4XEHA

Apo structure of kari from ignisphaera aggregans
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
327
structure length
326
Chain Sequence
AKIYKDEDISLEPIKNKTIAILGYGSQGRAWALNLRDSGLNVVVGLERQGDSWRRAIDDGFKPMYTKDAVAIADIIVFLVPDMVQKSLWLNSVKDFMKKGADLVFAHGFNIHFKIIEPPKDSDVYMIAPKSPGPIVRRSYEMGGGVPALVAVYQNVSGEALQKALAIAKGIGCARAGVIESTFKEETETDLFGEQVILVGGIMELIKASFETLVEEGYQPEVAYFETVNELKLIVDLIYEKGLTGMLRAVSDTAKYGGITVGKFIIDKSVRDKMKIVLERIRSGEFAREWIKEYERGMPTVFKELSELEGSTIETVGRKLREMMFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cofactor specificity motifs and the induced fit mechanism in class I ketol-acid reductoisomerases.
pubmed doi rcsb
source organism Ignisphaera aggregans
molecule tags Oxidoreductase
molecule keywords Ketol-acid reductoisomerase
total genus 127
structure length 326
sequence length 327
ec nomenclature ec 1.1.1.383: Ketol-acid reductoisomerase (NAD(P)(+)).
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain
A PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.40 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like fold 4xehA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xehA01
4ZQGA 4PLZA 3QVOA 1K6IA 1Z6ZA 1WDKA 4IMPA 2I3GA 4BO8A 4RF4A 1K5HA 4CM4B 4II2A 1N5DA 3H5RA 5I9LA 1NVTA 1A4IA 4DQUA 3PHHA 3W4IA 3PHIA 5TJHA 3FTPA 3OECA 3KETA 1LEHA 4ALJA 2PWZA 4G81A 4A2CA 3AUTA 1PL7A 4HKTA 1Y1PA 3CMCO 4JK3A 2JD2A 2CF6A 1KY4A 4GWKA 3JQ9A 3JYNA 2Y1GA 1V8BA 1VKNA 3H6KA 1U4SA 1PJCA 4NNJA 3CPSA 2JCVA 1H9BA 1TEHA 4NHEA 5U1PA 3AI1A 2D4AA 2O4UX 1VC2A 4F6LA 4URFA 3TJRA 1E92A 2HMTA 1R4MB 1M6HA 3L77A 3NJ8A 3RIHA 4FN4A 4L73A 5AYVA 3FR7A 4GKVA 4YTEA 4AG3A 5K6AC 3GHYA 1IUKA 5JO0A 1U3WA 2ILTA 2JD0A 4ZRNA 2C59A 4BNJA 1GCOA 2YZ7A 3F6YA 2AQ8A 4PLTA 2F1KA 5C7OO 1YS4A 4CL8A 3KYDB 1P45A 3QJ5A 4FFNA 4IM7A 3P2OA 1A72A 3D5QA 2GUGA 3IJPA 4IS2A 2FSVA 2QRLA 1NVGA 1AE1A 4ZHSA 1XEAA 4Z9YA 3VDQA 3M6IA 5CG1A 3KXDA 1YJQA 1KS9A 1HETA 5H82A 4TZTA 3PXXA 2O4CA 4CL3A 3A06A 1QORA 4EITA 3DFUA 1T24A 2VNAA 3DXFA 1LJ8A 1YRLA 2DQ4A 5U4QA 3AFNA 1SC6A 5TQVA 4MKRA 4RQUA 5IF3A 2X9VA 3BTVA 2EKPA 3VZPA 3M1LA 4RDIA 5KJ6A 5JAZA 2ZB4A 1E7MA 1VE9A 3RASA 1GV1A 4M54A 3DBLB 4WCDA 3UKOA 2FY8A 3DBLA 3LLVA 1ISGA 1ADCA 2GZ3A 4FCCA 3ROMA 3DL2A 2YDXA 4HFMA 3U49A 3INRA 1U3TA 1KBZA 1ZK4A 2Q2VA 2XF8A 3DR3A 2PFGA 4B79A 4BMNA 3B1KA 1ISMA 2WE8A 1BVRA 1LDNA 4CUJA 2QIOA 1EBFA 3FPLA 4DQXA 3AY3A 2GN6A 5L45A 3E9NA 1VJ0A 1PSDA 3D1LA 1MFPA 4LSMA 1NHWA 2C5AA 4YYZA 1PQWA 1PQUA 2DLDA 4MVJG 1OZAA 4J6FA 1YB5A 2BRUA 1HSOA 5K6AA 1HF3A 3RKRA 3S2EA 4RF2A 5COAA 1S6YA 1EK5A 4FFMA 3LK7A 4YRDA 3RJ9A 5C7LO 3RC1A 1P74A 4OOEA 5JXWA 4PG6A 4YAEA 1F8FA 4LK3A 4R9RA 4J49A 4Y6RA 1U2DA 1DFIA 4Y98A 4TRMA 5A3JA 5JNLA 1I5RA 5EPOA 5EQDA 4MVJA 3ZHXA 3K9QO 5ILGA 2I67A 1R0KA 3BYZA 1R4MA 1DO8A 1ONOA 3RVDA 4PN3A 2POQX 1Z73A 4M86A 4YB8A 3FNHA 4CMJA 2VNSA 3CXRA 3COSA 5C7IO 5IZ4A 1IYZA 3PYLA 2PKQO 2CNBA 3NT2A 2EW2A 1JKJA 4LRSB 1FDUA 2X9NA 4CLRA 3FNEA 1PIWA 4CMEA 5FFFA 4D42A 5IN4A 3KZVA 1PGNA 4BNTA 1AXEA 2JJYA 3QHAA 4U6QA 3HN7A 3Q9UA 4WNIA 5F5LA 5CP8A 4JN6B 1VSVA 3CKYA 1L7EA 4PLCA 2VRCA 3AWDA 4U8GA 4WJZA 3WXBA 1LLQA 2VN8A 5ENDA 3OIFA 3PYXA 3QLJA 4GLOA 4J1SA 4W9NC 1SZJG 3LU1A 4XYGA 3WSVA 1NR7A 2B83A 4RCVA 4A10A 1YGYA 1UP7A 2X86A 4J4HA 3ZWPA 1Y8RA 1P31A 3DBVO 1ONNA 2DM6A 1HLPA 3JQDA 3F46A 1E6WA 1PTJA 3ZGYA 1BXZA 5G4KA 1IZ0A 1I32A 3EYWA 3OJOA 3U9LA 1A4UA 4WPGA 1UDBA 4BGUA 5IG2A 4HFNA 5T6BA 1KEVA 1XQ6A 4FC7A 3VPXA 3PRJA 3Q6IA 3Q11A 3GF4A 5GZ6A 2QRJA 4CLEA 2I6TA 2H63A 3WB9A 4BNZA 4FJ1A 1EK6A 3C1TA 2OP0A 1BRMA 3DOCA 3JYOA 3FNFA 2NSDA 3HSKA 4E0BA 1T2FA 3NTRA 4XB1A 4PLPA 2PTGA 2Y67A 4I08A 3L9WA 4I5GA 4OSOA 3GNTA 2W2KA 4IPTA 3KYBA 1P1IA 4PG7A 3QWIA 4N18A 4GVLA 1D3AA 2EW8A 1HZZA 2C07A 1ZSNA 5JC8A 3UICA 1NAIA 2JL1A 1UZNA 4ND4A 1NXQA 3H5NA 3VPHA 1I10A 3MOIA 2NVWA 4ITUA 5HA5A 3EC7A 3T7EA 5KJFA 1L7DA 2EP7A 2R00A 5ICSA 3U62A 4PVCA 4XCVA 3C7AA 4KTTE 4PZDA 4JBGA 5DULA 4CQLB 1O8CA 1F8GA 1GYPA 1YDEA 2O23A 3EK2A 4XJTA 1ONPA 3NV9A 4CMIA 2P9EA 1E1LA 4J7XA 1NNUA 3E03A 3R3SA 3WBBA 3GRPA 4EW6A 4XJSA 1TVEA 1FDVA 4KUGA 4IXWA 3F3SA 4W6ZA 3PDUA 3U0BA 2DPGA 3EZYA 3CSDA 4TKLA 5BNTA 3ZNNA 4EJMA 4Q3AA 3INGA 3WWZA 4UREA 3S2FA 5KVVA 4CM8A 1ZSYA 4DTIA 4WE3A 1HWYA 3KOUA 4K26A 1V35A 1YL7A 3BAZA 1YXMA 3RBVA 3WIDA 1DAPA 3JQ8B 4YT4A 4KQXA 5B4VA 2NLOA 2PZMA 1R12A 4R41A 1ORRA 3DO5A 4J0FA 3HNPA 2V65A 4J9UE 4P8RA 1WWKA 1FK8A 3ZNOA 1YJ8A 3S2GA 3H5AA 4EJ0A 2PY6A 2O48X 3ZU5A 4AL4A 1DB3A 4MVJH 4EI2A 4YJGB 2IXBA 1JAXA 3QVSA 1VLLA 4GWGA 4RZIA 3ZWOA 1NWHA 2D0IA 1EE9A 2GRAA 4JJIA 3DMTC 3RUCA 1EFLA 4B4UA 3DDNA 1AUPA 4R68A 3GPIA 2YUTA 4QFDA 4U7WA 3ITKA 4FQ8A 3W8DA 3QRWA 4UULA 3HFSA 5FEUA 3KM0A 2PH5A 3PTZA 2UV8A 2DVMA 2QG4A 4GX0A 1NM5A 3A28A 1JKFA 5FWNA 1IHYA 4XWYA 4ZQEA 5ITVA 2DU8A 4OMUA 3K2EA 1HDRA 2XOXA 3DQPA 1BXGA 4RVDA 4N5LA 4E3ZA 3GQVA 3WR5A 3LLSA 4IGFA 5IZCC 3VDRA 1F14A 2I9PA 4WOKA 1A9YA 1XGKA 4PZCA 3R0IA 1HDGO 5CG2A 1PWZA 4OIMA 4WEQA 5JCJD 4F6CA 1QYWA 1ZXLA 4ZJUA 3I9OA 4R01A 1I3NA 4QQRA 4GAEA 4J4TA 4LMRA 3LQFA 3WTCA 2WEKA 4MINA 3OJFA 5L4NA 3TZ6A 3CTMA 5BNFA 5KOIA 4KQWA 1NBOA 3MZ0A 4FW8A 1LDEA 3U4CA 1BHSA 2CUKA 4XGKA 1F0YA 3ZZNA 