2IMJA 4G1MB 1W2B2 2XF3A 4FMAA 3LZAA 4WHAA 3LTAA 3O8YA 4NHFA 1W6GA 1GOVA 1OACA 3HIGA 4CDLA 3SEDA 1HZ1A 2F5MA 3S5CA 3QRDA 3SOAA 1X1YA 1V57A 1LOYA 1IVWA 1VQL3 3F7SA 4FMBA 2W56A 1DE3A 5DRVA 2LQVA 5IERA 4HAAA 1JJ22 1BRNL 1GOYA 3V98A 1B2MA 1Q814 3MG3A 3AMOB 2CHCA 1LVNA 1YGWA 2P05A 4LMIA 3D5IA 1N8QA 5IG0A 1WMOA 2CW9A 2B24B 2CG0A 3PGBA 3I0YA 3BB9A 3WDGB 3AMOA 2E2VA 4FMDA 4AKZA 1OCVA 2K0MA 1K734 1YJW3 3KSPA 4KT3B 4H61A 3JUMA 5AYRB 1W7CA 5KP3A 1UUWB 2XFTA 3Q2PA 3T8UA 1BRIA 1BU4A 3AHWA 1BNFA 1YJN3 1IV7A 1RCKA 1ZX2A 1BRKA 1Q9EA 2CWUA 4OK0A 3K0ZA 1RGHA 3DUKA 1BRSA 1RRLA 4U13A 1CYUA 1VQM3 4N6NB 5AIGA 2GSPA 4TX4A 1RSNA 5CK6A 3S27A 1C54A 3EQQB 2L1SA 4HZBB 1FW7A 1DYUA 3NM7A 2KF5A 1BUJA 8CHOA 1E97A 3IPTA 1T5YA 4HBRA 1RN4A 1GS3A 1YVBI 4EV5A 4N3VA 1Q7HA 2H0IA 2IA7A 5M1AA 1JNQA 1EUIC 1K8A4 3EJVA 1GMRA 1UI7A 4GL6A 3BNEA 3NX0A 3G713 1EG9B 1GY6A 4I4KA 3WMDA 1LNHA 1BVIA 1PY3A 2P38A 4HVNA 4KFDA 3ROBA 1I2FA 1VQQA 1ZS7A 1R4CA 3D79A 1JV2B 3Q3FA 1DMQA 1GMQA 2CKFB 1N5PA 1MOLA 1Q7Y4 3BLZA 5AYSC 3F8XA 1C7HA 1BSBA 1TRQA 3H51A 1G02A 4KVHA 3I553 1GD3A 1UW1A 2BNGA 1QVG2 2C11A 2GU3A 3X42A 1YHQ3 1J2BA 1RGFA 2XRXB 5M19A 2CX0A 5G1LA 2V1LA 4GB5A 4HM5B 4AEQA 2W56B 3X3YA 1Q824 1V74A 2WGQA 2Z6BA 5FGOA 3T0UA 5M18A 1DVDA 1BOXA 3BNDA 1I3IA 1VQK3 1STFI 2WOFA 1KQS2 3D4AA 3LTDA 4KZ1A 1VQ43 1ROAA 3A5EA 4FCZA 4K61A 5AIIA 2UX0A 4LGQA 3ZFZA 1BNSA 5HOHA 1MNLA 2W2CA 5IG5A 1OGZA 3CU3A 1FUSA 2RFRA 5G1KA 4FMCA 3OW22 1RCLA 3EN1B 1RMSA 3G0KA 4Q53A 2INXA 4EW5A 3EC9A 1QAKA 5IENA 4GSPA 1JKGB 2IYJA 1RKYA 1BNEA 1W6YA 2KF3A 2C10A 1GMPA 3G4S3 1RN7A 1I2GA 2Z76A 3LT8A 1PU4A 1O7MB 4HKVB 2BMRB 4KFEA 5JBSA 2QEX3 1TUHA 3KE7A 3OV4A 2W9PA 1YJ93 3K63A 2HMMB 1SIIA 3B8LA 2Y73A 2KF6A 3AGNA 2CC3A 2Z7AA 1N9JA 1RN1A 2HMNB 3LOYA 4XDWA 5ELJA 4CPKA 2E2UA 2XR8B 4BTWA 1DMNA 1ZGXA 3FG3A 5IG4A 4MJDA 1EA2A 1U5OA 1N8R4 5IW9A 1A2KA 1Q864 3NQYA 1VQ93 5EEOA 3D5GA 2CWTA 5STDA 2CX1A 1B2UA 1UGHI 1BNJA 7RNTA 1FGOA 2E2TA 1S5AA 5KP1A 1QJGA 3ALAA 2RNTA 3BIRA 1TFOA 1AY7A 3DM8A 3OWYA 4FR9A 3F14A 3FG1A 4HM4B 4R9LA 3CCM3 1W00A 3JUOA 2BMQB 1RGGA 3X41A 2K3DA 3MWZA 3SXXA 1RDSA 2GBWB 4X2HA 3U97A 2CFWA 1JB2A 3B4PA 5A0OB 2XGLA 2R4IA 3V99A 4N6V0 1B27A 5KP4A 1BRJA 1GD4A 1PFPA 3RGRA 3WOEB 1HU9A 1O7GB 3FF0A 5BU4A 3UL6A 1SJWA 2CFGA 2CH9A 1B20A 1LOXA 2W0QA 4LEHA 5DREA 1NJI4 2MF7A 5CF2A 2Z77A 1ZO2A 1W4NA 3A76A 3HIIA 2QIYA 5G2GA 1NU3A 3STDA 1S723 3GZRA 3I563 1O7NB 1VQ83 1B2XA 3DXOA 1IYYA 3WHOA 4KFFA 3MG2A 3X40A 1A2PA 1NB3I 6GSPA 3JUPA 1BUQA 2O3OA 4N6UA 1A90A 1JBRA 3HK4A 1E3RA 3KFQC 3ER7A 3V92A 4JRFA 1AV4A 3UL5A 4IIAA 3DGNA 3GZBA 1B3SA 3S67A 1BGSA 3K7CA 1IVVA 1KSIA 2D42A 2R41A 4N6MA 2QGUA 3ZG5A 1FUTA 3HI7A 1MWUA 4CJNA 3F8HA 3CCL3 2SBLA 1WQLB 1JKGA 3MKIA 1IDPA 1CH0A 4O3VA 2PZVA 3PZWA 3LXUX 1YNVX 1VQP3 1HKXA 5AIHA 2FNQA 1JRQA 1M1XB 2KAAA 3L0RA 2OQEC 3X3ZA 1UGIA 3CXC2 2K54A 1UCLA 1D6ZA 1FYSA 2W6JH 3FZWA 1IVUA 2GEYA 3QK9A 5I97A 3GZYB 1IV9A 3URPA 4HM1B 4RNZA 1VQN3 2WO0A 4HM0B 3OXAA 1SPUA 1ROVA 1AVKA 1CEWI 1UUGB 2ML5A 3B4OA 1RGAA 1IQ8A 3BU4A 1OPYA 3LTCA 2JQ5A 3J7Yd 2ZL8A 3EF8A 3NV0A 4MMYB 3MSOA 1NNVA 1PYLA 2F99A 2UUGC 1UCJA 1YIT3 1WMPA 1LNIA 3G6E3 2RSXA 2OTJ3 5AEUB 4IT7A 1FUWA 1BRHA 1BIRA 3CPOA 4WP5A 2HOHA 1BNRA 4PEJA 3KN4A 1T3BA 3BNCA 3MPHA 2RBIA 4I5QA 1HYFA 4ORLA 3X3XA 5BIRA 4HM3B 3WODG 3PCRA 1V58A 3SVAA 5CXOA 3DH2A 1R4YA 4R1KA 3CCV3 1NB5I 3CC43 3DGYA 3LT9A 4NPBA 3S28A 1OHPA 1BSAA 1B2SA 2D1WA 3SOYA 2ML6A 3HOHA 4BL3A 3FSDA 4MMXB 3UJMA 1X1XA 2W04A 3GRDA 3T8NA 4HM2B 4R4KA 3EN8A 3KIIA 5EVHA 4X2OA 3NM2A 5IEOA 5IF6A 1YVSA 2XSOB 1FGRA 3N8BA 4K1VA 3RGAA 2IUJA 4ILFA 4WFOA 5D82A 1RTUA 2P0MA 1US1A 3AGOA 1A67A 2HMKB 2HMLB 2SARA 3K5TA 4XBTA 1W01A 2YFIB 1BANA 4O02B 1Q40B 3GAXA 3EB8A 3WOFB 1SIHA 2Y74A 3SX1A 4RBNA 1NDOB 1WTHA 1O7HB 1EKMA 1NO3A 2P09A 5ELUA 3NBJA 4STDA 1VZZA 4BTXA 2W03A 4HM7B 2ZHXB 4IPBA 1I0VA 3N9HA 