4XDXA

The crystal structure of soluble human interleukin 8 expressed in pichia pastoris
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
70
structure length
70
Chain Sequence
KELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-8
publication title The crystal structure of soluble human interleukin 8 expressed in Pichia pastoris
rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 15
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2014-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xdxA00
2NZ1D 2XIWA 1BF4A 3DM1A 5D14A 1Q3LA 1O7ZA 3SVMA 1WVLA 1HRJA 2EPBA 4IUVA 4DN4M 1IL8A 1TVXA 3I90A 1O7YA 1U4LA 4CJ1B 1XYIA 2B2UC 4MN3A 4HEDA 4HSVA 1CM9A 2HCIA 1G6ZA 2B2WA 4RWSC 1PLFA 4X3KA 4ZKCB 1AP0A 4ZKBB 1VMPA 4OIJA 1RTOA 2FJ2A 2K05A 4U68A 1HUMA 1EL0A 1HFGA 1ML0D 3FPUB 1MSHA 1RJTA 3DEOA 2FINB 1BO0A 4RA8A 5EPJA 1CA6A 4OIKA 1F9QA 1HA6A 4QUCA 2K01A 1BBXC 2VXWA 2KEDA 2L1BA 2K04A 3ONAB 2MGSA 1SAPA 1B3AA 1E0BA 1NCVA 3F2UA 2DY7A 1WTPA 2L11A 3LWEA 1B2TA 1MSGA 3TZDA 2B2TC 5CBEE 1BNZA 2R3ZA 2FHTA 2L4NA 3I91A 3KUPA 5AFWA 2B2YC 1WTOA 2M2LA 1J8IA 2JP1A 1WTXA 1B53A 1NR2A 1CA5A 4HAEA 5CORA 1EOTA 2MPMA 1VMCA 4CJ2C 1G91A 1SDFA 2NWGA 1AZPA 1J9OA 2D9UA 1DOLA 5E4XA 1JE4A 1U4PA 2B2WC 2DY8A 5CBAE 1IKMA 1HUNA 4IUPA 5EQ0A 1S4ZA 2RA4A 5EJWA 1XX8A 1AZQA 1QG7A 1WTRA 1PFNA 1RODA 1F2LA 2RVLA 2EE1A 4UAIA 3KBXA 3P7JA 3DEPA 2HUGA 1X3PA 1SSOA 3N52A 1PFBA 4ZK9B 4CJ0B 5CMDA 2N88A 4LMQD 1A15A 3TN2A 1M8AA 1ESRA 1B50A 5E4WC 4XT3B 4ZLTF 3UI2A 4IUUA 1F9SA 1EIGA 1G2SA 1O80A 3D6WA 3GV3A 1F9PA 1PDQA 2KECA 2B2VA 2L12A 2KUMA 3FDTA 2K1BA 1X3QA 2MJ8A 2IL8A 3I8ZA 2FFKB 5T1IA 1U4MA 3MWYW 1GUWA 1G2TA 5EKIA 1HHVA 1RTNA 1DOKA 1QE6A 3I3CA 2BDNA 2KVMA 2MP1A 3HP3A 3IL8A 4X3UA 1WTQA 3GV6A 1WTWA 2HDLA 1KNAA 1PFMA 3R93A 1DOMA 1ICWA 4XT1B 5DNFA 5T1GA 4R9WA 4QUFA 2X6GA 4X3TA 1X32A 1WD0A 1C8CA 1KNEA 4HCSA 4MHEA 1DZ1A 1EIHA 2K03A 2NYZD 2N55A 4RAUC 2B2YA 2L9HA 2Q8TA 3QO2A 4IURA 3Q6SA 1ILPA 1EQTA 2K28A 1IKLA 1QNKA 1NAPA 2CVRA 2H1EA 2FMMA 2RSOA 1ILQA 1U4RA 1MGSA 1WTVA 2B2UA 5EPLA 2JYOA 1RHPA 2RSNA 2X69A 1HFNA 2B2VC 1ZXTA 2SDFA 5COYA 4IUTA 3MTSA 1MI2A 1F9RA 4X3SA 1WD1A 1JICA 4XDXA 3G7LA 3IFDA 2EOTA 1B4OA 2KOLA 2J7ZA 5EPKA 2HCCA 4ZAIA 2X6LA 4R8IA 5D65A 4O42A 1DONA 3H91A 4NW2A 2B2TA 1NR4A 2KEEA 5JJZA 2Q8RE 1LV9A 4IUQA 2HDMA
chains in the Genus database with same CATH superfamily
1G51A 4PQXA 2LMCB 3TREA 3ZJYC 2QGQA 1ZYRD 1TIID 3SE0A 3H15A 3C3LA 4BBRB 5BN4A 1SYFA 4HEDA 2F0MA 2B8FA 1CSPA 1IBML 3G71A 1HFGA 3CHBD 2VUMG 3GDEA 4UP8A 5E1FA 2BH2A 4GKKQ 2MGSA 4B3TL 1NCVA 2VUMB 2C9OA 4RGMA 2B2TC 4QCLA 4DAPA 4RGNA 3GTLB 1KTKA 3MFYA 2UXDL 1D1KA 3MEFA 1B9NA 3M4PA 3CCJA 1AZPA 4C2MB 3D0FA 5M5YB 2CCZA 1JE4A 2WB1G 1FJGL 4Y7NB 2EVBA 2IHEA 4H0LC 4DV6Q 2WB1B 1A0IA 1B8AA 2E2JB 1X3PA 1YZ6A 2ZT9C 1BOSA 1XXGA 3VYTA 1WCMH 2LSSA 1X3EA 1H95A 1UNSA 3HKZB 1SR3A 2ZJPA 5DM63 4A3JH 5GAHC 1ZKOA 1X3QA 2CQOA 4EX5A 4L8JA 4DAMA 4GLXA 1S5ED 3MWYW 3BYYB 2Z4HA 1PH4A 4N8X1 4X3UA 1AE2A 4YWLA 3GV6A 4A3CG 1I5FA 3VR6A 3W5OA 1Q90A 1GUTA 1TWHB 3VYSA 2ZJQA 1ASZA 3V96A 1IL2A 4ZYSA 5CC4A 4LF4Q 2Q2TA 4HIKA 2R7ZH 1LO5D 3P20A 2F0TA 3S1QH 3PUYA 2AQ1B 4YY3L 1CI3M 2SDFA 5BR8L 1D5XC 5IGFA 2L5TA 4PMCA 5EAYA 4HJ7A 5G3LF 4RH6A 5IGCA 1IBLL 5F2DA 4A3IG 2UUCQ 4ODGA 3PCOB 2XGTA 1A62A 2N78A 3J81E 5CV6A 1YNJD 1TWCH 4A3IB 3C1EA 1B70B 1NMGA 1BBUA 5CV8A 3A5ZB 4P73A 1Q3LA 4FO2A 2B63G 1BVSA 1E2WA 4CJ1B 1CKNB 2RQXA 3SEBA 2ZXPA 3VYUA 4H44C 5DAUA 1SE2A 4DR5L 2ZXRA 1AP0A 2FJ2A 4U68A 3HOZG 2F0FA 2NTTA 2IT1A 2ICEC 3ULPA 4QUCA 2PW7A 1BBXC 2KEDA 1WFQA 3HOZB 5I2XA 4L5RC 2F0LA 3JC66 2CH4A 1WTOA 5M5WB 1K0SA 1WTXA 3CU7A 4BBSG 3K5OA 2MO1A 2V1CC 4XXEA 3H09A 4FF1A 3L0OA 3BVMA 4OWTB 1JWMD 2UUAQ 5E4XA 4HIOA 3I2ZA 4IN3A 3GTPH 1I6HH 1KAAA 3HOYH 1RIPA 3BVGA 3ND9A 2VQEL 2JA8H 2EE1A 5FJ8H 3VR4A 4X64L 1JCKB 4B3ML 4DR3L 4YWMA 2Z6KA 4KMUC 4OO1I 1IYUA 3K8AA 3NELA 3MXUA 5C3WA 4WJ4A 3GV3A 3HOXH 4LFAL 1YHAA 2A69D 4KD4A 5J39A 2Z1CA 3I4LA 5IY0A 1HR0L 2UUBQ 3I3CA 2KVMA 3IL8A 1NNXA 4PG3A 1WTWA 1A3TA 3RZDB 4NXMQ 3TSSA 1KQSA 1GD7A 1X32A 1FNWA 2IWHA 2NVQB 2Q8TA 2JA5H 1HNZL 2MFIA 4C3IG 1NAPA 3EIVA 1O7LA 1G6PA 2H1EA 3S15H 1I50H 1EY0A 4RHSA 3S1NB 2HQLA 2PMZE 2PZTA 2QDLA 4A76A 5C3XA 2X69A 4JI1Q 1ZXTA 4FP5D 4N8FA 2JSOA 3NP8A 1F2YA 3KLRA 5I6WA 5K5PA 1WD1A 2Y0SE 5FO7B 3TBIB 2DNCA 3CCSA 1EY5A 4ZAIA 1PYWD 5JPNC 3RN5A 4YHHL 1LTRD 4DUYQ 1WI5A 4UDUC 1STGA 1WJJA 3T56B 1K3RA 2DUDA 4DR1Q 3FKIH 2XIWA 4JCVE 3CCLA 2Z6KC 2A1AA 2UXCQ 3WOEA 5CR3A 1X3GA 4V190 1U4LA 2B39A 2K7VA 3OPOA 2BCOA 4FDBA 1G6ZA 4OIJA 1YITA 3WWVA 4FVMA 4CKEA 2HHHQ 2QCPX 3LGJA 4OIKA 3NTIA 4OXPA 4Q0FA 5IYBH 3J80L 3TRZA 4K0KL 3ONAB 3T4AC 5A2QE 4LFCQ 1O78A 4XYOA 2AHOB 1N32L 2FHTA 4ZUIA 1GM5A 3CQZH 5GADC 4F87A 1MJCA 4DR7Q 1CKNA 4H02A 1C7YA 1EY9A 1MJEA 4CGYB 3D4DA 4DV2L 1PTOF 3U50C 3DM3A 5EKLA 2OT2A 3BDOA 3HOVH 3PSIA 4JW0A 4GOPB 3CCUA 4TQUS 1SLJA 1X9NA 1EY4A 3I4OA 3IFTA 1SYCA 1WCMG 1Y1VB 4OO1G 4LMQD 1EYDA 1VQFA 1AFPA 1SNMA 4PNYA 4JI8Q 4K2KA 1CHPD 4XT3B 1G2SA 2EYPA 2EYLA 3D31A 2KCCA 1JJCB 4HJ5A 3Q8DA 3PUXA 2JA6G 5D3IB 1GXDC 5LL6S 3PIO3 2Q2IA 5M5XB 1SNDA 2XVSA 4GKKL 2YTVA 2K52A 2JA6B 4KKSA 5T1GA 1TWGH 2XRSD 4X3TA 1I4XA 3HKSA 3U9OA 5IGBA 1CKMA 1SXTA 2R7ZG 2MQHA 4QF4A 1VQCA 4IFDH 1K73C 1FR3A 3TDQA 2VB3X 3FPPA 1MGSA 2RCFA 1SRUA 2B2UA 2A68D 1WTHA 2JA7G 3S1QB 2E76C 4MZ9A 1I3QH 3T16A 5IYDH 4JG2A 2JA7B 1TY0A 4KD3A 5IP9H 5IIFA 5EPKA 4DV6L 3RUZA 1G291 1HQRD 4P74A 3D6CA 3MEHA 4O2DA 4B3TQ 2A6HC 2KJXA 2NUCA 1S5FD 3J7AV 4RFBA 1E1OA 1TWCB 2Q2UA 1EWCA 4BY1H 1M90C 3EVQA 4OX9Q 1Q1BA 4DV3Q 4Y52H 3U9SA 1CA6A 2WACA 4HCEA 4ABNA 2K33A 3F2UA 2ZJRA 3D4WA 4LF4L 2A6EC 1EY7A 1X6OA 2VS1A 3TZDA 2RKSA 4EGVA 3A55A 2M2LA 2CKZB 2MPMA 1VMCA 4LW1A 3I4NG 3AFPA 5CV9A 5H1SE 4UY8C 3I4NB 4IUPA 2D62A 4J1MA 1QVGA 1TWFB 5FO8B 3GTPB 5JJKA 5FJ8G 4U673 1L0XB 2PZWA 3DEPA 4JBMA 3N52A 1Y8NB 4QL5A 1Q86C 1K3BC 5ELCA 1B9MA 1S72A 1B50A 1ESFA 1PTOC 3HOXG 4A3BG 1LT3D 4A3BB 1HA5A 1A3UA 2BDNA 3UDGA 1Y1WG 4GOPA 3K59A 1KNAA 3HOUH 5I2YA 4HIMA 2JA5G 1Y1WB 5M9OA 2NB0A 1DZ1A 4RAUC 1JR0D 1PZKD 1TWAH 2F0UA 4ZQ3A 5K36H 5HY6A 4A3GB 2EJMA 4KY5A 3S15B 1JC7A 1I50B 1RHPA 1Q7YC 1T9HA 2VNUD 3CCRA 2UUAL 3S2HB 1C4QA 3CRKC 3MTSA 5M3MH 1MI2A 4LF7Q 1EWIA 1TXYA 1N34L 4O42A 3NENA 1NR4A 1CUKA 3FKIG 3HFZB 2PI2E 4AYBG 1SJED 2CW0C 4C1NK 2BE5C 4A3EB 3UDIA 1HNWQ 1Q46A 1ICFB 3S1RH 3PUZA 3QB3A 3OSOA 4I7AA 1XYIA 4AYBB 1Y14B 2UUBL 2K05A 4FF4A 5IYBG 2D2CC 5EPJA 4NXML 2VXWA 3H0GB 5C4XG 4CDEC 1PYBA 2K04A 4TVAB 2ZTCA 1B2TA 2B3GA 1PRTB 3QG1A 5C4XB 2LXJA 3C1FA 4EQOA 2HT1A 4NDXA 4G57A 5CYUA 2WAQG 3GTQB 1EQQA 1C9OA 3PO2H 3DWPA 5CORA 1SN8A 4XTCS 3CQZB 4YCVA 2QKIC 1LT4D 2WAQB 1SDFA 2NWGA 4EQNA 4XQQA 1PH6A 3HOVG 2B2WC 4LF9Q 3KK7A 4DV0L 4JI7Q 1PH8A 4B3RQ 3A8JE 2EJGC 4POGA 1QWYA 1PYSB 1MHWC 1WTRA 1I4HA 5EBDA 4UAIA 1IYJB 3KBXA 5CV4A 4DUYL 1OXTA 4B9XA 3CP0A 4UP9A 5EGTA 4DR1L 1N9WA 3EBEA 2AWOA 2ICIA 2UXCL 3PQIA 3KLSA 5LHY1 3W1BA 2KECA 1PH5A 4CDCC 1PH1A 1PZID 2F0PA 1MBYA 4DK0A 1Z47A 2CHBD 2YU9B 2Z0SA 2HHHL 4A3DB 2TMPA 2R93G 2HDLA 3MAQA 2MUYA 4PMWA 5FO9B 4LFCL 4ME5A 1GJXA 4GLAC 2E2HB 3MXNB 1LTSD 1TWGB 1W2BA 2R93B 2N55A 3M4OB 1VQMA 4IFDJ 3NEMA 4B9WA 4QB4A 4DR7L 3GTJB 2LFNA 1S5BD 4NXNQ 1PRTF 2RSNA 3QIAA 2HIVA 5IYDG 3UDFA 2B2VC 4IUTA 2JQOA 1LTBD 4IJHA 1H9JA 1I3QB 2ZM6Q 5JJIA 4ZCKA 1LABA 3NE5B 1CHQD 3OWFA 1IW7C 4CHTB 4DGZA 2B2TA 3BZKA 1NTGA 2Q8RE 2K5QA 2CWPA 1BKBA 1K83B 4BY1G 1IL8A 1BDOA 2F3VA 4R8NA 5C4JH 3BDCA 4B08A 1A2TA 4DV2Q 1FYCA 1C48A 4A3MH 1XMQQ 1VQAA 3PGZA 1E0BA 2XWBB 1EEFD 1RD9D 4C3HH 5C44H 2AMCB 2YV5A 3Q22A 4UPAA 3NBIA 4MTNA 1MD2D 5A35A 2H4OA 1CK1A 3M7NA 1VDZA 3HEJA 5GAGC 2OF1A 4KY7A 1OXUA 1GUGA 2EY5A 1IKMA 4YWKA 3ER0A 1RCVD 1X65A 3R8BA 3UE0A 2RVLA 1XPOA 4DR6Q 4JI0Q 1KABA 1LACA 1SSOA 1I4GA 1GUSA 2F0KA 4IOAA 4G7OC 4FXDA 1KDAA 1KHIA 2GVAA 1Q82C 3PO3G 5E4WC 1LLRD 4DKAC 1Y8OB 3UI2A 5IP7H 4DV5L 1IHZA 1WYDA 4ALPA 4A3FG 4OX9L 2O2LD 3PO3B 4DV3L 4QJFA 3RLNA 4A3FB 3M9BA 1RTNA 1QE6A 4HJ9A 1GOZA 3GQBA 2F0QA 5C4ZA 1CSQA 3T53B 4Z9CB 3HOUG 2JXMB 3CCQA 4QUFA 2PNRC 1STHA 3K6OA 1K9MC 3HOUB 2F0GA 2YYZA 1RDPD 1V43A 5K36G 1VQEA 3GD7A 3CAMA 3K5NA 3G6JB 4EQPA 5IWAQ 2WB1E 2NVTH 1TWAB 3SHLA 1JJGA 2E2DC 1UEAB 1EZ8A 1KC8C 3AFQA 2M00A 1YJNA 1F9RA 3HKZE 4IJLA 5FK9C 4F7XA 5CV5A 5C6AA 1XPUA 2I5HA 3MXNA 4L63B 2A6HD 3TS0A 1JB3A 3FVQA 1PRTC 3R2IA 2G5DA 1F2MA 1S40A 2O5IC 4DK1A 4GKJL 4OWXB 3PIOA 4I7ZC 4ZUJA 1FGUA 3MXGA 1W3SA 4OEMB 3C46A 2E74C 5GQOA 3OIPA 4CBVA 3S1RB 1EY6A 1VQ7A 4X3KA 1HZBA 1HUMA 1MSHA 2FINB 3CPFA 1PV4A 1E2VA 2I46A 5EKKA 