4XEHA

Apo structure of kari from ignisphaera aggregans
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
327
structure length
326
Chain Sequence
AKIYKDEDISLEPIKNKTIAILGYGSQGRAWALNLRDSGLNVVVGLERQGDSWRRAIDDGFKPMYTKDAVAIADIIVFLVPDMVQKSLWLNSVKDFMKKGADLVFAHGFNIHFKIIEPPKDSDVYMIAPKSPGPIVRRSYEMGGGVPALVAVYQNVSGEALQKALAIAKGIGCARAGVIESTFKEETETDLFGEQVILVGGIMELIKASFETLVEEGYQPEVAYFETVNELKLIVDLIYEKGLTGMLRAVSDTAKYGGITVGKFIIDKSVRDKMKIVLERIRSGEFAREWIKEYERGMPTVFKELSELEGSTIETVGRKLREMMFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ketol-acid reductoisomerase
publication title Cofactor specificity motifs and the induced fit mechanism in class I ketol-acid reductoisomerases.
pubmed doi rcsb
source organism Ignisphaera aggregans
molecule tags Oxidoreductase
total genus 127
structure length 326
sequence length 327
ec nomenclature ec 1.1.1.383: Ketol-acid reductoisomerase (NAD(P)(+)).
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain
A PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.40 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like fold 4xehA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xehA01
1NVTA 1VJ0A 4HV4A 1X0XA 4QFDA 1GV0A 2DKNA 3GFBA 4KWIA 4KTVE 3JQGA 4KZPA 3FHLA 2Y1CA 4E3ZA 4ESOA 2C07A 2X0NA 1UP4A 4W4TA 2J3IA 4QO7A 3JQAD 1JVSA 5ES3A 4K6CA 3RUCA 1BXZA 1N92A 1RWBA 4M87A 4RF4A 3ROPA 4CMJA 2X1HA 1KBZA 1RYEA 1YVEI 5FYDA 4F6LA 1DJNA 4CM8B 4DA9A 4P22A 3NGLA 3TZHA 1A9ZA 1NQOA 1JQBA 3I23A 3RUFA 4TRJA 3RIHA 1X1EA 3WDSA 4CR8A 4CR7A 3GQVA 3WLEA 2Q2WA 2D2IA 4RVHA 3GMDA 1GPDG 4CODB 1T4DA 2NTNA 5F1KA 3JQ6A 2B0JA 1XELA 3IDSA 3ZNPA 1NP3A 1PSDA 4IXWA 5I7EA 2BFPA 2AQIA 4YQYA 4YT8A 4I9UA 2HAEA 1OBFO 4QSMA 2QX7A 4XYBA 2D5AA 3T7CA 4FQ8A 3KO8A 3UICA 3I3OA 3PHJA 3BXXA 4BHTA 3MWDB 3ZWNA 5I7FA 2DQ4A 2UYYA 1PS9A 1MA0A 1P45A 3JQ7A 3UXYA 1MB4A 4PLGA 4CLOA 1H0KA 4F45A 3PXXA 4YJGA 3INRA 2NM0A 4CLRA 3U5TA 1QYXA 5T57A 2HMVA 3UGKA 2NVBA 3DB2A 4WLEA 4PG8A 4J16A 3PLNA 2XOXA 1E3LA 1U3WA 3NT4A 3I6IA 1P0CA 3TFOA 5BNIA 1LDBA 4I5DA 3ZH2A 4FOOA 1DC5A 3ROMA 3PGJA 4Y9DA 4TQGA 1BGVA 1NX6A 3GGGA 5F21A 4BNXA 1HSZA 1EFKA 1ONPA 4NQZA 1U4SA 3OQ1A 5CP8A 4CM8A 1XA0A 2C5AA 4CJXA 3PI7A 2B5VA 2D8AA 3RFTA 3EVNA 1T2AA 4YEDA 3MJEA 1HT0A 2CF6A 5KVCA 1JW9B 2PGLA 1KOLA 4B8WA 2TMDA 4BO4A 5CEEA 5L4NA 2IDZA 1YE3A 3TL2A 2EV9A 2XF8A 4KWHA 1A4UA 3GVIA 4Z6KA 1YWGO 4OH1A 5CDUA 1M76A 1WDLA 5EPOA 2AG8A 3RUIA 2OP0A 4IY1A 5JBIA 1NWCA 4E12A 5HS6A 3U0BA 4ID9A 3R3SA 1R66A 5EIOA 2DTEA 4FN4A 2V7PA 3H9QA 4XCVA 2EKPA 5B37A 3PLRA 5CHEA 1TLTA 2AQHA 1QLJA 3HFSA 5BR7A 4UULA 5IN5A 2VHYA 1O9BA 1U28A 3RUHA 3WQSB 4CMBA 3MJTA 1PGQA 4DGSA 5DDIP 5KVVA 3RQSA 3M2TA 5L53A 4K9DA 3PVZA 4J4HA 2I3GA 4XWYA 1PR3A 5L7TA 1MUUA 2RCYA 1Y9EA 3H9UA 2QZ9A 2BFMA 1ZSYA 3ON5A 1N9GB 4HFJA 3AI3A 3WGQA 1D1SA 3C7CB 4XJTA 2HU2A 1P9LA 4RV9A 1OI7A 3F4BA 4MOWA 3ANMA 1P0FA 4BKUA 4TWRA 3WOHA 4UUNA 5F1PA 4EJ0A 5GY7A 4O0LA 2Q1TA 2C29D 1KEUA 3PHHA 3F5SA 4MIOA 3ONEA 4PRLA 4EUEA 3GY0A 3AOEA 1N1EA 2B83A 4E5KA 4O63O 1MXHA 4HP8A 3RU9A 2Y99A 3ZWAA 2Y68A 2W8ZA 2QG4A 3JV7A 3PQFA 5C37A 1OC4A 4RL6A 2JD2A 3JYPA 1CYDA 2GNAA 