1IQXA 3PXMA 1A2VA 1D6YA 4J9AA 1BNGA 1W2ZA 4O2HA 3LYGA 3CC73 1TU5A 3CNMA 3LMLA 1IT7A 1BNIA 1T2IA 1IT8A 2XSHB 4BIRA 2GBXB 4BTYA 1MWSA 4EV2A 3CMA3 4OUQA 1EEJA 1RGCA 5LC6A 1BSDA 1W6CA 2IY2A 2BT3A 3IJEB 1JBTA 1SARA 1K28A 1OUNA 1GYBA 1RNTA 1N5HA 2F4YA 3G8ZA 1L5GB 6STDA 1BSCA 4HJLB 1LOWA 3FLJA 1IVXA 3NXJA 1I2EA 2F56A 5JPPA 4XB5A 2C4BA 3NQZA 4N6TA 2OOVC 3NHXA 3NV0B 4RZMA 1LQGC 4EXRA 1UI8A 3WA3A 4HOHA 3SYUA 3OWUA 2YX9A 1RLSA 1M1K4 3M8CA 1VQ63 3DGMA 5BVBA 1AR0A 1MGRA 5AI1A 4HM8B 1BSEA 3F9SA 2PNCA 2CIUA 2GU1A 3WR2A 4MMZB 1UUVB 4LSOA 1TIJA 1N9EA 3LTBA 1DETA 5AEWB 1GOUA 4HM6B 1OGXA 1OHSA 3NBBA 4HZ9B 2WOHA 2HMOB 1JB4A 1QMAA 3CCU3 3KZTA 4J5KA 3MG1A 2I9WA 1DVCA 1U8CB 3FGYA 4H3UA 3MYTA 1GSPA 5IG3A 3DGLA 1FGQA 4CCVA 3CCQ3 3DZLA 3JUQA 3CNXA 1QALA 2ZDJA 3E99A 4XBYA 4AKYA 2HMJB 1Z1SA 2CFKA 3CCJ3 3EBYA 4DKIA 2B1XB 3FKAA 2ZA4A 3EX9A 4WYKB 2RCDA 3FG4A 2OOVA 5IEPA 1VQ53 2STDA 1MWTA 2BHMA 3WA2X 4WWUC 1K9M4 1YIJ3 5JPUA 1Q40A 2GEXA 1CQSA 2A15A 1ISKA 1ASKA 2XFSA 2XH9A 4K90B 3JVCA 3CD63 1RGKA 8RNTA 5CF1A 4L7KA 3TDGA 3AHSA 1DMMA 1ULJB 3PYJA 2CWVA 2AAEA 4BL2A 3Q90A 1M9GA 1BRGA 1QAFA 1RRHA 1W02A 1FGMA 3FH1A 3G16A 3JUNA 3OWSA 2J8XB 1I3FA 1B2ZA 1UCIA 3N54B 4GHOA 2FXTA 1YGEA 3GSPA 4R9KA 1CYVA 2OQEA 3VF1A 1G96A 3CC23 2AADA 3EBTA 3HZPA 3BNBA 4J8TA 3NBRA 3UB1A 1X1WA 3U1WA 1FZUA 4LYLB 2LYXA 2H0HA 1I0XA 1AVLA 1IU7A 1Q42A 2CFDA 3FCSB 3Q1CA 2MC8A 3KCHA 7STDA 3CCE3 3LH4A 3OX9A 3S29A 1TRPA 2RGQA 3GZXB 4R80A 4XDVA 1KD14 3DGOA 4EBGA 4J5GA 3CME3 2YFJB 5D81A 2F98A 3B7CA 3CCR3 4RNYA 4L8OA 1OHOA 1LXEA 1O7PB 3F7XA 1T2HA
chains in the Genus database with same CATH topology
3CCS3 1JN5B 1YI23 4O8SA 2JDIH 1TFKA 1FGTA 3VGNA 1KWIA 3PCSA 1SQWA 2M7OA 2OWPA 5CLKA 1JN5A 2YFLB 1OF5A 1F8NA 1VQO3 2XEPA 5D83A 1Y4KA 2CK3H 4XM4A 2OCTA 2F86B 3IMAB 3ECFA 4N6LA 1NWWA 1OF5B 5TGNA 4MEIA 4ZM8A 2KCDA 4QWTA 1IQYA 3KSED 1E3VA 1TP6A 3D3LA 1ULIB 5FW5A 1O7WB 1K41A 4EYCA 4XBXA 1D6UA 4FCMA 3DY5A 3K9MC 4HYZA 2Q07A 1VQ73 4L8PA 4WYKA 3D9RA 1WMNA 5LC7A 3RDEA 5EQLA 2GXFA 3EE1A 3GWRA 1QVF2 4N6OB 1W5ZA 2CFLA 2OTL3 4LZIA 1KC84 3PS8A 1JB5A 2W9QA 4K1UA 1FA3A 2KXGA 5HGRA 3KKGA 3F40A 2O9UX 3CPW2 2CG1A 1OH0A 3NUVA 4JF8A 3HX8A 4NREA 1RJOA 2IUKA 2BMOB 3UNLA 3FF2A 2KRTA 2FGTA 1IK3A 2BO9B 1M904 2WGOA 1GY5A 3VSYA 2XGNA 4OVMA 4FCJA 1GY7A 2P0XA 3H3HA 5AIFA 3MHEA 2QA43 2L4VA 3EHCA 3DMCA 3SLUA 4EC6A 5BXQA 1W2B2 1EQKA 1STDA 1WNHA 2IMJA 4G1MB 2XF3A 4FMAA 3LZAA 4WHAA 3LTAA 3O8YA 4NHFA 1W6GA 1OACA 3HIGA 4CDLA 3SEDA 3S5CA 3SOAA 3QRDA 1IVWA 1VQL3 3F7SA 4FMBA 2W56A 5DRVA 2LQVA 5IERA 1JJ22 3V98A 1Q814 3MG3A 3AMOB 2CHCA 1LVNA 2P05A 4LMIA 5IG0A 1N8QA 1WMOA 2CW9A 2B24B 2CG0A 3PGBA 3I0YA 3BB9A 3WDGB 3AMOA 2E2VA 4FMDA 4AKZA 1OCVA 2K0MA 1K734 1YJW3 3KSPA 4H61A 3JUMA 5AYRB 1W7CA 5KP3A 1UUWB 2XFTA 3Q2PA 3T8UA 1YJN3 1IV7A 1ZX2A 2CWUA 4OK0A 3K0ZA 3DUKA 4U13A 1RRLA 1CYUA 1VQM3 4N6NB 5AIGA 4TX4A 5CK6A 3S27A 3EQQB 4HZBB 1DYUA 3NM7A 8CHOA 1E97A 3IPTA 1T5YA 4HBRA 1GS3A 1YVBI 4EV5A 4N3VA 2IA7A 1JNQA 1K8A4 3EJVA 1UI7A 4GL6A 3BNEA 3NX0A 3G713 1GY6A 1EG9B 4I4KA 3WMDA 1LNHA 2P38A 4HVNA 4KFDA 3ROBA 1R4CA 1JV2B 1DMQA 2CKFB 1N5PA 1MOLA 1Q7Y4 3BLZA 5AYSC 3F8XA 1C7HA 3I553 3H51A 4KVHA 1GD3A 1UW1A 2BNGA 1QVG2 2C11A 2GU3A 3X42A 1YHQ3 1J2BA 2XRXB 2V1LA 4GB5A 4HM5B 4AEQA 2W56B 3X3YA 1Q824 1V74A 2WGQA 2Z6BA 5FGOA 3T0UA 1DVDA 3BNDA 1VQK3 1STFI 2WOFA 1KQS2 3LTDA 4KZ1A 1VQ43 1ROAA 4FCZA 4K61A 5AIIA 2UX0A 4LGQA 5IG5A 1MNLA 2W2CA 1OGZA 3CU3A 2RFRA 4FMCA 3OW22 3EN1B 3G0KA 4Q53A 2INXA 3EC9A 1QAKA 5IENA 1JKGB 1RKYA 1W6YA 2C10A 3G4S3 1RN7A 2Z76A 3LT8A 1PU4A 1O7MB 4HKVB 2BMRB 4KFEA 5JBSA 2QEX3 1TUHA 3KE7A 3OV4A 2W9PA 1YJ93 3K63A 2HMMB 1SIIA 3B8LA 2Y73A 2CC3A 2Z7AA 1N9JA 3LOYA 2HMNB 4XDWA 5ELJA 2E2UA 2XR8B 4BTWA 1DMNA 3FG3A 5IG4A 4MJDA 1EA2A 1U5OA 1N8R4 5IW9A 1A2KA 1Q864 3NQYA 1VQ93 5EEOA 2CWTA 5STDA 1FGOA 2E2TA 1S5AA 5KP1A 1QJGA 