1BBWA 3S1MH 1JOQA 2L4NA 1N36Q 5KYIA 1E2ZA 2KHSA 3RR5A 5IODA 3KFUA 1YHQA 1EOTA 1JQYD 2DGYA 4CJ2C 4IPDA 3RZOB 2QEXA 2B63B 1DOLA 1YBYA 4LF7L 1EOVA 4ME3A 1TY2A 3QWNA 5ELDA 4FXGC 1EU4A 4GLVB 2AUKA 2A73B 3NSWA 1N8RC 2OWOA 1RODA 2J4XA 3S24A 1PTOD 1HNWL 2PNHA 1UE7A 4ZLTF 4QIWB 1TT2A 2NZHA 4N9PA 3H3VH 2FFKB 2OXPA 4MTKA 1X55A 1UE5A 4IZ8A 4BBSB 4JYAL 4CDDC 3D3RA 1VF7A 3TP8A 4ID6A 3K7UC 3R93A 1KD1C 3FRPB 1Q8IA 1KLUD 3NXWA 1JJ2A 3W2DA 1QUQB 2RDHA 3CPWA 1HQMC 4DXFA 2E8GA 4DF7A 1N34Q 2L9HA 3AEVA 4JV5Q 2ID0A 4X66L 1HPCA 3LX0A 1VQKA 1BXTA 3AB9A 3I7FA 4LF9L 4JI7L 4B3RL 4XDXA 4DAYB 3E9HA 3IFDA 1VQ9A 3RN2A 5C5MA 2CQAA 5ELEA 4BY7H 2EQSA 2EYHA 5C3EH 3OMCA 4DR4L 1KXLA 3SK4A 2CW0D 1TS4A 2BE5D 2LXKA 1XNQQ 4QY7A 4WJ3M 1PTOB 1X54A 3I90A 1STEA 5J22A 1ENFA 1O7YA 3J80c 1ASYA 4C3IB 1D1IA 4MN3A 4K5XA 2EXZA 5M3FH 4JOIC 1SYEA 2CFMA 3TMEA 1RKNA 3M4YA 1U5KA 2F0OA 4MNOA 1CTMA 1D7QA 4DV0Q 1HA6A 3HS0C 1PFSA 2O5JC 4C3HG 5C44G 5C0XH 1KL9A 4OWWB 4HSPA 2K5WA 4DU9A 2ZTDA 1BCPF 3KYHC 3MXPA 2R3ZA 2F0HA 3T1HQ 3KUPA 2L0CA 1SFOB 4O0AA 1B44D 1PMRA 1SROA 4NXNL 2RF4A 1X56A 3EROA 1YNXA 2KQ3A 2NBFA 3GO5A 5CBAE 3JAML 2ZM6L 1SE3A 1YI2A 1EYGA 4IALA 3SK8A 1Q12A 2WKDA 4UHVA 3NQTA 5LMNW 3J80i 1QG7A 3HRZC 4C1NI 2IX3A 4J8QA 4POFA 2I5MX 4RGOS 3C2PA 3PMFA 1UE6A 4LJZC 1VQ6A 3DHQA 1VF5C 4RKBA 3K81C 3KDFB 2F0IA 1EIGA 2NVYH 3GTMH 1STNA 3OTOQ 3MFGA 3FDTA 3BS1A 1D5ZC 2VB2X 3LWUA 1EYCA 1XMQL 2F0NA 3X3MA 3W1GA 1W6KA 4P72A 4AQYQ 2X6GA 4HTHA 3CW2C 3NPPA 4ZRZA 3NWSA 1EIHA 2K03A 4DNRB 3NQIA 2VY3A 4GN4B 3CMAA 5JVH3 5LMUQ 1GO3E 1UUPA 1VQIA 2BDOA 4FF3A 1WCMB 4A3JG 5COYA 3B6YA 1OXVA 4A3JB 2QEJC 4KLKA 1JICA 2SEBD 2XWJB 3BU2A 2AQ3B 2AWNA 4YCUA 1ENAA 1QUQA 4A93H 4DR6L 5D65A 4JI0L 3IKJA 4XYQA 3UE1A 2OTLA 2EYMA 2N3SA 2UU9L 3AQQA 1O7ZA 1YEZA 3A74A 2R7ZB 3NWTA 2NVXH 2RHSB 3H94A 2K50A 3G4SA 4ZKBB 1VMPA 1JWUD 4CKBA 1RJTA 3CF5A 1HNXQ 1S5CD 4DUZQ 3STBC 5C0XI 3A0JA 1MSGA 5IWAL 3OWEB 1TR5A 2JP1A 1U0LA 4HAEA 4B3SQ 3SK6A 3BYTB 3Q0AA 4DV5Q 2LY7A 5IE8A 1D8LA 3RNUA 1JMCA 2PCFB 4K5WA 2E2IH 4JVZA 5LL6X 2RA4A 1BCPC 1K8AC 3CKIB 5IT9L 2F0WA 1MIUA 1VQJA 4V0BA 4AIMA 4A75A 3SGIA 1DGSA 1VQHA 3M4QA 1Q81C 1KIXA 1T5XD 2KCTA 3NUCA 4KN4C 1X3FA 2JEBI 1ESRA 2F0JA 2JEAI 3SK5A 1QVCA 1SYGA 2SNSA 1XTDA 2IL8A 2AQ2B 1NE3A 3S17H 2YTXA 3A8KE 1DOKA 3HOYG 1KRSA 1H9RA 5ELBA 1VQBA 4DA2A 4XT1B 4R9WA 2JA8G 1I6HB 3HOYB 1LUZA 4APVA 1QVFA 2IPKD 1N36L 2JA8B 1IKLA 3KDFA 2F52A 5HGTA 3U58A 2F0EA 4K2LA 4GKJQ 2QW7A 1A8VA 2V4DA 3HOXB 2N49A 1KRTA 2F4IA 4KJNA 3X3NA 4R1JA 5E7NA 4BY7G 2J0TD 2NZOA 5C3EG 1GHJA 1PRTD 4BY7B 1UE1A 3K5MA 3GTLH 3P1HA 4IFDI 1KDCA 4PV1C 2K5HA 1BF4A 1LYLA 2JA5B 4DPGA 4C2MH 4DN4M 2DJGC 3PIP3 3RD4A 5M5YH 5KNCA 3IAYA 4QGUA 4R4OA 4Y7NH 4OL7A 1PH2A 2HCIA 2B2WA 3L7ZC 4J15A 4NP5A 3Q23A 1ML0D 3JAME 3K58A 2A74C 2K01A 2ASBA 5C0XG 4E6IA 4GN3B 1SAPA 5ELOA 5C0XJ 2DY7A 3J80E 3LWEA 4JV5L 5AJ3Q 5CBEE 2WKCA 2PW5A 3I91A 1FL0A 1M4VA 1B53A 4ULLA 4KHVA 1I4QA 3FKIB 2Q2HA 3BZDB 3AU7A 3CC2A 2OTJA 3R3OA 1Z7TA 1TWHH 2XN9C 1II3A 1S4ZA 4IOCA 4JYAQ 2XTIA 4M8AA 4AYBE 5DEHA 4CJ0B 1AW7A 1XNQL 1JWSD 1A15A 5FLXL 2KCNA 1L0WA 1DXMA 5GROA 3A7AB 4HMIA 3A56A 2NN6H 4DR2Q 4X66Q 2B2VA 3K80C 2MJ8A 2IW3A 2KCMA 3I8ZA 2KBNA 1FGBD 2QDBA 3VYRA 2R7FA 4FNFA 4BXXH 4HMJA 2WAQE 2QA4A 3HOVB 1JORA 1SNQA 3HG9A 1KNEA 2R7DA 3TQYA 4A3IH 4MHEA 1ILPA 3QO2A 3T1HL 1HJPA 1K0RA 4KKUA 4DR4Q 1S5DD 1KDBA 2FXQA 2EXDA 4I65A 3PF4A 3MZ5A 4C56C 2PO4A 2BA1A 2UXBL 1D5MC 4K6LA 4G4KA 4WRDA 5D3DA 3HOZH 4LF8Q 2SOBA 2KOLA 1LTGD 4OELB 3DLLA 2I0QA 3J81L 4CKCA 5I9OA 2FMCA 2VW9A 5JJZA 4IFDG 3FEWX 4DNIA 1VQ5A 3OTOL 5IYCH 3J7AF 1W6JA 3ICEA 2ENBA 3TP6A 1VS0A 1R9TH 4DV7Q 2NVXB 2IY5B 4K6DA 4HN7A 1HTLD 5IP9G 3PF5A 2I5LX 2EZVA 4AQYL 1AH9A 3KF6B 1MKHA 2JK8A 4A3KH 2I07B 5IT9E 3EFXD 4KV6A 2VQFQ 3ZYYX 4TKOB 5LMUL 1YNNC 2G9HD 2OCEA 5ISRA 1J5EL 3BG3A 5G3LD 1VQGA 4X6AH 1GVPA 1EZ6A 1H9SB 1J9OA 2D9UA 1K28A 1D6EC 2DY8A 4BY1B 3RZDH 3TP7A 3H3VC 1S3OA 1LTTD 2K5NA 2E2IB 1EEID 5IGGA 4DK6C 1B7YB 2DNEA 3VR2A 3KOJA 2F03A 2HUGA 1XWEA 2F4VQ 1E24A 3S1NH 2Z9HA 4OGQC 1AE3A 3TN2A 1M8AA 4CDFC 3M7GA 1NMFA 3QR8A 2NN6I 3OMGA 4KI0A 1QJOA 1EWHA 2H5XA 3FHWA 2AKWB 3NK9A 5LMNQ 2A19A 2KENA 3T51B 4IPCA 4N9TA 3CRLC 2EYJA 1HNXL 3I73A 5CGKA 1SE8A 4DUZL 4MIUA 2K5VA 1N33Q 3D8GA 4JBKA 2BA0A 2GN5A 1EQTA 2K28A 1EIYB 2Z4IA 3TZUA 2IHFA 1H9MA 2EY6A 2FMMA 1TKWB 2EY2A 2F3WA 4QMGA 1U4RA 3T1YQ 4B3SL 3W3AA 2UU9Q 1PXUA 3RLOA 3CD6A 1R4PB 1HFNA 2QILA 1QZGA 3KLWA 1A6XA 3D4RA 4JI6L 4OHJA 1EFID 4GNXC 2KA7A 2WIIB 1PA6A 1TQOA 2R6GA 3DMUA 5GAEC 3L3OC 3GTGH 4IUQA 1LV9A 1ZEQX 2GVBA 3E3XA 3L2PA 4LWCA 5ELFA 1HRJA 2F3IA 3URYA 4IUVA 2OQKA 1KAWA 4ILWA 4DV1Q 4KN7C 4X62L 4JI5Q 1C0AA 2XRQD 4ZKCB 1L1OC 5M3MG 4C3JH 1LTID 1B1ZA 1L2FA 3R2TA 5A2QL 4PZ6A 5J1ZA 3STBD 3ULLA 5I4DA 5M3MB 1STBA 5TSSA 1Y1VH 4LFBQ 4DXGA 3HKZG 1Q1EA 2L11A 3GTOH 1TS2A 2HD3A 4H13C 2VL6A 1PHJA 4OO1H 1T5EA 2PQAB 1NR2A 5FLXE 3G6EA 3K57A 1E1TA 2RDFA 1LM0A 4AH6A 1UEBA 1G91A 4K8JA 4RG1A 5M5XH 5C5LA 1U4PA 4DNTB 1JE5A 2JA6H 2EYOA 1EQRA 5KNDA 1M1KC 1OTCA 1BCPD 3CCMA 1HTPA 3KF6A 2ATWA 4EQ5A 1F2LA 2A6ED 1K8MA 2MO0A 3AMUA 4GN5A 4JI2L 1ONLA 3VR5A 3EN2A 2G9DA 1SBBB 1VQOA 1P16A 1DD2A 5L37A 3PO2G 1YJWA 2NN6G 1WOCA 1XMOQ 1YVCA 1SJHD 2EYFA 1IBKQ 1H9SA 2JA7H 3PO2B 1VQ4A 1SNCA 3OW2A 3MA2B 4BXXG 1O7IA 1LTLA 3AYHB 2F0SA 2ES2A 1H9KA 2WFWA 5AJ3L 5I9PA 5I6YA 5IGDA 2E5LQ 4JPBW 1QZHA 3TS2A 3Q6SA 3BZCA 1QNKA 2CVRA 3HGBA 1ILQA 4RCOA 1PH9A 5IOCA 3EQLC 4JOIA 2AUJD 3EJIA 4QIWE 3G7LA 2HCCA 4LF6Q 2YTYA 1BCPB 4FXKC 4R8IA 3SDZA 3CMEA 1G8ZD 2PQEA 2L15A 1I4PA 1HR0W 3L9AX 4R4TA 2KEEA 1DYQA 5ELNA 4DV4Q 5JJLA 1XPRA 5IYCG 1WVLA 2EPBA 1CFMA 3ND8A 4DR2L 1OXXK 3U4VA 2IX1A 1STAA 1SNOA 2F0DA 3I4NH 3DUZA 1PLFA 4LK1C 1RTOA 1TWFH 1R9TB 3DXJC 1EL0A 4HR7B 3CC7A 5BN3A 1F9QA 1TS5A 1NJIC 1I94Q 2RHQB 4P71A 1ET9A 4A3KG 4HIDA 1WTPA 4RKLA 3F2BA 3PV0A 4A3KB 4A4IA 3MHBA 3JAMc 3S2DH 3A7LA 2Q8IB 4JI4Q 4A3BH 2K32A 3WDNA 4L5QA 1HUNA 4LF8L 1Z9FA 1FNUA 4A3MG 3KBGA 1OO9B 1Y1WH 3O13A 5C4JB 1QB5D 3PUWA 4JI3L 3QJYA 3OIQA 2PMZB 4A3MB 3PIPA 1PFBA 1QNUA 2HIXA 2Y0SG 3G48A 4ZK9B 4A3GH 3M85A 2ZTEA 2PQAA 3J7ZC 4C3HB 5C44B 2Y0SB 3S2HH 1F9SA 4P2CB 4HJAA 4LUVA 1PDQA 4HJ8A 2D0PA 1YHBA 4DV7L 3OW7A 5T1IA 1SMYC 3K0YA 2RBMA 5JEAH 1VQLA 1GHKA 1G2TA 4RMFA 3JAMi 4L6TB 2UXBQ 1WTQA 4LF5Q 1DOMA 3ITPA 4KHPQ 3RLFA 5FLMH 2VQFL 4WFN3 3I56A 4A3EH 1BQQT 1HCZA 2RDGA 5IP7G 3HZXA 3TP5A 1PH3A 3NTKA 4LAAA 3H3VI 3E0EA 3DWAA 2D5DA 3H0GH 2R92H 1NY4A 2DN8A 4NPSA 4JBWA 4RCNA 2J7ZA 3OYYA 2PYKA 5DLQE 5FKAC 2VZAA 5C4XH 2DJFC 5KGUA 1SE4A 1V8QA 2B29A 2F4VL 4NW2A 3GTQH 4F88A 2R61A 1V1PB 3GTGB 2JJQA 4A3LH 5D14A 3HOWH 4RHRA 2WINB 1K8GA 1IYVA 3S14H 1EU3A 1ZYRC 3BVZA 5LMNL 4C3JG 1J5EQ 3S16H 2NVTB 2WV6D 2RCNA 1CT1D 2Z8LA 4WJWA 2JE6I 4C3JB 4RA8A 4BWGB 1Y1VG 3F1ZA 1N33L 3VR3A 1IW7D 3PUVA 3MC0B 1CQVA 4L5SA 2WP8J 1TS3A 4X65Q 1XNRQ 1YNND 1BNZA 4IPHA 4LUZA 3GTOB 3T1YL 1I4RA 1VQ8A 4LUOA 3V05A 1CA5A 5NUCA 4KY6A 5IT9c 2YU9H 3E0JA 4A3DH 2CWAA 1E7ZA 2PZUA 1SMXA 3K0XA 2MHVA 3H6MA 3WOFA 1CZGA 3I70A 4DAYA 2ALYB 2E2HH 5C4HA 2R93H 1XX8A 3I4MH 1CZWA 1GUNA 3M4OH 1PFNA 4KTAA 1V9PA 3Q24A 1QCBD 3GTJH 1SYDA 2N88A 3BJUA 1AEXA 1UAPA 2JA9A 3S1MB 4F8MA 3K5LA 4DV1L 4JI5L 2L12A 4PZ7A 4IUNA 1PH7A 4NB3A 1GUWA 4NMZA 1PZJD 3VDYA 1KLGD 1IBMQ 2MP1A 2LS01 3K7AH 4RGTA 4JI6Q 1ICWA 4LFBL 2B8GA 2LKVA 1TU2B 3I55A 1JT8A 1Z6HA 1C8CA 3KF8B 4WORA 4Q5VA 3GTKH 3MVVA 4P75A 4IURA 1K83H 3BDLA 3M3YH 2M9VA 1SYBA 3RMHA 1WTVA 2JYOA 4H7BA 4IO9A 2F1MA 2UXDQ 1HZCA 3CC4A 4X62Q 1ENCA 1J6QA 3NBHB 1JOKA 3U4ZA 1XJVA 2QF7A 3KLSX 4JK1C 2XNAC 1FJGQ 2EOTA 1P8LA 1QOHA 1SNPA 2A5HA 2X6LA 3SXHA 2CH4W 1NUCA 3T13A 1CKOA 3CXCA 4DFAA 2MNAA 3OOCA 2BH8A 5HURA 3J7A5 1Y69U 4KHZA 4BBRH 1XMOL 4OONA 1YNJC 3J7YW 1IBKL 1TVXA 4BA2I 1E22A 4UP7A 2B2UC 4HSVA 1YJ9A 4IPGA 4RWSC 4XQNA 1E3PA 3DEOA 1BO0A 2UUCL 2VUMH 5KIXA 2L1BA 4NKLA 2E5LL 1PVOA 1Y8PB 1RL2A 4KK7A 4YCWA 5JOBA 1V1PA 2A8VA 1HXYD 3I72A 4JI2Q 5C3EB 1Q8KA 2OQ0A 2SNMA 4R4CA 3PO3H 2IX0A 3S2DB 1STYA 3ERQA 4A3FH 5M3FG 3F2CA 4YY3Q 5BR8Q 1NBWA 5M3FB 1V1QA 5EQ0A 4LF6L 1K8OA 5FLXc 4GNXB 2TSSA 1FD7D 2E2JH 2HQEA 2OEOA 2K75A 4G7ZC 1IBLQ 1LTAD 3P7JA 3P75A 4A3GG 2N8NA 3N6RA 4DV4L 1D2BA 4GZYC 4KKTA 3E5SA 1QILA 4LNQA 3J81j 3VA5A 2NTSA 5EBCA 3GP7A 2EY1A 3KJPA 2K5DA 4PMBA 2C5CA 1O80A 3D6WA 4G7HC 1F9PA 1DM0B 5JEAG 5JEAJ 4DR5Q 1L1OB 2A69C 4JBJA 5HGQA 5KNBA 1HHVA 1I94L 3DWQA 1IZ6A 1PFMA 5J3BA 5DNFA 1A2UA 1GUOA 5FLMG 4A3CH 1EFWA 3TEHB 2KHJA 4A3EG 4HCSA 1BUVT 2B2YA 1BR9A 1AN8A 3FMCA 4TRDA 1A63A 2XSCA 4JI4L 4KJOA 5FOBB 1ET6A 3J81c 3GTMB 2NVYB 4M1UB 1DJRD 3H0GG 3SR1A 2R92G 3KJOA 1V1OA 4FF2A 1EYAA 1B4OA 2R92B 1RF2D 4GOPC 3KF8A 2EIFA 3ULJA 3H91A 1SEBD 2VQEQ 1EY8A 4X64Q 2PPBC 1VQDA 2HDMA 3OHXC 4B3MQ 4DR3Q 4A3LG 3A54A 3HOWG 2NZ1D 2E75C 3DM1A 3SVMA 4JI1L 1L0YB 2K6AA 3RZOH 5JAVA 2B63H 2D0OA 2EJFC 1FVIA 2EDGA 3HOWB 2Z6BA 2K4KA 4LFAQ 3S14B 4J6HA 3NBHA 1CM9A 4IQZA 1OXSC 3S16B 4LF5L 3FPUB 1HR0Q 4A93G 4KHPL 4JC0A 5KEEA 2IJ0A 1B3AA 3J81i 3QOLA 3QOJA 4JI3Q 4A93B 5M5WH 3A5UA 1JB7A 1F2ZA 5AFWA 2B2YC 1HNZQ 2KHIA 1J8IA 4R4QA 3A8IE 3UDXA 1I6VC 3F2DA 4A3DG 1IXRA 4BBSH 3LNNA 4R4IA 1EIFA 4TSSA 3S9WA 5E3FA 4XIGS 4EVOA 5KYLA 3FP9A 1A3VA 4GS3A 1HZ9A 3I4MG 5EJWA 4O1NA 1AZQA 1JOOA 2K14A 3I4MB 5KRUA 4YHHQ 1LT6D 5CMDA 5IGEA 1F77A 1NSNS 3IRBA 1XTCD 1DCZA 2C35B 4IUUA 5BN5A 1SMYD 1EQVA 2KUMA 2O4XA 2K1BA 5CV7A 4XQJA 4QQBX 3CCVA 3VA7A 1U4MA 1HH2P 5EKIA 4PZ8A 2L55A 3HP3A 4GNXA 4DK3C 1CQFA 1EUJA 3E9IA 2NVQH 4K0KQ 1GKHA 1WD0A 3K7AB 1FNVA 4X65L 1XNRL 2NYZD 3V2TA 5JVG3 1PTOH 1LT5D 4JI8L 4FYDA 3GTKB 2ZXOA 4C3IH 2RSOA 4BA1I 1N32Q 1R4QB 1U9RA 4S3SA 3M3YB 4L5TA 4DAVA 5EPLA 5DM73 1YIJA 1B3QA 1VCIA 1HZAA 3NTHA 1L1OA 2A68C 4K8IA 1UWVA 2JN4A 4YIJA 3E6ZX 4X3SA 3EA6A 4K14A 5JPMC 2GA4B 2PI2A 3S17B 3CCEA 4K5VA 3NHHA 2P5ZX 2F0VA 1DONA 3F8TA 1SFOH 3ERSX 1VQPA 4BS9A 4BBRG 1VQNA 2BOSA