4IIUA 4I1IA 5TS3A 2B69A 4E5YA 4EJ6A 5MDHA 4IJVA 4CLHA 4CMGA 2O3QA 3P19A 5CDSA 3KSUA 4AJEA 4MP8A 1QSGA 1IOLA 1C0LA 3O4RA 5GMOA 4FFPA 4GGOA 4WLFA 2CDBA 2XXJA 3INTA 4CQMD 4HUJA 2WWRA 4DC0A 3DMTA 3PIDA 4ND5A 1E5QA 3S55A 2W4QA 1HYEA 4W9NA 4LRTB 2NQTA 3JYPA 4L9RA 1HDOA 1QYCA 1I2BA 4M89A 5A02A 1V0JA 2PA3A 3E5MA 1EDZA 4WK6A 4RL6A 4ZU3A 3F5QA 4CJXA 2J5RA 1AN9A 3EDMA 1NFFA 4RO0A 2E6UX 3D4OA 1ID1A 1NVMB 5BSEA 5A1TA 4I9UA 4YAKA 1I3MA 1NFQA 4YACA 1YQXA 5A04A 3R3JA 3PJDA 3JCZA 4PRLA 3ZWAA 1PL6A 1R4NB 4BKRA 2YHIB 1ZO8A 1JW9B 1W8DA 1H6CA 2FR1A 4OKIA 1DRVA 4K9DA 4DIBA 1U5CA 6LDHA 5HWSA 4DIOA 2Q46A 2X0RA 4XYMA 4E21A 1ZEMA 5DCWA 4J7UA 4R9SA 3DZFA 2P68A 3BHIA 2FPIA 4YT5A 3LC7O 5IDYA 1CJCA 3QVWA 4R4JA 4YWJA 1H0KA 3ZHZA 1JN0A 1HXHA 4CM9A 2EJWA 4OM8A 2YJZA 3FBTA 4K1LA 5JYEA 2P9CA 3UVEA 3KLMX 5AVOA 3JQAD 4GI2A 5TNXA 2Y99A 5A5EA 3SX2A 1MG0A 2Q3EA 3HG7A 3W1VA 5ER9A 2AQIA 2JCXA 3E9MA 4PLVA 1Y8QA 1LSJA 3AM5A 5DN9A 1ZCJA 1I0ZA 4BS9A 2O50A 4IJWA 3FWZA 3GRKA 5AXAA 3U4DA 1R15A 5DP1A 5IDXA 4FGWA 1R4NA 4R54A 1GV0A 3KTDA 1QYVA 2F00A 3JQGA 4DA9A 2GO1A 3CZRA 4L4RA 4NIMA 3TRIA 3BMCB 4ILKA 3BMOB 3WFJA 2Q4BA 1WMAA 2X7HA 3JQCA 3I4FA 1UP6A 2FZEA 1OFGA 3N74A 5KTKA 4OKNA 1N9GB 3MTJA 3ON5A 4IZHA 4A7PA 2ZJ1A 1EQ2A 3HN2A 1JA9A 1C3VA 3GDFA 1S7CA 3TFQA 4AJLA 3ZDFA 3PIIA 1HDXA 3H7AA 3GFGA 3DAGA 3ONEA 2XPCA 2AEFA 1Z7BA 5TT1A 3C8MA 1GR0A 2J5KA 1QRRA 3G3EA 4YJFB 3IP3A 2G17A 1SB8A 5A9TA 4B3JA 4CMKA 1O95A 3QY9A 4J16A 1ZSVA 1ZNQO 5L3ZA 3ICPA 1BDBA 1GTMA 3DBHA 1NAHA 4LMPA 1LUAA 1WXDA 1JQBA 4J3FA 2ZK7A 1ZMTA 4ZVVA 1MXHA 4LVCA 4BGVA 4OAQA 3JQAA 3ZU4A 2OOSA 1FMCA 1DOHA 1UXIA 3DONA 5FF9A 5JS6A 5C37A 1QV7A 3FRJA 3RC2A 2I65A 1EQUA 3OQ1A 1NR1A 3D64A 3JD1A 3SBOA 1GZ6A 1UDCA 4F45A 4N54A 1UZLA 4CUKA 1IPEA 3OA0A 3ORFA 4BGIA 2O3RA 1ZIDA 1T2CA 3ROKA 2VHXA 4TSKA 1G0NA 3WGOA 4BMVA 1V3VA 3TPCA 3UGKA 1K0UA 2NTJA 4JBIA 1GZ3A 1A71A 1M6WA 2Q50A 2VWQA 2YV3A 3FCOA 2X4GA 1C0PA 3FF4A 4E2ZA 1TXGA 2QYTA 1MX3A 4TRJA 2JAPA 4QSMA 1DIAA 3WIEA 2BGKA 4PLFA 5JCXA 2YHIA 4U5QA 1TT5A 3EUWA 1JLLA 5DBFA 4IIVA 3EZLA 1DC6A 5ES3A 4BNLA 5DCYA 1KVSA 3QV1A 3GLQA 1YO6A 3V2UA 2WJPA 1UXGA 5ITWA 1LSOA 2WYVA 3BHJA 3D4NA 1I01A 2EGHA 2B5VA 3DAPA 1H6AA 4JQCA 3VPGA 3WTBA 4BKPA 4BO4A 4FJ0A 3IMFA 1ZZEA 1P0CA 3GN2A 3DOOA 4YXFA 3SVTA 1HE5A 5JDIC 4IUYA 1X1TA 1LDMA 2X8LA 3KHUA 1G1AA 5IN5A 2NU8A 3ZHBA 3RSHA 1UAGA 4NDNE 1GUFA 3FR8A 2FR0A 3BMQA 3JQBC 4IQ0A 1PJTA 3K73O 4YQYA 2BLLA 4DMMA 1H5QA 2VWHA 4BO5A 3H8VA 3L9XA 2BH9A 3QA9A 1I3LA 4AJKA 1YOVA 3QP9A 4OSPA 2X0NA 1ISIA 1E3WA 1T4DA 2Q1SA 4J0EA 4OXNA 2A94A 2DC1A 2Y0DA 4PG5A 3CH6A 1U4OA 5CHEA 1TT7A 1PEDA 1MLDA 4UUNA 2ZYAA 3Q2KA 4X54A 1UXKA 4ZD6A 1RM4A 4KDEA 3D3WB 3ZWCA 3GZNA 4RQTA 5A9RA 5LDGA 1WP4A 1E3SA 2NVBA 5THKA 1UAYA 3V2HA 5EN4A 2J3IA 3OICA 1ZH8A 4B4OA 3ICCA 3ZW9A 5G0VA 4CLOA 1J4AA 3GUYA 2EHDA 1I36A 1Z75A 4HFRA 4R1NA 2WTBA 3M1AA 4MVJM 4FIZA 4JXKA 1GFSA 3RUIA 3Q1LA 1O6ZA 2CSUA 2DAPA 4XYEA 5EL0A 2VWPA 2IDZA 3WLFA 2I66A 2OGUA 3D3WA 4UUMA 3PYMA 1BW9B 4JJGA 2HK9A 3GDGA 4N5MA 5TF4A 3C7DB 2PGDA 2Q49A 2GN4A 2CDCA 2WYWA 1LLDA 4HV4A 2EWMA 1XSEA 3V1TC 2JFHA 1E3WB 2FN7A 2AW5A 1LRKA 3DZHA 4O1MA 4TWRA 5JY1A 3BA1A 3H4VA 3NDRA 3TF5A 2O7SA 3FI9A 1KIFA 3JV7A 4OOFA 1ZXBA 2FMUA 1MXFA 2D5CA 5JLAA 5J23A 5H81A 5TJ9A 3LT0A 1DC5A 1VKOA 1XIVA 4J4BA 5DDIP 3BTOA 1VJ1A 1QXSA 3HFGA 3PWKA 2IZ0A 5JDCA 3AOEC 2VYVD 2BELA 1SB9A 1RJWA 3GY0A 2Q1UA 3L4BA 1C14A 5AQ1A 3DC2A 1H94A 3OBBA 2PV7A 1E7RA 2FZWA 2GN8A 4MVJI 4TRRA 1NPYA 1C1DB 2H9IA 3DZKA 4QTZA 4I9HA 4BMSA 5KCZA 1PS9A 4PG4A 2E48A 3U5TA 4HXYA 4WUVA 4ROSA 3OQBA 4RDHA 3I9KA 4DWVA 4CR6A 4JBHA 5DOZA 4FGSA 3TQHA 3GDOA 4JIGA 1OAAA 4DL9A 2A92A 4AFNA 4GMFA 1ZEJA 4DVJA 4FD3A 2TMGA 1YL5A 1P1FA 4IDGA 4JLWA 3EVTA 1PJ3A 4KZPA 3B6ZA 4A73A 4NH4A 2X0IA 4XIYA 1NPTO 2QZ9A 2X9GA 4ZQFA 1X0VA 4MKZA 3I9JA 1DFHA 3IQDB 2RBEA 5A4DA 4AJJA 1F17A 3OSUA 4WGGA 1N1GA 2PZKA 2A9FA 2BFOA 1EMDA 1LNQA 1WVGA 3OHSX 1CETA 1YVEI 2IEBA 1PJBA 3Q3CA 2CMDA 3IL2A 2I3AA 1QYDA 2WDZA 4CQMA 2JKVA 1GEGA 2YHUA 1TB4A 1Q1NA 4W7IA 5IDWA 4XGIA 3G0OA 2DBQA 4XDZA 5L7WA 3W8FA 4D3DA 1Y6JA 3OEYA 5COBA 2GASA 5FI3A 2C5EA 3ONDA 4CMIB 4JCOA 4DUPA 4IZIA 2RAFA 5F21A 5COQA 4E32A 2ZTLA 3RD5A 3DBRB 3DZGA 3GPDG 2WD8A 1DC4A 3BMCA 1B8PA 4RVSA 2AQKA 5KJEA 4BO3A 4YR9A 2CVZA 1SOWA 5HM8A 1P77A 2AQHA 4WLVA 4NBVA 1T1SA 5BSGA 1RM5A 5CEFA 5A06A 1H93A 4FOSA 1DSSG 3GFBA 9LDTA 2JD1A 4M55A 4XRRA 3RFTA 4Z3KA 1J0XO 2J3HA 2EKLA 3RCBA 3WG9A 5B1YA 3QE3A 1E7QA 2VWGA 2SCUA 5G0TA 4LSWA 4BB6A 5JC1A 1DHTA 2V6FA 4RVHA 4NI5A 3GVCA 4R69A 1X0XA 4D79A 3I5MA 4B7UA 2J5QA 2EG9A 3RUFA 1BSVA 1ZKMA 2GZ2A 1GAEO 2Y1DA 1UJMA 2PKQP 3JQ7A 4KUHA 4UUOA 4XKJA 4GKBA 1FJHA 1U7TA 2I99A 4IQGA 1Z45A 1DIRA 3QWFA 1N1EA 3GH3A 4YCAA 4AJ2A 2NTVA 4IMRA 5BSHA 1LBEA 4RVFA 2C20A 4I9NA 4HNGA 5A9SA 1VM6A 3LT2A 3ONFA 4CM4A 3H2ZA 1EUZA 1BXKA 3JQBA 3PWZA 4NG5A 5JDCC 3K2BA 2FP4A 1SPXA 4P4LA 2AXQA 3AOEA 1HRDA 1RPNA 4JNKA 5IFLA 1VJTA 1X15A 2B0JA 4GSKA 3C1OA 4TVOA 1O9BA 1VSUA 2GGSA 3JQ6A 1GY8A 1LLCA 4CODB 1F12A 3E82A 5JMPA 4Y6SA 5CDUA 4FS3A 1R66A 4JP2A 2I5PO 4HADA 4FR5A 3CUKA 4JX8A 4LVUA 4CQMB 1YBAA 2OL4A 4ALMA 1CWUA 2QRKA 1NWCA 4FFOA 5FYDA 3DHYA 1SNYA 2BI7A 2HQ1A 3I1JA 3AUSA 4OXYA 