3ALAA 1TFOA 3DM8A 3OWYA 4FR9A 3F14A 3FG1A 4HM4B 4R9LA 3CCM3 1W00A 3JUOA 2BMQB 3X41A 3MWZA 3SXXA 2GBWB 4X2HA 3U97A 2CFWA 1JB2A 3B4PA 5A0OB 2XGLA 2R4IA 3V99A 4N6V0 5KP4A 1GD4A 1PFPA 3RGRA 3WOEB 1HU9A 1O7GB 3FF0A 3UL6A 1SJWA 2CFGA 2CH9A 1LOXA 2W0QA 4LEHA 5DREA 1NJI4 2MF7A 5CF2A 2Z77A 3A76A 1ZO2A 1W4NA 3HIIA 2QIYA 5G2GA 1NU3A 3STDA 1S723 3GZRA 3I563 1O7NB 1VQ83 3DXOA 4KFFA 3MG2A 3X40A 1NB3I 1BUQA 3JUPA 2O3OA 4N6UA 1A90A 3HK4A 1E3RA 3KFQC 3ER7A 3V92A 4JRFA 1AV4A 3UL5A 4IIAA 3DGNA 3GZBA 3S67A 3K7CA 1IVVA 1KSIA 2D42A 4N6MA 2QGUA 3HI7A 3F8HA 3CCL3 2SBLA 1WQLB 1JKGA 3MKIA 1IDPA 4O3VA 2PZVA 3PZWA 3LXUX 1VQP3 1HKXA 5AIHA 2FNQA 1JRQA 1M1XB 3X3ZA 3L0RA 2OQEC 3CXC2 2K54A 3FZWA 1D6ZA 3QK9A 2W6JH 1IVUA 2GEYA 5I97A 3GZYB 1IV9A 4HM1B 4RNZA 1VQN3 2WO0A 4HM0B 3OXAA 1SPUA 1ROVA 1AVKA 1CEWI 2ML5A 3B4OA 3LTCA 1IQ8A 1OPYA 2JQ5A 3J7Yd 2ZL8A 3EF8A 3NV0A 4MMYB 3MSOA 2F99A 1YIT3 1WMPA 3G6E3 2RSXA 2OTJ3 5AEUB 4IT7A 1FUWA 3CPOA 4WP5A 4PEJA 3KN4A 3X3XA 3BNCA 3MPHA 4ORLA 4HM3B 3WODG 3PCRA 3SVAA 5CXOA 3CCV3 4R1KA 1NB5I 3CC43 3LT9A 3S28A 1OHPA 2D1WA 3SOYA 2ML6A 3FSDA 4MMXB 3UJMA 2W04A 3GRDA 3T8NA 4HM2B 4R4KA 3EN8A 3KIIA 5EVHA 4X2OA 3NM2A 5IEOA 5IF6A 2XSOB 3N8BA 1FGRA 4K1VA 3RGAA 2IUJA 4WFOA 5D82A 2P0MA 1US1A 1A67A 2HMKB 2HMLB 3K5TA 4XBTA 1W01A 2YFIB 4O02B 1Q40B 3GAXA 3EB8A 3WOFB 1SIHA 2Y74A 3SX1A 4RBNA 1NDOB 1WTHA 1EKMA 2P09A 1O7HB 1NO3A 5ELUA 3NBJA 4STDA 1VZZA 4BTXA 2W03A 4HM7B 4IPBA 3N9HA 3PXMA 1IQXA 1A2VA 1D6YA 4J9AA 1W2ZA 4O2HA 3LYGA 3CC73 1TU5A 3CNMA 3LMLA 1IT7A 1IT8A 2XSHB 2GBXB 4BTYA 4EV2A 3CMA3 4OUQA 5LC6A 1W6CA 2BT3A 3IJEB 1K28A 1OUNA 1GYBA 1N5HA 3G8ZA 1L5GB 6STDA 4HJLB 3FLJA 1IVXA 3NXJA 5JPPA 4XB5A 3NQZA 4N6TA 2OOVC 3NHXA 3NV0B 4RZMA 4EXRA 3WA3A 1UI8A 3OWUA 2YX9A 1M1K4 3M8CA 1VQ63 3DGMA 5BVBA 1AR0A 5AI1A 4HM8B 3F9SA 2PNCA 2CIUA 2GU1A 4MMZB 1UUVB 4LSOA 1TIJA 1N9EA 3LTBA 5AEWB 4HM6B 1OGXA 1OHSA 3NBBA 4HZ9B 2WOHA 2HMOB 1JB4A 1QMAA 3CCU3 3KZTA 3MG1A 2I9WA 1DVCA 1U8CB 3FGYA 4H3UA 3MYTA 5IG3A 3DGLA 1FGQA 4CCVA 3CCQ3 3DZLA 3JUQA 3CNXA 1QALA 2ZDJA 3E99A 4XBYA 4AKYA 2HMJB 1Z1SA 2CFKA 3CCJ3 3EBYA 2B1XB 3FKAA 3EX9A 4WYKB 2RCDA 3FG4A 2OOVA 5IEPA 1VQ53 2STDA 2BHMA 3WA2X 4WWUC 1K9M4 1YIJ3 5JPUA 1Q40A 2GEXA 1CQSA 2A15A 1ISKA 1ASKA 2XFSA 2XH9A 4K90B 3JVCA 3CD63 5CF1A 4L7KA 3TDGA 1DMMA 1ULJB 3PYJA 2CWVA 3Q90A 1M9GA 1QAFA 1RRHA 1W02A 1FGMA 3FH1A 3G16A 3JUNA 3OWSA 3N54B 2FXTA 1YGEA 3VF1A 4R9KA 1CYVA 2OQEA 1G96A 3CC23 3EBTA 3HZPA 3BNBA 4J8TA 3NBRA 3UB1A 3U1WA 2LYXA 1Q42A 1IU7A 1AVLA 2CFDA 3FCSB 3Q1CA 2MC8A 7STDA 3CCE3 3LH4A 3OX9A 3S29A 2RGQA 3GZXB 4R80A 4XDVA 1KD14 3DGOA 4EBGA 3CME3 2YFJB 5D81A 2F98A 3B7CA 3CCR3 4RNYA 4L8OA 1OHOA 1LXEA 1O7PB 3F7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JN5 B;  4HM4 B;  3K0Z A;  1W00 A;  4R9L A;  3JUO A;  2BMQ B;  4STD A;  5IF6 A;  1VZZ A;  3DUK A;  2GBW B;  4HM7 B;  4U13 A;  4X2H A;  3VGN A;  1JB2 A;  2OWP A;  3B4P A;  4J9A A;  5CLK A;  2R4I A;  5KP4 A;  1JN5 A;  2YFL B;  5AIG A;  1OF5 A;  3RGR A;  3LYG A;  5CK6 A;  5D83 A;  3EQQ B;  4HZB B;  3CNM A;  1O7G B;  3FF0 A;  1SJW A;  2XSH B;  4XM4 A;  2GBX B;  8CHO A;  2F86 B;  1E97 A;  3IPT A;  3ECF A;  4OUQ A;  4LEH A;  1NWW A;  1OF5 B;  5DRE A;  5TGN A;  5CF2 A;  2Z77 A;  1ZO2 A;  1O7P B;  1GS3 A;  3A76 A;  1E3V A;  1OUN A;  1GYB A;  1NU3 A;  1TP6 A;  2QIY A;  1ULI B;  3G8Z A;  3GZR A;  4N3V A;  5FW5 A;  6STD A;  1O7N B;  1O7W B;  1K41 A;  3DXO A;  3EJV A;  3FLJ A;  4FCM A;  4HJL B;  4XBX A;  3NXJ A;  3DM8 A;  5JPP A;  3MG2 A;  1GY6 A;  1EG9 B;  4I4K A;  3JUP A;  4XB5 A;  3WMD A;  1BUQ A;  3HK4 A;  4HVN A;  3NHX A;  1E3R A;  3NV0 B;  3ER7 A;  4L8P A;  4RZM A;  3D9R A;  4WYK A;  3ROB A;  5IER A;  4IIA A;  3OWU A;  1DMQ A;  2CKF B;  2GXF A;  3GZB A;  3GWR A;  3M8C A;  3BLZ A;  3K7C A;  3F8X A;  1C7H A;  5BVB A;  1AR0 A;  3H51 