chains in the Genus database with same CATH topology
4PQXA 2LMCB 3SE0A 1ZYRD 1TIID 3C3LA 4BBRB 5BN4A 1SYFA 4HEDA 2F0MA 2B8FA 1HFGA 3CHBD 5E1FA 2MGSA 1NCVA 2VUMB 2C9OA 4RGMA 2B2TC 4QCLA 4DAPA 4RGNA 3GTLB 1KTKA 3MFYA 1D1KA 1B9NA 1AZPA 4C2MB 5M5YB 1JE4A 4Y7NB 2EVBA 4H0LC 2WB1B 2E2JB 1X3PA 2ZT9C 1BOSA 1XXGA 3VYTA 1UNSA 3HKZB 5DM63 1ZKOA 1X3QA 4L8JA 1S5ED 3MWYW 3BYYB 2Z4HA 4X3UA 3GV6A 3VR6A 1Q90A 1GUTA 1TWHB 3VYSA 3V96A 4ZYSA 5CC4A 1LO5D 3P20A 2F0TA 3PUYA 2AQ1B 1CI3M 2SDFA 1D5XC 5IGFA 2L5TA 4PMCA 5G3LF 4RH6A 5IGCA 5F2DA 4ODGA 3J81E 5CV6A 1YNJD 4A3IB 3C1EA 5CV8A 1Q3LA 4FO2A 1E2WA 4CJ1B 3SEBA 2RQXA 2ZXPA 3VYUA 4H44C 5DAUA 1SE2A 2ZXRA 1AP0A 2FJ2A 4U68A 2F0FA 2NTTA 2IT1A 2ICEC 4QUCA 2PW7A 1BBXC 2KEDA 3HOZB 5I2XA 2F0LA 1WTOA 5M5WB 1WTXA 3CU7A 3K5OA 4XXEA 3H09A 4FF1A 3BVMA 1JWMD 5E4XA 4IN3A 1KAAA 3BVGA 3ND9A 2EE1A 3VR4A 1JCKB 4KMUC 4OO1I 1IYUA 3MXUA 5C3WA 3GV3A 2A69D 4KD4A 5J39A 2Z1CA 3I4LA 3I3CA 2KVMA 3IL8A 1WTWA 1A3TA 3RZDB 3TSSA 1X32A 1FNWA 2IWHA 2NVQB 2Q8TA 4C3IG 1NAPA 1O7LA 2H1EA 1EY0A 4RHSA 3S1NB 2PZTA 5C3XA 2X69A 1ZXTA 4FP5D 2JSOA 3NP8A 1F2YA 3KLRA 5I6WA 5K5PA 1WD1A 5FO7B 3TBIB 2DNCA 1EY5A 4ZAIA 1PYWD 5JPNC 1LTRD 4UDUC 1STGA 3T56B 2XIWA 3WOEA 5CR3A 4V190 1U4LA 2B39A 2K7VA 3OPOA 2BCOA 1G6ZA 4OIJA 4FVMA 4CKEA 2QCPX 4OIKA 3NTIA 3J80L 4Q0FA 3ONAB 3T4AC 5A2QE 1O78A 4XYOA 2FHTA 4ZUIA 4F87A 1EY9A 4CGYB 3D4DA 1PTOF 5EKLA 2OT2A 3BDOA 4TQUS 1EY4A 3IFTA 1SYCA 1Y1VB 4OO1G 4LMQD 1EYDA 1AFPA 1SNMA 4PNYA 4K2KA 1CHPD 4XT3B 1G2SA 2EYPA 2EYLA 3D31A 2KCCA 3PUXA 5D3IB 1GXDC 5LL6S 3PIO3 5M5XB 1SNDA 2XVSA 2JA6B 4KKSA 5T1GA 2XRSD 4X3TA 1I4XA 3U9OA 5IGBA 1SXTA 4QF4A 4IFDH 1FR3A 3TDQA 2VB3X 3FPPA 1MGSA 2B2UA 2A68D 3S1QB 2E76C 3T16A 2JA7B 1TY0A 4KD3A 5IIFA 5EPKA 3RUZA 1G291 1HQRD 3D6CA 3MEHA 2A6HC 2KJXA 2NUCA 1S5FD 3J7AV 4RFBA 1TWCB 1EWCA 3EVQA 1Q1BA 3U9SA 1CA6A 2WACA 4HCEA 4ABNA 2K33A 3F2UA 3D4WA 2A6EC 1EY7A 3TZDA 2RKSA 4EGVA 3A55A 2M2LA 2MPMA 1VMCA 5CV9A 3I4NB 4IUPA 2D62A 4J1MA 1TWFB 5FO8B 3GTPB 4U673 1L0XB 2PZWA 3DEPA 3N52A 1Y8NB 5ELCA 1B9MA 1B50A 1ESFA 1PTOC 1LT3D 4A3BB 1HA5A 1A3UA 2BDNA 3K59A 1KNAA 5I2YA 1Y1WB 5M9OA 2NB0A 1DZ1A 4RAUC 1JR0D 1PZKD 2F0UA 4ZQ3A 5K36H 4A3GB 2EJMA 4KY5A 3S15B 1JC7A 1I50B 1RHPA 2VNUD 3S2HB 1C4QA 3CRKC 3MTSA 1MI2A 4O42A 1NR4A 1SJED 2CW0C 4C1NK 2BE5C 4A3EB 3PUZA 3QB3A 3OSOA 1XYIA 4AYBB 2K05A 4FF4A 2D2CC 5EPJA 2VXWA 3H0GB 2K04A 1B2TA 1PRTB 3QG1A 5C4XB 3C1FA 4EQOA 4NDXA 4G57A 5CYUA 3GTQB 3DWPA 5CORA 4XTCS 3CQZB 2QKIC 1LT4D 2WAQB 1SDFA 2NWGA 4EQNA 4XQQA 2B2WC 3KK7A 3A8JE 2EJGC 1QWYA 1WTRA 1I4HA 5EBDA 4UAIA 5CV4A 3KBXA 1OXTA 4B9XA 5EGTA 2AWOA 2ICIA 3KLSA 5LHY1 2KECA 1PZID 2F0PA 1MBYA 4DK0A 1Z47A 2CHBD 2YU9B 4A3DB 2TMPA 2HDLA 3MAQA 2MUYA 4PMWA 5FO9B 4ME5A 1GJXA 2E2HB 1LTSD 1TWGB 2R93B 2N55A 3M4OB 4IFDJ 4B9WA 4QB4A 3GTJB 2LFNA 1S5BD 1PRTF 2RSNA 3QIAA 2B2VC 4IUTA 1LTBD 1H9JA 1I3QB 1LABA 3NE5B 1CHQD 3OWFA 1IW7C 4CHTB 4DGZA 2B2TA 2Q8RE 2K5QA 1K83B 1IL8A 1BDOA 2F3VA 4R8NA 3BDCA 4B08A 1A2TA 1FYCA 1C48A 1E0BA 2XWBB 1EEFD 1RD9D 3Q22A 3NBIA 1MD2D 5A35A 2H4OA 1CK1A 3M7NA 1VDZA 3HEJA 2OF1A 4KY7A 1OXUA 1GUGA 2EY5A 1IKMA 1RCVD 3R8BA 2RVLA 1KABA 1LACA 1SSOA 1I4GA 1GUSA 2F0KA 4G7OC 4FXDA 1KDAA 5E4WC 1LLRD 1Y8OB 3UI2A 1IHZA 2O2LD 3PO3B 4A3FB 1RTNA 1QE6A 1GOZA 3GQBA 2F0QA 5C4ZA 3T53B 4Z9CB 2JXMB 4QUFA 2PNRC 1STHA 3K6OA 3HOUB 2F0GA 2YYZA 1RDPD 1V43A 5K36G 3GD7A 3K5NA 3G6JB 4EQPA 1TWAB 3SHLA 2E2DC 1UEAB 1EZ8A 2M00A 1F9RA 5FK9C 4F7XA 5CV5A 5C6AA 3MXNA 4L63B 2A6HD 1JB3A 3FVQA 1PRTC 3R2IA 1F2MA 2O5IC 4DK1A 4I7ZC 4ZUJA 3MXGA 3C46A 2E74C 3OIPA 4CBVA 3S1RB 1EY6A 4X3KA 1HUMA 1MSHA 2FINB 1E2VA 2I46A 5EKKA 1JOQA 2L4NA 5KYIA 1E2ZA 2KHSA 5IODA 1EOTA 1JQYD 4CJ2C 3RZOB 2B63B 1DOLA 1TY2A 3QWNA 5ELDA 4FXGC 1EU4A 2AUKA 2A73B 3NSWA 1RODA 2J4XA 1PTOD 4ZLTF 4QIWB 1TT2A 4N9PA 2FFKB 2OXPA 4IZ8A 4BBSB 3D3RA 1VF7A 3TP8A 4ID6A 3R93A 3FRPB 1Q8IA 1KLUD 3NXWA 3W2DA 2RDHA 1HQMC 4DXFA 4DF7A 2L9HA 2ID0A 1HPCA 3LX0A 1BXTA 3AB9A 4XDXA 3IFDA 5C5MA 2CQAA 5ELEA 2EYHA 3OMCA 3SK4A 2CW0D 1TS4A 2BE5D 1PTOB 3I90A 1STEA 5J22A 1ENFA 1O7YA 4C3IB 1D1IA 4MN3A 4K5XA 2EXZA 1SYEA 3TMEA 1RKNA 3M4YA 2F0OA 1CTMA 1HA6A 3HS0C 2O5JC 4C3HG 5C0XH 4HSPA 2K5WA 4DU9A 1BCPF 3MXPA 2R3ZA 2F0HA 1SFOB 3KUPA 2L0CA 1B44D 1PMRA 3EROA 2KQ3A 2NBFA 3GO5A 5CBAE 3JAML 1SE3A 4IALA 3SK8A 1Q12A 2WKDA 3NQTA 1QG7A 3HRZC 4C1NI 2IX3A 4J8QA 4RGOS 3C2PA 3PMFA 4LJZC 3DHQA 1VF5C 4RKBA 2F0IA 1EIGA 1STNA 3MFGA 3FDTA 3BS1A 1D5ZC 2VB2X 3LWUA 1EYCA 2F0NA 3X3MA 1W6KA 2X6GA 4HTHA 4ZRZA 3NPPA 3NWSA 1EIHA 2K03A 4DNRB 3NQIA 5JVH3 1UUPA 2BDOA 4FF3A 1WCMB 5COYA 1OXVA 4A3JB 2QEJC 1JICA 2SEBD 2XWJB 2AQ3B 2AWNA 1ENAA 5D65A 3IKJA 4XYQA 2EYMA 1O7ZA 2R7ZB 3NWTA 3H94A 4ZKBB 1VMPA 1JWUD 4CKBA 1RJTA 1S5CD 5C0XI 1MSGA 3OWEB 1TR5A 2JP1A 4HAEA 3SK6A 3BYTB 3Q0AA 2LY7A 2PCFB 4K5WA 5LL6X 2RA4A 1BCPC 3CKIB 5IT9L 2F0WA 4V0BA 1T5XD 3NUCA 4KN4C 2JEBI 1ESRA 2F0JA 2JEAI 3SK5A 1SYGA 2SNSA 2IL8A 2AQ2B 3A8KE 1DOKA 5ELBA 1H9RA 4DA2A 4XT1B 4R9WA 1I6HB 3HOYB 2IPKD 2JA8B 1IKLA 5HGTA 2F0EA 4K2LA 2V4DA 3HOXB 2F4IA 4KJNA 3X3NA 2J0TD 1GHJA 1PRTD 4BY7B 3K5MA 3P1HA 4IFDI 1KDCA 4PV1C 1BF4A 2JA5B 4DN4M 3PIP3 3RD4A 5KNCA 3IAYA 4OL7A 2HCIA 2B2WA 3L7ZC 4NP5A 3Q23A 1ML0D 3JAME 3K58A 2A74C 2K01A 5C0XG 4E6IA 1SAPA 5C0XJ 2DY7A 3J80E 3LWEA 5CBEE 2WKCA 2PW5A 3I91A 1M4VA 1B53A 4ULLA 4KHVA 1I4QA 3FKIB 3BZDB 3AU7A 3R3OA 1Z7TA 2XN9C 1II3A 1S4ZA 4M8AA 5DEHA 4CJ0B 1AW7A 1JWSD 1A15A 5FLXL 2KCNA 1DXMA 3A7AB 4HMIA 3A56A 2NN6H 2B2VA 2MJ8A 2IW3A 3I8ZA 1FGBD 2QDBA 3VYRA 4FNFA 4HMJA 3HOVB 1JORA 1SNQA 3HG9A 1KNEA 4MHEA 1ILPA 3QO2A 4KKUA 1S5DD 1KDBA 4I65A 3MZ5A 4C56C 2PO4A 2BA1A 1D5MC 4K6LA 4G4KA 4WRDA 5D3DA 2SOBA 2KOLA 1LTGD 3J81L 4CKCA 5I9OA 2FMCA 5JJZA 4IFDG 3FEWX 3J7AF 1W6JA 2ENBA 3TP6A 2NVXB 4K6DA 4HN7A 1HTLD 2EZVA 2I07B 5IT9E 3EFXD 4KV6A 3ZYYX 4TKOB 1YNNC 2G9HD 5ISRA 3BG3A 5G3LD 1EZ6A 1H9SB 1J9OA 2D9UA 1D6EC 2DY8A 4BY1B 3TP7A 3H3VC 1LTTD 2E2IB 1EEID 5IGGA 2DNEA 3VR2A 2F03A 2HUGA 1XWEA 4OGQC 3TN2A 1M8AA 3M7GA 2NN6I 3OMGA 4KI0A 1QJOA 1EWHA 3NK9A 3T51B 4N9TA 3CRLC 2EYJA 3I73A 5CGKA 4MIUA 3D8GA 2BA0A 1EQTA 2K28A 3TZUA 2Z4IA 1H9MA 4QMGA 2EY6A 2FMMA 1TKWB 2EY2A 2F3WA 1U4RA 3W3AA 1PXUA 1HFNA 1R4PB 2QILA 1A6XA 3D4RA 4OHJA 1EFID 2KA7A 2WIIB 1TQOA 2R6GA 3DMUA 3L3OC 4IUQA 1LV9A 1ZEQX 5ELFA 1HRJA 3URYA 4IUVA 4ILWA 4KN7C 2XRQD 4ZKCB 1LTID 1B1ZA 3R2TA 5A2QL 5J1ZA 5M3MB 5I4DA 1STBA 5TSSA 4DXGA 1Q1EA 2L11A 1TS2A 4H13C 4OO1H 1T5EA 1NR2A 5FLXE 3K57A 2RDFA 1G91A 4K8JA 5C5LA 1U4PA 4DNTB 2EYOA 5KNDA 1BCPD 1HTPA 1F2LA 2A6ED 1K8MA 3AMUA 1ONLA 3VR5A 2G9DA 1SBBB 1DD2A 2NN6G 1SJHD 2EYFA 1H9SA 3PO2B 1SNCA 3MA2B 2F0SA 1H9KA 5I9PA 5I6YA 5IGDA 3Q6SA 1QNKA 2CVRA 3HGBA 1ILQA 4RCOA 5IOCA 3EQLC 2AUJD 3EJIA 3G7LA 2HCCA 1BCPB 4FXKC 4R8IA 3SDZA 1G8ZD 2PQEA 1I4PA 3L9AX 2KEEA 1DYQA 1WVLA 2EPBA 1CFMA 3ND8A 1OXXK 2IX1A 1STAA 1SNOA 2F0DA 3DUZA 1PLFA 4LK1C 1RTOA 1R9TB 3DXJC 1EL0A 4HR7B 5BN3A 1F9QA 1TS5A 1ET9A 1WTPA 4RKLA 3PV0A 4A3KB 3MHBA 3A7LA 2Q8IB 2K32A 3WDNA 1HUNA 1FNUA 3KBGA 1OO9B 3O13A 5C4JB 1QB5D 3PUWA 3QJYA 3OIQA 2PMZB 4A3MB 1PFBA 1QNUA 4ZK9B 3M85A 4C3HB 5C44B 2Y0SB 1F9SA 4P2CB 1PDQA 3OW7A 5T1IA 1SMYC 3K0YA 2RBMA 5JEAH 1GHKA 1G2TA 4L6TB 1WTQA 1DOMA 3ITPA 3RLFA 4WFN3 1BQQT 1HCZA 2RDGA 3HZXA 3TP5A 3NTKA 4LAAA 