5JCJA 4BV8A 3SJ7A 4RVUA 1E1NA 4Y6PA 3JSAA 4BQPA 4BNFA 3DMYA 3RUDA 5TLSA 4U0JA 3BHMA 3FNGA 3PQDA 1DC3A 1K89A 3EVNA 3X2EA 5JDIA 4GH5A 2B4TO 5B37A 4L0QA 5CFZA 2GCGA 2PZLA 3PLRA 4MKXA 1H9AA 3MJEA 3PDJA 4BO2A 1PGOA 4Y9DA 3WJ7A 1T2EA 4R5MA 3H2SA 3O38A 3N58A 3ROQA 3ZWXA 1ML3A 4MJLA 3KRTA 4RF5A 4AICA 4WLNA 4BUCA 2ZYDA 1I30A 4E5MA 4D0SA 2P2SA 2VYND 4OQYA 4WOJA 3WBFA 2EF1A 3C3XA 3NX4A 4P38A 2D1YA 3V2GA 1D1TA 4XQGA 2DUWA 4XDYA 2HRBA 3IKVA 1E3IA 2RHCA 2WSBA 2W2LA 1EUDA 3TDKA 1LDYA 3ZU2A 1LLUA 4BIIA 4DIFA 2C82A 2G5CA 1DRUA 1EVIA 1IE3A 1VL0A 4R51A 5I7SA 2OBNA 2FRDA 4YAIA 2HMVA 3AOGA 1KVRA 5T5QA 4QO7A 1B16A 3L4SO 1X14A 2Z1MA 3WGYA 4XQ9A 2UAGA 1WNTA 1B8VA 1QR6A 3E9QA 1JVBA 4PCVA 4RGBA 3RUAA 2HRZA 4P4NA 5EIOA 2VTEA 4G5HA 2CZCA 2JCYA 1HLDA 1QMGA 3ULKA 5THQA 3HDYA 4NBTA 3IDSA 1EVZA 2YQ4A 4NK5A 4YJHA 1E0DA 4YJGA 3QWHA 3OA2A 3RBZA 4J7CA 1P1RA 3GR6A 1J49A 1LA2A 3WGQA 3NRCA 3RBXA 5JW6A 1Z7EA 1X7DA 4GPD1 3GVHA 4YDRA 1EE2A 1N7GA 3GN1A 3ZHYA 4Z6KA 1GYQA 3M2PA 3DZJA 4B8WA 5GZ3A 3O03A 2QZZA 1ZBQA 2Y0CA 3VZRA 1A7AA 4NBRA 4CMCA 2Q99A 2VUTA 2VT2A 2WM3A 2FHSA 1WMBA 4A26A 4BKUA 1VL8A 3KEOA 1F06A 3S1LA 3OJ0A 2QQ5A 3H3FA 5HTOA 1XU7A 4TKMA 4UUPA 2XXBA 4OGWA 2V7PA 3MJTA 5BSFA 2PD4A 4Y8VA 1FDSA 1GCUA 3ETEA 1YKFA 2G1UA 4KWIA 2P5YA 4MVJE 2EJVA 3WFIA 3ZV6A 4H16A 1GU7A 4CM6A 1XCBA 1GUYA 3CIFA 4KWHA 3PQFA 4AJHA 3F4BA 3NEPX 1H6DA 3C24A 1YB1A 4M49A 4O5OA 5DCUA 2C7GA 2WD7B 3JQ7B 1HYHA 1HE3A 4EEZA 1OC2A 1ZMOA 1ZVMA 4D46A 1JU9A 2RH8A 1HDCA 4Q3BA 3CMMA 1CF2O 3RC9A 3HHPA 4E31A 3RJ5A 2CD9A 2XAAA 3U3XA 4B4WA 4UAGA 5K9ZA 2GLXA 3PLNA 4CV0A 4DC1A 2ZCUA 3VTFA 1ZUD1 3UCXA 3AFMA 3SC6A 4ZQHA 1ENOA 5KWEA 1P9LA 4HX5A 1CERA 3ZWYA 3WSWA 3V1YA 1YQDA 3D3EA 2HLPA 3RROA 1WW8A 2Y1EA 3D7LA 3K31A 4QXMA 2RIRA 3WGZA 1Q7GA 4QEDA 1WZEA 5DF1A 1LDBA 2FPPA 2AHRA 4TROA 3D4PA 4E5NA 4MVJF 3QSGA 3L6OO 2CVOA 2V6MA 1YB4A 3ADOA 3MJCA 1DIGA 3GZ4A 3BXXA 2DTEA 5G0WA 3LC2O 3S2IA 1V6AA 3A4VA 4KP7A 2YW9A 3G17A 5JBIA 1JTVA 4J43A 4C4OA 4FBGA 4NPCA 4BNIA 2Y1OA 4AJ1A 1WDMA 1K6XA 5H83A 1G0OA 3WLEA 3JD0A 2J3KA 1PS0A 1SCUA 1YH3A 3B1FA 3T7CA 1SAYA 1LX6A 3HUDA 1RWBA 3KSZO 3VH4A 3K92A 3EHEA 4YA6A 4DLAA 4OL9A 1MC5A 4ZA2A 4E13A 2VUSA 4NBWA 1AGNA 4RJTA 3WWYA 3UAGA 2NACA 2EERA 3SXPA 3T4XA 2VZ8A 4XIJA 4CM9D 4GQAA 5G0UA 3ZH2A 3L07A 2BMAA 2HCTA 3OJLA 3CZMA 1KVQA 1LQUA 3OIGA 3IAHA 4YEDA 1UR5A 3GGGA 4IINA 1HEUA 5F5NA 3KLPX 4HWKA 2ZB8A 2IRWA 1KEPA 2PD3A 4P22A 4IBOA 4R3NA 1HYGA 3PQEA 3GK3A 4WLOA 2DBVO 1B14A 4BO7A 5C5IA 1N8KA 3G1UA 3FHLA 3H3JA 3I4CA 2AE1A 1GD1O 2UUOA 4CM7A 3TN7A 5CDTA 5DBGA 3AI3A 2VHZA 5T64A 4MVJP 1Y7TA 4NBUA 1NTOA 4E5PA 1E5LA 5AXDA 1YBVA 4S1VA 1YL6A 1DIHA 4IGEA 3ZCXA 4TMFA 3IUPA 1C0IA 4Z3DA 3KEQA 4RPKA 2NV6A 4JROA 2RHRA 5T57A 1PZEA 4Q3EA 5KJ1A 3IS3A 2Q2QA 3WGTA 3TFOA 1DIBA 3HQ4O 2D59A 2EEZA 5DP2A 4F3YA 5JAMA 2D3TA 2HK7A 1HDYA 5IAAA 3W4KA 4B4VA 1UH5A 2G0TA 3NT5A 5L4SA 5T8KA 4YJHB 1LI4A 1QP8A 3ZW8A 1KOLA 1B3BA 2VRBA 1ENZA 1DRWA 2E49A 4JP3A 3VZQA 2VHWA 3NT4A 4TQGA 2ZTMA 4NJMB 5TRTA 5HRUA 3R1IA 5B4UA 3KYCA 3FTNA 3KB6A 4BB5A 3U4HA 1J5PA 4N7RA 4TZKA 2O7QA 1PX0A 1P0FA 3RUEA 3IKTA 2Z1NA 3I9LA 1DJNA 2JHFA 3NAQA 1Z74A 3F47A 1LDGA 1YOVB 4IJUA 3TWOA 5GZ1A 2CY0A 2VOJA 4ALLA 2LDBA 3P2YA 2NU9A 4DBZA 2GR9A 3ZWNA 2D5AA 1E77A 5JMWA 3ETDA 4CMAA 2VT3A 4ZGWA 1TT5B 5C3MA 3GGOA 1NFRA 3FWNA 4LGVA 3Q2IA 1ENYA 3TL2A 3OEWA 2FPGA 3JQFC 5ADHA 3H65A 1YE3A 3OQ6A 3K6JA 2DPHA 1IHXA 5HBRA 4OJNA 1M67A 4BNUA 1H2BA 2CVQA 2V6BA 3EW7A 3I52A 4CPDA 3STHA 5JSFA 4CMHA 2FSSA 3LT4A 1HE2A 1PJSA 4TRNA 5BQFA 3WNVA 2PR2A 4J9VA 3RFXA 4ID9A 3IJRA 4UVDA 2TMDA 2AEJA 3ANNA 2ET6A 1KETA 4MOWA 3HDHA 5B12A 2DKNA 4NFHA 1LSUA 5T8KC 4FJ2A 3BIOA 4GSLA 4DBVO 3GNQA 5DOVA 1M66A 4WCFB 2EXXA 3P7MA 2YV2A 1XLTA 4XQEA 1AXGA 2H6EA 3GT0A 3LSYA 3HB4X 3FD8A 3O9ZA 4B8ZA 4MDHA 3EAGA 3FPCA 3RWBA 4QO8A 1NQTA 2VRCD 3AY6A 3NTQA 3V1UA 1BW9A 4XX0A 4FPXA 4YJFA 4Z0PA 3WYBA 4FB5A 3DTTA 4Q9NA 2HDHA 1X13A 1HSZA 1PZGA 2IYPA 4WLUA 3SLGA 3AM4A 4KUEA 2BD0A 1FXSA 7MDHA 5KVSA 3K8ZA 4TVBA 2ZATA 1N92A 4IXTA 1P1HA 4D44A 1SOVA 2RH4A 4J1NA 3U09A 3ZI0A 4GX2A 3SEFA 3MEQA 1NQ5A 5DZSA 2VCYA 4FFRA 5I7VA 1LXCA 1ADFA 1EVYA 2C7VA 4Y67A 1EFKA 1JKIA 1YWGO 2GZ1A 4II3A 5GY7A 1GYRA 2PKRA 4IS3A 5I7FA 3MOGA 4Z9FA 1ENPA 1QLHA 3IOYA 4ZRMA 1PZFA 3GOHA 3ADPA 4BVAA 2VOEA 1E6UA 1ZK0A 1Q0LA 3HDJA 3RU9A 4EBFA 1YQGA 2IXAA 3OP4A 5A03A 4UEKA 4DXHA 3I6QA 4W99A 4NQZA 2OBYA 4GX1A 5AXBA 1KEUA 2Y1CA 5KVCA 1WZIA 2DUUA 4YVFA 5L9AA 1D7OA 2VYNA 3QWBA 3ETGA 4WCFC 3UFXA 5JY6A 3E8XA 3JQEA 2X22A 4CLOB 4W4TA 3ENKA 2R00C 1ULUA 2EV9A 3B20A 4S3MA 4YBZA 4B3IA 1M76A 1ISFA 5LDHA 3NTOA 1ZK1A 1I2ZA 1W4ZA 4I5DA 4BO6A 2CF5A 3K5PA 3VVCA 3WICA 4L75A 3PJEA 3GUCA 5LC1A 3PK0A 4L4SA 2WYUA 4Q3DA 4FC6A 1GADO 8LDHA 2YQ5A 5TIIA 1DHRA 1Y8QB 4DREA 5L53A 4AJ4A 1PJ4A 1Y9EA 2DBRA 3AI2A 3WQSB 4DPKA 1NYTA 3NJ4A 4L76A 5ER6A 4DQVA 4YAGA 1B8UA 3MJ4A 2JAHA 5DBIA 5ILOA 5JAIA 1Q2XA 2QX7A 1P3DA 3I9NA 5JPIA 1MUUA 3EY4A 3S8MA 1C1XA 3ZWVA 1C0KA 1B3RA 3W6UA 5A5FA 5G2OA 3BMQB 3PGXA 1RKXA 3GZNB 2UUPA 2O3TA 2C54A 5CDGA 3GAZA 1PS8A 5CEEA 4BHTA 2BF7A 2YFHA 3HE3A 4BOYA 1R16A 1Y8RB 2J8ZA 4MIOA 3IUSA 4PFJA 1ZK3A 8ADHA 4AJOA 3VVBA 4WKGA 4NFYA 4R16A 2HKIA 3JQGB 2PK3A 