3V2GA 2ET6A 2B35A 1PU2A 4NPCA 1LC0A 4YT5A 4E33A 1ZMOA 4UAGA 1ZJZA 3LU1A 2J3HA 5K6AC 4KOAA 3WS7A 4I9NA 4QFCA 1V8BA 4PZCA 5MGBA 3UCEA 4J1NA 2X86A 2HK7A 5IN4A 5L51A 5A9RA 1D8AA 1EK6A 1D7OA 4J6FA 4IMPA 4XGKA 3UCXA 5G4LA 2CVOA 3NDJA 2PZKA 4ZQBA 2IYOA 1LBEA 2FSSA 3A4VA 4MIEA 4R16A 2Y1OA 3GH3A 4BKQA 1F12A 4Z3KA 2R6JA 3G49A 3JQEA 3ZV3A 5A9TA 1JVBA 4BO6A 3ZGYA 2YY7A 1QYCA 3GVPA 4OYRA 3EAGA 3KYDB 3K2BA 3TZCA 1V9LA 5CAEA 3PDJA 5C3MA 1I24A 3OICA 4OGWA 1NM5A 1P74A 2O3SA 3TF5A 1N9GA 3NTRA 4JJFA 4DWVA 5BNFA 1U3UA 1PGPA 1XR3A 3LQFA 1PGJA 4RPLA 3VZPA 7ADHA 1E7MA 2P2SA 1F8GA 1EVJA 1JAYA 3RC7A 1XIVA 1LUAA 1AUPA 1LNQA 1A27A 3BMCB 3ZN2A 4BNWA 2ZB8A 1K6JA 2W90A 5TJ9A 4IMRA 1RYDA 4YCAA 2VHZA 2JAPA 2VRCD 3SX2A 3H9GA 3KTDA 2W2LD 4E2WA 4GI2A 3PJEA 3ZW9A 2FY8A 3I9OA 4J1TA 3ZU3A 3I1JA 4D3SA 5HS4A 2ZTVA 2DM6A 4I08A 3LC1O 3NJ4A 4JX8A 1W0CA 4LMPA 4RPJA 3UFXA 1QXSA 4DTIA 1DJQA 4BGEA 1ZW1A 4GGPA 2VHXA 1ZKMA 1DO8A 4Z3DA 2ZYGA 3ETEA 5AXBA 2PGJA 3M6IA 3X2FA 4EJMA 1H93A 1QORA 3ZWYA 4B4OA 4CLXA 3WBBA 5JW6A 1I2ZA 1PJ2A 2QHXA 1I32A 3C24A 3PIDA 4XYLA 4YT4A 4NBRA 3C3XA 3GN1A 4GX0A 3HN7A 4Z0HO 1X0VA 3ZU2A 2OZPA 3E82A 1ISJA 4DLAA 2BHLA 4CV0A 1W4ZA 2WEKA 5DBFA 4J4TA 2GN8A 3JQ9A 3KYDA 4L9RA 5ITVA 2JKVA 3D7LA 3A28A 3B6ZA 2FSVA 4KDEA 3HZZA 3DZKA 4YDRA 3W4JA 4BQRA 2EWMA 4G5HA 2DLDA 2O3UA 3U62A 3WGOA 2FR0A 1QRRA 4OIMA 5JDCA 1NAHA 3M2PA 4CV1A 4XDYA 1SMKA 1ZK0A 2PK3A 3VKVA 1BVRA 4KTTE 4LW8A 3CIFA 4J1QA 3BMCA 1MG0A 1UJMA 1LQUA 2Q1SA 3QSGA 3JQBA 3NV9A 4LVCA 1FXSA 4R1NA 1YXMA 2WDZA 2WMDA 1YB5A 1OFGA 1FDUA 2X9VA 4D44A 2BFAA 3EW7A 4BQPA 1NFRA 2PGDA 4FSHA 1WXDA 4BNKA 4YAJA 2EW2A 4N54A 3GHYA 3H65A 4TMFA 5COQA 1O94A 3TZQA 4AJOA 1GZ4A 5A9SB 5C7IO 3IUSA 1B15A 2OORA 1ULUA 4IDCA 4IDDA 2HRZA 2FN7A 1CERA 1H2BA 4ALKA 2YFQA 3QA9A 4U0KA 2CDCA 5I9MA 1MV8A 2EKQA 3PFFA 1MX3A 3PTZA 1XWFA 2P91A 4Y6SA 4CM3A 1E7SA 1WZIA 2VYVA 4GBJA 3VZRA 4PG4A 1BWSA 3WYBA 2RIRA 3H3FA 3L07A 4ND3A 3O8QB 4IGEA 1O89A 3WGIA 4CLEA 1ZJYA 5ILOA 2PNFA 3ASVA 4J7XA 3LVFO 4WNIA 2GZ1A 4IDEA 4R01A 4KDFA 4D79A 1UXHA 2GN9A 5JDIC 5T5QA 1T4BA 2ZK7A 1I10A 2X5KO 3HSKA 3PYLA 4Y67A 3JD3A 4NNJA 2FPIA 3LT0A 1ZSVA 1LC3A 2EHDA 1V6AA 2HMTA 2PWZA 1LQTA 4WNCA 4EEXA 4CMHA 4IJVA 4DIOA 3AWDA 3AY6A 1YJQA 4YJFB 4WECA 3HDYA 2YV1A 1GAEO 2NSDA 4JROA 4HNHA 2VQ3A 5A05A 5T67A 5IFLA 1U3VA 3DZHA 4PLPA 4YAIA 2P68A 5U9CA 3KSDO 5JYDA 4G65A 3RSHA 1E3JA 4FFMA 3I4CA 5H83A 2FP4A 3MEQA 1B7GO 1R16A 4BV9A 1R12A 4N7RA 1B3BA 1E3EA 3FCOA 4P4NA 4DQVA 5A9SA 5HBRA 1ZNQO 1R4MB 4R9RA 5DCYA 4BUCA 3GFGA 4EUFA 3ZI0A 4YTEA 5DBGA 1PZEA 1XLTA 3OEYA 1ZVMA 2ZJ1A 4B8ZA 1NBOA 1QV6A 2AEMA 4FB5A 4RF3A 4B3JA 1GDHA 1YL6A 2GCGA 1OMOA 2WYVA 4NFHA 3DBVO 4P4LA 4R1SA 5G4KB 3WIDA 4DUPA 3HHPA 2PH5A 1C0KA 4TVOA 3FTPA 2OUIA 2J5RA 2IEBA 2C59A 1A5ZA 2JFGA 1ISGA 5BQFA 2Q2QA 1Q1NA 1E0DA 2JJYA 3AI2A 3O8QA 1K89A 2HUNA 1EEHA 4UUOA 3NDIA 5ICSA 1H9BA 3EGOA 3PP8A 4FS3A 5BT9A 2J5QA 2NACA 2Y1DA 1UDBA 3CMMA 4NR0A 1HE4A 3ASUA 1E6EA 4TRMA 2YV2A 5I9NA 2DBZA 2XAAA 3AM4A 1E7QA 3K5PA 3C1TA 3AY7A 1AE1A 4II3A 2Y0DA 2O23A 3OBBA 3WGZA 1EUCA 4C7KA 1TT7A 1FK8A 4YJFA 4WEQA 1GL3A 3ENNA 1ZEMA 1M67A 3O26A 4XRGA 1E3SA 