A;  4KVH A;  5AI1 A;  4HM8 B;  1JB5 A;  4K1U A;  2BNG A;  2QGU A;  3F9S A;  3F8H A;  5HGR A;  1WQL B;  2XRX B;  1UUV B;  1JKG A;  3KKG A;  3MKI A;  1IDP A;  3F40 A;  4GB5 A;  4HM5 B;  5AEW B;  4HM6 B;  1OH0 A;  1OGX A;  1OHS A;  2PZV A;  4HZ9 B;  1HKX A;  5AIH A;  3NUV A;  2HMO B;  3HX8 A;  1JB4 A;  1QMA A;  3KZT A;  2K54 A;  3MG1 A;  2I9W A;  3FZW A;  2GEY A;  3FGY A;  2BMO B;  3GZY B;  4H3U A;  3FF2 A;  3MYT A;  3UNL A;  4HM1 B;  5IG3 A;  3DZL A;  3JUQ A;  4HM0 B;  3CNX A;  3OXA A;  3E99 A;  4XBY A;  2HMJ B;  1Z1S A;  5AII A;  1GY5 A;  3B4O A;  2UX0 A;  3VSY A;  4LGQ A;  1OPY A;  4OVM A;  3EBY A;  4FCJ A;  2JQ5 A;  1GY7 A;  2B1X B;  3FKA A;  3EF8 A;  3H3H A;  3NV0 A;  2W2C A;  3EX9 A;  3MHE A;  2F99 A;  1OGZ A;  2RCD A;  3MSO A;  3CU3 A;  4WYK B;  5IEP A;  2STD A;  2RFR A;  5AEU B;  4WWU C;  3EHC A;  3CPO A;  3DMC A;  1Q40 A;  4WP5 A;  3STD A;  5BXQ A;  2GEX A;  5JPU A;  1STD A;  4PEJ A;  1CQS A;  2IMJ A;  3EN1 B;  3LZA A;  4ORL A;  2A15 A;  1ISK A;  1ASK A;  3G0K A;  2INX A;  4HM3 B;  4Q53 A;  3EC9 A;  5IEN A;  4CDL A;  1JKG B;  5CF1 A;  1W6Y A;  4L7K A;  4R1K A;  5CXO A;  1DMM A;  1ULJ B;  3S5C A;  3SED A;  3SOA A;  5IG5 A;  3Q90 A;  1OHP A;  3F7S A;  2Z76 A;  1W02 A;  3JUN A;  5DRV A;  1O7M B;  3FH1 A;  2BMR B;  3G16 A;  4HKV B;  3OWS A;  3FSD A;  3SOY A;  1TUH A;  3KE7 A;  3OV4 A;  5AIF A;  3UJM A;  3MG3 A;  2HMM B;  3GRD A;  3T8N A;  2CHC A;  4R9K A;  3B8L A;  4HM2 B;  3EN8 A;  5EVH A;  4LMI A;  4X2O A;  3EBT A;  3HZP A;  3NM2 A;  2Z7A A;  5IG0 A;  2B24 B;  2HMN B;  4XDW A;  4J8T A;  3NBR A;  2XSO B;  3BB9 A;  3I0Y A;  4K1V A;  2XR8 B;  5IEO A;  3RGA A;  1DMN A;  5IG4 A;  4MJD A;  1EA2 A;  1Q42 A;  1U5O A;  5D82 A;  7STD A;  1OCV A;  5G2G A;  1A2K A;  3KSP A;  3OX9 A;  2RGQ A;  3GZX B;  3JUM A;  5STD A;  4XDV A;  2HMK B;  2HML B;  5KP3 A;  1UUW B;  4XBT A;  1W01 A;  2YFJ B;  2YFI B;  5D81 A;  3T8U A;  1S5A A;  5KP1 A;  1Q40 B;  1QJG A;  2F98 A;  3B7C A;  4L8O A;  1OHO A;  1ZX2 A;  1NDO B;  3OWY A;  3F7X A;  1O7H B;  3F14 A; 
#chains in the Genus database with same CATH topology
 1BAO A;  1JN5 B;  3CCS 3;  1YI2 3;  4O8S A;  2JDI H;  1TFK A;  3ZG0 A;  1FGT A;  3VGN A;  1KWI A;  3PCS A;  1SQW A;  1TTO A;  2M7O A;  2OWP A;  5CLK A;  1JN5 A;  2YFL B;  1OF5 A;  1F8N A;  1UDI I;  1RGE A;  2XEP A;  5D83 A;  1VQO 3;  1Y4K A;  2CK3 H;  1JZD A;  4XM4 A;  2OCT A;  2F86 B;  3IMA B;  3ECF A;  4N6L A;  1RNB A;  1NWW A;  1OF5 B;  5TGN A;  4MEI A;  4ZM8 A;  2KCD A;  9RNT A;  4QWT A;  1IQY A;  3KSE D;  5GSP A;  1E3V A;  1TP6 A;  1UCK A;  2UGI A;  3D3L A;  1ULI B;  5FW5 A;  1RHL A;  2KF4 A;  1O7W B;  1K41 A;  4EYC A;  4XBX A;  1D6U A;  4FCM A;  3DY5 A;  3K9M C;  4HYZ A;  1LOV A;  2Q07 A;  3RNT A;  1G0T A;  1VQ7 3;  4L8P A;  1MWR A;  4WYK A;  1B21 A;  1WMN A;  3D9R A;  5LC7 A;  5EQL A;  3RDE A;  1X1U A;  1JBS A;  2GXF A;  3EE1 A;  3GWR A;  1QVF 2;  2BIR A;  4N6O B;  2CFL A;  1W5Z A;  2OTL 3;  4LZI A;  1RGL A;  1KC8 4;  3PS8 A;  1JB5 A;  2W9Q A;  4K1U A;  1FA3 A;  2KXG A;  5HGR A;  3KKG A;  3F40 A;  2O9U X;  3CPW 2;  2F5W A;  2CG1 A;  2BU4 A;  1OH0 A;  1AQZ A;  3NUV A;  4JF8 A;  3HX8 A;  4NRE A;  1TJD A;  1LQM B;  1RJO A;  1I70 A;  2IUK A;  2BMO B;  3UNL A;  3FF2 A;  2KRT A;  2FGT A;  1LRA A;  1IK3 A;  1JZO A;  2BO9 B;  1M90 4;  2WGO A;  1GY5 A;  3VSY A;  2XGN A;  4OVM A;  4FCJ A;  5RNT A;  1GY7 A;  2P0X A;  3H3H A;  5AIF A;  1EQK A;  3MHE A;  7GSP A;  6RNT A;  2QA4 3;  2H0G A;  2L4V A;  3EHC A;  3DMC A;  3SLU A;  4EC6 A;  4RNT A;  1I8V A;  4BU4 A;  5BXQ A;  1STD A;  1WNH A;  1MGW A;  2IMJ A;  4G1M B;  1W2B 2;  2XF3 A;  4FMA A;  3LZA A;  4WHA A;  3LTA A;  3O8Y A;  4NHF A;  1W6G A;  1GOV A;  1OAC A;  3HIG A;  4CDL A;  3SED A;  1HZ1 A;  2F5M A;  3S5C A;  3QRD A;  3SOA A;  1X1Y A;  1V57 A;  1LOY