3AJRA 3E1KA 3UOGA 3K30A 2Z5LA 2AG5A 2QYSA 3FSRA 3RUHA 4D45A 2LDXA 4U6SA 4UVHA 4YAJA 1SEPA 1IZ9A 3ZU3A 3GMSA 3I83A 1NHGA 3ZN2A 3JYQA 3GVPA 2GDZA 4FDAA 1U3VA 2GNAA 1BTOA 1JWAB 3DBHB 3BMNA 3ST7A 1KC1A 2PH3A 3AK4A 3I6IA 4AVYA 4PG8A 1GDHA 1KERA 3NKLA 1W0CA 3MCVA 3WGGA 3KVOA 3UXYA 2ZB3A 3OM9A 3V8BA 3PHGA 3PEFA 3WMWA 2R6JA 4J2HA 5BT9A 1PZHA 1ADGA 4QX6A 5EESA 4INAA 4PVDA 1ZW1A 4ONEA 1I8TA 1LRJA 1JDJA 3A9WA 1MV8A 1ZJYA 1I3KA 2IE0A 4NU6A 4QFCA 1N7HA 4LCJA 1ZFNA 1ZJZA 4PLYA 5A9SB 4PLHA 3WX0A 4UVEA 3ASUA 2ZTVA 3ZV5A 1GQYA 2NADA 4O63O 4M8SA 3VC7A 3LF1A 1XA0A 3NGXA 5JO9A 2NUAA 2G82A 3FN4A 1IY8A 5HS4A 2GD1O 1LRLA 3F1LA 3TZKA 4LW8A 4D0RA 4J1QA 3VAZA 4W82A 3BMNB 1WPQA 3PJFA 1OOEA 2QHXA 2JFGA 3KYCB 5F1OA 3UHAA 3WGHA 1U9JA 1Q7BA 3B1JA 2DT5A 1C1XB 3NYWA 4K6CA 2J3JA 2X0JA 3WQQA 3OF2A 4K6FA 1LU9A 2NWQA 3HB5X 5EMHA 4CR8A 4EZBA 4WLEA 1LTHR 1SBYA 3KV3O 1EUCA 4BNGA 2W8ZA 1P1JA 4NR0A 4Q3CA 5KKAA 2ZKLA 4R1TA 2BFPA 5MGBA 2HUNA 4XZ3A 2W2KB 2ZJ0A 4IJKA 4D7AA 1QV6A 4BNWA 4IDAA 2YDYA 1VL6A 4E30A 1Y5MA 3VTZA 3O8QB 1PGJA 3RC7A 2JFFA 3UH1A 2CDAA 3LYLA 1RYDA 3HJAA 4IDCA 3RQSA 1XG5A 1DJQA 4CM5A 1ARZA 2WE7A 2EKQA 4CLDA 2HJRA 5I9NA 1KEWA 5TC4A 4DYVA 1LQTA 4E4YA 1UDAA 5IDQA 2VZ9A 3WGIA 3A1NA 2ZCVA 1MP0A 3B70A 4XGNA 2O3JA 4KMSA 2ZQZA 3P5SA 1HT0A 3GMDA 5CDYA 5U9CA 1TI7A 2P5UA 2OO5A 5A05A 4ALIA 1RYEA 3H9QA 4BNVA 1CQJA 4R3WA 3O8QA 9LDBA 1A27A 4BNKA 4E2WA 3O26A 4RORA 1PR9A 4YJDA 5G4LA 4BKQA 1H2HA 3PVZA 1XU9A 2VHYA 5L51A 1JAYA 3MWDB 4G2NA 4I8XA 4RVGA 4CQLA 4E2XA 2OFPA 2P9GA 3VPFA 4EDFA 4F46A 3DOJA 1DXYA 3JQ8A 1EDOA 3Q0EA 3TZQA 4YT2A 3DZIA 3I9MA 1A5ZA 5T67A 3UW3A 1X7HA 2AA3A 1XR3A 4H7PA 4I5EA 3JD3A 4R1UA 4BO1A 3PI7A 1DLJA 1TA4A 2NU7A 1T1RA 4OQZA 1LC0A 3MWEB 3V5NA 3F4LA 3C1AA 2EGGA 4EUEA 3WOHA 3EGOA 1CQIA 5A3VA 1I33A 1K2WA 1VPDA 3VOSA 4YPOA 1IL0A 2PLAA 4I5FA 4L4XA 4E33A 1DBVO 3TL3A 1MG5A 2HU2A 3RFVA 4C7JA 1GPJA 4IDEA 5F1KA 3RKUA 1T26A 1O5IA 4FFLA 4XA8A 2W90A 4Z0HO 4YRBA 3GEDA 3MTGA 3LC1O 1T2AA 4BNNA 5EJ2A 3LVFO 2GPTA 2QW8A 5B4TA 3HZZA 3ANLA 3E48A 5AXCA 3KUXA 1QLJA 3ASVA 3TOXA 4C7KA 4XD2A 1V9LA 4A03A 3PHJA 3IC5A 4PLGA 1VRWA 3PZBA 3UUWA 3WYCA 4HFJA 1X1EA 4WASA 4A0SA 3CINA 4CLRB 4O59O 2B4RO 1EZ4A 2VTDA 3PWSA 2OXIA 4WECA 1B26A 4D3FA 1BWSA 5I7EA 1P44A 2VUUA 4A27A 1P1KA 3VHRA 1XKQA 3UF0A 1ISHA 1PQPA 1O89A 2IZZA 4XR9A 4L8VA 5G4KB 1M2WA 1GQ2A 2X5JO 1W73A 3W6ZA 2O3UA 3GG9A 5JYDA 3TSCA 4H3VA 4YT8A 1MC4A 1EEHA 1OI7A 4Q3NA 3E5RA 2D8AA 3W8EA 1R37A 1OMOA 1HKUA 4MIYA 1V3TA 2Y93A 3VKVA 4PIVA 4WCFA 4LISA 4CV3A 4EUHA 1J6UA 4E5KA 5ICMA 4QT0A 2P4QA 1E6EA 2VQ3A 2AMFA 3AUAA 3GNSA 4MP6A 3LDHA 3GC6A 3JD4A 4MO2A 1EVJA 2C0CA 3F5SA 3LF2A 3M2TA 3PZRA 4O6VA 4RZHA 4Z0TA 3T4EA 4A5OA 4BKOA 1O0SA 4NZ9A 4XYLA 1ZK2A 1C1DA 3RAJA 1NP3A 1T4BA 3I23A 2Q45A 1QYXA 2FWMX 1U8FO 2WD7A 4Z9XA 4E2YA 3DTYA 1I2CA 2NM0A 2YV1A 1E1KA 3OETA 5CPBA 2DTXA 2DFVA 1B0AA 1E1MA 4UVIA 4XB2A 3L6EA 3C7CB 3PGJA 1UXJA 4H15A 1XELA 2NTNA 2OUIA 3BTSA 2ZQYA 3OMLA 3VPSA 2JHGA 2W98A 1DLIA 4XQCA 4JGBA 4MPDA 2CFCA 2YYYA 4GMGA 4DRYA 5KJCA 4B7XA 2YFQA 3VH1A 3ZV3A 2EIHA 2Y68A 1PWXA 3TNLA 1ADBA 1R6DA 1BXGB 4J2OA 3GHHA 2HO5A 2PNFA 1B7GO 5KVQA 4MIEA 2GN9A 3ZNPA 4BQRA 1KYQA 3UCFA 4EUFA 2E37A 1YBMA 4JJFA 4BNHA 5L7TA 2E4AA 4D41A 5JAQA 2GSDA 3VH3A 4NJOA 4ND1A 4EYEA 2IZ1A 2P91A 2BHLA 2FR8A 1GL3A 2BFMA 1G6KA 5K0ZA 2BFAA 3JD2A 3QQPA 2OZPA 3EMKA 4B3HA 2PGLA 2VYVA 4IDFA 3LZ6A 4AJIA 4E12A 5KKCA 1GEEA 1SMKA 1BG6A 1CDOA 2IYOA 1DAOA 3PJGA 3SC4A 6ADHA 2W2LD 5L7YA 4PZEA 4GL4A 3SJUA 4PLWA 4HP8A 2PD6A 3QWAA 1GPDG 3C85A 5ENVA 1MGOA 1NQOA 5KNLA 4Q39A 1CYDA 3KBOA 1D8AA 3DZBA 1NPDA 4NK4A 2C2YA 4HBGA 1IB6A 2NQ8A 2PZJA 4KTVE 4GVXA 4OXKA 1RM3A 2UYYA 5IZCA 5JFOA 1U7HA 4ND2A 4W7HA 5TSDA 2X1HA 1PGQA 3G1TA 5EERA 4R1SA 2ZB7A 3UN1A 3WS7A 5I8ZA 1BVUA 4O0LA 4MP3A 1HDZA 2DBZA 3D5TA 4RF3A 4CUZA 2IODA 2HMWA 1K3TA 2BGMA 3A14A 2BI8A 4XRGA 4IDDA 1PJQA 4EGFA 1E7WA 4J1TA 3F1KA 1ISJA 1N9GA 1KY5A 3JYLA 4AJPA 1JVSA 3CEAA 4RV9A 4IQ8A 2GF2A 4QUKA 5L4LA 4CV1A 3WYEA 5EINA 2C29D 2RCYA 3JQFA 2X23A 3U4IA 3AM3A 1EBUA 3ENNA 4FOOA 3W4JA 4HNHA 2G76A 1E3LA 5BNIA 2B35A 4ALNA 4CLXA 4PRKA 1MFZA 1T25A 2UDPA 3ANMA 3K96A 1U5AA 2X5KO 3AU8A 1E7SA 3L0DA 3H9GA 5IXYA 4XEHA 5IJZA 3WMXA 1OC4A 4BO9A 3HWRA 3AW9A 1D1SA 1FDTA 2O2YA 1Q0HA 3MJSA 3Q9NA 4RLSA 4RPGA 2A4KA 1D4FA 1E3JA 1SO8A 2OMEA 1E7YA 1GUZA 1U3UA 3GEGA 4UEOA 2AG8A 1JWBB 1I24A 4K28A 4FSHA 3JQ9C 2ZTUA 1GZ4A 3L4BC 1Q7CA 4BL5A 3KSDO 1XHLA 1B2LA 4ZQBA 3PFFA 4CR7A 5HS6A 4RLHA 2NVUA 3AU9A 5CAEA 3QW2A 4GBJA 1Y5RA 4GX5A 3SLKA 4DLLA 3JTMA 1A7KA 1PR3A 3ZWBA 4DPMA 1FF9A 4YQZA 4P4GA 2HSDA 2I76A 2J6IA 2C2XA 3DHEA 1XYGA 4OYRA 1O94A 1R0LA 1LSSA 5DNAA 1YDWA 4GGPA 4WNCA 3JQAB 1SEVA 4NMHA 4BNMA 7ADHA 3OIDA 1CIVA 2FOIA 2O3SA 3I3OA 4UVGA 3N7UA 3NDJA 4BNYA 1KVTA 3GVXA 3PHLA 3CE6A 3PPIA 4DMLA 2B5WA 3ROPA 2O2SA 1PGPA 1WAMA 2OORA 2R2GA 2Y1FA 4R5HA 3WNQA 4DLBA 1Y81A 2H5LA 4YRAA 2X58A 3E18A 3QIVA 2Y66A 3OH8A 2Z95A 1L1FA 2HK8A 3KO8A 1NX6A 3WDSA 3L6DA 2Q1TA 4N5NA 1DDOA 4DYDA 4D43A 5IXSA 4ALKA 3GA0A 3OFSA 4E6PA 1V3UA 3HDQA 1CRWG 4UEJA 3IP1A 1WDLA 4RPJA 5L95A 2YY7A 5DT9A 1XQ1A 3WJAA 3GAFA 1T2DA 3AY7A 2B4QA 4WEOA 4GLLA 4LN1A 2Q1WA 2BKAA 2P4HX 3KYDA 1W6UA 4CMEC 