4AJPA 1HRDA 4I9HA 4ZU3A 3WNQA 5I9LA 3VTFA 5IZCC 3PJGA 2HDHA 2PD6A 3D3WB 5BSEA 4RGBA 5TGDA 4BO3A 2YW9A 4MINA 2VTDA 4DREA 2AG5A 3OIDA 1ENYA 1R4MA 5ENDA 1GV1A 3WMXA 3OP4A 1U2GA 3AM5A 3ENKA 3LC7O 1A9YA 3GA0A 4GGOA 3TWOA 3DZJA 3L6DA 4CPDA 4H3VA 1A7KA 3OH8A 1N7GA 2C20A 3DTTA 3PHLA 5TRTA 1GYRA 1HL3A 3P2OA 5G4KA 3L0DA 1AGNA 1DSSG 1YS4A 1TA4A 5EQFA 3TZKA 4A73A 4UUMA 5JMPA 3RUEA 1VKNA 1Y8RB 4CQLB 2CY0A 2AE2A 4CUZA 4BO8A 3A06A 4NBVA 1IUKA 1RM4A 3GK3A 4INAA 4MJLA 1HTBA 3UW3A 5CEFA 4W6ZA 3DBRA 2QQ5A 5CDSA 3HUDA 2GN4A 4FPXA 2F00A 1DXYA 1PJLA 1SBYA 1UXGA 2DBQA 5TJHA 3U4HA 1X15A 5G2OA 2Y0EA 1LTHR 1NHGA 4FC7A 2BH9A 3KM0A 3GDOA 4N5NA 1PWZA 4AVYA 2VHVA 1ZH8A 4DPKA 1HSOA 1NASA 2O3QA 1JDJA 4NK4A 2IE0A 4Y8VA 4W9NC 1PJQA 4RVUA 4BO9A 4A2CA 3D3WA 4CM7A 2RAFA 2ZCUA 2WWRA 2O4CA 5J23A 3V1UA 1HZJA 2A35A 1FDTA 3V5NA 3E5MA 1V3UA 4YPOA 3WYEA 5IDXA 3Q3CA 5JY1A 4LSWA 2VNSA 4E2YA 3D4PA 1JKJA 2W98A 1E7RA 5TF4A 3JTMA 1ZZEA 4FBGA 4PLVA 4L4XA 4MKXA 4WLNA 3L4SO 1JU9A 1KY5A 2VWPA 3ZHBA 2EP5A 1KETA 2EGHA 1VM6A 2G17A 5A1TA 3DXFA 4B79A 1NFFA 5L4LA 1P33A 4NBUA 2VZ8A 3STHA 4BOYA 2QYSA 1YQDA 3S55A 1Z73A 3KOUA 4QTZA 1ZK4A 4WCDA 4XGNA 2FMUA 3ITKA 4MVJI 2OO5A 3AUSA 2Q99A 3WXBA 3ZNOA 3DBLB 4MIYA 1T25A 2SCUA 1U7HA 4WOKA 4ZJUA 1UAGA 1LA2A 1H2HA 1UH5A 3FBGA 3ZCXA 1XDWA 1WW8A 1CWUA 4LN1A 4Q3NA 3UCFA 3N58A 1UXJA 2IEDA 3VPXA 4FCCA 3W8FA 1PJ3A 4BNMA 3VVBA 3WWZA 4EEZA 4PGFA 2HMUA 3ZDFA 4EUHA 3BIOA 4QUKA 4TKMA 3H7AA 4L73A 1JLLA 4WCFB 3SBOA 5F3RA 1PTJA 4LGVA 4YA6A 5L45A 2NTJA 2Z95A 2NU9A 4FFLA 1VPDA 3OJ0A 4YAKA 4IPTA 4LISA 3TOXA 1AXEA 4BGUA 3LYLA 1DFGA 3GZ4A 2CF5A 5A3JA 4IBOA 3U4IA 4ZVVA 4BO0A 4PIVA 3L9WA 3QVSA 3FTNA 4TVBA 1FDVA 3RKRA 2E82A 3ZV6A 4BV8A 3ZHYA 1ADFA 2CNBA 4MVJA 1E7WA 3GF4A 2Y0CA 4E5YA 1CQJA 3GUCA 4AJJA 4R4JA 3AY3A 1CJCA 3AW9A 1N2SA 1KS9A 1KVUA 3OA2A 2B4RO 4HY3A 4TZTA 1RM3A 4PLTA 1TEHA 4CLRB 1H94A 1H5QA 1KC1A 4ZQEA 1XGKA 3ADOA 2VWQA 4J90A 2D0IA 4XB2A 3RD5A 3GEGA 3RU7A 5K0ZA 2EXXA 4JBGA 4Q3EA 3DBLA 1GEEA 2EG9A 3IKTA 2BD0A 1BHSA 2Y1EA 5K9ZA 1AHIA 9LDTA 1HLDA 3QLJA 1H6BA 2O7SA 1GQ2A 4U0JA 5IAAA 1R0KA 1L1FA 1WMAA 1RM0A 4AG3A 1HKUA 5KWEA 2J5KA 1UUFA 4ROSA 2HRBA 4RF2A 3FNFA 4GSKA 1XHLA 3I9KA 4RPHA 4WCFA 5AXDA 5T8KC 3VAZA 4UUPA 4UVIA 3MJ4A 2WE8A 1J0XO 1YDWA 4CUJA 4BB6A 1C14A 3FWNA 2V6FA 1HDRA 4EI2A 4PN3A 1WNTA 5HRUA 4S1VA 5G0TA 1IZ9A 3MCVA 4HUJA 2WJPA 4YRAA 1Y8QB 4DPMA 4NDNE 3HQ4O 2O7QA 1ENZA 4Q3AA 4MVJH 4GLLA 3GOHA 2P9CA 2B5WA 4OXYA 3BHJA 2X23A 1LEHA 1GUYA 1U1IA 1ARZA 3COSA 1R15A 1ZO8A 2CUKA 2X22A 3HB5X 4MO2A 4IQ0A 1JWAB 3D4NA 2X0JA 4BIIA 4GVLA 5JC8A 1I01A 4J1SA 3QE3A 2NNLD 5THQA 3DR3A 4D41A 5BSHA 3NYWA 3P5SA 4DMMA 4WK6A 4Y6RA 4W7IA 2IXBA 1AHHA 2E4AA 4HFMA 3GVXA 4E30A 1Q7CA 1UAYA 2FR1A 1NR7A 3FPLA 1MP0A 1I36A 5JSFA 3RUAA 2Q4EA 1CIVA 1PJSA 5IDWA 4IDBA 1NFQA 2ZKLA 3DWFA 1NXQA 4R68A 3ST7A 2JCXA 2R00A 1IPFA 1SO8A 1KVSA 2C0CA 5CFZA 2WD7B 4M89A 1PWXA 1ZXLA 4MVJM 4W7HA 5TNXA 3WQRA 3WWYA 1W73A 4OM8A 5LDGA 4O6VA 3AJRA 4OO3A 5HTOA 1UXIA 4MPDA 2UUPA 1XQ1A 2C2YA 4QX6A 3K9QO 4RF5A 4XRRA 3JD4A 1DHTA 4JGBA 1B8PA 1Y8QA 4MVJG 3GT0A 3JYOA 3Q0EA 3VPHA 2NU6A 1KIFA 4XYEA 4RLHA 1XU7A 2G0TA 