3DWAA 2D5DA 2DN8A 4JBWA 4RCNA 2J7ZA 2PYKA 5FKAC 5KGUA 1SE4A 1V8QA 4NW2A 4F88A 2R61A 1V1PB 3GTGB 5D14A 4RHRA 2WINB 1IYVA 1EU3A 1ZYRC 3BVZA 2NVTB 4C3JG 2WV6D 1CT1D 2Z8LA 4WJWA 2JE6I 4C3JB 4RA8A 4BWGB 3VR3A 1IW7D 3PUVA 3MC0B 1CQVA 2WP8J 1TS3A 1YNND 1BNZA 3GTOB 1I4RA 3V05A 1CA5A 5NUCA 4KY6A 3E0JA 2PZUA 2MHVA 4DAYA 3H6MA 1CZGA 3I70A 3WOFA 5C4HA 1XX8A 1CZWA 1GUNA 1PFNA 4KTAA 3Q24A 1QCBD 1SYDA 2N88A 1UAPA 1AEXA 3S1MB 4F8MA 3K5LA 2L12A 4IUNA 1GUWA 4NMZA 1PZJD 1KLGD 2MP1A 2LS01 4RGTA 1ICWA 2B8GA 2LKVA 1TU2B 1Z6HA 1C8CA 4WORA 4Q5VA 3MVVA 4IURA 3BDLA 2M9VA 1SYBA 3RMHA 1WTVA 2JYOA 4H7BA 2F1MA 1ENCA 1JOKA 2QF7A 3KLSX 4JK1C 2XNAC 2EOTA 1QOHA 1SNPA 2A5HA 2X6LA 3SXHA 3T13A 1NUCA 4DFAA 3OOCA 5HURA 1Y69U 4KHZA 1YNJC 3J7YW 1TVXA 4BA2I 2B2UC 4HSVA 4RWSC 4XQNA 3DEOA 1BO0A 5KIXA 2L1BA 4NKLA 1Y8PB 4KK7A 5JOBA 1V1PA 1HXYD 3I72A 5C3EB 2SNMA 2IX0A 3S2DB 1STYA 3ERQA 5M3FB 5EQ0A 1K8OA 2TSSA 1FD7D 2HQEA 2OEOA 4G7ZC 1LTAD 3P7JA 3P75A 3N6RA 1D2BA 4GZYC 4KKTA 3E5SA 1QILA 3VA5A 2NTSA 5EBCA 3GP7A 2EY1A 2K5DA 4PMBA 2C5CA 1O80A 3D6WA 4G7HC 1F9PA 1DM0B 5JEAG 5JEAJ 2A69C 5KNBA 1HHVA 3DWQA 1PFMA 5DNFA 1A2UA 1GUOA 4HCSA 1BUVT 2B2YA 1BR9A 1AN8A 3FMCA 4TRDA 2XSCA 4KJOA 5FOBB 1ET6A 3GTMB 2NVYB 4M1UB 1DJRD 3SR1A 1V1OA 4FF2A 1EYAA 1B4OA 2R92B 1RF2D 3KF8A 3H91A 1SEBD 1EY8A 2PPBC 2HDMA 3OHXC 3A54A 2NZ1D 2E75C 3DM1A 3SVMA 1L0YB 2K6AA 5JAVA 2EJFC 2EDGA 3HOWB 3S14B 4J6HA 3NBHA 1CM9A 4IQZA 1OXSC 3S16B 3FPUB 5KEEA 2IJ0A 1B3AA 3QOLA 3QOJA 4A93B 1F2ZA 5AFWA 2B2YC 1J8IA 3A8IE 1I6VC 3LNNA 4TSSA 3S9WA 5E3FA 4XIGS 4EVOA 5KYLA 1A3VA 5EJWA 4O1NA 1AZQA 1JOOA 3I4MB 5KRUA 1LT6D 5CMDA 5IGEA 1F77A 1NSNS 1XTCD 1DCZA 4IUUA 5BN5A 1SMYD 1EQVA 2KUMA 2O4XA 2K1BA 5CV7A 4XQJA 3VA7A 1U4MA 5EKIA 2L55A 3HP3A 1CQFA 1WD0A 3K7AB 1FNVA 2NYZD 3V2TA 5JVG3 1PTOH 1LT5D 4FYDA 3GTKB 2ZXOA 2RSOA 4BA1I 1R4QB 1U9RA 4S3SA 3M3YB 4DAVA 5EPLA 5DM73 1VCIA 3NTHA 2A68C 4K8IA 4YIJA 3E6ZX 4X3SA 3EA6A 4K14A 5JPMC 2GA4B 3S17B 4K5VA 3NHHA 2F0VA 1DONA 4BS9A 2BOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZ1 D;  2XIW A;  1BF4 A;  3DM1 A;  5D14 A;  1Q3L A;  1O7Z A;  3SVM A;  1WVL A;  1HRJ A;  2EPB A;  4IUV A;  4DN4 M;  1IL8 A;  1TVX A;  3I90 A;  1O7Y A;  1U4L A;  4CJ1 B;  1XYI A;  2B2U C;  4MN3 A;  4HED A;  4HSV A;  1CM9 A;  2HCI A;  1G6Z A;  2B2W A;  4RWS C;  1PLF A;  4X3K A;  4ZKC B;  1AP0 A;  4ZKB B;  1VMP A;  4OIJ A;  1RTO A;  2FJ2 A;  2K05 A;  4U68 A;  1HUM A;  1EL0 A;  1HFG A;  1ML0 D;  3FPU B;  1MSH A;  1RJT A;  3DEO A;  2FIN B;  1BO0 A;  4RA8 A;  5EPJ A;  1CA6 A;  4OIK A;  1F9Q A;  1HA6 A;  4QUC A;  2K01 A;  1BBX C;  2VXW A;  2KED A;  2L1B A;  2K04 A;  3ONA B;  2MGS A;  1SAP A;  1B3A A;  1E0B A;  1NCV A;  3F2U A;  2DY7 A;  1WTP A;  2L11 A;  3LWE A;  1B2T A;  1MSG A;  3TZD A;  2B2T C;  5CBE E;  1BNZ A;  2R3Z A;  2FHT A;  2L4N A;  3I91 A;  3KUP A;  5AFW A;  2B2Y C;  1WTO A;  2M2L A;  1J8I A;  2JP1 A;  1WTX A;  1B53 A;  1NR2 A;  1CA5 A;  4HAE A;  5COR A;  1EOT A;  2MPM A;  1VMC A;  4CJ2 C;  1G91 A;  1SDF A;  2NWG A;  1AZP A;  1J9O A;  2D9U A;  1DOL A;  5E4X A;  1JE4 A;  1U4P A;  2B2W C;  2DY8 A;  5CBA E;  1IKM A;  1HUN A;  4IUP A;  5EQ0 A;  1S4Z A;  2RA4 A;  5EJW A;  1XX8 A;  1AZQ A;  1QG7 A;  1WTR A;  1PFN A;  1ROD A;  1F2L A;  2RVL A;  2EE1 A;  4UAI A;  3KBX A;  3P7J A;  3DEP A;  2HUG A;  1X3P A;  1SSO A;  3N52 A;  1PFB A;  4ZK9 B;  4CJ0 B;  5CMD A;  2N88 A;  4LMQ D;  1A15 A;  3TN2 A;  1M8A A;  1ESR A;  1B50 A;  5E4W C;  4XT3 B;  4ZLT F;  3UI2 A;  4IUU A;  1F9S A;  1EIG A;  1G2S A;  1O80 A;  3D6W A;  3GV3 A;  1F9P A;  1PDQ A;  2KEC A;  2B2V A;  2L12 A;  2KUM A;  3FDT A;  2K1B A;  1X3Q A;  2MJ8 A;  2IL8 A;  3I8Z A;  2FFK B;  5T1I A;  1U4M A;  3MWY W;  1GUW A;  1G2T A;  5EKI A;  1HHV A;  1RTN A;  1DOK A;  1QE6 A;  3I3C A;  2BDN A;  2KVM A;  2MP1 A;  3HP3 A;  3IL8 A;  4X3U A;  1WTQ A;  3GV6 A;  1WTW A;  2HDL A;  1KNA A;  1PFM A;  3R93 A;  1DOM A;  1ICW A;  4XT1 B;  5DNF A;  5T1G A;  4R9W A;  4QUF A;  2X6G A;  4X3T A;  1X32 A;  1WD0 A;  1C8C A;  1KNE A;  4HCS A;  4MHE A;  1DZ1 A;  1EIH A;  2K03 A;  2NYZ D;  2N55 A;  4RAU C;  2B2Y A;  2L9H A;  2Q8T A;  3QO2 A;  4IUR A;  3Q6S A;  1ILP A;  1EQT A;  2K28 A;  1IKL A;  1QNK A;  1NAP A;  2CVR A;  2H1E A;  2FMM A;  2RSO A;  1ILQ A;  1U4R A;  1MGS A;  1WTV A;  2B2U A;  5EPL A;  2JYO A;  1RHP A;  2RSN A;  2X69 A;  1HFN A;  2B2V C;  1ZXT A;  2SDF A;  5COY A;  4IUT A;  3MTS A;  1MI2 A;  1F9R A;  4X3S A;  1WD1 A;  1JIC A;  4XDX A;  3G7L A;  3IFD A;  2EOT A;  1B4O A;  2KOL A;  2J7Z A;  5EPK A;  2HCC A;  4ZAI A;  2X6L A;  4R8I A;  5D65 A;  4O42 A;  1DON A;  3H91 A;  4NW2 A;  2B2T A;  1NR4 A;  2KEE A;  5JJZ A;  2Q8R E;  1LV9 A;  4IUQ A;  2HDM A; 
#chains in the Genus database with same CATH topology
 1G51 A;  4PQX A;  2LMC B;  3TRE A;  3ZJY C;  2QGQ A;  1ZYR D;  1TII D;  3SE0 A;  3H15 A;  3C3L A;  4BBR B;  5BN4 A;  1SYF A;  4HED A;  2F0M A;  2B8F A;  1CSP A;  1IBM L;  3G71 A;  1HFG A;  3CHB D;  2VUM G;  3GDE A;  4UP8 A;  5E1F A;  2BH2 A;  4GKK Q;  2MGS A;  4B3T L;  1NCV A;  2VUM B;  2C9O A;  4RGM A;  2B2T C;  4QCL A;  4DAP A;  4RGN A;  3GTL B;  1KTK A;  3MFY A;  2UXD L;  1D1K A;  3MEF A;  1B9N A;  3M4P A;  3CCJ A;  1AZP A;  4C2M B;  3D0F A;  5M5Y B;  2CCZ A;  1JE4 A;  2WB1 G;  1FJG L;  4Y7N B;  2EVB A;  2IHE A;  4H0L C;  4DV6 Q;  2WB1 B;  1A0I A;  1B8A A;  2E2J B;  1X3P A;  1YZ6 A;  2ZT9 C;  1BOS A;  1XXG A;  3VYT A;  1WCM H;  2LSS A;  1X3E A;  1H95 A;  1UNS A;  3HKZ B;  1SR3 A;  2ZJP A;  5DM6 3;  4A3J H;  5GAH C;  1ZKO A;  1X3Q A;  2CQO A;  4EX5 A;  4L8J A;  4DAM A;  4GLX A;  1S5E D;  3MWY W;  3BYY B;  2Z4H A;  1PH4 A;  4N8X 1;  4X3U A;  1AE2 A;  4YWL A;  3GV6 A;  4A3C G;  1I5F A;  3VR6 A;  3W5O A;  1Q90 A;  1GUT A;  1TWH B;  3VYS A;  2ZJQ A;  1ASZ A;  3V96 A;  1IL2 A;  4ZYS A;  5CC4 A;  4LF4 Q;  2Q2T A;  4HIK A;  2R7Z H;  1LO5 D;  3P20 A;  2F0T A;  3S1Q H;  3PUY A;  2AQ1 B;  4YY3 L;  1CI3 M;  2SDF A;  5BR8 L;  1D5X C;  5IGF A;  2L5T A;  4PMC A;  5EAY A;  4HJ7 A;  5G3L F;  4RH6 A;  5IGC A;  1IBL L;  5F2D A;  4A3I G;  2UUC Q;  4ODG A;  3PCO B;  2XGT A;  1A62 A;  2N78 A;  3J81 E;  5CV6 A;  1YNJ D;  1TWC H;  4A3I B;  3C1E A;  1B70 B;  1NMG A;  1BBU A;  5CV8 A;  3A5Z B;  4P73 A;  1Q3L A;  4FO2 A;  2B63 G;  1BVS A;  1E2W A;  4CJ1 B;  1CKN B;  2RQX A;  3SEB A;  2ZXP A;  3VYU A;  4H44 C;  5DAU A;  1SE2 A;  4DR5 L;  2ZXR A;  1AP0 A;  2FJ2 A;  4U68 A;  3HOZ G;  2F0F A;  2NTT A;  2IT1 A;  2ICE C;  3ULP A;  4QUC A;  2PW7 A;  1BBX C;  2KED A;  1WFQ A;  3HOZ B;  5I2X A;  4L5R C;  2F0L A;  3JC6 6;  2CH4 A;  1WTO A;  5M5W B;  1K0S A;  1WTX A;  3CU7 A;  4BBS G;  3K5O A;  2MO1 A;  2V1C C;  4XXE A;  3H09 A;  4FF1 A;  3L0O A;  3BVM A;  4OWT B;  1JWM D;  2UUA Q;  5E4X A;  4HIO A;  3I2Z A;  4IN3 A;  3GTP H;  1I6H H;  1KAA A;  3HOY H;  1RIP A;  3BVG A;  3ND9 A;  2VQE L;  2JA8 H;  2EE1 A;  5FJ8 H;  3VR4 A;  4X64 L;  1JCK B;  4B3M L;  4DR3 L;  4YWM A;  2Z6K A;  4KMU C;  4OO1 I;  1IYU A;  3K8A A;  3NEL A;  3MXU A;  5C3W A;  4WJ4 A;  3GV3 A;  3HOX H;  4LFA L;  1YHA A;  2A69 D;  4KD4 A;  5J39 A;  2Z1C A;  3I4L A;  5IY0 A;  1HR0 L;  2UUB Q;  3I3C A;  2KVM A;  3IL8 A;  1NNX A;  4PG3 A;  1WTW A;  1A3T A;  3RZD B;  4NXM Q;  3TSS A;  1KQS A;  1GD7 A;  1X32 A;  1FNW A;  2IWH A;  2NVQ B;  2Q8T A;  2JA5 H;  1HNZ L;  2MFI A;  4C3I G;  1NAP A;  3EIV A;  1O7L A;  1G6P A;  2H1E A;  3S15 H;  1I50 H;  1EY0 A;  4RHS A;  3S1N B;  2HQL A;  2PMZ E;  2PZT A;  2QDL A;  4A76 A;  5C3X A;  2X69 A;  4JI1 Q;  1ZXT A;  4FP5 D;  4N8F A;  2JSO A;  3NP8 A;  1F2Y A;  3KLR A;  5I6W A;  5K5P A;  1WD1 A;  2Y0S E;  5FO7 B;  3TBI B;  2DNC A;  3CCS A;  1EY5 A;  4ZAI A;  1PYW D;  5JPN C;  3RN5 A;  4YHH L;  1LTR D;  4DUY Q;  1WI5 A;  4UDU C;  1STG A;  1WJJ A;  3T56 B;  1K3R A;  2DUD A;  4DR1 Q;  3FKI H;  2XIW A;  4JCV E;  3CCL A;  2Z6K C;  2A1A A;  2UXC Q;  3WOE A;  5CR3 A;  1X3G A;  4V19 0;  1U4L A;  2B39 A;  2K7V A;  3OPO A;  2BCO A;  4FDB A;  1G6Z A;  4OIJ A;  1YIT A;  3WWV A;  4FVM A;  4CKE A;  2HHH Q;  2QCP X;  3LGJ A;  4OIK A;  3NTI A;  4OXP A;  4Q0F A;  5IYB H;  3J80 L;  3TRZ A;  4K0K L;  3ONA B;  3T4A C;  5A2Q E;  4LFC Q;  1O78 A;  4XYO A;  2AHO B;  1N32 L;  2FHT A;  4ZUI A;  1GM5 A;  3CQZ H;  5GAD C;  4F87 A;  1MJC A;  4DR7 Q;  1CKN A;  4H02 A;  1C7Y A;  1EY9 A;  1MJE A;  4CGY B;  3D4D A;  4DV2 L;  1PTO F;  3U50 C;  3DM3 A;  5EKL A;  2OT2 A;  3BDO A;  3HOV H;  3PSI A;  4JW0 A;  4GOP B;  