A;  1IVW A;  1VQL 3;  3F7S A;  4FMB A;  2W56 A;  1DE3 A;  5DRV A;  2LQV A;  5IER A;  4HAA A;  1JJ2 2;  1BRN L;  1GOY A;  3V98 A;  1B2M A;  1Q81 4;  3MG3 A;  3AMO B;  2CHC A;  1LVN A;  1YGW A;  2P05 A;  4LMI A;  3D5I A;  1N8Q A;  5IG0 A;  1WMO A;  2CW9 A;  2B24 B;  2CG0 A;  3PGB A;  3I0Y A;  3BB9 A;  3WDG B;  3AMO A;  2E2V A;  4FMD A;  4AKZ A;  1OCV A;  2K0M A;  1K73 4;  1YJW 3;  3KSP A;  4KT3 B;  4H61 A;  3JUM A;  5AYR B;  1W7C A;  5KP3 A;  1UUW B;  2XFT A;  3Q2P A;  3T8U A;  1BRI A;  1BU4 A;  3AHW A;  1BNF A;  1YJN 3;  1IV7 A;  1RCK A;  1ZX2 A;  1BRK A;  1Q9E A;  2CWU A;  4OK0 A;  3K0Z A;  1RGH A;  3DUK A;  1BRS A;  1RRL A;  4U13 A;  1CYU A;  1VQM 3;  4N6N B;  5AIG A;  2GSP A;  4TX4 A;  1RSN A;  5CK6 A;  3S27 A;  1C54 A;  3EQQ B;  2L1S A;  4HZB B;  1FW7 A;  1DYU A;  3NM7 A;  2KF5 A;  1BUJ A;  8CHO A;  1E97 A;  3IPT A;  1T5Y A;  4HBR A;  1RN4 A;  1GS3 A;  1YVB I;  4EV5 A;  4N3V A;  1Q7H A;  2H0I A;  2IA7 A;  5M1A A;  1JNQ A;  1EUI C;  1K8A 4;  3EJV A;  1GMR A;  1UI7 A;  4GL6 A;  3BNE A;  3NX0 A;  3G71 3;  1EG9 B;  1GY6 A;  4I4K A;  3WMD A;  1LNH A;  1BVI A;  1PY3 A;  2P38 A;  4HVN A;  4KFD A;  3ROB A;  1I2F A;  1VQQ A;  1ZS7 A;  1R4C A;  3D79 A;  1JV2 B;  3Q3F A;  1DMQ A;  1GMQ A;  2CKF B;  1N5P A;  1MOL A;  1Q7Y 4;  3BLZ A;  5AYS C;  3F8X A;  1C7H A;  1BSB A;  1TRQ A;  3H51 A;  1G02 A;  4KVH A;  3I55 3;  1GD3 A;  1UW1 A;  2BNG A;  1QVG 2;  2C11 A;  2GU3 A;  3X42 A;  1YHQ 3;  1J2B A;  1RGF A;  2XRX B;  5M19 A;  2CX0 A;  5G1L A;  2V1L A;  4GB5 A;  4HM5 B;  4AEQ A;  2W56 B;  3X3Y A;  1Q82 4;  1V74 A;  2WGQ A;  2Z6B A;  5FGO A;  3T0U A;  5M18 A;  1DVD A;  1BOX A;  3BND A;  1I3I A;  1VQK 3;  1STF I;  2WOF A;  1KQS 2;  3D4A A;  3LTD A;  4KZ1 A;  1VQ4 3;  1ROA A;  3A5E A;  4FCZ A;  4K61 A;  5AII A;  2UX0 A;  4LGQ A;  3ZFZ A;  1BNS A;  5HOH A;  1MNL A;  2W2C A;  5IG5 A;  1OGZ A;  3CU3 A;  1FUS A;  2RFR A;  5G1K A;  4FMC A;  3OW2 2;  1RCL A;  3EN1 B;  1RMS A;  3G0K A;  4Q53 A;  2INX A;  4EW5 A;  3EC9 A;  1QAK A;  5IEN A;  4GSP A;  1JKG B;  2IYJ A;  1RKY A;  1BNE A;  1W6Y A;  2KF3 A;  2C10 A;  1GMP A;  3G4S 3;  1RN7 A;  1I2G A;  2Z76 A;  3LT8 A;  1PU4 A;  1O7M B;  4HKV B;  2BMR B;  4KFE A;  5JBS A;  2QEX 3;  1TUH A;  3KE7 A;  3OV4 A;  2W9P A;  1YJ9 3;  3K63 A;  2HMM B;  1SII A;  3B8L A;  2Y73 A;  2KF6 A;  3AGN A;  2CC3 A;  2Z7A A;  1N9J A;  1RN1 A;  2HMN B;  3LOY A;  4XDW A;  5ELJ A;  4CPK A;  2E2U A;  2XR8 B;  4BTW A;  1DMN A;  1ZGX A;  3FG3 A;  5IG4 A;  4MJD A;  1EA2 A;  1U5O A;  1N8R 4;  5IW9 A;  1A2K A;  1Q86 4;  3NQY A;  1VQ9 3;  5EEO A;  3D5G A;  2CWT A;  5STD A;  2CX1 A;  1B2U A;  1UGH I;  1BNJ A;  7RNT A;  1FGO A;  2E2T A;  1S5A A;  5KP1 A;  1QJG A;  3ALA A;  2RNT A;  3BIR A;  1TFO A;  1AY7 A;  3DM8 A;  3OWY A;  4FR9 A;  3F14 A;  3FG1 A;  4HM4 B;  4R9L A;  3CCM 3;  1W00 A;  3JUO A;  2BMQ B;  1RGG A;  3X41 A;  2K3D A;  3MWZ A;  3SXX A;  1RDS A;  2GBW B;  4X2H A;  3U97 A;  2CFW A;  1JB2 A;  3B4P A;  5A0O B;  2XGL A;  2R4I A;  3V99 A;  4N6V 0;  1B27 A;  5KP4 A;  1BRJ A;  1GD4 A;  1PFP A;  3RGR A;  3WOE B;  1HU9 A;  1O7G B;  3FF0 A;  5BU4 A;  3UL6 A;  1SJW A;  2CFG A;  2CH9 A;  1B20 A;  1LOX A;  2W0Q A;  4LEH A;  5DRE A;  1NJI 4;  2MF7 A;  5CF2 A;  2Z77 A;  1ZO2 A;  1W4N A;  3A76 A;  3HII A;  2QIY A;  5G2G A;  1NU3 A;  3STD A;  1S72 3;  3GZR A;  3I56 3;  1O7N B;  1VQ8 3;  1B2X A;  3DXO A;  1IYY A;  3WHO A;  4KFF A;  3MG2 A;  3X40 A;  1A2P A;  1NB3 I;  6GSP A;  3JUP A;  1BUQ A;  2O3O A;  4N6U A;  1A90 A;  1JBR A;  3HK4 A;  1E3R A;  3KFQ C;  3ER7 A;  3V92 A;  4JRF A;  1AV4 A;  3UL5 A;  4IIA A;  3DGN A;  3GZB A;  1B3S A;  3S67 A;  1BGS A;  3K7C A;  1IVV A;  1KSI A;  2D42 A;  2R41 A;  4N6M A;  2QGU A;  3ZG5 A;  1FUT A;  3HI7 A;  1MWU A;  4CJN A;  3F8H A;  3CCL 3;  2SBL A;  1WQL B;  