3ZV5A 1D3AA 4BMSA 4HBGA 5I7SA 1PZHA 3DOCA 3WJ7A 3X2EA 3IIEA 3F9IA 4RDIA 2VRBA 1A71A 4R51A 2VOJA 1FF9A 2QRLA 3WSVA 1ISMA 3F1KA 4A10A 1Y5MA 4E5MA 2QRKA 2GN6A 2Y67A 3ICPA 2PV7A 3ONFA 2IZZA 4QQRA 4YJDA 3KEOA 4IINA 3DFZA 3PEFA 5C7LO 1ONNA 5CDYA 3T4XA 2BELA 3DO5A 1VLLA 3DMTA 1EDOA 3Q6IA 1E6UA 2BFOA 1ZIDA 4MKRA 1JKFA 2PLAA 3R6DA 4DIBA 3LT1A 1GEGA 1DC6A 1PZGA 3HWRA 4MVJP 1EVIA 5DP2A 2VUUA 4XDZA 3E03A 5DULA 4J9UE 4AJHA 1P44A 3K73O 1DOHA 1FMCA 3LT4A 1I0ZA 4ZQHA 2NU8A 1JAXA 3BA1A 3F46A 4TRRA 4YT2A 2O4UX 3OMLA 4IDFA 2JFHA 4PVCA 1UXKA 5H81A 1KC3A 4H7PA 1HDGO 4CMAA 2CD9A 5ICMA 3F3SA 2WD7A 1MGOA 2AQKA 3UF0A 5T6BA 1GYQA 4M1QA 5KNLA 3ETDA 3JQFA 4ZQGA 2JHFA 1YRLA 2VWGA 1PL8A 4PCVA 3ANLA 3WICA 2NQ8A 3I9JA 2JCYA 2BRUA 4UEOA 2QYTA 3TL3A 3WBFA 4CQMB 1HDYA 2Q2VA 1ONOA 2D5CA 4RZHA 5G0SA 1N7HA 2VZ9A 4FJ0A 5JCJA 3H9EO 3RCBA 5BNTA 5L7WA 1HDXA 3L6OO 3PJDA 3C7AA 4BO2A 5IXYA 2BKAA 3DZBA 2DC1A 4NIMA 1P1FA 1W8DA 2AXQA 2BGLA 5C7OO 2PD4A 1AXGA 1ZBQA 1I8TA 2J3KA 3KXDA 3F1LA 3K30A 5TIIA 2VN8A 1P1JA 1V3VA 4FFNA 3E6AA 3L77A 5CPFA 2Y66A 5CG1A 5JY6A 1Z45A 2OBYA 1CEQA 2VYNA 2VZ0A 3I9LA 1SPXA 3GZNB 1WDMA 2A94A 4U8GA 3A1NA 1Z75A 1IHXA 3DHEA 3WFJA 3ZWPA 1DAOA 1UZNA 3KVOA 1HYHA 5ER9A 4AJLA 1BG6A 1Y6JA 2X0RA 3W1VA 3ZWWA 5AXCA 3ONDA 2H6EA 2O50A 3T7EA 1GFSA 3N7UA 4FGSA 4GMGA 4A0SA 2GD1O 4FIZA 3DAFA 4GWGA 3INGA 4UEKA 3LZ6A 4J0EA 4AJKA 1MFPA 4BNFA 4DXHA 4L74A 1ZMTA 4YQZA 1PL6A 2W4QA 2FPGA 3BHMA 1SEPA 3K6JA 5DOZA 2I66A 4OHUA 3CUKA 2IRWA 3KB6A 3OF2A 4WOJA 2JL1A 2ZQZA 5TT0A 4Z0TA 4EYEA 4K1LA 3VDRA 4F6CA 4OXNA 4B4WA 4CQMA 1M2WA 4G2NA 3PIIA 1NVMB 3PWSA 3NDRA 1HETA 3IAHA 2I76A 1A4IA 1YBAA 2NVWA 3U4CA 2Q3EA 3GPIA 4E31A 1WWKA 3K2EA 4OJNA 3TOZA 4D3FA 1OZAA 5ER6A 4IJUA 1VI2A 1VL6A 2YJZA 5EERA 2CMDA 2ZYDA 3CKYA 5JXWA 1Q7GA 3GNQA 4ZRMA 5LDHA 2PKQP 3H8VA 3C1AA 1QKIA 1YL5A 2HMWA 4KUGA 1PS0A 2FZWA 3D0OA 4IDGA 3AOEC 3NUGA 2EEZA 1Z74A 4XQ9A 5FI5A 1JN0A 2F1KA 4CM6A 3GZNA 3PQDA 4U5QA 5JAMA 3BTOA 3O38A 3WX0A 3DBHA 3C85A 3VPFA 4ND5A 2H63A 2OXIA 4KQWA 4BKPA 4Q3DA 5U4QA 3JYQA 3OA0A 3GEDA 3B1FA 2YV3A 3EYWA 4BO5A 4BGVA 4BO1A 3MOIA 3IJPA 1IOLA 3DONA 3KEQA 5DF1A 4GVXA 1GUZA 4FFOA 2POQX 2X4GA 3VC7A 3H5NA 2NLOA 2ZTMA 5ENVA 1ADBA 2RH4A 3VH3A 4NBTA 5THKA 2G82A 3AM3A 4KQXA 4E2XA 4R9SA 2B4TO 1GU7A 4J43A 4C4OA 3LDHA 3H4VA 3K92A 4FW8A 3KV3O 4YWJA 4XR9A 5L40A 3NRCA 3H2SA 4CMGA 3HB4X 3PWKA 2Z1MA 4XB1A 5JYEA 3E9MA 2ILTA 1LLQA 3ZHZA 3UUWA 4WGGA 2XXJA 3RKUA 4DBVO 1IULA 3C8MA 4ZHSA 1K0UA 1PGNA 3RC9A 4DLBA 3C7DB 3I6QA 2DAPA 3O4RA 4XA8A 3ROQA 1U8XX 2I9PA 1EMDA 4PZEA 4WUVA 3JSAA 5TT1A 1TXGA 3DZGA 3IL2A 4ALJA 1C0IA 1C0LA 4QEDA 5JCXA 1UZLA 1XSEA 2ZJ0A 4IS2A 4BKOA 2RHRA 1MFZA 3DOOA 4XYGA 5L7YA 3TQHA 5JO9A 4IS3A 1NYTA 4NU5A 1T1RA 4Q3CA 1R37A 2V65A 3A9WA 1KEVA 5JC1A 4OL9A 2O2SA 3INTA 1MG5A 2OBNA 4ZGWA 3Q2IA 1B8UA 1SOVA 3FI9A 5TQVA 2FOIA 4YJHA 5I7VA 2C7GA 3E5RA 4L4SA 1G0OA 4OKIA 5KVSA 4BB5A 3DZIA 3TSCA 3OJFA 4TKLA 1V0JA 4ZA2A 1GUFA 2BI8A 9LDBA 5TLSA 4LVUA 4IQGA 3BTUA 1DEHA 2I65A 4BNTA 1K6IA 1K5HA 1GADO 2X9NA 2YZ7A 1HDOA 4E0BA 1GTMA 4O1MA 4MVJD 2Q1WA 1VSUA 3BAZA 4FC6A 5IDYA 3JQ9C 1QSGA 3RBZA 3U49A 1M75A 3VH1A 2H5LA 