3CCU A;  4TQU S;  1SLJ A;  1X9N A;  1EY4 A;  3I4O A;  3IFT A;  1SYC A;  1WCM G;  1Y1V B;  4OO1 G;  4LMQ D;  1EYD A;  1VQF A;  1AFP A;  1SNM A;  4PNY A;  4JI8 Q;  4K2K A;  1CHP D;  4XT3 B;  1G2S A;  2EYP A;  2EYL A;  3D31 A;  2KCC A;  1JJC B;  4HJ5 A;  3Q8D A;  3PUX A;  2JA6 G;  5D3I B;  1GXD C;  5LL6 S;  3PIO 3;  2Q2I A;  5M5X B;  1SND A;  2XVS A;  4GKK L;  2YTV A;  2K52 A;  2JA6 B;  4KKS A;  5T1G A;  1TWG H;  2XRS D;  4X3T A;  1I4X A;  3HKS A;  3U9O A;  5IGB A;  1CKM A;  1SXT A;  2R7Z G;  2MQH A;  4QF4 A;  1VQC A;  4IFD H;  1K73 C;  1FR3 A;  3TDQ A;  2VB3 X;  3FPP A;  1MGS A;  2RCF A;  1SRU A;  2B2U A;  2A68 D;  1WTH A;  2JA7 G;  3S1Q B;  2E76 C;  4MZ9 A;  1I3Q H;  3T16 A;  5IYD H;  4JG2 A;  2JA7 B;  1TY0 A;  4KD3 A;  5IP9 H;  5IIF A;  5EPK A;  4DV6 L;  3RUZ A;  1G29 1;  1HQR D;  4P74 A;  3D6C A;  3MEH A;  4O2D A;  4B3T Q;  2A6H C;  2KJX A;  2NUC A;  1S5F D;  3J7A V;  4RFB A;  1E1O A;  1TWC B;  2Q2U A;  1EWC A;  4BY1 H;  1M90 C;  3EVQ A;  4OX9 Q;  1Q1B A;  4DV3 Q;  4Y52 H;  3U9S A;  1CA6 A;  2WAC A;  4HCE A;  4ABN A;  2K33 A;  3F2U A;  2ZJR A;  3D4W A;  4LF4 L;  2A6E C;  1EY7 A;  1X6O A;  2VS1 A;  3TZD A;  2RKS A;  4EGV A;  3A55 A;  2M2L A;  2CKZ B;  2MPM A;  1VMC A;  4LW1 A;  3I4N G;  3AFP A;  5CV9 A;  5H1S E;  4UY8 C;  3I4N B;  4IUP A;  2D62 A;  4J1M A;  1QVG A;  1TWF B;  5FO8 B;  3GTP B;  5JJK A;  5FJ8 G;  4U67 3;  1L0X B;  2PZW A;  3DEP A;  4JBM A;  3N52 A;  1Y8N B;  4QL5 A;  1Q86 C;  1K3B C;  5ELC A;  1B9M A;  1S72 A;  1B50 A;  1ESF A;  1PTO C;  3HOX G;  4A3B G;  1LT3 D;  4A3B B;  1HA5 A;  1A3U A;  2BDN A;  3UDG A;  1Y1W G;  4GOP A;  3K59 A;  1KNA A;  3HOU H;  5I2Y A;  4HIM A;  2JA5 G;  1Y1W B;  5M9O A;  2NB0 A;  1DZ1 A;  4RAU C;  1JR0 D;  1PZK D;  1TWA H;  2F0U A;  4ZQ3 A;  5K36 H;  5HY6 A;  4A3G B;  2EJM A;  4KY5 A;  3S15 B;  1JC7 A;  1I50 B;  1RHP A;  1Q7Y C;  1T9H A;  2VNU D;  3CCR A;  2UUA L;  3S2H B;  1C4Q A;  3CRK C;  3MTS A;  5M3M H;  1MI2 A;  4LF7 Q;  1EWI A;  1TXY A;  1N34 L;  4O42 A;  3NEN A;  1NR4 A;  1CUK A;  3FKI G;  3HFZ B;  2PI2 E;  4AYB G;  1SJE D;  2CW0 C;  4C1N K;  2BE5 C;  4A3E B;  3UDI A;  1HNW Q;  1Q46 A;  1ICF B;  3S1R H;  3PUZ A;  3QB3 A;  3OSO A;  4I7A A;  1XYI A;  4AYB B;  1Y14 B;  2UUB L;  2K05 A;  4FF4 A;  5IYB G;  2D2C C;  5EPJ A;  4NXM L;  2VXW A;  3H0G B;  5C4X G;  4CDE C;  1PYB A;  2K04 A;  4TVA B;  2ZTC A;  1B2T A;  2B3G A;  1PRT B;  3QG1 A;  5C4X B;  2LXJ A;  3C1F A;  4EQO A;  2HT1 A;  4NDX A;  4G57 A;  5CYU A;  2WAQ G;  3GTQ B;  1EQQ A;  1C9O A;  3PO2 H;  3DWP A;  5COR A;  1SN8 A;  4XTC S;  3CQZ B;  4YCV A;  2QKI C;  1LT4 D;  2WAQ B;  1SDF A;  2NWG A;  4EQN A;  4XQQ A;  1PH6 A;  3HOV G;  2B2W C;  4LF9 Q;  3KK7 A;  4DV0 L;  4JI7 Q;  1PH8 A;  4B3R Q;  3A8J E;  2EJG C;  4POG A;  1QWY A;  1PYS B;  1MHW C;  1WTR A;  1I4H A;  5EBD A;  4UAI A;  1IYJ B;  3KBX A;  5CV4 A;  4DUY L;  1OXT A;  4B9X A;  3CP0 A;  4UP9 A;  5EGT A;  4DR1 L;  1N9W A;  3EBE A;  2AWO A;  2ICI A;  2UXC L;  3PQI A;  3KLS A;  5LHY 1;  3W1B A;  2KEC A;  1PH5 A;  4CDC C;  1PH1 A;  1PZI D;  2F0P A;  1MBY A;  4DK0 A;  1Z47 A;  2CHB D;  2YU9 B;  2Z0S A;  2HHH L;  4A3D B;  2TMP A;  2R93 G;  2HDL A;  3MAQ A;  2MUY A;  4PMW A;  5FO9 B;  4LFC L;  4ME5 A;  1GJX A;  4GLA C;  2E2H B;  3MXN B;  1LTS D;  1TWG B;  1W2B A;  2R93 B;  2N55 A;  3M4O B;  1VQM A;  4IFD J;  3NEM A;  4B9W A;  4QB4 A;  4DR7 L;  3GTJ B;  2LFN A;  1S5B D;  4NXN Q;  1PRT F;  2RSN A;  3QIA A;  2HIV A;  5IYD G;  3UDF A;  2B2V C;  4IUT A;  2JQO A;  1LTB D;  4IJH A;  1H9J A;  1I3Q B;  2ZM6 Q;  5JJI A;  4ZCK A;  1LAB A;  3NE5 B;  1CHQ D;  3OWF A;  1IW7 C;  4CHT B;  4DGZ A;  2B2T A;  3BZK A;  1NTG A;  2Q8R E;  2K5Q A;  2CWP A;  1BKB A;  1K83 B;  4BY1 G;  1IL8 A;  1BDO A;  2F3V A;  4R8N A;  5C4J H;  3BDC A;  4B08 A;  1A2T A;  4DV2 Q;  1FYC A;  1C48 A;  4A3M H;  1XMQ Q;  1VQA A;  3PGZ A;  1E0B A;  2XWB B;  1EEF D;  1RD9 D;  4C3H H;  5C44 H;  2AMC B;  2YV5 A;  3Q22 A;  4UPA A;  3NBI A;  4MTN A;  1MD2 D;  5A35 A;  2H4O A;  1CK1 A;  3M7N A;  1VDZ A;  3HEJ A;  5GAG C;  2OF1 A;  4KY7 A;  1OXU A;  1GUG A;  2EY5 A;  1IKM A;  4YWK A;  3ER0 A;  1RCV D;  1X65 A;  3R8B A;  3UE0 A;  2RVL A;  1XPO A;  4DR6 Q;  4JI0 Q;  1KAB A;  1LAC A;  1SSO A;  1I4G A;  1GUS A;  2F0K A;  4IOA A;  4G7O C;  4FXD A;  1KDA A;  1KHI A;  2GVA A;  1Q82 C;  3PO3 G;  5E4W C;  1LLR D;  4DKA C;  1Y8O B;  3UI2 A;  5IP7 H;  4DV5 L;  1IHZ A;  1WYD A;  4ALP A;  4A3F G;  4OX9 L;  2O2L D;  3PO3 B;  4DV3 L;  4QJF A;  3RLN A;  4A3F B;  3M9B A;  1RTN A;  1QE6 A;  4HJ9 A;  1GOZ A;  3GQB A;  2F0Q A;  5C4Z A;  1CSQ A;  3T53 B;  4Z9C B;  3HOU G;  2JXM B;  3CCQ A;  4QUF A;  2PNR C;  1STH A;  3K6O A;  1K9M C;  3HOU B;  2F0G A;  2YYZ A;  1RDP D;  1V43 A;  5K36 G;  1VQE A;  3GD7 A;  3CAM A;  3K5N A;  3G6J B;  4EQP A;  5IWA Q;  2WB1 E;  2NVT H;  1TWA B;  3SHL A;  1JJG A;  2E2D C;  1UEA B;  1EZ8 A;  1KC8 C;  3AFQ A;  2M00 A;  1YJN A;  1F9R A;  3HKZ E;  4IJL A;  5FK9 C;  4F7X A;  5CV5 A;  5C6A A;  1XPU A;  2I5H A;  3MXN A;  4L63 B;  2A6H D;  3TS0 A;  1JB3 A;  3FVQ A;  1PRT C;  3R2I A;  2G5D A;  1F2M A;  1S40 A;  2O5I C;  4DK1 A;  4GKJ L;  4OWX B;  3PIO A;  4I7Z C;  4ZUJ A;  1FGU A;  3MXG A;  1W3S A;  4OEM B;  3C46 A;  2E74 C;  5GQO A;  3OIP A;  4CBV A;  3S1R B;  1EY6 A;  1VQ7 A;  4X3K A;  1HZB A;  1HUM A;  1MSH A;  2FIN B;  3CPF A;  1PV4 A;  1E2V A;  2I46 A;  5EKK A;  1BBW A;  3S1M H;  1JOQ A;  2L4N A;  1N36 Q;  5KYI A;  1E2Z A;  2KHS A;  3RR5 A;  5IOD A;  3KFU A;  1YHQ A;  1EOT A;  1JQY D;  2DGY A;  4CJ2 C;  4IPD A;  3RZO B;  2QEX A;  2B63 B;  1DOL A;  1YBY A;  4LF7 L;  1EOV A;  4ME3 A;  1TY2 A;  3QWN A;  5ELD A;  4FXG C;  1EU4 A;  4GLV B;  2AUK A;  2A73 B;  3NSW A;  1N8R C;  2OWO A;  1ROD A;  2J4X A;  3S24 A;  1PTO D;  1HNW L;  2PNH A;  1UE7 A;  4ZLT F;  4QIW B;  1TT2 A;  2NZH A;  4N9P A;  3H3V H;  2FFK B;  2OXP A;  4MTK A;  1X55 A;  1UE5 A;  4IZ8 A;  4BBS B;  4JYA L;  4CDD C;  3D3R A;  1VF7 A;  3TP8 A;  4ID6 A;  3K7U C;  3R93 A;  1KD1 C;  3FRP B;  1Q8I A;  1KLU D;  3NXW A;  1JJ2 A;  3W2D A;  1QUQ B;  2RDH A;  3CPW A;  1HQM C;  4DXF A;  2E8G A;  4DF7 A;  1N34 Q;  2L9H A;  3AEV A;  4JV5 Q;  2ID0 A;  4X66 L;  1HPC A;  3LX0 A;  1VQK A;  1BXT A;  3AB9 A;  3I7F A;  4LF9 L;  4JI7 L;  4B3R L;  4XDX A;  4DAY B;  3E9H A;  3IFD A;  1VQ9 A;  3RN2 A;  5C5M A;  2CQA A;  5ELE A;  4BY7 H;  2EQS A;  2EYH A;  5C3E H;  3OMC A;  4DR4 L;  1KXL A;  3SK4 A;  2CW0 D;  1TS4 A;  2BE5 D;  2LXK A;  1XNQ Q;  4QY7 A;  4WJ3 M;  1PTO B;  1X54 A;  3I90 A;  1STE A;  5J22 A;  1ENF A;  1O7Y A;  3J80 c;  1ASY A;  4C3I B;  1D1I A;  4MN3 A;  4K5X A;  2EXZ A;  5M3F H;  4JOI C;  1SYE A;  2CFM A;  3TME A;  1RKN A;  3M4Y A;  1U5K A;  2F0O A;  4MNO A;  1CTM A;  1D7Q A;  4DV0 Q;  1HA6 A;  3HS0 C;  1PFS A;  2O5J C;  4C3H G;  5C44 G;  5C0X H;  1KL9 A;  4OWW B;  4HSP A;  2K5W A;  4DU9 A;  2ZTD A;  1BCP F;  3KYH C;  3MXP A;  2R3Z A;  2F0H A;  3T1H Q;  3KUP A;  2L0C A;  1SFO B;  4O0A A;  1B44 D;  1PMR A;  1SRO A;  4NXN L;  2RF4 A;  1X56 A;  3ERO A;  1YNX A;  2KQ3 A;  2NBF A;  3GO5 A;  5CBA E;  3JAM L;  2ZM6 L;  1SE3 A;  1YI2 A;  1EYG A;  4IAL A;  3SK8 A;  1Q12 A;  2WKD A;  4UHV A;  3NQT A;  5LMN W;  3J80 i;  1QG7 A;  3HRZ C;  4C1N I;  2IX3 A;  4J8Q A;  4POF A;  2I5M X;  4RGO S;  3C2P A;  3PMF A;  1UE6 A;  4LJZ C;  1VQ6 A;  3DHQ A;  1VF5 C;  4RKB A;  3K81 C;  3KDF B;  2F0I A;  1EIG A;  2NVY H;  3GTM H;  1STN A;  3OTO Q;  3MFG A;  3FDT A;  3BS1 A;  1D5Z C;  2VB2 X;  3LWU A;  1EYC A;  1XMQ L;  2F0N A;  3X3M A;  3W1G A;  1W6K A;  4P72 A;  4AQY Q;  2X6G A;  4HTH A;  3CW2 C;  3NPP A;  4ZRZ A;  3NWS A;  1EIH A;  2K03 A;  4DNR B;  3NQI A;  2VY3 A;  4GN4 B;  3CMA A;  5JVH 3;  5LMU Q;  1GO3 E;  1UUP A;  1VQI A;  2BDO A;  4FF3 A;  1WCM B;  4A3J G;  5COY A;  3B6Y A;  1OXV A;  4A3J B;  2QEJ C;  4KLK A;  1JIC A;  2SEB D;  2XWJ B;  3BU2 A;  2AQ3 B;  2AWN A;  4YCU A;  1ENA A;  1QUQ A;  4A93 H;  4DR6 L;  5D65 A;  4JI0 L;  3IKJ A;  4XYQ A;  3UE1 A;  2OTL A;  2EYM A;  2N3S A;  2UU9 L;  3AQQ A;  1O7Z A;  1YEZ A;  3A74 A;  2R7Z B;  3NWT A;  2NVX H;  2RHS B;  3H94 A;  2K50 A;  3G4S A;  4ZKB B;  1VMP A;  1JWU D;  4CKB A;  1RJT A;  3CF5 A;  1HNX Q;  1S5C D;  4DUZ Q;  3STB C;  5C0X I;  3A0J A;  1MSG A;  5IWA L;  3OWE B;  1TR5 A;  2JP1 A;  1U0L A;  4HAE A;  4B3S Q;  3SK6 A;  3BYT B;  3Q0A A;  4DV5 Q;  2LY7 A;  5IE8 A;  1D8L A;  3RNU A;  1JMC A;  2PCF B;  4K5W