4CV2A 1PJLA 2Y05A 4ND3A 5AOVA 1BMDA 3NGLA 1UZMA 3DB2A 3ITDA 3ZWMA 3TZHA 4KDFA 5CEJA 1A9ZA 3DBRA 3LT1A 4MVJD 4B7CA 5EQFA 2VZ0A 2UVDA 1N2SA 5BR7A 2Q2WA 5F1PA 1E3EA 2ZIZA 3GEMA 4G65A 4LCEA 2IEDA 5KIAA 3NUGA 3G49A 2AE2A 3H9EO 5JE8A 1WLYA 3TOZA 5L40A 4CMBA 2WMDA 4BNXA 2HMSA 3RI3A 4QECA 5TT0A 4IDBA 3OJEA 1AHIA 4J90A 1BDMA 4NJMA 4ZN6A 4ZICA 2BGLA 2GYYA 1YONA 1K6JA 1X7GA 5LCXA 1UUFA 2X5OA 2H1SA 3GVIA 4BO0A 4DPLA 5CPFA 3ABIA 1LC3A 2E82A 4HY3A 2HJSA 1HTBA 4ESOA 1PL8A 3ZWWA 2AEMA 1P33A 1HL3A 1Z82A 5I8WA 1BGVA 1MB4A 2V6GA 1HE4A 2A35A 2HMUA 3VZSA 1CEQA 5FI5A 4CM3A 2D2IA 3VKUA 3GGPA 4XR4A 1QG6A 1UP4A 3MJVA 4CM1A 4M87A 3R6DA 2Q4EA 3TZCA 3DEYX 4DGSA 1TLTA 1OBFO 3NDIA 4BV9A 3AUUA 4L74A 1NASA 1R0SA 1AHHA 5TX7A 1DEHA 2DTDA 2HAEA 4XYBA 4EEXA 1PU2A 2VHVA 1GQQA 2OP1A 3X2FA 5G0SA 3G79A 3QVTA 3DWFA 4RPLA 1DPGA 3E6AA 2NU6A 3BTUA 3RU7A 4NU5A 1MA0A 3QVXA 3DHNA 1KVUA 1DFGA 2EP5A 3H9JA 1UXHA 1H6BA 1Q0QA 3DFZA 5TGDA 1U2GA 1Y9AA 1XDWA 3BMOA 1B15A 1M75A 3F9IA 4BGEA 1NQAO 1U28A 2X6TA 3DAFA 1IPFA 4U0KA 4CM8B 1PJ2A 3ZV4A 3IIEA 1QKIA 2GERA 3HADA 2B36A 2OHXA 3GG2A 2Y0EA 1U8XX 3ZNQA 5F3RA 3PP8A 3H9UA 4IY1A 4OO3A 4OHUA 5I9MA 1HZJA 3BZUA 1RM0A 4NFSA 3PFWO 4AJNA 1ULSA 4KOAA 1U1IA 1XWFA 3WQRA 4J91A 2NNLD 1IULA 4OH1A 1VI2A 3VH2A 2ZYGA 4M1QA 2NVUB 4D3SA 3D0OA 1FDWA 3UCEA 4RPHA 1KC3A 2B37A 2DFDA 4PGFA 3FBGA 2PGJA
chains in the Genus database with same CATH superfamily
1SUIA 2FJUA 1KYWA 3D2AA 4JB8A 4Q15A 4QUBA 2YYZA 5CNMA 1BE0A 1R1DA 1WU8A 4JBNA 1Q1QA 1BHQ1 1IBSA 3A9TA 3TUJC 4RF4A 1NRXA 1F8UA 2J3EA 3H5RA 3OCVA 4N48A 3UGJA 2CXTA 2JGKA 1Y3CE 3VHQA 2AFIE 1A4IA 4C0WA 1IZZA 3KETA 3OECA 4N6OA 4V1CI 1LEHA 2F43B 1NRWA 2GT1A 3I3SR 2J4DA 1JILA 4A2CA 5E6UB 4DMUB 5KTRA 2WINI 3OZIA 2BYTA 1XVVA 3M33A 1PEAA 1RVDA 2H17A 3O4FA 1JB9A 1B0ZA 2Y1GA 4ZAZA 1U4SA 1UEXC 3BSFA 4PIPA 3CPSA 5CLGA 3R7SA 4LZPA 2D4AA 4ZT4A 3GJYA 2BFNA 2EG5A 1VC2A 2PMWB 5FPHA 1KJ9A 3WRYC 3G8AA 1P73A 2GQ0A 1M10A 4KMRA 5ADUS 1M6HA 2Z56A 3RIHA 2VNIA 2O1EA 4ZOAA 4D8XA 1BN7A 2F55A 4KYTA 3DNFA 1YT5A 5FLEX 4GKVA 1L5YA 3NHUA 4J0GA 1YZQA 3ABRB 3KXIA 1IUKA 3H83A 3GFSA 2XUOA 3I0NA 3K3PA 5DM1A 2QAJA 3NCTA 4DEYA 5IM4A 4Q12A 3KTFA 1UWCA 4BNJA 2G40A 2JI8A 4IHJF 2YZ7A 3EC1A 4M7PA 5JG7A 1YVPA 3G1WA 4F84A 3E3MA 1HTWA 1A50B 2Q7XA 4FFNA 4G1CA 1XN4A 2WJVA 3P2OA 4IM7A 4K8OA 5CLQA 2I34A 2VDMB 1YFZA 3ZQ6A 2FSVA 3GPBA 2ZPTX 4QAJA 4CCWA 5KSWB 4ZHSA 2IHZA 1FXWA 4PO8A 2NZWA 3M6IA 1LD3A 3KXDA 3F7NA 1KS9A 1HETA 1L8LA 3QFHA 4TZTA 4CGZA 2C1XA 2EKDA 4OQFA 1UOEA 5EJ5A 2HPHA 2JHPA 1CLEA 3HUEA 3DFUA 4IHJB 4IVRA 2WV7A 3VX4A 2C9MA 2CFOA 1YZYA 2VNAA 1RP1A 1LJ8A 1GPYA 2IOYA 4IQ4A 1AZWA 1ZM7A 3AFNA 5TQVA 4DUZB 2P77A 3ZQKA 3GLGA 3BTVA 1P9NA 5LD2B 2YOFA 2FEOA 2NU6B 3DMRA 1ZVJA 3JASA 2PMCA 4PRYA 5KJ6A 1E7MA 1VE9A 5KSZA 3CH4B 2PQMA 3RASA 1NG1A 2FUNB 1XD9A 1GTVA 2X3UA 3B9RA 4Z9AA 1VE6A 3BT7A 1Z2AA 3AL2A 4I1YA 3DBLA 1WOMA 1ISGA 1ADCA 4DSAA 4QYMA 3INRA 2O1WA 1QO0A 1RZVA 1KBZA 2Q2VA 5T4FA 4R1LA 1FTNA 1KMNA 3DR3A 4BAUA 4IFTA 1N2BA 2XT6A 3B1KA 4YS6A 5IABA 3BJZA 4CUJA 1AQ6A 1ICIA 1EBFA 1Y3IA 1LW6E 3FPLA 3FG9A 3JW8A 3OAAA 1G8KA 4OK6A 4RJJA 3KL4A 1YIAA 4AKTA 3WBKA 3MLBA 4M9SA 3AYZB 4L3WA 1H1LB 1A9XB 2AZMA 3C2QA 4LSMA 3E9CA 4FZRA 4NDZA 3L8CA 1ODKA 4MUGA 1RQGA 3NHZA 4MUJA 1Z5UA 4NCJA 1QB8A 2GKGA 2HJWA 2V4ZA 2Q0SA 2AXPA 3UAWA 2Z08A 2O57A 3Q8LA 4MVJG 1CHDA 3S2EA 1V2GA 1J2RA 4RF2A 2O7RA 5A5VA 3QX8A 5HF5A 4Y6LA 4J07A 3RC1A 5H59A 1I2DA 4OOEA 1WF6A 5JXWA 3H2BA 3CW9A 5AKXA 4JYZA 2BFCA 1UJ4A 4L8YA 3PBKA 4TRMA 2ZAIA 4RL4A 2JFVA 4BMZA 2EYQA 1OTHA 1RCFA 3K0HA 3ZHXA 2YIJA 4A6EA 2I67A 3QH4A 1IOWA 1XF9A 3PQ8A 4FFWA 4DSTA 3WJ2A 4HC4A 1DO8A 4AUMA 3ISTA 5K05A 1NSTA 1C1HA 4PN3A 3Q9SA 2HLDA 5GOZA 4BATA 2CVHA 3EXG1 2PMBA 3H19A 1CRZA 2CKDA 4CMJA 1SUAA 2OXEA 3CXRA 1EVKA 4RGVA 5IZ4A 4I8DA 4TGLA 2OYRA 2WJHA 3TDMA 3NT2A 3TLEA 3BSYA 4UPVA 4LRSB 4C0AC 1WZNA 2JEOA 2QMZA 4G07A 3CLUC 3MB5A 4CLRA 4KFCA 1S3IA 1WUYA 1AGYA 3BSWA 3F2IA 4G4IA 1XRJA 4L08A 5FL7D 4EHAA 4KE8A 4BE7B 5CB6A 4CMEA 3KT3A 5CX1B 4EA9A 4HRYA 3KZVA 1PGNA 2J0QA 1OWPA 3ZGLA 4BNTA 1AXEA 3SHQA 4RY8A 4I81A 3Q9UA 3PSHA 4P2GA 1RQPA 3IULA 5CP8A 1E1QA 1KFKB 3CKYA 4QBKA 1USKA 1LLQA 3VR6D 1CP3A 1P5ZB 3OBIA 3PYXA 4AP6A 4EY8A 4GLOA 3PA6A 3T7DA 1ZAKA 5TGTA 3LU1A 4XYGA 1DBIA 3ZWKA 1H85A 4CKWA 4A10A 3HB0A 4C76A 1YGYA 4DMFA 1V11A 4I1RA 4LNAA 2VHTA 4NWIA 3GGCA 2ASVA 4J4HA 3ZWPA 4D6PA 1KRXA 2P7IA 3DBVO 2DM6A 2P2DA 3N87A 2PJZA 1VXRA 2AVDA 3F46A 3FIUA 5LXTA 2CV2A 5DX0A 3E4DA 2NZXA 1IZ0A 1ZOPA 3M0EA 1ODSA 3ESCA 5TVKA 4W5OA 1VCIA 3GXOA 2L18A 4W5HA 5CW2A 5YASA 4DUYB 4F56A 4KPGA 4K0RA 2PUDA 2XEXA 5JXGA 3B60A 3PUZA 2ID4A 4WPGA 1JLRA 2GKOA 5ALOA 5T6BA 1KEVA 1MDFA 1GL7A 2O5RA 2IWHA 3TTTA 3ELDA 1XQ6A 1ZN7A 1CZUA 2JFQA 3B13B 4FC7A 3VPXA 2HT1A 4YXWD 3QPCA 1BD4A 1F2VA 4ICIA 3LC0A 4WV3A 3V46A 2I2XB 3IBYA 1VBMA 2R1TA 3TBKA 3ZJTA 3KD2A 5GM2A 2Q9BA 4JQOA 4FKMA 4MW9A 3E7PA 3U7EB 4CLEA 4KNYA 4B83A 2ESRA 2Y3IA 3ELUA 3LCUA 3WB9A 3L7LA 1KEEB 2OKGA 1LTQA 3ACDA 1TJYA 4JH0A 2VQDA 4G5OA 3FSJX 2OZLA 2VPIA 4DCGA 4DLKA 2NSDA 1N6KA 1DXOA 2ZJAA 4RAOA 5AHXA 3CONA 4DGQA 2FSIA 4UDYX 5JXIA 3THXA 2I2AA 4PLPA 1QBKC 4C4YA 2AKYA 2PTGA 2Y67A 1W5SA 4Q4HA 5CT5A 4G4SO 4MQEB 