4GSLA 3FR7A 3SLGA 1XQ6A 3NT5A 3OM9A 4E4YA 3ZWBA 1ADGA 1VSVA 2VWHA 3H2ZA 2CDAA 3NAQA 4OQZA 1DDOA 3D3EA 5A06A 1CRWG 4NFSA 5JDCC 2ZTLA 4RQTA 1LLDA 5TC4A 1EQ2A 3MJVA 3GGPA 1HZZA 1Q7BA 1QLHA 1DIHA 1I2BA 1HYGA 2I99A 4NG5A 1LRKA 3JQBC 1UP7A 2Y05A 3GPDG 1O95A 1Q2XA 3DBRB 1M6HA 3F6YA 2YDYA 3V1TC 1YGYA 5JNLA 2O3JA 4LMRA 2O48X 3OIFA 4NJMA 3TZ6A 1X14A 2PZJA 4BNIA 4PG5A 3ZHXA 5EJ2A 4CMEA 1P31A 1TVEA 3GVHA 4RORA 4XX0A 3MOGA 4PLHA 4QXMA 5JLAA 3V1YA 2C2XA 3LC2O 4DVJA 4JJIA 1QYVA 4IXTA 3SVTA 1XKQA 4R5HA 1H6CA 1TI7A 2J6IA 2BGKA 3AUTA 1R6DA 2B36A 4PRKA 1K3TA 3VZQA 3R3JA 3DC2A 3LLSA 4YR9A 1I3NA 2IZ0A 3K31A 3I4FA 3ZW8A 1DIAA 1HLPA 3ADPA 3L6EA 3GRKA 1KVRA 2PH3A 3FBTA 4R3NA 4J7CA 4C7JA 1B14A 3LF1A 3DMYA 4RO0A 1ULSA 4FFPA 3PZBA 1J49A 1JTVA 2FZEA 2HMSA 2VRCA 1U5AA 4QO8A 5BSFA 4CMCA 1YQXA 2W2LA 2YYYA 4GQAA 3B70A 5ITWA 3H6KA 2CDBA 4WLVA 2YHUA 4UVHA 2HLPA 3ULKA 3L4BA 4D3DA 4FD3A 3QVXA 4N5MA 3GC6A 1KEPA 3LK7A 3GDGA 1EVZA 1IYZA 1ORRA 2DVMA 1B26A 1LRJA 2W2KB 3IP1A 1DRVA 3O03A 4JJGA 4DQXA 4Z9FA 2WE7A 3WNVA 4LSMA 8LDHA 3HDJA 4CM4B 1XU9A 1EE9A 4AJ2A 3G17A 5AYVA 3NTQA 3H3JA 1HYEA 1Y9AA 3NKLA 4D0RA 3QV1A 5DOVA 1Y5RA 4GWKA 3TPCA 1Q0LA 3L9XA 3QWIA 4NHEA 1GD1O 3DEYX 3WFIA 2OMEA 1ZK1A 1DIGA 2GZ3A 1WPQA 4HX5A 2E49A 4WJZA 3WGGA 2GDZA 2AA3A 1WVGA 2DFDA 5CDGA 4TROA 2DBRA 1D4FA 2VCYA 4OSPA 5L95A 2DPGA 1U3TA 4RZIA 4FDAA 3PYMA 5BSGA 2B69A 1BDBA 1WDKA 5F1OA 4AFNA 1XG5A 2D1YA 5G0UA 4JNKA 5KCZA 5KIAA 2H9IA 4IZHA 4XQCA 4B7CA 1BTOA 1G6KA 2PFGA 1MXFA 2PR2A 1MLDA 4YVFA 3AFNA 2AHRA 3BTVA 4IDAA 1T2EA 3V2HA 3HADA 1Z7BA 1EBUA 2ZTUA 1LSOA 5LCXA 2XPCA 1ZXBA 3QJ5A 4L0QA 3KYBA 1MC4A 5KKCA 1X1TA 3GN2A 1QG6A 3I83A 2RHCA 1E77A 2XXBA 2I3AA 2CZCA 3GAFA 3IMFA 4ZD6A 3QP9A 1CETA 4XZ3A 4E6PA 3DFUA 2W2KA 1DBVO 4IIVA 1LDYA 2OGUA 3ANNA 2UUOA 1K2WA 1RM5A 1LSUA 1PQUA 4JXKA 4CM4A 3GGOA 2EKLA 3GAZA 4DIFA 4TZKA 4WKGA 4NFYA 4XQGA 5JO0A 4WLOA 3BYZA 1EZ4A 3VHRA 1B16A 4JCOA 1I2CA 2DBVO 1Y81A 1LJ8A 2EJVA 2PKQO 2Y93A 2OFPA 1SC6A 1NWHA 1TB4A 3ZWXA 3GHHA 3IUPA 1PQPA 5EESA 5AVOA 1R0SA 3WTCA 3AOGA 4GLOA 2GERA 5A5FA 2FWMX 5B4UA 3W6ZA 3NTOA 4M8SA 1E1LA 5CPBA 2ZATA 4M49A 3HG7A 5B4TA 2GASA 1FDSA 3VPGA 3KHUA 5CDTA 3A14A 5JCJD 2GR9A 5FFFA 5FWNA 3ETGA 3IQDB 3RC2A 4EDFA 1HE3A 4AJEA 5DBIA 5ADHA 3KSUA 5AQ1A 4CM9A 3AK4A 3EDMA 2UAGA 1E5LA 1F14A 5FF9A 2JHGA 4LRTB 3AUUA 4HADA 2VYND 1IHYA 1W6UA 4NK5A 3HJAA 3DAGA 4MVJF 1DFIA 1N8KA 3VH4A 2H1SA 4XGIA 3S2IA 1DB3A 1EBFA 4RJTA 4M55A 3E1KA 3WR5A 5EQDA 5A02A 1CF2O 2G1UA 3OSUA 1UDCA 4N18A 1U8FO 4Q9NA 3RBVA 1KEWA 4G81A 1BW9A 5KOIA 1DRWA 4I5FA 3BMOB 2X0IA 4I8XA 1AN9A 2YQ5A 1ISIA 3FNHA 4X54A 3RC1A 3WGTA 3KLPX 4OKNA 4XYMA 4A7PA 6LDHA 1OOEA 1NQAO 3RFVA 4J3FA 1E1KA 4P4GA 3RI3A 3TJRA 1L7EA 4AJIA 3TDKA 3UH1A 3G79A 4NI5A 3G1UA 3OECA 3H5RA 4ONEA 4CQMD 3E8XA 4S3MA 4ND2A 1CDOA 3B1JA 3PJFA 2NADA 3MJCA 5IF3A 1SAYA 2PZLA 4QT0A 1ZFNA 4NU6A 1T24A 1GZ6A 4U7WA 2Q1UA 2HKIA 2JCVA 3EUWA 3AFMA 3EVTA 1R0LA 4LK3A 4YAGA 3D5QA 3MTGA 3PFWO 3FRJA 2EIHA 4R69A 4RVGA 2X5OA 4CM1A 3KRTA 1DRUA 4GAEA 1ENPA 1NPTO 2IYPA 1SNYA 1J4AA 4BNZA 7MDHA 3GMSA 1KY4A 1C1DB 4BNHA 3R0IA 4BVAA 3DOJA 4GL4A 1O0SA 5A4DA 4DYVA 1SCUA 