1JKG A;  3MKI A;  1IDP A;  1CH0 A;  4O3V A;  2PZV A;  3PZW A;  3LXU X;  1YNV X;  1VQP 3;  1HKX A;  5AIH A;  2FNQ A;  1JRQ A;  1M1X B;  2KAA A;  3L0R A;  2OQE C;  3X3Z A;  1UGI A;  3CXC 2;  2K54 A;  1UCL A;  1D6Z A;  1FYS A;  2W6J H;  3FZW A;  1IVU A;  2GEY A;  3QK9 A;  5I97 A;  3GZY B;  1IV9 A;  3URP A;  4HM1 B;  4RNZ A;  1VQN 3;  2WO0 A;  4HM0 B;  3OXA A;  1SPU A;  1ROV A;  1AVK A;  1CEW I;  1UUG B;  2ML5 A;  3B4O A;  1RGA A;  1IQ8 A;  3BU4 A;  1OPY A;  3LTC A;  2JQ5 A;  3J7Y d;  2ZL8 A;  3EF8 A;  3NV0 A;  4MMY B;  3MSO A;  1NNV A;  1PYL A;  2F99 A;  2UUG C;  1UCJ A;  1YIT 3;  1WMP A;  1LNI A;  3G6E 3;  2RSX A;  2OTJ 3;  5AEU B;  4IT7 A;  1FUW A;  1BRH A;  1BIR A;  3CPO A;  4WP5 A;  2HOH A;  1BNR A;  4PEJ A;  3KN4 A;  1T3B A;  3BNC A;  3MPH A;  2RBI A;  4I5Q A;  1HYF A;  4ORL A;  3X3X A;  5BIR A;  4HM3 B;  3WOD G;  3PCR A;  1V58 A;  3SVA A;  5CXO A;  3DH2 A;  1R4Y A;  4R1K A;  3CCV 3;  1NB5 I;  3CC4 3;  3DGY A;  3LT9 A;  4NPB A;  3S28 A;  1OHP A;  1BSA A;  1B2S A;  2D1W A;  3SOY A;  2ML6 A;  3HOH A;  4BL3 A;  3FSD A;  4MMX B;  3UJM A;  1X1X A;  2W04 A;  3GRD A;  3T8N A;  4HM2 B;  4R4K A;  3EN8 A;  3KII A;  5EVH A;  4X2O A;  3NM2 A;  5IEO A;  5IF6 A;  1YVS A;  2XSO B;  1FGR A;  3N8B A;  4K1V A;  3RGA A;  2IUJ A;  4ILF A;  4WFO A;  5D82 A;  1RTU A;  2P0M A;  1US1 A;  3AGO A;  1A67 A;  2HMK B;  2HML B;  2SAR A;  3K5T A;  4XBT A;  1W01 A;  2YFI B;  1BAN A;  4O02 B;  1Q40 B;  3GAX A;  3EB8 A;  3WOF B;  1SIH A;  2Y74 A;  3SX1 A;  4RBN A;  1NDO B;  1WTH A;  1O7H B;  1EKM A;  1NO3 A;  2P09 A;  5ELU A;  3NBJ A;  4STD A;  1VZZ A;  4BTX A;  2W03 A;  4HM7 B;  2ZHX B;  4IPB A;  1I0V A;  3N9H A;  1IQX A;  3PXM A;  1A2V A;  1D6Y A;  4J9A A;  1BNG A;  1W2Z A;  4O2H A;  3LYG A;  3CC7 3;  1TU5 A;  3CNM A;  3LML A;  1IT7 A;  1BNI A;  1T2I A;  1IT8 A;  2XSH B;  4BIR A;  2GBX B;  4BTY A;  1MWS A;  4EV2 A;  3CMA 3;  4OUQ A;  1EEJ A;  1RGC A;  5LC6 A;  1BSD A;  1W6C A;  2IY2 A;  2BT3 A;  3IJE B;  1JBT A;  1SAR A;  1K28 A;  1OUN A;  1GYB A;  1RNT A;  1N5H A;  2F4Y A;  3G8Z A;  1L5G B;  6STD A;  1BSC A;  4HJL B;  1LOW A;  3FLJ A;  1IVX A;  3NXJ A;  1I2E A;  2F56 A;  5JPP A;  4XB5 A;  2C4B A;  3NQZ A;  4N6T A;  2OOV C;  3NHX A;  3NV0 B;  4RZM A;  1LQG C;  4EXR A;  1UI8 A;  3WA3 A;  4HOH A;  3SYU A;  3OWU A;  2YX9 A;  1RLS A;  1M1K 4;  3M8C A;  1VQ6 3;  3DGM A;  5BVB A;  1AR0 A;  1MGR A;  5AI1 A;  4HM8 B;  1BSE A;  3F9S A;  2PNC A;  2CIU A;  2GU1 A;  3WR2 A;  4MMZ B;  1UUV B;  4LSO A;  1TIJ A;  1N9E A;  3LTB A;  1DET A;  5AEW B;  1GOU A;  4HM6 B;  1OGX A;  1OHS A;  3NBB A;  4HZ9 B;  2WOH A;  2HMO B;  1JB4 A;  1QMA A;  3CCU 3;  3KZT A;  4J5K A;  3MG1 A;  2I9W A;  1DVC A;  1U8C B;  3FGY A;  4H3U A;  3MYT A;  1GSP A;  5IG3 A;  3DGL A;  1FGQ A;  4CCV A;  3CCQ 3;  3DZL A;  3JUQ A;  3CNX A;  1QAL A;  2ZDJ A;  3E99 A;  4XBY A;  4AKY A;  2HMJ B;  1Z1S A;  2CFK A;  3CCJ 3;  3EBY A;  4DKI A;  2B1X B;  3FKA A;  2ZA4 A;  3EX9 A;  4WYK B;  2RCD A;  3FG4 A;  2OOV A;  5IEP A;  1VQ5 3;  2STD A;  1MWT A;  2BHM A;  3WA2 X;  4WWU C;  1K9M 4;  1YIJ 3;  5JPU A;  1Q40 A;  2GEX A;  1CQS A;  2A15 A;  1ISK A;  1ASK A;  2XFS A;  2XH9 A;  4K90 B;  3JVC A;  3CD6 3;  1RGK A;  8RNT A;  5CF1 A;  4L7K A;  3TDG A;  3AHS A;  1DMM A;  1ULJ B;  3PYJ A;  2CWV A;  2AAE A;  4BL2 A;  3Q90 A;  1M9G A;  1BRG A;  1QAF A;  1RRH A;  1W02 A;  1FGM A;  3FH1 A;  3G16 A;  3JUN A;  3OWS A;  2J8X B;  1I3F A;  1B2Z A;  1UCI A;  3N54 B;  4GHO A;  2FXT A;  1YGE A;  3GSP A;  4R9K A;  1CYV A;  2OQE A;  3VF1 A;  1G96 A;  3CC2 3;  2AAD A;  3EBT A;  3HZP A;  3BNB A;  4J8T A;  3NBR A;  3UB1 A;  1X1W A;  3U1W A;  1FZU A;  4LYL B;  2LYX A;  2H0H A;  1I0X A;  1AVL A;  1IU7 A;  1Q42 A;  2CFD A;  3FCS B;  3Q1C A;  2MC8 A;  3KCH A;  7STD A;  3CCE 3;  3LH4 A;  3OX9 A;  3S29 A;  1TRP A;  2RGQ A;  3GZX B;  4R80 A;  4XDV A;  1KD1 4;  3DGO A;  4EBG A;  4J5G A;  3CME 3;  2YFJ B;  5D81 A;  2F98 A;  3B7C A;  3CCR 3;  4RNY A;  4L8O A;  1OHO A;  1LXE A;  1O7P B;  3F7X A;  1T2H A; 