5AWFC 4C7BA 3UK7A 2PLNA 1XDSA 3T95A 4ZTZB 4A5SA 1XVUA 3DJYA 1ORWA 4HNTA 4IPTA 2G70A 3DVSX 5JS7A 1V1RB 4L8GA 4PG7A 2WJJA 2C78A 1W6RA 4N18A 1AQLA 4HNRA 2IBMA 1D3AA 3IV7A 1VYUA 2DLCX 2I7DA 1CSEE 2WNSA 1NW7A 4YRSA 2I6SA 1MAAA 4TLMB 3ABOB 5B64A 3FKSA 5F76A 1SKQA 1I10A 1X1RA 4MV8A 5J5AA 4ZZ3A 4ARVA 1QHHB 3EC7A 3N5KA 4LJRA 2C1EA 3T7EA 4BJHB 1K3UB 1L7DA 3UMCA 3A3OA 2GAAA 2BISA 2J9YB 3JRWA 3U62A 1I6LA 2V55B 5L3QB 4EH1A 5FBWB 2AC2A 5DBEX 3RGGA 1N57A 1WULS 1YBFA 4K9SA 5F64A 4AAYA 2O23A 1JZTA 4A8TA 4XJTA 1XTIA 1L4KA 2Q3CA 2WFLA 3BIXA 4G4SP 1OBOA 1R50A 1E1LA 2P9EA 1NNUA 3AUYA 4HLUC 1RHMA 4M8LA 4R3UC 3WBBA 4DE5A 3HWX1 2Z6QA 4GG1A 1TVEA 4B7ZA 1FDVA 4PHFA 3F3SA 2OHJA 1O9HA 1JHOA 3AFOA 4R8KA 4AF6A 3IVXA 5E9QA 3EZYA 3CSDA 5TMBA 3CVWA 1SHKA 3U7QB 3ZNNA 1RYYA 3HU3A 5DO9A 3E84A 4F1KA 2CWWA 4MCIA 3HP4A 1GDDA 3FMPB 1NOKA 2YHAA 4JI3B 1OPXA 5FXMA 4CM8A 4F4IA 2JJ8A 3GUHA 3KOUA 2AIRA 1IOZA 4KQCA 2YFYA 4C08A 1J8YF 3M81A 3PT5A 1YXMA 5EXEA 4P3XA 1DAPA 3ZJYA 5JJCA 4KQXA 1Q77A 1UBMS 2E0IA 2NLOA 1OWLA 1Y3HA 1R12A 2PZMA 2RHDA 4CFYA 3QKSA 5CFLA 1ORRA 4J0FA 3G9ZA 3HNPA 3OZDA 3L82B 4J9UE 3ISJA 3TIFA 3UK0A 3GLIE 3U61B 4G5SA 3ZNOA 1Z25A 4YRMA 5A0FA 2EHJA 4HYQA 4KLNA 4M0UA 1RWOA 3WE7A 4EJ0A 2W4IA 3TEJA 3UOWA 1L7BA 2O48X 3DDZX 1EK2A 4ZQIA 2JK0A 3ZU5A 5HX7A 2UVPA 1FTQA 4G86A 4EA7A 4C89A 4Q4JA 4X90A 3QVSA 4D1YA 1IVNA 1D6MA 4NXNB 1VLLA 5C18A 1VLQA 2SBTA 2Q1XA 5E3JA 5M04A 4KODA 1K97A 4ZCMA 4EPXA 3CO5A 2R7AA 5ED0A 1VMIA 5JCOA 1TZCA 2VF2A 4BLUA 4E22A 4G0XA 4O2AF 4PYIA 5IPFA 3I6MA 1O87A 1QGUA 1Z06A 3GJ4A 1K5PA 3ITKA 4QFDA 4UULA 1NLUA 2BCJQ 4CG0A 1TMKA 5FEUA 4JVNA 3KM0A 5EXXA 4NE7A 2I29A 2F17A 4QJBA 1Y1QA 1C7JA 2ORVA 5D51S 1JE0A 2AJCA 3ICVA 2O8EA 3SF8B 1JSCA 2QTVB 4R0NA 1IHYA 1V7ZA 1V16A 1W44A 2CHUA 4HQKA 1HDRA 3DQPA 4NLLA 2VPTA 3CURA 4RVDA 4KE7A 1G8GA 1NI3A 1XEFA 3GQVA 4UNQA 5C2JB 3NWEA 2XOEA 1G19A 3WR5A 4DDVA 4PZ0A 2G07A 5I7HA 2KM1A 4KE9A 4LQDA 4IGFA 2QTZA 3TQSA 2BJVA 3WISA 4D5EA 3NHBA 3LOPA 3LKZA 2FSVC 3B7WA 5JQWA 3ZCVA 1Q11A 3OM8A 2IV3A 3WKCA 3IPCA 5B57C 1VKHA 2PPLA 1KDZA 4CTNA 3LUFA 1WQ3A 1TF5A 1B6SA 3IMEA 3I9OA 2JLZA 1NIJA 4GQBA 1AZLA 3EVGA 4BYMA 1XVTA 1ZPDA 3GD5A 3FZQA 4GAEA 4RLFA 5FBQB 1JZQA 4L5BA 3NEAA 4MINA 4XQ0A 5L4NA 3TGLA 2HFKA 1FW8A 5AHWA 5KNCA 4J0CA 4K40A 3GFVA 5KDOA 4KQWA 2DSNA 1CS0B 2CHFA 2FRXA 3MZ0A 1NQUA 1SR8A 4DM3A 2W5UA 2NP7A 1SKYB 4QVGA 5CCBA 4XGKA 1YBHA 2HIAA 2BJHA 2OV8A 3RYHB 3LYAA 4I1IA 3KQNA 4AF7A 3EB9A 5ECWA 4B2PA 2BR3A 1ACMA 2AF4C 4E5YA 5MDHA 2WAOA 4HQNA 4CMGA 3AB8A 4MP8A 1QSGA 5GMOA 1C0LA 5BWOA 4KQ1A 1NBIA 3RVPA 3U3OA 2DUJA 2D00A 1CFJA 3B6KA 4ZV9A 1VA4A 3H17A 3NKVA 4BBAA 4BKMA 1RXWA 2VUHB 3AVYA 4CQMD 1L5HA 1C3OA 3WRWA 4HDOB 2C95A 2GNOA 4MMYB 5AOBA 5K4AA 2NOAA 1AHNA 5GJWC 1M1XB 4F60A 1HDOA 1QYCA 3NAGA 1K8RA 3FAKA 1DKPA 4FHCA 4RYDA 2PA3A 2VSFA 2TS1A 4N7JA 3E5MA 3WWCA 1RI4A 5CCEA 2D1SA 4KEAA 5LZ9A 1XQWA 5EE1A 4KK3A 3UZUA 1AN9A 1LZLA 4NMWA 4MYRA 3MWGA 1I6MA 1YFJA 3PR1A 4B3MB 2GKSA 2X3FA 2J0UB 3QKIA 5DTJA 3D4OA 3KJQA 4YUYA 5LP6B 3B6MA 2HWWA 3S8EA 1JAIA 1BDJA 2CXXA 5C32A 2O2XA 1P5RA 3KAQA 3KUCA 3I2YX 1YQXA 3R3JA 2PR7A 5EKSA 2GFHA 4EAAA 3BL5A 4FBLA 1PL6A 1TGVA 3JALA 1JW9B 3OZVA 1JALA 3QY0A 5K3OA 1M2VB 1EH5A 2I3ZA 4MWGA 2VDLB 2Y6VA 1PK9A 4MULA 3SS9X 3VDNB 4NOJA 2JI6A 3C5VA 4Q9HA 2ECFA 3IE2A 1JSLA 1EG7A 1PDVA 1BEZA 2G9ZA 2QAGA 3BGOS 3LT5A 4XYMA 3UWDA 4DIOA 4YHHB 1Q5PA 4R9SA 5AK5A 2P68A 4ZZIA 3BHIA 4YT5A 2F9LA 3LC7O 4K9OA 4YWJA 3RARA 3THYB 1HFKA 1C8KA 4OYLA 2YJZA 3M9WA 4NABA 5TPWB 4EI7A 5JYEA 4MVXA 5IH3A 1QP7A 1X8JA 4N9QA 3UVEA 1Z8FA 4QJ3A 3DE4X 1DBSA 3ZUPA 1O58A 5ALKA 4ZCRA 5IASA 5EZYA 1SVWA 4A91A 1Z4NA 1QRTA 3HG7A 5KX5A 3CLVA 3DEAA 3IDFA 2OWDA 4M0MA 2JCXA 1QC5B 2WT4A 5KYUB 1BCSB 3L7OA 1Y8QA 2YCBA 1LSJA 3BBPA 3FAZA 4MA0A 4MEJA 5HCUA 2ID9A 1R8JA 1ZCJA 3O8DA 4BS9A 1NULA 4X44A 1Y8ZA 3P45A 1E9EA 3FWZA 1P2UA 3CLTD 4R1PA 4E03A 2H2IA 3U4DA 4EHNA 2YOHA 2JGMA 1GAQA 5IDXA 4FGWA 4OFZA 3LUJA 4R54A 3ZGVA 4DV4B 3VR6A 2VDPB 4MRSA 3TRIA 2OO3A 3KNZA 1M2FA 2QQGA 2AZDA 4ILKA 3BMOB 4DV0B 9MHTA 2A1TS 1IJBA 4M0PA 1C7IA 1EHCA 2Q4BA 3QU4A 1BROA 3WQHA 1TZMA 1KS2A 1OH8A 2OKCA 1R5JA 5BV7A 1TO6A 1L4UA 3I4FA 1UP6A 2FZEA 2W2OA 1OFGA 1G6HA 2ECPA 1W52X 1NUPA 3REQA 3PX7A 1FLDA 5FTMA 1T9BA 2X2FA 4A7PA 3H0KA 4I4CA 1FEZA 3K09C 1AN0A 1JA9A 5EMMA 2W71A 1S7CA 1OFVA 2AHOA 1B2RA 2XNJA 3RS4A 4AJLA 4C4SA 5F7OA 4LXXA 3RVNA 3I5XA 1ZD5A 4HLNA 3RAFC 2RI6A 1SUEA 4S1OA 1GGKA 3CRRA 2QU7A 3ONEA 1GTL1 1Z7BA 5LMCA 4C7OB 2VNHA 2H06A 4MYUA 1GR0A 1NVKA 2GXQA 1EDBA 2JIMA 3DKVA 1WXGA 3E9DA 2G17A 3TXXA 5A9TA 2A9KA 2AR9A 1Z4OA 3EH2A 1W36B 3ELWA 4CMKA 1M2OA 1VJDA 1ZUNB 4J16A 1EE1A 2VP0A 2XMRA 3ICPA 4YRFA 5L3ZA 1FNDA 3TSYA 1GTMA 4C4TA 2CL5A 2HBRA 4CI0B 5KOJB 1E58A 1NAHA 4L7VA 4LMPA 1LUAA 3NVDA 4UARA 1C4XA 1G16A 2AX4A 1OI4A 4WACA 1ZCBA 3T9FA 4ZVVA 2XZPA 2CXNA 2ZWVA 4BGVA 2W43A 3TR0A 1VHTA 1OROA 4NMLA 5IKXA 4PTLA 3QF7A 4KACA 5JJ5A 2OHGA 2OESA 1JKXA 1SXJE 3V4FA 4NNPA 1HC7A 3U3KA 3JZAA 1IN6A 2ZJ6A 5AM3A 3WKAA 3LXRA 3ICQB 3D64A 3JD1A 3SBOA 3LH5A 3CYFA 3OCXA 4C14A 2LCQA 3TCXB 4KIFA 1UZLA 3JQRA 2ODAA 3OA0A 2PUAA 3QLVA 2C5LA 4B3XA 2F9FA 1MABB 2I4RA 5GPBA 3OQIB 3QLTA 2I80A 3DWIA 3IMCA 5BQ3A 