A;  2E2I H;  4JVZ A;  5LL6 X;  2RA4 A;  1BCP C;  1K8A C;  3CKI B;  5IT9 L;  2F0W A;  1MIU A;  1VQJ A;  4V0B A;  4AIM A;  4A75 A;  3SGI A;  1DGS A;  1VQH A;  3M4Q A;  1Q81 C;  1KIX A;  1T5X D;  2KCT A;  3NUC A;  4KN4 C;  1X3F A;  2JEB I;  1ESR A;  2F0J A;  2JEA I;  3SK5 A;  1QVC A;  1SYG A;  2SNS A;  1XTD A;  2IL8 A;  2AQ2 B;  1NE3 A;  3S17 H;  2YTX A;  3A8K E;  1DOK A;  3HOY G;  1KRS A;  1H9R A;  5ELB A;  1VQB A;  4DA2 A;  4XT1 B;  4R9W A;  2JA8 G;  1I6H B;  3HOY B;  1LUZ A;  4APV A;  1QVF A;  2IPK D;  1N36 L;  2JA8 B;  1IKL A;  3KDF A;  2F52 A;  5HGT A;  3U58 A;  2F0E A;  4K2L A;  4GKJ Q;  2QW7 A;  1A8V A;  2V4D A;  3HOX B;  2N49 A;  1KRT A;  2F4I A;  4KJN A;  3X3N A;  4R1J A;  5E7N A;  4BY7 G;  2J0T D;  2NZO A;  5C3E G;  1GHJ A;  1PRT D;  4BY7 B;  1UE1 A;  3K5M A;  3GTL H;  3P1H A;  4IFD I;  1KDC A;  4PV1 C;  2K5H A;  1BF4 A;  1LYL A;  2JA5 B;  4DPG A;  4C2M H;  4DN4 M;  2DJG C;  3PIP 3;  3RD4 A;  5M5Y H;  5KNC A;  3IAY A;  4QGU A;  4R4O A;  4Y7N H;  4OL7 A;  1PH2 A;  2HCI A;  2B2W A;  3L7Z C;  4J15 A;  4NP5 A;  3Q23 A;  1ML0 D;  3JAM E;  3K58 A;  2A74 C;  2K01 A;  2ASB A;  5C0X G;  4E6I A;  4GN3 B;  1SAP A;  5ELO A;  5C0X J;  2DY7 A;  3J80 E;  3LWE A;  4JV5 L;  5AJ3 Q;  5CBE E;  2WKC A;  2PW5 A;  3I91 A;  1FL0 A;  1M4V A;  1B53 A;  4ULL A;  4KHV A;  1I4Q A;  3FKI B;  2Q2H A;  3BZD B;  3AU7 A;  3CC2 A;  2OTJ A;  3R3O A;  1Z7T A;  1TWH H;  2XN9 C;  1II3 A;  1S4Z A;  4IOC A;  4JYA Q;  2XTI A;  4M8A A;  4AYB E;  5DEH A;  4CJ0 B;  1AW7 A;  1XNQ L;  1JWS D;  1A15 A;  5FLX L;  2KCN A;  1L0W A;  1DXM A;  5GRO A;  3A7A B;  4HMI A;  3A56 A;  2NN6 H;  4DR2 Q;  4X66 Q;  2B2V A;  3K80 C;  2MJ8 A;  2IW3 A;  2KCM A;  3I8Z A;  2KBN A;  1FGB D;  2QDB A;  3VYR A;  2R7F A;  4FNF A;  4BXX H;  4HMJ A;  2WAQ E;  2QA4 A;  3HOV B;  1JOR A;  1SNQ A;  3HG9 A;  1KNE A;  2R7D A;  3TQY A;  4A3I H;  4MHE A;  1ILP A;  3QO2 A;  3T1H L;  1HJP A;  1K0R A;  4KKU A;  4DR4 Q;  1S5D D;  1KDB A;  2FXQ A;  2EXD A;  4I65 A;  3PF4 A;  3MZ5 A;  4C56 C;  2PO4 A;  2BA1 A;  2UXB L;  1D5M C;  4K6L A;  4G4K A;  4WRD A;  5D3D A;  3HOZ H;  4LF8 Q;  2SOB A;  2KOL A;  1LTG D;  4OEL B;  3DLL A;  2I0Q A;  3J81 L;  4CKC A;  5I9O A;  2FMC A;  2VW9 A;  5JJZ A;  4IFD G;  3FEW X;  4DNI A;  1VQ5 A;  3OTO L;  5IYC H;  3J7A F;  1W6J A;  3ICE A;  2ENB A;  3TP6 A;  1VS0 A;  1R9T H;  4DV7 Q;  2NVX B;  2IY5 B;  4K6D A;  4HN7 A;  1HTL D;  5IP9 G;  3PF5 A;  2I5L X;  2EZV A;  4AQY L;  1AH9 A;  3KF6 B;  1MKH A;  2JK8 A;  4A3K H;  2I07 B;  5IT9 E;  3EFX D;  4KV6 A;  2VQF Q;  3ZYY X;  4TKO B;  5LMU L;  1YNN C;  2G9H D;  2OCE A;  5ISR A;  1J5E L;  3BG3 A;  5G3L D;  1VQG A;  4X6A H;  1GVP A;  1EZ6 A;  1H9S B;  1J9O A;  2D9U A;  1K28 A;  1D6E C;  2DY8 A;  4BY1 B;  3RZD H;  3TP7 A;  3H3V C;  1S3O A;  1LTT D;  2K5N A;  2E2I B;  1EEI D;  5IGG A;  4DK6 C;  1B7Y B;  2DNE A;  3VR2 A;  3KOJ A;  2F03 A;  2HUG A;  1XWE A;  2F4V Q;  1E24 A;  3S1N H;  2Z9H A;  4OGQ C;  1AE3 A;  3TN2 A;  1M8A A;  4CDF C;  3M7G A;  1NMF A;  3QR8 A;  2NN6 I;  3OMG A;  4KI0 A;  1QJO A;  1EWH A;  2H5X A;  3FHW A;  2AKW B;  3NK9 A;  5LMN Q;  2A19 A;  2KEN A;  3T51 B;  4IPC A;  4N9T A;  3CRL C;  2EYJ A;  1HNX L;  3I73 A;  5CGK A;  1SE8 A;  4DUZ L;  4MIU A;  2K5V A;  1N33 Q;  3D8G A;  4JBK A;  2BA0 A;  2GN5 A;  1EQT A;  2K28 A;  1EIY B;  2Z4I A;  3TZU A;  2IHF A;  1H9M A;  2EY6 A;  2FMM A;  1TKW B;  2EY2 A;  2F3W A;  4QMG A;  1U4R A;  3T1Y Q;  4B3S L;  3W3A A;  2UU9 Q;  1PXU A;  3RLO A;  3CD6 A;  1R4P B;  1HFN A;  2QIL A;  1QZG A;  3KLW A;  1A6X A;  3D4R A;  4JI6 L;  4OHJ A;  1EFI D;  4GNX C;  2KA7 A;  2WII B;  1PA6 A;  1TQO A;  2R6G A;  3DMU A;  5GAE C;  3L3O C;  3GTG H;  4IUQ A;  1LV9 A;  1ZEQ X;  2GVB A;  3E3X A;  3L2P A;  4LWC A;  5ELF A;  1HRJ A;  2F3I A;  3URY A;  4IUV A;  2OQK A;  1KAW A;  4ILW A;  4DV1 Q;  4KN7 C;  4X62 L;  4JI5 Q;  1C0A A;  2XRQ D;  4ZKC B;  1L1O C;  5M3M G;  4C3J H;  1LTI D;  1B1Z A;  1L2F A;  3R2T A;  5A2Q L;  4PZ6 A;  5J1Z A;  3STB D;  3ULL A;  5I4D A;  5M3M B;  1STB A;  5TSS A;  1Y1V H;  4LFB Q;  4DXG A;  3HKZ G;  1Q1E A;  2L11 A;  3GTO H;  1TS2 A;  2HD3 A;  4H13 C;  2VL6 A;  1PHJ A;  4OO1 H;  1T5E A;  2PQA B;  1NR2 A;  5FLX E;  3G6E A;  3K57 A;  1E1T A;  2RDF A;  1LM0 A;  4AH6 A;  1UEB A;  1G91 A;  4K8J A;  4RG1 A;  5M5X H;  5C5L A;  1U4P A;  4DNT B;  1JE5 A;  2JA6 H;  2EYO A;  1EQR A;  5KND A;  1M1K C;  1OTC A;  1BCP D;  3CCM A;  1HTP A;  3KF6 A;  2ATW A;  4EQ5 A;  1F2L A;  2A6E D;  1K8M A;  2MO0 A;  3AMU A;  4GN5 A;  4JI2 L;  1ONL A;  3VR5 A;  3EN2 A;  2G9D A;  1SBB B;  1VQO A;  1P16 A;  1DD2 A;  5L37 A;  3PO2 G;  1YJW A;  2NN6 G;  1WOC A;  1XMO Q;  1YVC A;  1SJH D;  2EYF A;  1IBK Q;  1H9S A;  2JA7 H;  3PO2 B;  1VQ4 A;  1SNC A;  3OW2 A;  3MA2 B;  4BXX G;  1O7I A;  1LTL A;  3AYH B;  2F0S A;  2ES2 A;  1H9K A;  2WFW A;  5AJ3 L;  5I9P A;  5I6Y A;  5IGD A;  2E5L Q;  4JPB W;  1QZH A;  3TS2 A;  3Q6S A;  3BZC A;  1QNK A;  2CVR A;  3HGB A;  1ILQ A;  4RCO A;  1PH9 A;  5IOC A;  3EQL C;  4JOI A;  2AUJ D;  3EJI A;  4QIW E;  3G7L A;  2HCC A;  4LF6 Q;  2YTY A;  1BCP B;  4FXK C;  4R8I A;  3SDZ A;  3CME A;  1G8Z D;  2PQE A;  2L15 A;  1I4P A;  1HR0 W;  3L9A X;  4R4T A;  2KEE A;  1DYQ A;  5ELN A;  4DV4 Q;  5JJL A;  1XPR A;  5IYC G;  1WVL A;  2EPB A;  1CFM A;  3ND8 A;  4DR2 L;  1OXX K;  3U4V A;  2IX1 A;  1STA A;  1SNO A;  2F0D A;  3I4N H;  3DUZ A;  1PLF A;  4LK1 C;  1RTO A;  1TWF H;  1R9T B;  3DXJ C;  1EL0 A;  4HR7 B;  3CC7 A;  5BN3 A;  1F9Q A;  1TS5 A;  1NJI C;  1I94 Q;  2RHQ B;  4P71 A;  1ET9 A;  4A3K G;  4HID A;  1WTP A;  4RKL A;  3F2B A;  3PV0 A;  4A3K B;  4A4I A;  3MHB A;  3JAM c;  3S2D H;  3A7L A;  2Q8I B;  4JI4 Q;  4A3B H;  2K32 A;  3WDN A;  4L5Q A;  1HUN A;  4LF8 L;  1Z9F A;  1FNU A;  4A3M G;  3KBG A;  1OO9 B;  1Y1W H;  3O13 A;  5C4J B;  1QB5 D;  3PUW A;  4JI3 L;  3QJY A;  3OIQ A;  2PMZ B;  4A3M B;  3PIP A;  1PFB A;  1QNU A;  2HIX A;  2Y0S G;  3G48 A;  4ZK9 B;  4A3G H;  3M85 A;  2ZTE A;  2PQA A;  3J7Z C;  4C3H B;  5C44 B;  2Y0S B;  3S2H H;  1F9S A;  4P2C B;  4HJA A;  4LUV A;  1PDQ A;  4HJ8 A;  2D0P A;  1YHB A;  4DV7 L;  3OW7 A;  5T1I A;  1SMY C;  3K0Y A;  2RBM A;  5JEA H;  1VQL A;  1GHK A;  1G2T A;  4RMF A;  3JAM i;  4L6T B;  2UXB Q;  1WTQ A;  4LF5 Q;  1DOM A;  3ITP A;  4KHP Q;  3RLF A;  5FLM H;  2VQF L;  4WFN 3;  3I56 A;  4A3E H;  1BQQ T;  1HCZ A;  2RDG A;  5IP7 G;  3HZX A;  3TP5 A;  1PH3 A;  3NTK A;  4LAA A;  3H3V I;  3E0E A;  3DWA A;  2D5D A;  3H0G H;  2R92 H;  1NY4 A;  2DN8 A;  4NPS A;  4JBW A;  4RCN A;  2J7Z A;  3OYY A;  2PYK A;  5DLQ E;  5FKA C;  2VZA A;  5C4X H;  2DJF C;  5KGU A;  1SE4 A;  1V8Q A;  2B29 A;  2F4V L;  4NW2 A;  3GTQ H;  4F88 A;  2R61 A;  1V1P B;  3GTG B;  2JJQ A;  4A3L H;  5D14 A;  3HOW H;  4RHR A;  2WIN B;  1K8G A;  1IYV A;  3S14 H;  1EU3 A;  1ZYR C;  3BVZ A;  5LMN L;  4C3J G;  1J5E Q;  3S16 H;  2NVT B;  2WV6 D;  2RCN A;  1CT1 D;  2Z8L A;  4WJW A;  2JE6 I;  4C3J B;  4RA8 A;  4BWG B;  1Y1V G;  3F1Z A;  1N33 L;  3VR3 A;  1IW7 D;  3PUV A;  3MC0 B;  1CQV A;  4L5S A;  2WP8 J;  1TS3 A;  4X65 Q;  1XNR Q;  1YNN D;  1BNZ A;  4IPH A;  4LUZ A;  3GTO B;  3T1Y L;  1I4R A;  1VQ8 A;  4LUO A;  3V05 A;  1CA5 A;  5NUC A;  4KY6 A;  5IT9 c;  2YU9 H;  3E0J A;  4A3D H;  2CWA A;  1E7Z A;  2PZU A;  1SMX A;  3K0X A;  2MHV A;  3H6M A;  3WOF A;  1CZG A;  3I70 A;  4DAY A;  2ALY B;  2E2H H;  5C4H A;  2R93 H;  1XX8 A;  3I4M H;  1CZW A;  1GUN A;  3M4O H;  1PFN A;  4KTA A;  1V9P A;  3Q24 A;  1QCB D;  3GTJ H;  1SYD A;  2N88 A;  3BJU A;  1AEX A;  1UAP A;  2JA9 A;  3S1M B;  4F8M A;  3K5L A;  4DV1 L;  4JI5 L;  2L12 A;  4PZ7 A;  4IUN A;  1PH7 A;  4NB3 A;  1GUW A;  4NMZ A;  1PZJ D;  3VDY A;  1KLG D;  1IBM Q;  2MP1 A;  2LS0 1;  3K7A H;  4RGT A;  4JI6 Q;  1ICW A;  4LFB L;  2B8G A;  2LKV A;  1TU2 B;  3I55 A;  1JT8 A;  1Z6H A;  1C8C A;  3KF8 B;  4WOR A;  4Q5V A;  3GTK H;  3MVV A;  4P75 A;  4IUR A;  1K83 H;  3BDL A;  3M3Y H;  2M9V A;  1SYB A;  3RMH A;  1WTV A;  2JYO A;  4H7B A;  4IO9 A;  2F1M A;  2UXD Q;  1HZC A;  3CC4 A;  4X62 Q;  1ENC A;  1J6Q A;  3NBH B;  1JOK A;  3U4Z A;  1XJV A;  2QF7 A;  3KLS X;  4JK1 C;  2XNA C;  1FJG Q;  2EOT A;  1P8L A;  1QOH A;  1SNP A;  2A5H A;  2X6L A;  3SXH A;  2CH4 W;  1NUC A;  3T13 A;  1CKO A;  3CXC A;  4DFA A;  2MNA A;  3OOC A;  2BH8 A;  5HUR A;  3J7A 5;  1Y69 U;  4KHZ A;  4BBR H;  1XMO L;  4OON A;  1YNJ C;  3J7Y W;  1IBK L;  1TVX A;  4BA2 I;  1E22 A;  