#chains in the Genus database with same CATH homology
 3CCS 3;  1JN5 B;  1YI2 3;  4O8S A;  2JDI H;  1TFK A;  1FGT A;  3VGN A;  1KWI A;  3PCS A;  1SQW A;  2M7O A;  2OWP A;  5CLK A;  1JN5 A;  2YFL B;  1OF5 A;  1F8N A;  1VQO 3;  2XEP A;  5D83 A;  1Y4K A;  2CK3 H;  4XM4 A;  2OCT A;  2F86 B;  3IMA B;  3ECF A;  4N6L A;  1NWW A;  1OF5 B;  5TGN A;  4MEI A;  4ZM8 A;  2KCD A;  4QWT A;  1IQY A;  3KSE D;  1E3V A;  1TP6 A;  3D3L A;  1ULI B;  5FW5 A;  1O7W B;  1K41 A;  4EYC A;  4XBX A;  1D6U A;  4FCM A;  3DY5 A;  3K9M C;  4HYZ A;  2Q07 A;  1VQ7 3;  4L8P A;  4WYK A;  3D9R A;  1WMN A;  5LC7 A;  3RDE A;  5EQL A;  2GXF A;  3EE1 A;  3GWR A;  1QVF 2;  4N6O B;  1W5Z A;  2CFL A;  2OTL 3;  4LZI A;  1KC8 4;  3PS8 A;  1JB5 A;  2W9Q A;  4K1U A;  1FA3 A;  2KXG A;  5HGR A;  3KKG A;  3F40 A;  2O9U X;  3CPW 2;  2CG1 A;  1OH0 A;  3NUV A;  4JF8 A;  3HX8 A;  4NRE A;  1RJO A;  2IUK A;  2BMO B;  3UNL A;  3FF2 A;  2KRT A;  2FGT A;  1IK3 A;  2BO9 B;  1M90 4;  2WGO A;  1GY5 A;  3VSY A;  2XGN A;  4OVM A;  4FCJ A;  1GY7 A;  2P0X A;  3H3H A;  5AIF A;  3MHE A;  2QA4 3;  2L4V A;  3EHC A;  3DMC A;  3SLU A;  4EC6 A;  5BXQ A;  1W2B 2;  1EQK A;  1STD A;  1WNH A;  2IMJ A;  4G1M B;  2XF3 A;  4FMA A;  3LZA A;  4WHA A;  3LTA A;  3O8Y A;  4NHF A;  1W6G A;  1OAC A;  3HIG A;  4CDL A;  3SED A;  3S5C A;  3SOA A;  3QRD A;  1IVW A;  1VQL 3;  3F7S A;  4FMB A;  2W56 A;  5DRV A;  2LQV A;  5IER A;  1JJ2 2;  3V98 A;  1Q81 4;  3MG3 A;  3AMO B;  2CHC A;  1LVN A;  2P05 A;  4LMI A;  5IG0 A;  1N8Q A;  1WMO A;  2CW9 A;  2B24 B;  2CG0 A;  3PGB A;  3I0Y A;  3BB9 A;  3WDG B;  3AMO A;  2E2V A;  4FMD A;  4AKZ A;  1OCV A;  2K0M A;  1K73 4;  1YJW 3;  3KSP A;  4H61 A;  3JUM A;  5AYR B;  1W7C A;  5KP3 A;  1UUW B;  2XFT A;  3Q2P A;  3T8U A;  1YJN 3;  1IV7 A;  1ZX2 A;  2CWU A;  4OK0 A;  3K0Z A;  3DUK A;  4U13 A;  1RRL A;  1CYU A;  1VQM 3;  4N6N B;  5AIG A;  4TX4 A;  5CK6 A;  3S27 A;  3EQQ B;  4HZB B;  1DYU A;  3NM7 A;  8CHO A;  1E97 A;  3IPT A;  1T5Y A;  4HBR A;  1GS3 A;  1YVB I;  4EV5 A;  4N3V A;  2IA7 A;  1JNQ A;  1K8A 4;  3EJV A;  1UI7 A;  4GL6 A;  3BNE A;  3NX0 A;  3G71 3;  1GY6 A;  1EG9 B;  4I4K A;  3WMD A;  1LNH A;  2P38 A;  4HVN A;  4KFD A;  3ROB A;  1R4C A;  1JV2 B;  1DMQ A;  2CKF B;  1N5P A;  1MOL A;  1Q7Y 4;  3BLZ A;  5AYS C;  3F8X A;  1C7H A;  3I55 3;  3H51 A;  4KVH A;  1GD3 A;  1UW1 A;  2BNG A;  1QVG 2;  2C11 A;  2GU3 A;  3X42 A;  1YHQ 3;  1J2B A;  2XRX B;  2V1L A;  4GB5 A;  4HM5 B;  4AEQ A;  2W56 B;  3X3Y A;  1Q82 4;  1V74 A;  2WGQ A;  2Z6B A;  5FGO A;  3T0U A;  1DVD A;  3BND A;  1VQK 3;  1STF I;  2WOF A;  1KQS 2;  3LTD A;  4KZ1 A;  1VQ4 3;  1ROA A;  4FCZ A;  4K61 A;  5AII A;  2UX0 A;  4LGQ A;  5IG5 A;  1MNL A;  2W2C A;  1OGZ A;  3CU3 A;  2RFR A;  4FMC A;  3OW2 2;  3EN1 B;  3G0K A;  4Q53 A;  2INX A;  3EC9 A;  1QAK A;  5IEN A;  1JKG B;  1RKY A;  1W6Y A;  2C10 A;  3G4S 3;  1RN7 A;  2Z76 A;  3LT8 A;  1PU4 A;  1O7M B;  4HKV B;  2BMR B;  4KFE A;  5JBS A;  2QEX 3;  1TUH A;  3KE7 A;  3OV4 A;  2W9P A;  1YJ9 3;  3K63 A;  2HMM B;  1SII A;  3B8L A;  2Y73 A;  2CC3 A;  2Z7A A;  1N9J A;  3LOY A;  2HMN B;  4XDW A;  5ELJ A;  2E2U A;  2XR8 B;  4BTW A;  1DMN A;  3FG3 A;  5IG4 A;  4MJD A;  1EA2 A;  1U5O A;  1N8R 4;  5IW9 A;  1A2K A;  1Q86 4;  3NQY A;  1VQ9 3;  5EEO A;  2CWT A;  5STD A;  1FGO A;  2E2T A;  1S5A A;  5KP1 A;  1QJG A;  3ALA A;  1TFO A;  3DM8 A;  3OWY A;  4FR9 A;  3F14 A;  3FG1 A;  4HM4 B;  4R9L A;  3CCM 3;  1W00 A;  3JUO A;  2BMQ B;  3X41 A;  3MWZ A;  3SXX A;  2GBW B;  4X2H A;  3U97 A;  2CFW A;  1JB2 A;  3B4P A;  5A0O B;  2XGL A;  2R4I A;  3V99 