4TSKA 3MMNA 3WGOA 1IK4A 4OI2A 4MO9A 4OQQA 3A2LA 4RY0A 3WMRA 2PAFA 2WF7A 4WZAA 3MILA 3TPCA 4JBIA 4YLEA 3W9UA 2Q50A 1KI7A 3E81A 3WLSA 1WPGA 2HGZA 2C4NA 5B1HA 4FBMA 1C0PA 4XWKA 1T9GS 3U81A 4MW2A 4A1OA 4E2ZA 4N5IX 3GLHE 2MOKA 2VQFB 2OOKA 2ZRHA 4H7IA 1J9GA 4Z7NB 3GCZA 5JCXA 3BJIC 5CX1A 4U5QA 2OWEA 2HY7A 1Y37A 3FKQA 5K5EA 1LPNA 1Y34E 1I9GA 2WF5A 1JLLA 3JARA 3ID6C 2OT3B 3EZLA 4RENA 2WB4A 4WZZA 4YONB 4DDWA 5AVSA 5ES3A 4QGBA 1KVSA 4KVFA 5AVWA 5ITWA 2WJPA 3GA5A 1T3GA 4O0MA 1I01A 1AKEA 4BKPA 1AA9A 1TADA 4IRUB 3WTBA 2R84A 1A9SA 4GYJA 1TQ2A 3CF4A 3H86A 4QODA 4R2IA 1RZRA 3CUVA 3SZGA 4YXFA 2XTZA 2WWHA 4IUYA 2P0EA 4Q7LA 1X7XB 4D80A 1H5NA 3KALA 4WK4B 4DDUA 3QKSB 3SSOA 1UAGA 4F96A 4NDNE 1CQJB 4PHHA 3FR8A 4JT8A 4QSHA 5E4YA 1LWOA 1PJTA 4ESHA 4QYIB 1ILEA 4CIWA 3Q8XB 4DMMA 3GB9A 1XA3A 2F3PA 1NN1A 1LPPA 1XEWX 2C8JA 5KX5B 3QBTA 4IVNA 1YZLA 3SIPA 3AV0B 4LF8B 2Q6VA 5JMOA 2UVPB 3P9ZA 3AL0C 4YV0A 5LOVB 3TSZA 2COKA 1IXRC 2OCXA 2Q1SA 3I73A 4OXNA 2DC1A 1VGQA 4X60A 3BXZA 2K4MA 3AHFA 3KZMA 1U4OA 1U8YA 3ZVKA 5CHEA 3FPKA 1PEDA 1Y1LA 4K81B 5HHTA 2ZXFA 4HEHA 2HN9A 1FTWA 2ZYAA 1XD8A 3MD0A 1UXKA 4KDEA 1C9DB 4RM3A 3D3WB 1E20A 4RACA 3IPRA 1WKVA 2GTHA 4P5EA 3P0HA 4M36A 5LDGA 3ZK7A 4R1MA 1Q12A 1PUIA 3PT9A 2W70A 2P8SA 1K8QA 4N5DA 1UAYA 5ALLA 2WF9A 3Q7SA 3ETHA 3OICA 1WHSB 1KARA 1E60A 2DUNA 4QJIA 4GEKA 1XKXA 4KW7A 4RE5A 5G0VA 4CLOA 4IHAA 1J00A 3ZZTA 1QNFA 1RXUA 3BGDA 1CZNA 1U3GA 4G63A 4UPDA 1Z75A 2WSMA 4IVPA 3CEPB 5A6SA 1C0EA 3KLNA 3K9GA 3M1AA 1DKRA 4JXKA 3RUIA 3OTOB 1OH6A 4AIRA 3Q1LA 1O6ZA 4OTZA 2CSUA 2DAPA 2CLEB 2WWWA 3DMHA 2IDZA 3R5XA 4XYEA 5EL0A 3WLFA 4C3ZA 2OGUA 3D3WA 3SXJA 2ZQ5A 1IEXA 3HKCB 2ZZNA 1HMYA 4N5MA 5T6MA 1XMPA 1SKYE 3KWLA 2H4HA 3CRZA 3I2JA 3WLJA 4ETMA 4HV4A 1LV7A 2JFHA 4CETA 2CLCX 1UKBA 2BBSA 2FW1A 3H1AA 4LZAA 9GPBA 2D2EA 1NRJB 1X6VA 2AW5A 2BR4A 3IXQA 1YR3A 5DM2A 5E4TA 4LQ4A 3OTWA 5JY1A 1M7GA 3PDIA 3QYPA 3OKCA 5BSMA 5LIRA 4OOFA 3OO0A 3TQOA 3IVMA 1MXFA 2VBIA 1U0FA 3HFRA 3O8LA 3W2FA 5JLAA 4BMPB 1VKOA 1XIVA 5MF6A 2B4YA 1BMTA 1VJ1A 1QG2A 2HA2A 3HEMA 3KOMA 2IZ0A 4X97A 5T41A 5JDCA 3AOEC 1AKWA 2R6FA 2BELA 3JSXA 4GDMA 2PBZA 4Q34A 5HKBA 3OZCA 2F1RA 3KUDA 1EAYA 4QDOA 5EMKA 3L4BA 3UFBA 3O8RA 5TXGA 1G1MA 4DV7B 3U3MA 3GQBB 4ZYZA 3L0CA 4MVJI 4QG7A 3U2QA 2W2PA 1ODIA 2H9IA 2YNMD 5DNVA 2OCLA 4I9HA 4CCSA 3LWZA 5KCZA 4PG4A 3ZK9A 2PUFA 3U5TA 4IIFA 2EJBA 1VYVA 3G89A 1U9ZA 1LGYA 3VO8A 5LOVA 2Q5CA 3LKVA 2WIJA 4KJXA 3OX3A 4RDHA 4UJ3A 1KYZA 2YMLA 3D02A 4LYDA 4ENUA 2WLSA 5DOZA 3TW0A 2DY0A 2OHFA 4FGSA 1N6NA 3QUBA 3QE2A 4DS3A 5AUPB 3FYUC 2C2ZA 4DL9A 1VQ1A 1W29A 4HATA 5BYKA 5BW4A 4ARIA 2DQKA 4GMFA 4AFNA 5EJ9A 2R4TA 4QU0A 3RSOA 1QVZA 3VYUB 4CKXA 1E96A 3MC1A 1ZC3A 4IDGA 4MQLA 1E98A 3UPUA 1JJBA 4NH4A 2W6CX 2H2HA 2QZ9A 3COYA 1JEYA 2ZRBA 2X9GA 2VXBA 1X0VA 2YC4C 3DNPA 3WHKA 2ZR9A 5FOSA 4HQLA 4FFDA 2AXNA 4HX9A 4HWGA 4KI7A 1QBGA 5J2TB 4F2PA 2ECKA 4HQFA 2RGDA 5HF8A 3RNOA 4G1FA 1H2ZA 1EMDA 1LNQA 2VTVA 1O4WA 1RHQA 2HHAA 1EI9A 4KYVA 1XZLA 3W04A 1A82A 1PJBA 1V8ZA 4FSXA 4JDUA 2I3AA 3DGFC 1V1JA 4TWBA 3UJ7A 4BMOB 3NBXX 1D6NA 1QH9A 3WK4A 3R40A 1Q1NA 1VECA 2XW6A 2ZYTX 2VBGA 3I62A 1CYEA 2CC2A 3ZI7A 1J33A 3CGWA 3QVLA 4LDJA 1Y6JA 3AP3A 3ODPA 5COBA 4JVOA 5FBKA 2GASA 4CN9A 1D2NA 3VR4D 5F9HA 1POXA 2J9FB 3ONDA 4ZGGA 3UXMA 4INPA 1X8XA 4GR5A 1TQ4A 5CK4A 4E32A 5LXTB 1MO3A 1HUQA 2AUNA 3DBRB 3RD5A 3GPDG 1HQCA 3A9RA 1FQWA 2GFIA 5EWMB 3RHSA 1U8EA 3BMCA 4RHTA 4TLLB 4RK0A 2AQKA 5HM8A 1XEWY 4FINA 3QLUC 4WLVA 2FPXA 4NBVA 4B4DA 4HTAA 5A06A 3CUUA 4RX1A 3TJMA 4EO9A 3GFBA 1MF7A 3QXGA 3MMZA 5KNCD 5TEWA 1KIAA 2ZBPA 2GEBA 4ZDKA 1Y3DE 1S3GA 3FB1A 4MQFB 5TMPA 1H3FA 3RFTA 2D13A 2V9PA 5AFSA 5HKKD 4KRYA 1SBTA 3TTYA 2QV0A 1YFKA 4EABA 4MJ7A 5MHTA 1E7QA 3GFQA 2PH1A 1E63A 3IH5A 3E8MA 2V6FA 2ZE7A 2CSXA 3K9BA 4GZ5A 3GVCA 4R69A 1GNLA 5FWYA 2G67A 1TD1A 5LBTA 2IHJA 1BHO1 4JKYA 2FN9A 4NQRA 4CU5A 1IJEA 2FGJA 1MIOA 1MPXA 2F67A 1U3DA 2WIDA 3IDAA 3PQ4A 5HKLA 2RAVA 3DF7A 1HZZC 1BGWA 1DIOB 2O2JA 3JQ7A 2W4MA 4I5IA 1FJHA 3KJEA 4QXAA 1CU1A 1DDIA 1Z45A 4JASB 4RKYA 4EVIA 2VDWB 1Z6GA 2IGTA 4RTMA 4BJ5A 1NNSA 1EFVB 1OSNA 3K7EA 2PGXA 2PT7A 2CB0A 4BVGA 4D81A 3CW8X 4BMXA 3DP9A 5KO2A 1CUYA 3T94A 3FSGA 1TYEB 1EUZA 4TWAA 1CRPA 3L1IA 1U5BB 1VCHA 1BXKA 4B2IA 4PTZA 4KDCA 4F3KA 2QI9F 1NF2A 3M3DA 2VPXA 3BQ9A 2QN7A 3VJMA 2VA9A 4Q7QA 1GT91 1U7DA 2VJMA 1V8FA 1PYDA 3UBTA 1E1QD 5JHGB 1SVMA 3IEUA 1A5AB 1O9BA 4MS4A 5HOEA 1WNFA 4JLMA 1EX9A 4GD3Q 3ZD8A 1DWOA 1VSUA 2BMVA 4LUCA 4CFZA 2CFRA 1QUEA 1A5SB 2ZSKA 3KQVA 1F12A 4RJIA 3DPSA 4CODB 2XTJA 4C0QC 5CDUA 1ABEA 4FS3A 2I5PO 4UXHA 5JR3A 5EVJA 1NATA 4LFAB 3O9MA 1Z2PX 4TWIA 1PFQA 5CA0F 4KVZA 3WDLA 3EIHA 2ZRMA 4INZA 1EYZA 1JBKA 3HYTA 2IITA 2QRKA 3ZXYA 4DR3B 1CUXA 4KAFA 1R0RE 5BN4B 1I13A 2HQ1A 4WK2B 2XYRA 1DXHA 3Q7IA 1W96A 4E51A 2ZSJA 2W9XA 4RVUA 4F8YA 1E1NA 4Y6PA 2OD9A 2MCFA 1QC5A 2RC5A 3RANA 4X91A 3RVOA 4BB9A 3CXUA 3RUDA 1O0CA 4U0JA 1N36B 1CR2A 1DC3A 2DOKA 5HRCA 1FFEA 4M76B 5E7IA 1F38A 1K89A 1OA0A 1KBOA 3X2EA 4F4FA 3DQZA 4YLYA 3GZTB 3RM3A 5FOXA 2F3UA 2GYUA 2V5AA 2XZOA 1H9AA 5TDHA 3E4CA 5JZMA 3PDJA 1XALA 3ER8A 2GHIA 3BILA 1ANKA 1J9EA 3A9VA 1JHRA 1T2EA 4EKEA 1XO1A 3EQZA 3JQPA 4WAUA 1Z62A 1ML3A 3HV2A 