4UP7 A;  2B2U C;  4HSV A;  1YJ9 A;  4IPG A;  4RWS C;  4XQN A;  1E3P A;  3DEO A;  1BO0 A;  2UUC L;  2VUM H;  5KIX A;  2L1B A;  4NKL A;  2E5L L;  1PVO A;  1Y8P B;  1RL2 A;  4KK7 A;  4YCW A;  5JOB A;  1V1P A;  2A8V A;  1HXY D;  3I72 A;  4JI2 Q;  5C3E B;  1Q8K A;  2OQ0 A;  2SNM A;  4R4C A;  3PO3 H;  2IX0 A;  3S2D B;  1STY A;  3ERQ A;  4A3F H;  5M3F G;  3F2C A;  4YY3 Q;  5BR8 Q;  1NBW A;  5M3F B;  1V1Q A;  5EQ0 A;  4LF6 L;  1K8O A;  5FLX c;  4GNX B;  2TSS A;  1FD7 D;  2E2J H;  2HQE A;  2OEO A;  2K75 A;  4G7Z C;  1IBL Q;  1LTA D;  3P7J A;  3P75 A;  4A3G G;  2N8N A;  3N6R A;  4DV4 L;  1D2B A;  4GZY C;  4KKT A;  3E5S A;  1QIL A;  4LNQ A;  3J81 j;  3VA5 A;  2NTS A;  5EBC A;  3GP7 A;  2EY1 A;  3KJP A;  2K5D A;  4PMB A;  2C5C A;  1O80 A;  3D6W A;  4G7H C;  1F9P A;  1DM0 B;  5JEA G;  5JEA J;  4DR5 Q;  1L1O B;  2A69 C;  4JBJ A;  5HGQ A;  5KNB A;  1HHV A;  1I94 L;  3DWQ A;  1IZ6 A;  1PFM A;  5J3B A;  5DNF A;  1A2U A;  1GUO A;  5FLM G;  4A3C H;  1EFW A;  3TEH B;  2KHJ A;  4A3E G;  4HCS A;  1BUV T;  2B2Y A;  1BR9 A;  1AN8 A;  3FMC A;  4TRD A;  1A63 A;  2XSC A;  4JI4 L;  4KJO A;  5FOB B;  1ET6 A;  3J81 c;  3GTM B;  2NVY B;  4M1U B;  1DJR D;  3H0G G;  3SR1 A;  2R92 G;  3KJO A;  1V1O A;  4FF2 A;  1EYA A;  1B4O A;  2R92 B;  1RF2 D;  4GOP C;  3KF8 A;  2EIF A;  3ULJ A;  3H91 A;  1SEB D;  2VQE Q;  1EY8 A;  4X64 Q;  2PPB C;  1VQD A;  2HDM A;  3OHX C;  4B3M Q;  4DR3 Q;  4A3L G;  3A54 A;  3HOW G;  2NZ1 D;  2E75 C;  3DM1 A;  3SVM A;  4JI1 L;  1L0Y B;  2K6A A;  3RZO H;  5JAV A;  2B63 H;  2D0O A;  2EJF C;  1FVI A;  2EDG A;  3HOW B;  2Z6B A;  2K4K A;  4LFA Q;  3S14 B;  4J6H A;  3NBH A;  1CM9 A;  4IQZ A;  1OXS C;  3S16 B;  4LF5 L;  3FPU B;  1HR0 Q;  4A93 G;  4KHP L;  4JC0 A;  5KEE A;  2IJ0 A;  1B3A A;  3J81 i;  3QOL A;  3QOJ A;  4JI3 Q;  4A93 B;  5M5W H;  3A5U A;  1JB7 A;  1F2Z A;  5AFW A;  2B2Y C;  1HNZ Q;  2KHI A;  1J8I A;  4R4Q A;  3A8I E;  3UDX A;  1I6V C;  3F2D A;  4A3D G;  1IXR A;  4BBS H;  3LNN A;  4R4I A;  1EIF A;  4TSS A;  3S9W A;  5E3F A;  4XIG S;  4EVO A;  5KYL A;  3FP9 A;  1A3V A;  4GS3 A;  1HZ9 A;  3I4M G;  5EJW A;  4O1N A;  1AZQ A;  1JOO A;  2K14 A;  3I4M B;  5KRU A;  4YHH Q;  1LT6 D;  5CMD A;  5IGE A;  1F77 A;  1NSN S;  3IRB A;  1XTC D;  1DCZ A;  2C35 B;  4IUU A;  5BN5 A;  1SMY D;  1EQV A;  2KUM A;  2O4X A;  2K1B A;  5CV7 A;  4XQJ A;  4QQB X;  3CCV A;  3VA7 A;  1U4M A;  1HH2 P;  5EKI A;  4PZ8 A;  2L55 A;  3HP3 A;  4GNX A;  4DK3 C;  1CQF A;  1EUJ A;  3E9I A;  2NVQ H;  4K0K Q;  1GKH A;  1WD0 A;  3K7A B;  1FNV A;  4X65 L;  1XNR L;  2NYZ D;  3V2T A;  5JVG 3;  1PTO H;  1LT5 D;  4JI8 L;  4FYD A;  3GTK B;  2ZXO A;  4C3I H;  2RSO A;  4BA1 I;  1N32 Q;  1R4Q B;  1U9R A;  4S3S A;  3M3Y B;  4L5T A;  4DAV A;  5EPL A;  5DM7 3;  1YIJ A;  1B3Q A;  1VCI A;  1HZA A;  3NTH A;  1L1O A;  2A68 C;  4K8I A;  1UWV A;  2JN4 A;  4YIJ A;  3E6Z X;  4X3S A;  3EA6 A;  4K14 A;  5JPM C;  2GA4 B;  2PI2 A;  3S17 B;  3CCE A;  4K5V A;  3NHH A;  2P5Z X;  2F0V A;  1DON A;  3F8T A;  1SFO H;  3ERS X;  1VQP A;  4BS9 A;  4BBR G;  1VQN A;  2BOS A; 
#chains in the Genus database with same CATH homology
 4PQX A;  2LMC B;  3SE0 A;  1ZYR D;  1TII D;  3C3L A;  4BBR B;  5BN4 A;  1SYF A;  4HED A;  2F0M A;  2B8F A;  1HFG A;  3CHB D;  5E1F A;  2MGS A;  1NCV A;  2VUM B;  2C9O A;  4RGM A;  2B2T C;  4QCL A;  4DAP A;  4RGN A;  3GTL B;  1KTK A;  3MFY A;  1D1K A;  1B9N A;  1AZP A;  4C2M B;  5M5Y B;  1JE4 A;  4Y7N B;  2EVB A;  4H0L C;  2WB1 B;  2E2J B;  1X3P A;  2ZT9 C;  1BOS A;  1XXG A;  3VYT A;  1UNS A;  3HKZ B;  5DM6 3;  1ZKO A;  1X3Q A;  4L8J A;  1S5E D;  3MWY W;  3BYY B;  2Z4H A;  4X3U A;  3GV6 A;  3VR6 A;  1Q90 A;  1GUT A;  1TWH B;  3VYS A;  3V96 A;  4ZYS A;  5CC4 A;  1LO5 D;  3P20 A;  2F0T A;  3PUY A;  2AQ1 B;  1CI3 M;  2SDF A;  1D5X C;  5IGF A;  2L5T A;  4PMC A;  5G3L F;  4RH6 A;  5IGC A;  5F2D A;  4ODG A;  3J81 E;  5CV6 A;  1YNJ D;  4A3I B;  3C1E A;  5CV8 A;  1Q3L A;  4FO2 A;  1E2W A;  4CJ1 B;  3SEB A;  2RQX A;  2ZXP A;  3VYU A;  4H44 C;  5DAU A;  1SE2 A;  2ZXR A;  1AP0 A;  2FJ2 A;  4U68 A;  2F0F A;  2NTT A;  2IT1 A;  2ICE C;  4QUC A;  2PW7 A;  1BBX C;  2KED A;  3HOZ B;  5I2X A;  2F0L A;  1WTO A;  5M5W B;  1WTX A;  3CU7 A;  3K5O A;  4XXE A;  3H09 A;  4FF1 A;  3BVM A;  1JWM D;  5E4X A;  4IN3 A;  1KAA A;  3BVG A;  3ND9 A;  2EE1 A;  3VR4 A;  1JCK B;  4KMU C;  4OO1 I;  1IYU A;  3MXU A;  5C3W A;  3GV3 A;  2A69 D;  4KD4 A;  5J39 A;  2Z1C A;  3I4L A;  3I3C A;  2KVM A;  3IL8 A;  1WTW A;  1A3T A;  3RZD B;  3TSS A;  1X32 A;  1FNW A;  2IWH A;  2NVQ B;  2Q8T A;  4C3I G;  1NAP A;  1O7L A;  2H1E A;  1EY0 A;  4RHS A;  3S1N B;  2PZT A;  5C3X A;  2X69 A;  1ZXT A;  4FP5 D;  2JSO A;  3NP8 A;  1F2Y A;  3KLR A;  5I6W A;  5K5P A;  1WD1 A;  5FO7 B;  3TBI B;  2DNC A;  1EY5 A;  4ZAI A;  1PYW D;  5JPN C;  1LTR D;  4UDU C;  1STG A;  3T56 B;  2XIW A;  3WOE A;  5CR3 A;  4V19 0;  1U4L A;  2B39 A;  2K7V A;  3OPO A;  2BCO A;  1G6Z A;  4OIJ A;  4FVM A;  4CKE A;  2QCP X;  4OIK A;  3NTI A;  3J80 L;  4Q0F A;  3ONA B;  3T4A C;  5A2Q E;  1O78 A;  4XYO A;  2FHT A;  4ZUI A;  4F87 A;  1EY9 A;  4CGY B;  3D4D A;  1PTO F;  5EKL A;  2OT2 A;  3BDO A;  4TQU S;  1EY4 A;  3IFT A;  1SYC A;  1Y1V B;  4OO1 G;  4LMQ D;  1EYD A;  1AFP A;  1SNM A;  4PNY A;  4K2K A;  1CHP D;  4XT3 B;  1G2S A;  2EYP A;  2EYL A;  3D31 A;  2KCC A;  3PUX A;  5D3I B;  1GXD C;  5LL6 S;  3PIO 3;  5M5X B;  1SND A;  2XVS A;  2JA6 B;  4KKS A;  5T1G A;  2XRS D;  4X3T A;  1I4X A;  3U9O A;  5IGB A;  1SXT A;  4QF4 A;  4IFD H;  1FR3 A;  3TDQ A;  2VB3 X;  3FPP A;  1MGS A;  2B2U A;  2A68 D;  3S1Q B;  2E76 C;  3T16 A;  2JA7 B;  1TY0 A;  4KD3 A;  5IIF A;  5EPK A;  3RUZ A;  1G29 1;  1HQR D;  3D6C A;  3MEH A;  2A6H C;  2KJX A;  2NUC A;  1S5F D;  3J7A V;  4RFB A;  1TWC B;  1EWC A;  3EVQ A;  1Q1B A;  3U9S A;  1CA6 A;  2WAC A;  4HCE A;  4ABN A;  2K33 A;  3F2U A;  3D4W A;  2A6E C;  1EY7 A;  3TZD A;  2RKS A;  4EGV A;  3A55 A;  2M2L A;  2MPM A;  1VMC A;  5CV9 A;  3I4N B;  4IUP A;  2D62 A;  4J1M A;  1TWF B;  5FO8 B;  3GTP B;  4U67 3;  1L0X B;  2PZW A;  3DEP A;  3N52 A;  1Y8N B;  5ELC A;  1B9M A;  1B50 A;  1ESF A;  1PTO C;  1LT3 D;  4A3B B;  1HA5 A;  1A3U A;  2BDN A;  3K59 A;  1KNA A;  5I2Y A;  1Y1W B;  5M9O A;  2NB0 A;  1DZ1 A;  4RAU C;  1JR0 D;  1PZK D;  2F0U A;  4ZQ3 A;  5K36 H;  4A3G B;  2EJM A;  4KY5 A;  3S15 B;  1JC7 A;  1I50 B;  1RHP A;  2VNU D;  3S2H B;  1C4Q A;  3CRK C;  3MTS A;  1MI2 A;  4O42 A;  1NR4 A;  1SJE D;  2CW0 C;  4C1N K;  2BE5 C;  4A3E B;  3PUZ A;  3QB3 A;  3OSO A;  1XYI A;  4AYB B;  2K05 A;  4FF4 A;  2D2C C;  5EPJ A;  2VXW A;  3H0G B;  2K04 A;  1B2T A;  1PRT B;  3QG1 A;  5C4X B;  3C1F A;  4EQO A;  4NDX A;  4G57 A;  5CYU A;  3GTQ B;  3DWP A;  5COR A;  4XTC S;  3CQZ B;  2QKI C;  1LT4 D;  2WAQ B;  1SDF A;  2NWG A;  4EQN A;  4XQQ A;  2B2W C;  3KK7 A;  3A8J E;  2EJG C;  1QWY A;  1WTR A;  1I4H A;  5EBD A;  4UAI A;  5CV4 A;  3KBX A;  1OXT A;  4B9X A;  5EGT A;  2AWO A;  2ICI A;  3KLS A;  5LHY 1;  2KEC A;  1PZI D;  2F0P A;  1MBY A;  4DK0 A;  1Z47 A;  2CHB D;  2YU9 B;  4A3D B;  2TMP A;  2HDL A;  3MAQ A;  2MUY A;  4PMW A;  5FO9 B;  4ME5 A;  1GJX A;  2E2H B;  1LTS D;  1TWG B;  2R93 B;  2N55 A;  3M4O B;  4IFD J;  4B9W A;  4QB4 A;  3GTJ B;  2LFN A;  1S5B D;  1PRT F;  2RSN A;  3QIA A;  2B2V C;  4IUT A;  1LTB D;  1H9J A;  1I3Q B;  1LAB A;  3NE5 B;  1CHQ D;  3OWF A;  1IW7 C;  4CHT B;  4DGZ A;  2B2T A;  2Q8R E;  2K5Q A;  1K83 B;  1IL8 A;  1BDO A;  2F3V A;  4R8N A;  3BDC A;  4B08 A;  1A2T A;  1FYC A;  1C48 A;  1E0B A;  2XWB B;  1EEF D;  1RD9 D;  3Q22 A;  3NBI A;  1MD2 D;  5A35 A;  2H4O A;  1CK1 A;  3M7N A;  1VDZ A;  3HEJ A;  2OF1 A;  4KY7 A;  1OXU A;  1GUG A;  2EY5 A;  1IKM A;  1RCV D;  3R8B A;  2RVL A;  1KAB A;  1LAC A;  1SSO A;  1I4G A;  1GUS A;  2F0K A;  4G7O C;  4FXD A;  1KDA A;  5E4W C;  1LLR D;  1Y8O B;  3UI2 A;  1IHZ A;  2O2L D;  3PO3 B;  4A3F B;  1RTN A;  1QE6 A;  1GOZ A;  3GQB A;  2F0Q A;  5C4Z A;  3T53 B;  4Z9C B;  2JXM B;  4QUF A;  2PNR C;  1STH A;  3K6O A;  3HOU B;  2F0G A;  2YYZ A;  1RDP D;  1V43 A;  5K36 G;  3GD7 A;  3K5N A;  3G6J B;  4EQP A;  1TWA B;  3SHL A;  2E2D C;  1UEA B;  1EZ8 A;  2M00 A;  1F9R A;  5FK9 C;  4F7X A;  5CV5 A;  5C6A A;  3MXN A;  4L63 B;  2A6H D;  1JB3 A;  3FVQ A;  1PRT C;  3R2I A;  1F2M A;  2O5I C;  4DK1 A;  4I7Z C;  4ZUJ A;  3MXG A;  3C46 A;  2E74 C;  3OIP A;  4CBV A;  3S1R B;  1EY6 A;  4X3K A;  1HUM A;  