A;  4N6V 0;  5KP4 A;  1GD4 A;  1PFP A;  3RGR A;  3WOE B;  1HU9 A;  1O7G B;  3FF0 A;  3UL6 A;  1SJW A;  2CFG A;  2CH9 A;  1LOX A;  2W0Q A;  4LEH A;  5DRE A;  1NJI 4;  2MF7 A;  5CF2 A;  2Z77 A;  3A76 A;  1ZO2 A;  1W4N A;  3HII A;  2QIY A;  5G2G A;  1NU3 A;  3STD A;  1S72 3;  3GZR A;  3I56 3;  1O7N B;  1VQ8 3;  3DXO A;  4KFF A;  3MG2 A;  3X40 A;  1NB3 I;  1BUQ A;  3JUP A;  2O3O A;  4N6U A;  1A90 A;  3HK4 A;  1E3R A;  3KFQ C;  3ER7 A;  3V92 A;  4JRF A;  1AV4 A;  3UL5 A;  4IIA A;  3DGN A;  3GZB A;  3S67 A;  3K7C A;  1IVV A;  1KSI A;  2D42 A;  4N6M A;  2QGU A;  3HI7 A;  3F8H A;  3CCL 3;  2SBL A;  1WQL B;  1JKG A;  3MKI A;  1IDP A;  4O3V A;  2PZV A;  3PZW A;  3LXU X;  1VQP 3;  1HKX A;  5AIH A;  2FNQ A;  1JRQ A;  1M1X B;  3X3Z A;  3L0R A;  2OQE C;  3CXC 2;  2K54 A;  3FZW A;  1D6Z A;  3QK9 A;  2W6J H;  1IVU A;  2GEY A;  5I97 A;  3GZY B;  1IV9 A;  4HM1 B;  4RNZ A;  1VQN 3;  2WO0 A;  4HM0 B;  3OXA A;  1SPU A;  1ROV A;  1AVK A;  1CEW I;  2ML5 A;  3B4O A;  3LTC A;  1IQ8 A;  1OPY A;  2JQ5 A;  3J7Y d;  2ZL8 A;  3EF8 A;  3NV0 A;  4MMY B;  3MSO A;  2F99 A;  1YIT 3;  1WMP A;  3G6E 3;  2RSX A;  2OTJ 3;  5AEU B;  4IT7 A;  1FUW A;  3CPO A;  4WP5 A;  4PEJ A;  3KN4 A;  3X3X A;  3BNC A;  3MPH A;  4ORL A;  4HM3 B;  3WOD G;  3PCR A;  3SVA A;  5CXO A;  3CCV 3;  4R1K A;  1NB5 I;  3CC4 3;  3LT9 A;  3S28 A;  1OHP A;  2D1W A;  3SOY A;  2ML6 A;  3FSD A;  4MMX B;  3UJM A;  2W04 A;  3GRD A;  3T8N A;  4HM2 B;  4R4K A;  3EN8 A;  3KII A;  5EVH A;  4X2O A;  3NM2 A;  5IEO A;  5IF6 A;  2XSO B;  3N8B A;  1FGR A;  4K1V A;  3RGA A;  2IUJ A;  4WFO A;  5D82 A;  2P0M A;  1US1 A;  1A67 A;  2HMK B;  2HML B;  3K5T A;  4XBT A;  1W01 A;  2YFI B;  4O02 B;  1Q40 B;  3GAX A;  3EB8 A;  3WOF B;  1SIH A;  2Y74 A;  3SX1 A;  4RBN A;  1NDO B;  1WTH A;  1EKM A;  2P09 A;  1O7H B;  1NO3 A;  5ELU A;  3NBJ A;  4STD A;  1VZZ A;  4BTX A;  2W03 A;  4HM7 B;  4IPB A;  3N9H A;  3PXM A;  1IQX A;  1A2V A;  1D6Y A;  4J9A A;  1W2Z A;  4O2H A;  3LYG A;  3CC7 3;  1TU5 A;  3CNM A;  3LML A;  1IT7 A;  1IT8 A;  2XSH B;  2GBX B;  4BTY A;  4EV2 A;  3CMA 3;  4OUQ A;  5LC6 A;  1W6C A;  2BT3 A;  3IJE B;  1K28 A;  1OUN A;  1GYB A;  1N5H A;  3G8Z A;  1L5G B;  6STD A;  4HJL B;  3FLJ A;  1IVX A;  3NXJ A;  5JPP A;  4XB5 A;  3NQZ A;  4N6T A;  2OOV C;  3NHX A;  3NV0 B;  4RZM A;  4EXR A;  3WA3 A;  1UI8 A;  3OWU A;  2YX9 A;  1M1K 4;  3M8C A;  1VQ6 3;  3DGM A;  5BVB A;  1AR0 A;  5AI1 A;  4HM8 B;  3F9S A;  2PNC A;  2CIU A;  2GU1 A;  4MMZ B;  1UUV B;  4LSO A;  1TIJ A;  1N9E A;  3LTB A;  5AEW B;  4HM6 B;  1OGX A;  1OHS A;  3NBB A;  4HZ9 B;  2WOH A;  2HMO B;  1JB4 A;  1QMA A;  3CCU 3;  3KZT A;  3MG1 A;  2I9W A;  1DVC A;  1U8C B;  3FGY A;  4H3U A;  3MYT A;  5IG3 A;  3DGL A;  1FGQ A;  4CCV A;  3CCQ 3;  3DZL A;  3JUQ A;  3CNX A;  1QAL A;  2ZDJ A;  3E99 A;  4XBY A;  4AKY A;  2HMJ B;  1Z1S A;  2CFK A;  3CCJ 3;  3EBY A;  2B1X B;  3FKA A;  3EX9 A;  4WYK B;  2RCD A;  3FG4 A;  2OOV A;  5IEP A;  1VQ5 3;  2STD A;  2BHM A;  3WA2 X;  4WWU C;  1K9M 4;  1YIJ 3;  5JPU A;  1Q40 A;  2GEX A;  1CQS A;  2A15 A;  1ISK A;  1ASK A;  2XFS A;  2XH9 A;  4K90 B;  3JVC A;  3CD6 3;  5CF1 A;  4L7K A;  3TDG A;  1DMM A;  1ULJ B;  3PYJ A;  2CWV A;  3Q90 A;  1M9G A;  1QAF A;  1RRH A;  1W02 A;  1FGM A;  3FH1 A;  3G16 A;  3JUN A;  3OWS A;  3N54 B;  2FXT A;  1YGE A;  3VF1 A;  4R9K A;  1CYV A;  2OQE A;  1G96 A;  3CC2 3;  3EBT A;  3HZP A;  3BNB A;  4J8T A;  3NBR A;  3UB1 A;  3U1W A;  2LYX A;  1Q42 A;  1IU7 A;  1AVL A;  2CFD A;  3FCS B;  3Q1C A;  2MC8 A;  7STD A;  3CCE 3;  3LH4 A;  3OX9 A;  3S29 A;  2RGQ A;  3GZX B;  4R80 A;  4XDV A;  1KD1 4;  3DGO A;  4EBG A;  3CME 3;  2YFJ B;  5D81 A;  2F98 A;  3B7C A;  3CCR 3;  4RNY A;  4L8O A;  1OHO A;  1LXE A;  1O7P B;  3F7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...