3P19A 5GMOA 5EINA 4RVFA 1DC3A 2P5YA 4JP2A 2PY6A 4M54A 2IODA 3PRJA 4R41A 3KSZO 3OQBA 3HNPA 1G0NA 4DLLA 3WB9A 4E5NA 5G0WA 4DL9A 1BRMA 1JKIA 4NZ9A 4OAQA 4PLZA 4B7UA 5K6AA 4FJ2A 3BMOA 3QVWA 1DIBA 2R2GA 3EY4A 2WYWA 2ZB4A 2GO1A 1X7GA 4J2HA 4HWKA 3FN4A 3ROKA 1X7HA 3PYXA 3Q9UA 4P38A 4RPKA 1NNUA 5EL0A 5CG2A 3MWEB 3T4EA 4D0SA 1NPDA 4XEHA 2YDXA 4PLYA 3ZV4A 3CXRA 3CZRA 3U09A 3ZWOA 4D7AA 1DHRA 4NH4A 1TT5B 5JFOA 1PJTA 1IB6A 3WGHA 5FEUA 4EBFA 4A27A 1B8VA 1WMBA 2DTXA 5F5NA 3QWBA 1UR5A 1PIWA 1LDGA 1QP8A 1T1SA 2CVQA 2P9GA 1ZUD1 3DQPA 3ABIA 3D4OA 4J49A 1LDNA 2GZ2A 3OEWA 2VT2A 1GCUA 2VYVD 3EZYA 4O59O 1YL7A 4U6QA 1UP6A 3GRPA 3HE3A 1C1DA 4ALIA 2JAHA 1ADCA 4OOFA 3TN7A 1DLIA 1OAAA 2NWQA 4GKVA 4UREA 4WCFC 3PK0A 1VE9A 1YONA 2QW8A 1E92A 4KP7A 3GG9A 3I5MA 2B37A 4D45A 3PHIA 3EK2A 5TSDA 1VKOA 3ZWVA 3OQ6A 2X6TA 4RPGA 5DN9A 5KJEA 1J5PA 2YFHA 3PWZA 2NVUB 4W99A 4D43A 4CM5A 5L4SA 2HCTA 1P1KA 2D3TA 3WSWA 2AMFA 1KYQA 4XIJA 4RVSA 3S1LA 5A3VA 3N74A 4AJ1A 5LC1A 1FDWA 3IOYA 5EMHA 2Z5LA 3GR6A 1E3WB 2EERA 5IJZA 2P9EA 3KUXA 1U2DA 1QYWA 5MDHA 2A9FA 3JQAB 2EP7A 3WTBA 1EDZA 1TT5A 3PGXA 2I67A 4FFRA 4I1IA 1A7AA 4YXFA 3RAJA 4GX5A 1X7DA 1I30A 3E48A 5DZSA 2EJWA 3G3EA 4B4VA 4Q39A 3V2UA 4TRNA 1K6XA 4BMVA 3WQQA 3JD1A 1IE3A 1EFLA 4JK3A 1YBMA 5CEJA 4AJ4A 4ALLA 1VJTA 2C5EA 2Q45A 4PG7A 1PGOA 2VNAA 4K26A 2AEJA 1NR1A 1BXKA 4BL5A 2QZZA 4OQYA 1LLCA 4PZDA 3D1LA 1RPNA 1C1XB 1ENOA 2R00C 2IZ1A 2O2YA 3RASA 2X58A 3BMNB 3SC4A 2UVDA 4J9VA 4J91A 5AOVA 1R4NB 3C1OA 3DBHB 4DQUA 5I8ZA 3F5QA 4EZBA 2NTVA 1KVQA 2GSDA 3R1IA 1A72A 2WD8A 2NVUA 3JQ8B 4YRDA 2QIOA 3D5TA 1Z6ZA 4BNYA 2D4AA 1WAMA 3H9JA 3I9MA 2X9GA 3VDQA 3KETA 1QYDA 4H16A 2WSBA 1T2DA 4FGWA 1O8CA 2V6BA 1C3VA 3LF2A 3G0OA 1NQ5A 1ZK2A 3NT2A 4E5PA 3AU8A 3WLFA 1E3WA 3OIGA 4MP3A 4PLFA 2J3JA 1YH3A 2HO5A 1BVUA 3U9LA 3VTZA 1Z82A 3AU9A 3VVCA 5IZ4A 4WPGA 2V6GA 2YUTA 3DAPA 2EW8A 3JQAA 5COAA 3QRWA 2E48A 1ZSNA 4KUEA 2C54A 3Q2KA 5KJ1A 4BMNA 5KJ6A 1PR9A 4WASA 4CMIB 4GKBA 5JAZA 1UDAA 3VPSA 3DMTC 4EITA 3VZSA 1HWYA 2OOSA 1C0PA 4WEOA 3F47A 2IXAA 4E13A 1I5RA 4BNGA 3M1LA 2FPPA 1EQUA 1DPGA 1Q0HA 3IJRA 4M86A 5JDIA 1Z7EA 3JD0A 4L75A 3CH6A 3DHYA 4II2A 2C82A 4DBZA 1PJ4A 3W6UA 4L4RA 3WYCA 3RVDA 3CSDA 3K96A 2ZIZA 4K28A 2VOEA 2UV8A 1C1XA 1IY8A 3OJEA 4WE3A 3ITDA 4A03A 1NHWA 4JP3A 3BMNA 2Z1NA 1SZJG 1R4NA 3JQFC 3TRIA 4CR6A 3MTJA 4JN6B 3FSRA 4CV2A 3ZNNA 1NAIA 4LCJA 5B1YA 1T2FA 3JQ8A 1HE5A 2P5UA 3WJAA 3WG9A 5JE8A 4ZICA 4IM7A 1DIRA 4R54A 3RFXA 1KVTA 1LSJA 1ZCJA 2EGGA 3JQDA 4ALMA 2PD3A 1E5QA 3QWFA 4YJHB 1DC4A 4P8RA 1U5CA 3FPCA 4XJSA 3QWAA 3BMQB 4FOSA 1PJCA 5JAQA 3S2EA 4BS9A 4AICA 4XR4A 3NEPX 1PZFA 2I5PO 5KVQA 3P2YA 5I8WA 1WLYA 3UHAA 1LRLA 1E6WA 3GVCA 3PPIA 4L76A 3LSYA 6ADHA 4IIUA 3S2GA 4CMIA 4A26A 3FWZA 4Y98A 3WMWA 2I6TA 1ISHA 5U1PA 3E9QA 2PTGA 2Q50A 1YQGA 1YBVA 2FR8A 5B12A 2G5CA 2RBEA 5DT9A 3UAGA 5IG2A 4YAEA 2G76A 3NGXA 2HK9A 2B4QA 3JCZA 5GZ6A 3VOSA 1LXCA 1V35A 5A5EA 1VJ1A 3VH2A 1XCBA 2LDBA 1YDEA 4AL4A 3MZ0A 2HK8A 4J7UA 2WM3A 1E3IA 2Q49A 3IP3A 3DDNA 1H6AA 3SJUA 2DTDA 4BO7A 2YQ4A 1RKXA 1E7YA 4OXKA 2BI7A 3MJSA 4UVGA 4XD2A 3FD8A 1L7DA 1Y1PA 5IZCA 1YB4A 1NQTA 5FI3A 4NJMB 4YYZA 