1MSH A;  2FIN B;  1E2V A;  2I46 A;  5EKK A;  1JOQ A;  2L4N A;  5KYI A;  1E2Z A;  2KHS A;  5IOD A;  1EOT A;  1JQY D;  4CJ2 C;  3RZO B;  2B63 B;  1DOL A;  1TY2 A;  3QWN A;  5ELD A;  4FXG C;  1EU4 A;  2AUK A;  2A73 B;  3NSW A;  1ROD A;  2J4X A;  1PTO D;  4ZLT F;  4QIW B;  1TT2 A;  4N9P A;  2FFK B;  2OXP A;  4IZ8 A;  4BBS B;  3D3R A;  1VF7 A;  3TP8 A;  4ID6 A;  3R93 A;  3FRP B;  1Q8I A;  1KLU D;  3NXW A;  3W2D A;  2RDH A;  1HQM C;  4DXF A;  4DF7 A;  2L9H A;  2ID0 A;  1HPC A;  3LX0 A;  1BXT A;  3AB9 A;  4XDX A;  3IFD A;  5C5M A;  2CQA A;  5ELE A;  2EYH A;  3OMC A;  3SK4 A;  2CW0 D;  1TS4 A;  2BE5 D;  1PTO B;  3I90 A;  1STE A;  5J22 A;  1ENF A;  1O7Y A;  4C3I B;  1D1I A;  4MN3 A;  4K5X A;  2EXZ A;  1SYE A;  3TME A;  1RKN A;  3M4Y A;  2F0O A;  1CTM A;  1HA6 A;  3HS0 C;  2O5J C;  4C3H G;  5C0X H;  4HSP A;  2K5W A;  4DU9 A;  1BCP F;  3MXP A;  2R3Z A;  2F0H A;  1SFO B;  3KUP A;  2L0C A;  1B44 D;  1PMR A;  3ERO A;  2KQ3 A;  2NBF A;  3GO5 A;  5CBA E;  3JAM L;  1SE3 A;  4IAL A;  3SK8 A;  1Q12 A;  2WKD A;  3NQT A;  1QG7 A;  3HRZ C;  4C1N I;  2IX3 A;  4J8Q A;  4RGO S;  3C2P A;  3PMF A;  4LJZ C;  3DHQ A;  1VF5 C;  4RKB A;  2F0I A;  1EIG A;  1STN A;  3MFG A;  3FDT A;  3BS1 A;  1D5Z C;  2VB2 X;  3LWU A;  1EYC A;  2F0N A;  3X3M A;  1W6K A;  2X6G A;  4HTH A;  4ZRZ A;  3NPP A;  3NWS A;  1EIH A;  2K03 A;  4DNR B;  3NQI A;  5JVH 3;  1UUP A;  2BDO A;  4FF3 A;  1WCM B;  5COY A;  1OXV A;  4A3J B;  2QEJ C;  1JIC A;  2SEB D;  2XWJ B;  2AQ3 B;  2AWN A;  1ENA A;  5D65 A;  3IKJ A;  4XYQ A;  2EYM A;  1O7Z A;  2R7Z B;  3NWT A;  3H94 A;  4ZKB B;  1VMP A;  1JWU D;  4CKB A;  1RJT A;  1S5C D;  5C0X I;  1MSG A;  3OWE B;  1TR5 A;  2JP1 A;  4HAE A;  3SK6 A;  3BYT B;  3Q0A A;  2LY7 A;  2PCF B;  4K5W A;  5LL6 X;  2RA4 A;  1BCP C;  3CKI B;  5IT9 L;  2F0W A;  4V0B A;  1T5X D;  3NUC A;  4KN4 C;  2JEB I;  1ESR A;  2F0J A;  2JEA I;  3SK5 A;  1SYG A;  2SNS A;  2IL8 A;  2AQ2 B;  3A8K E;  1DOK A;  5ELB A;  1H9R A;  4DA2 A;  4XT1 B;  4R9W A;  1I6H B;  3HOY B;  2IPK D;  2JA8 B;  1IKL A;  5HGT A;  2F0E A;  4K2L A;  2V4D A;  3HOX B;  2F4I A;  4KJN A;  3X3N A;  2J0T D;  1GHJ A;  1PRT D;  4BY7 B;  3K5M A;  3P1H A;  4IFD I;  1KDC A;  4PV1 C;  1BF4 A;  2JA5 B;  4DN4 M;  3PIP 3;  3RD4 A;  5KNC A;  3IAY A;  4OL7 A;  2HCI A;  2B2W A;  3L7Z C;  4NP5 A;  3Q23 A;  1ML0 D;  3JAM E;  3K58 A;  2A74 C;  2K01 A;  5C0X G;  4E6I A;  1SAP A;  5C0X J;  2DY7 A;  3J80 E;  3LWE A;  5CBE E;  2WKC A;  2PW5 A;  3I91 A;  1M4V A;  1B53 A;  4ULL A;  4KHV A;  1I4Q A;  3FKI B;  3BZD B;  3AU7 A;  3R3O A;  1Z7T A;  2XN9 C;  1II3 A;  1S4Z A;  4M8A A;  5DEH A;  4CJ0 B;  1AW7 A;  1JWS D;  1A15 A;  5FLX L;  2KCN A;  1DXM A;  3A7A B;  4HMI A;  3A56 A;  2NN6 H;  2B2V A;  2MJ8 A;  2IW3 A;  3I8Z A;  1FGB D;  2QDB A;  3VYR A;  4FNF A;  4HMJ A;  3HOV B;  1JOR A;  1SNQ A;  3HG9 A;  1KNE A;  4MHE A;  1ILP A;  3QO2 A;  4KKU A;  1S5D D;  1KDB A;  4I65 A;  3MZ5 A;  4C56 C;  2PO4 A;  2BA1 A;  1D5M C;  4K6L A;  4G4K A;  4WRD A;  5D3D A;  2SOB A;  2KOL A;  1LTG D;  3J81 L;  4CKC A;  5I9O A;  2FMC A;  5JJZ A;  4IFD G;  3FEW X;  3J7A F;  1W6J A;  2ENB A;  3TP6 A;  2NVX B;  4K6D A;  4HN7 A;  1HTL D;  2EZV A;  2I07 B;  5IT9 E;  3EFX D;  4KV6 A;  3ZYY X;  4TKO B;  1YNN C;  2G9H D;  5ISR A;  3BG3 A;  5G3L D;  1EZ6 A;  1H9S B;  1J9O A;  2D9U A;  1D6E C;  2DY8 A;  4BY1 B;  3TP7 A;  3H3V C;  1LTT D;  2E2I B;  1EEI D;  5IGG A;  2DNE A;  3VR2 A;  2F03 A;  2HUG A;  1XWE A;  4OGQ C;  3TN2 A;  1M8A A;  3M7G A;  2NN6 I;  3OMG A;  4KI0 A;  1QJO A;  1EWH A;  3NK9 A;  3T51 B;  4N9T A;  3CRL C;  2EYJ A;  3I73 A;  5CGK A;  4MIU A;  3D8G A;  2BA0 A;  1EQT A;  2K28 A;  3TZU A;  2Z4I A;  1H9M A;  4QMG A;  2EY6 A;  2FMM A;  1TKW B;  2EY2 A;  2F3W A;  1U4R A;  3W3A A;  1PXU A;  1HFN A;  1R4P B;  2QIL A;  1A6X A;  3D4R A;  4OHJ A;  1EFI D;  2KA7 A;  2WII B;  1TQO A;  2R6G A;  3DMU A;  3L3O C;  4IUQ A;  1LV9 A;  1ZEQ X;  5ELF A;  1HRJ A;  3URY A;  4IUV A;  4ILW A;  4KN7 C;  2XRQ D;  4ZKC B;  1LTI D;  1B1Z A;  3R2T A;  5A2Q L;  5J1Z A;  5M3M B;  5I4D A;  1STB A;  5TSS A;  4DXG A;  1Q1E A;  2L11 A;  1TS2 A;  4H13 C;  4OO1 H;  1T5E A;  1NR2 A;  5FLX E;  3K57 A;  2RDF A;  1G91 A;  4K8J A;  5C5L A;  1U4P A;  4DNT B;  2EYO A;  5KND A;  1BCP D;  1HTP A;  1F2L A;  2A6E D;  1K8M A;  3AMU A;  1ONL A;  3VR5 A;  2G9D A;  1SBB B;  1DD2 A;  2NN6 G;  1SJH D;  2EYF A;  1H9S A;  3PO2 B;  1SNC A;  3MA2 B;  2F0S A;  1H9K A;  5I9P A;  5I6Y A;  5IGD A;  3Q6S A;  1QNK A;  2CVR A;  3HGB A;  1ILQ A;  4RCO A;  5IOC A;  3EQL C;  2AUJ D;  3EJI A;  3G7L A;  2HCC A;  1BCP B;  4FXK C;  4R8I A;  3SDZ A;  1G8Z D;  2PQE A;  1I4P A;  3L9A X;  2KEE A;  1DYQ A;  1WVL A;  2EPB A;  1CFM A;  3ND8 A;  1OXX K;  2IX1 A;  1STA A;  1SNO A;  2F0D A;  3DUZ A;  1PLF A;  4LK1 C;  1RTO A;  1R9T B;  3DXJ C;  1EL0 A;  4HR7 B;  5BN3 A;  1F9Q A;  1TS5 A;  1ET9 A;  1WTP A;  4RKL A;  3PV0 A;  4A3K B;  3MHB A;  3A7L A;  2Q8I B;  2K32 A;  3WDN A;  1HUN A;  1FNU A;  3KBG A;  1OO9 B;  3O13 A;  5C4J B;  1QB5 D;  3PUW A;  3QJY A;  3OIQ A;  2PMZ B;  4A3M B;  1PFB A;  1QNU A;  4ZK9 B;  3M85 A;  4C3H B;  5C44 B;  2Y0S B;  1F9S A;  4P2C B;  1PDQ A;  3OW7 A;  5T1I A;  1SMY C;  3K0Y A;  2RBM A;  5JEA H;  1GHK A;  1G2T A;  4L6T B;  1WTQ A;  1DOM A;  3ITP A;  3RLF A;  4WFN 3;  1BQQ T;  1HCZ A;  2RDG A;  3HZX A;  3TP5 A;  3NTK A;  4LAA A;  3DWA A;  2D5D A;  2DN8 A;  4JBW A;  4RCN A;  2J7Z A;  2PYK A;  5FKA C;  5KGU A;  1SE4 A;  1V8Q A;  4NW2 A;  4F88 A;  2R61 A;  1V1P B;  3GTG B;  5D14 A;  4RHR A;  2WIN B;  1IYV A;  1EU3 A;  1ZYR C;  3BVZ A;  2NVT B;  4C3J G;  2WV6 D;  1CT1 D;  2Z8L A;  4WJW A;  2JE6 I;  4C3J B;  4RA8 A;  4BWG B;  3VR3 A;  1IW7 D;  3PUV A;  3MC0 B;  1CQV A;  2WP8 J;  1TS3 A;  1YNN D;  1BNZ A;  3GTO B;  1I4R A;  3V05 A;  1CA5 A;  5NUC A;  4KY6 A;  3E0J A;  2PZU A;  2MHV A;  4DAY A;  3H6M A;  1CZG A;  3I70 A;  3WOF A;  5C4H A;  1XX8 A;  1CZW A;  1GUN A;  1PFN A;  4KTA A;  3Q24 A;  1QCB D;  1SYD A;  2N88 A;  1UAP A;  1AEX A;  3S1M B;  4F8M A;  3K5L A;  2L12 A;  4IUN A;  1GUW A;  4NMZ A;  1PZJ D;  1KLG D;  2MP1 A;  2LS0 1;  4RGT A;  1ICW A;  2B8G A;  2LKV A;  1TU2 B;  1Z6H A;  1C8C A;  4WOR A;  4Q5V A;  3MVV A;  4IUR A;  3BDL A;  2M9V A;  1SYB A;  3RMH A;  1WTV A;  2JYO A;  4H7B A;  2F1M A;  1ENC A;  1JOK A;  2QF7 A;  3KLS X;  4JK1 C;  2XNA C;  2EOT A;  1QOH A;  1SNP A;  2A5H A;  2X6L A;  3SXH A;  3T13 A;  1NUC A;  4DFA A;  3OOC A;  5HUR A;  1Y69 U;  4KHZ A;  1YNJ C;  3J7Y W;  1TVX A;  4BA2 I;  2B2U C;  4HSV A;  4RWS C;  4XQN A;  3DEO A;  1BO0 A;  5KIX A;  2L1B A;  4NKL A;  1Y8P B;  4KK7 A;  5JOB A;  1V1P A;  1HXY D;  3I72 A;  5C3E B;  2SNM A;  2IX0 A;  3S2D B;  1STY A;  3ERQ A;  5M3F B;  5EQ0 A;  1K8O A;  2TSS A;  1FD7 D;  2HQE A;  2OEO A;  4G7Z C;  1LTA D;  3P7J A;  3P75 A;  3N6R A;  1D2B A;  4GZY C;  4KKT A;  3E5S A;  1QIL A;  3VA5 A;  2NTS A;  5EBC A;  3GP7 A;  2EY1 A;  2K5D A;  4PMB A;  2C5C A;  1O80 A;  3D6W A;  4G7H C;  1F9P A;  1DM0 B;  5JEA G;  5JEA J;  2A69 C;  5KNB A;  1HHV A;  3DWQ A;  1PFM A;  5DNF A;  1A2U A;  1GUO A;  4HCS A;  1BUV T;  2B2Y A;  1BR9 A;  1AN8 A;  3FMC A;  4TRD A;  2XSC A;  4KJO A;  5FOB B;  1ET6 A;  3GTM B;  2NVY B;  4M1U B;  1DJR D;  3SR1 A;  1V1O A;  4FF2 A;  1EYA A;  1B4O A;  2R92 B;  1RF2 D;  3KF8 A;  3H91 A;  1SEB D;  1EY8 A;  2PPB C;  2HDM A;  3OHX C;  3A54 A;  2NZ1 D;  2E75 C;  3DM1 A;  3SVM A;  1L0Y B;  2K6A A;  5JAV A;  2EJF C;  2EDG A;  3HOW B;  3S14 B;  4J6H A;  3NBH A;  1CM9 A;  4IQZ A;  1OXS C;  3S16 B;  3FPU B;  5KEE A;  2IJ0 A;  1B3A A;  3QOL A;  3QOJ A;  4A93 B;  1F2Z A;  5AFW A;  2B2Y C;  1J8I A;  3A8I E;  1I6V C;  3LNN A;  4TSS A;  3S9W A;  5E3F A;  4XIG S;  4EVO A;  5KYL A;  1A3V A;  5EJW A;  4O1N A;  1AZQ A;  1JOO A;  3I4M B;  5KRU A;  1LT6 D;  5CMD A;  5IGE A;  1F77 A;  1NSN S;  1XTC D;  1DCZ A;  4IUU A;  5BN5 A;  1SMY D;  1EQV A;  2KUM A;  2O4X A;  2K1B A;  5CV7 A;  4XQJ A;  3VA7 A;  1U4M A;  5EKI A;  2L55 A;  3HP3 A;  1CQF A;  1WD0 A;  3K7A B;  1FNV A;  2NYZ D;  3V2T A;  5JVG 3;  1PTO H;  1LT5 D;  4FYD A;  3GTK B;  2ZXO A;  2RSO A;  4BA1 I;  1R4Q B;  1U9R A;  4S3S A;  3M3Y B;  4DAV A;  5EPL A;  5DM7 3;  1VCI A;  3NTH A;  2A68 C;  4K8I A;  4YIJ A;  3E6Z X;  4X3S A;  3EA6 A;  4K14 A;  5JPM C;  2GA4 B;  3S17 B;  4K5V A;  3NHH A;  2F0V A;  1DON A;  4BS9 A;  2BOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...