3CLSD 1ZD1A 2YWCA 3N9IA 4RF5A 1YS1X 3EIQA 3EZ9A 1TJPB 3HM2A 1M2HA 1VPLA 3HKDA 3LTEA 4HDKB 4CCYB 4ZYUA 3PICA 1HFEL 2Y2VA 1EGQA 1K4KA 1UFKA 1BKSB 1UMDB 2GD2A 2P2SA 2PZAA 4TUYB 2GD0A 1DX6A 3S68A 1JG6A 2IYFA 2BFDA 2EF1A 3C3XA 3S1AB 1JHQA 1SBNE 2BKUA 1RJ9A 2QL6A 4LJ9A 1SVUA 3CFYA 2ABWA 3MMPA 2OPBA 4OCZA 1Y6FA 2HRBA 4RS4A 2Q3LA 4LWZA 2RHCA 2WSBA 4QUGA 3ZU2A 4L3OA 1SIBE 2KMLA 3ILSA 1EVIA 5KQPA 1P4HA 2OBNA 2JBAB 2A9RA 3CB2A 3N07A 1V4NA 3AJEA 1KVRA 5K3CA 1NN5A 2XUPA 5DNYB 4HGPA 2H1VA 2WSSD 1B16A 4L5JA 1L7NA 3RVRA 1RXVA 1J9ZA 2J7PA 2Y4NA 2ZS8A 2OQIA 2R11A 3DAOA 1KI3A 1S1CA 4PCVA 1QR6A 2CBXA 1JVBA 4UBIA 5IXSA 4D4KA 2RHJA 1ELOA 1RI3A 2B4KA 5AKKA 4G85A 3A9CA 4DLNA 3WK5A 3WK9A 3B8EA 5FUWA 1EVZA 1C2TA 1DMSA 1B1CA 3FYUA 3HJHA 4WD3A 5E6UA 4NK5A 3WGVA 4YRLA 1E2BA 3OJXA 3L7JA 1CE8A 1XPJA 3PPXA 4J0JA 2A1TR 3OA2A 5IAAA 5CFNA 1HKHA 3G2KA 2Z6UA 3P27A 1J49A 4C0KA 1YZVA 2PAAA 3LOQA 3NRCA 4ZDWA 5JW6A 2DG2A 4JUAA 3GVHA 3E1GA 2A9VA 2Z6VA 2PU7A 4AK9A 4C88A 1PCXA 3O03A 4NTZA 5JWRA 3DEFA 4RVOA 1E9FA 3N8HA 4F7WA 2IXDA 2ZBDA 1D0IA 3F67A 1DELA 5B55A 3IP5A 5FBLB 4BKUA 1JL3A 1F2UB 4RA9B 3G8DA 4NULA 4JX9A 4PBSA 4CIDA 3H3FA 5IT5A 1IMJA 1J23A 2Z4SA 4P53A 3BFXA 4V1CA 4UUPA 2DULA 2XXBA 3SXUA 4OGWA 5BSFA 2ATXA 2V8OA 3K1JA 3KEFA 2P5SA 1T2VA 3UT0A 1IOVA 4IIJB 2KWIA 4IKPA 3QPBA 3Q0IA 3WFIA 3OLWA 3HDGA 2W2NA 1GUYA 1JQAA 2ONYA 3TBFA 2CJWB 3AEUB 3EASA 4KR6A 3X1DA 4AJHA 3F4BA 1IZ8A 1EKXA 1GGVA 2NAFA 4UAVA 5ALVA 2X0DA 2XQGA 3ZG6A 3TO5A 2BMJA 1L4LA 4GLBA 4B43A 2WD7B 3E9ZA 3INYA 1WR8A 3KCQA 2XMSA 1HYHA 5FWDA 2TYSB 1EVQA 3TTWA 2CJYA 1ZINA 4ZOCA 3ZDYB 4D46A 3GLFA 2PYDA 1CY7A 3OWHA 1GA1A 3O4VA 2RH8A 1IG0A 4Q3BA 1ODFA 2PSJA 1SD5A 4GPBA 3RJ5A 5HK8A 5K9ZA 2GLXA 3OCUA 4OYYA 4UHBA 4ZVQA 4PYNA 2TMKA 4KBFA 1T3LA 2JBHA 2HV8A 1FU8A 3UCXA 1WCXA 5KNCH 5LR6A 3M49A 2C7PA 4QYIA 1C8LA 4S05A 3D6NB 1CERA 4UFNA 3VFDA 3R23A 3K94A 1PAUA 1TDJA 2XMQA 3NLLA 3UW1A 4RTRA 2PUGA 3V1YA 1Y3BE 2WAYA 2PL5A 1X19A 4G0OA 1YQDA 3D3EA 2HLPA 3KB2A 3RROA 3ZZUA 2PDAA 1G9TA 1Y3FE 3LUBA 4U1RA 3WGZA 2A5FA 3WZMA 1HY3A 3FNIA 4V3BA 4HBZA 2AHRA 1OVGA 3NG1A 1KEEA 1QRUA 4PV7A 5FL3A 1VHQA 4E5NA 2OC4A 1IEWA 3I64A 4D4MA 3L6OO 3WK8A 3IBTA 4CF4A 2V6MA 3AR3A 2ONZA 3A4LA 1DIGA 2AN9A 3GZ4A 3QFTA 4C1BA 3CVOA 5G0WA 3RYFB 3CLSC 1JEEA 5DW3A 5JZ9A 5D5HA 1JDVA 2JLQA 2WWGA 2BIFA 3QNWA 4IV0A 3ODGA 5JBIA 1M34E 1G64A 4C4OA 1GT6A 4FBGA 4WESB 4J3JA 4BNIA 1DCTA 1WDMA 1K6XA 1IFXA 1C2YA 2Q4TA 5HM6A 1TAUA 2C7RA 2W2XA 2INGX 3C8UA 1P7YA 2XKJE 1YH3A 3T7CA 3VH4A 5KVVA 1SAYA 4LNUB 5DCLA 4KQHA 2IQ5A 4R81A 2ZM6B 1QPZA 2A0FA 3OU7A 5E38A 5C8ZA 4MWZA 3KVRA 3B52X 1X70A 2CNNA 4RYLA 1XU4A 4DTCA 3AG6A 3TEMA 3KB1A 3SE7A 2Q29A 1SBIA 2D54A 2EERA 4LJ5A 1DVRA 4S1WA 4UTZA 4CM9D 5AVYA 4DLUA 3ORSA 2H18A 3OE1A 5G0UA 2FUG6 3ZH2A 3L07A 4HAOA 4IYRA 5IMBA 4YEDA 1KGSA 2M9MA 1HEUA 3OUUA 5F5NA 3ZZ0A 2C3MA 1G21E 4ZVSA 2ZB8A 1KEPA 4KQ9A 1GNSA 1PFGA 3H4TA 3L1UA 3QVUA 4R84A 1DDGA 1R8XA 2P90A 3CRMA 5CXXA 3RRBA 3T7AA 3TLCA 3J7TA 3WGMA 4EYQA 3PQEA 2Q0XA 3GK3A 5EPUA 4KIGA 3UKDA 5LU8A 1TQDA 1B14A 1Z18A 3MXTA 4JQZA 4X6UA 4BO7A 3H3JA 2Q4RA 2AE1A 4YRNA 3N2KB 1ORTA 5DTIA 2GO7A 4RD2A 4AZ3A 3L3BA 1NVXQ 4QDJA 4XFDA 2WIGA 3AONB 1N32B 3EXHC 3E8SA 3L8FA 5CDFA 3UWSA 4E5PA 2CLOB 4LHXA 4MUMA 1BU5A 1E5LA 4Q02A 4CN8A 6REQA 4DR6B 4S1VA 1DIHA 2P9TA 5LJLA 4TMFA 1TQ8A 3BRWA 2X8JB 1ABFA 3K53A 4EJFA 4RPKA 5C53B 1JXMA 3QUAA 4WA7A 4JELA 4Q3EA 5KJ1A 1F2TB 5JVDB 3TFOA 3K0SA 2EEZA 3LY5A 5FBRB 2Y76A 4LMBA 5CA1B 1E6CA 1MQ8B 1VKRA 2ZYUX 1FXWF 2XNDD 1LI4A 2XWBF 4IIEA 4P5PA 3ZW8A 3R3XA 4RHYA 3AEKB 2VRBA 1YHZA 4FYJA 4DDTA 1RXSA 2OB1A 3OE4A 3R9WA 1P1BA 2IW1A 3BSSA 2ZTMA 2W7TA 2R44A 3CVYA 3FTNA 3HBMA 4G9GA 2HWKA 5EC8A 1OZHA 4FNMA 1K75A 4WBNB 1G20B 2JGRA 5LNK6 1J5PA 1SVKA 4TZKA 3T5DA 1TEZA 1V4BA 1HFWA 2O7QA 3MAJA 1JG7A 3R7LA 4YGXB 2GDJA 1X38A 1GNQA 3PNSA 2JHFA 3GIDA 3MF4A 2Z9DA 3NAQA 3F47A 5JZVA 3K9FC 4DG5A 3IR7A 1S5PA 3I9V6 1YOVB 4IJUA 1KAEA 1XAHA 2CY0A 4IIJF 2EGUA 2XWSA 4J0HA 4RCZA 2HWXA 3X1XA 5EWLA 2WHEA 1BCRA 3KHTA 3OOJA 3EMVA 1Z88A 4DBZA 2I6XA 2GR9A 3BUSA 4Z7OB 3ZWNA 2D5AA 2XVYA 3EUFA 2ODEA 4X3OA 3T34A 1KI6A 1D7AA 4JS0A 1KPIA 3ETDA 3WXMA 4ZGWA 5JMWA 1XPUA 4XUGB 1TT5B 2GK3A 2CXQA 4N0EA 1NFRA 3WIBA 4I2VA 4UBLA 1N5LA 4G0YA 5C3MA 3LRTA 3D4IA 1VCNA 2PBRA 3FCSB 3C41J 3ESAA 2J45A 4FGKA 1SVSA 2EWWA 3K6JA 1J1ZA 1DG9A 3UJCA 5J4YA 5J2UA 4ENWA 2BZGA 2CVQA 4OQLA 1IZYA 5LA6F 5GONB 1RJGA 4G97A 3EXHA 5JSFA 2FSSA 1ZUHA 3ECSA 2WSSA 3KAPA 2ZRKA 3C6YA 4C07A 2WFLB 4TOIA 2M2IA 1OKKA 1HLFA 2Y92A 1HE2A 1PJSA 4TRNA 4XM0A 1ZDMA 4ID9A 4C0HA 1B42A 3UTCA 3O93A 2J5XA 2AEJA 5LA6A 3IPXA 3LUKA 4BN4A 1USWA 4F4HA 5FOQA 1PVOA 1H42A 4MI3A 4P7FA 1I4WA 1KETA 3E3LA 1JMVA 1HG1A 2ZJ7A 1A2OA 3FOAA 3HDHA 1KXZA 4LTNA 3U7QA 4PWYA 4FJ2A 3BIOA 4WY2A 5SV2A 4DBVO 1GVNB 4RHFA 3QNUA 1M66A 1JJVA 1GA4A 2XNHA 3C4JA 2YBDA 3MA0A 2JRLA 1RQ2A 1WXIA 4MJ3A 3AZOA 3DFFA 3NHPA 1R18A 3PPWA 1CZHA 5CHYA 2X6QA 3ZWDA 4PNZA 2FPPB 3PQ2A 3FPCA 4O2BA 3RWBA 5J4VA 1OLXB 2WTAA 4MB0A 2FKAA 3NGMA 3NTQA 5AOAA 1UPBA 5J47A 1I1QB 5EKDA 1BW9A 1L7VC 1L5GB 2XCUA 2ZB2A 2KLBA 3U7JA 1SU7A 1AQNA 3GROA 3OLZA 3PIRA 2J6BA 3KP1A 4F2HA 2DETA 4FB5A 4PNEA 2WP0A 4XFJA 5D87A 1Y48E 2IUSA