2GUGA 2O3RA 2GYYA 2NU7A 3I52A 2DT5A 3UKOA 1GY8A 2FRDA 3U3XA 4YRBA 3HDHA 4URFA 2UDPA 2AW5A 3IS3A 1RJWA 3E18A 4IJKA 4W82A 2DUUA 1ZK3A 2HSDA 2JD1A 4B3IA 4IQ8A 1I3KA 1YKFA 1FJHA 3CEAA 4Z9YA 3H5AA 5JPIA 1GQYA 4GX2A 2Q4BA 3OJOA 2VUTA 3ZNQA 3BMQA 2CSUA 2O3TA 2YHIB 1P1HA 4FR5A 1T2CA 4F46A 1B0AA 2TMGA 1HE2A 3IKVA 1QV7A 3NJ8A 1Y7TA 2BMAA 3ORFA 3PDUA 3QY9A 3RROA 4ZN6A 1EUDA 1P1RA 3EMKA 3D64A 3OFSA 1QMGA 3HFGA 2AQ8A 4RCVA 3GG2A 4Y6PA 4CL3A 4CLHA 1DAPA 4B3HA 4JBIA 1EK5A 3TFQA 1VL8A 1PL7A 3LT2A 1PEDA 2VUSA 1ID1A 3ZWMA 4ITUA 3CTMA 3JYNA 4CM9D 4R3WA 4MVJE 2VHWA 2CVZA 4D46A 1IL0A 2ZB7A 5HWSA 1OC2A 1BXGB 4R1TA 1EVYA 4PLCA 3I9NA 2DU8A 3F4LA 3LLVA 5KJFA 2E37A 3SJ7A 2X8LA 2ZB3A 4BNVA 3B20A 4GX1A 2JD0A 3UVEA 1GZ3A 3BZUA 3PHGA 3CZMA 2DPHA 3KZVA 4YBZA 5EN4A 1YOVB 4XQEA 4W9NA 4BNNA 1VC2A 4J0FA 4OSOA 2P4QA 2ZCVA 4DPLA 2P4HX 4GPD1 1E1NA 3P7MA 5H82A 3RJ9A 3SEFA 3TNLA 1XEAA 3JD2A 5AXAA 1H9AA 2VT3A 3Q9NA 3QVOA 1SB9A 3OHSX 3AUAA 1IPEA 1P3DA 4YB8A 1HEUA 1GCOA 4ZRNA 1V3TA 2C7VA 2YHIA 3K8ZA 1P1IA 1PX0A 2GPTA 3EHEA 5HM8A 3AI1A 3GNSA 2E6UX 5COBA 3W4IA 1O5IA 3Q1LA 4YACA 2Q46A 2WYUA 5GZ3A 4NJOA 1LLUA 1LI4A 3CINA 3FF4A 1J6UA 2ZYAA 3KYCB 4I5EA 3PQEA 3FR8A 4UVDA 3OJLA 2BLLA 4O5OA 3RJ5A 4PFJA 1CQIA 4CV3A 4OOEA 1SOWA 3QWHA 1D1TA 4BNJA 4PVDA 3EC7A 2GLXA 2CFCA 4MKZA 3UOGA 3RUDA 4HKTA 3DTYA 3SLKA 5JS6A 1GPJA 1M6WA 1B3RA 1BXGA 4N5LA 4D42A 2HQ1A 1I3MA 1XYGA 5HA5A 1MC5A 5C5IA 1IZ0A 5KKAA 4H15A 3V8BA 2PKRA 1HXHA 2FHSA 5L9AA 1HDZA 5KJCA 3SXPA 3JYLA 1B2LA 2J8ZA 3S8MA 2JFFA 1VL0A 3B1KA 1YOVA 4PG6A 2GGSA 1WZEA 2A92A 4ZQFA 3CMCO 5T64A 1N1GA 3GNTA 4IUYA 1LX6A 4IJWA 5IXSA 4I5GA 4AJNA 1U7TA 1UZMA 2HJSA 1S6YA 4OMUA 4KMSA 3DL2A 3QHAA 4CL8A 3GLQA 3Q11A 3GEMA 4BKRA 5G0VA 3JQCA 4LRSB 1O6ZA 4K6FA 3W4KA 4MDHA 4QECA 3HDQA 4Q3BA 4CMKA 3BHIA 2EF1A 1ISFA 2OHXA 3CE6A 4GH5A 3QW2A 4Z0PA 4DYDA 4PLWA 3UN1A 4HXYA 3FNEA 5A03A 5DP1A 4NMHA 1EUZA 4KUHA 1ML3A 4BNUA 4E2ZA 1M66A 1S7CA 1PS8A 3KYCA 5DCUA 3PZRA 3S2FA 5DCWA 3M1AA 1KERA 2NQTA 4JBHA 1GQQA 4LCEA 4ND1A 4WLFA 5L3ZA 2GRAA 4EGFA 1Q0QA 1I33A 4R5MA 3KLMX 4L8VA 5TS3A 1BSVA 1F8FA 4FJ1A 4XIYA 3QVTA 1SB8A 4ILKA 4DC0A 4B7XA 1HF3A 3HN2A 4GMFA 3DHNA 4IZIA 4RVDA 4B4UA 3SC6A 4JLWA 4ALNA 4F3YA 3KBOA 4JIGA 1BDMA 1F06A 2GF2A 3DZFA 5DNAA 4Z9XA 3VKUA 5A04A 1GR0A 3QQPA 3O9ZA 2V6MA 3W8DA 5TX7A 4CMEC 5T8KA 1F17A 1PJBA 2AEFA 1YO6A 3ZU4A 1HDCA 1LU9A 1LDEA 3EZLA 3ZZNA 1E1MA 4DRYA 3IC5A 2D59A 1U4OA 5B4VA 5F5LA 5ILGA 1EE2A 1NVGA 4DMLA 2OL4A 1QR6A 3E9NA 3GDFA 4UEJA 4UVEA 5KTKA 1ZEJA 3ZU5A 4MP6A 2WTBA 3GUYA 4J2OA 4JQCA 1BW9B 2PZMA 2RH8A 1G1AA 3ICCA 1Y8RA 3JQGB 4CQLA 4BGIA 3CPSA 2X7HA 5GZ1A 5IDQA 2Y1GA 4RDHA 1T26A 4EJ6A 1U9JA 4HFNA 1PQWA 1JA9A 1LSSA 4E21A 3NX4A 4ND4A 4WLUA 4EW6A 3W8EA 3U4DA 4HFRA 3FNGA 2X5JO 2VTEA 1SEVA 1LDMA 1DFHA 2OP1A 2ZQYA 4RQUA 3L4BC 4RLSA 4A5OA 1P77A 2NV6A 1YB1A 3QIVA 3WGYA 1JWBB 3ZWCA 4NBWA 4DC1A 4CUKA 3OETA 2LDXA 4XKJA 1I3LA 3RWBA 3RBXA 8ADHA 1NPYA 1NTOA 4J4BA 1YJ8A 3WIEA 1DLJA 1N5DA 1GYPA 4HNGA 4R1UA 1X13A 2NUAA 1VRWA 4MP8A 4IGFA 4TSKA 4CLDA 2DUWA 2HJRA 4U6SA 1WP4A 1BMDA 2QRJA 3BTSA 1F0YA 4E32A 2AE1A 2BF7A 5JAIA 3JQ7B 2PA3A 5JMWA 2BGMA 3G1TA 4CLOB 2DFVA 2Y1FA 4YJGB 1H6DA 4BNLA 2A4KA
chains in the Genus database with same CATH superfamily
4LDZA 3J7AC 5J58A 1UQTA 4G1BA 1NR5A 1LTQA 1YZHA 4TXMA 5AVJA 1QV9A 1NJ2A 4R83A 3JQGA 3ZEIA 3U1TA 5K4AA 3FHLA 4DNPA 1XMQB 1N0VC 4JGIA 4E3ZA 3DH0A 3M6WA 2P1DA 4XVQA 2ZB2A 1TYEB 4QO7A 1HV8A 4UTRA 1JB9A 1IHDA 3V42A 4EVSA 2HLHA 2WIFA 3AVOA 3JQAD 3LG2A 5ES3A 3HCFA 3RUCA 2XSZD 1NUSA 1BXZA 1W5AA 2OHGA 3M9WA 2D54A 3CPJB 4IV5A 3I5XA 4C2TA 4RTMA 2EX1A 1XZDA 3GDWA 3NTXA 4MUJA 2QLNA 4CM8B 5AVYA 3W5AA 5F52A 5EHGA 3NAMA 2JS7A 3TZHA 3TVYA 1MJGA 3VSCA 2ZRGA 3WMEA 3ZQJA 5FA8A 1Z0DA 3I0NA 1IOVA 2X0DA 3RRFA 3IRVA 3RUFA 4TYWA 1KZ4A 1X1EA 4MTLA 3EPLA 4CR7A 5LP1A 1P7VA 3AB3A 3B53X 3QI2A 1NA5A 1GPDG 3GMDA 1KMHA 4BFCA 2FWRA 2NTNA 1Q44A 4B40A 4B87A 5CYPA 3IDSA 3EPKA 1GO2A 1Y33E 1BA2A 4RGQA 3ZNPA 4ON9A 1KY3A 1TVKA 2GHRA 3F2VA 3H2IA 1W87A 4IXWA 4I3GA 4IVQA 4CDRA 2BFPA 2AQIA 1N2IA 1VG1A 1A88A 1OBFO 2LUOA 2QX7A 4FI3F 4QSMA 4R31A 2D5AA 4RY0A 1EJ6A 5FI1B 4FQ8A 3T7CA 3Q7SA 3UICA 1QRAA 2RKOA 1N33B 2XCUA 4WJKB 4BHTA 4Z1MA 2BCEA 5FPQA 1NVFA 2FUG6 2UYYA 1MA0A 1EPUA 1KR2A 3JQ7A 3ME5A 2NPIA 1UZAA 1QFMA 3OWXA 3DL4A 3L46A 4Y9RA 3R41A 4PO1A 2O1XA 5JNVA 2CEAA 4AS2A 1I9CA 4RZUA 5AW2A 4GXTA 2CL0X 2OV6A 1UJ5A 5CURA 1V16A 4HDNA 3TH5A 3RRBA 5LQAA 3VI3B 5IK2A 4J16A 3PLNA 4UTOA 3AESA 4EHIA 3DTVD 1RI3A 1U3WA 2JCBA 3LQYA 3NT4A 4IIEA 3R8FA 2ZROA 3I6IA 1N78A 4KQFA 4YMSA 2IYVA 4JVNA 5BNIA 1S5PA 4CFSA 3TFOA 1C30B 2CLMB 1YZVA 1XMOB 3ENZA 2G4CA 3NHWA 4EENA 2V7BA 2UVPA 3IKLA 1H4SA 3TUZC 3BH7A 1TF2A 1EWTA 3GJ0A 4TQGA 2BWJA 4X8HA 3UHFA 1HSZA 2O8CA 1EFKA 1TNDA 1VE7A 4KQ9A 1U4SA 1B23P 5CP8A 2V74B 3CZCA 1T8TA 1CZKA 2TRSB 1N5IA 1SKQA 4GG1A 3GELA 1I2AA 4L7QA 1WE2A 1Y4DE 2Q3HA 3AV0B 1TO1E 4WZAB 4CJXA 2GHIA 1DCMA 3OZTA 4Z3OA 3T41A 1F0KA 1YD7A 4GLBA 4RVCA 4DMRA 2AKEA 4OH7A 4L28A 4R0MA 4EMBA 4BRWA 4B8WA 5CEEA 4TXNA 2X4DA 4EI8A 3GCWA 3KKQA 1PLKA 1T3HA 4EY4A 3LP8A 1G5TA 4HWRA 5ICFA 4H1TA 4DDMA 2A1IA 2JI8A 5FTKA 3ZLTA 1A2OA 4CKEA 2WJHA 5HQ3A 3ZHTA 1AQLA 1EM8A 1W49A 5LXTB 3HVKA 5EPOA 1E79A 4NNPA 3H8WA 5JBIA 1NWCA 5E0KB 1NW7A 1ULBA 2FPXA 3B9PA 4ID9A 5HS6A 4E12A 3K70C 1R66A 3B1VA 1TL7C 3FUVA 2V7PA 2VLIA 3HH8A 4M21A 1QIFA 3BXPA 1IJFA 1J9EA 2R62A 3M5CA 3RBAA 5HKOA 3ED5A 1SXPA 3ZIAD 2JG3A 1NY6A 4W1SA 5ANRB 4AX4A 4BMZA 3OIVA 1T0UA 3WK6A 4HVAA 2BI4A 4NICA 2Q4DA 3DLCA 5EMNA 1P8JA 1U28A 3CUUA 3ORHA 2BR5A 1V8FA 1EFPB 1TECE 2WAMA 4MLZA 2YWBA 1HTWA 3E35A 3R3VA 3L0OA 5EP4A 5H4GA 4XPZA 1WCIA 3ZX4A 1Z6YA 3OE7A 4IIDA 2RCYA 1Y9EA 5J40A 5CIYA 2QZ9A 2BFMA 2L82A 3ON5A 2C3YA 2OV8A 2WF9A 2A1UA 1TUGA 2O8BB 3TLGB 1NLMA 1MOSA 1YIOA 3PV0A 4X3OA 4B31A 1GGVA 1I4WA 1YVPA 4WXRA 1P0FA 3ELDA 3LL4A 1JI0A 4UUNA 4EJ0A 1SPBS 5GY7A 2XUJA 4RJLA 4UM9B 4CVNA 2DRIA 1M1YE 2C29D 3CBQA 3MLEA 2FH5B 5JVDA 1KEUA 3ZEAA 4EUEA 3OCVA 1WQ3A 2Q5JA 1AGRA 3ZKWA 1NBWB 2YBDA 1YR3A 4O63O 1MXHA 2VP2A 2P6UA 3RU9A 2NZWA 1V1RA 4X65B 2C1ZA 5HZGA 5FA5A 3LHDA 5B1EA 1Z06A 4GUDA 1YRBA 1OC4A 3X3HA 3JYPA 3DMHA 1ZH4A 1NC1A 821PA 1BWPA 2A5GA 1OU4A 1ZWLA 2ZUWA 1HNWB 2QTVA 4E09A 1J09A 3LU1A 1ZQ1A 4KOAA 2V7QA 1NT4A 3JVEA 3TR5A 4C7BA 2J0UA 5JVDF 3EZ6A 4OPMA 5BN5A 2D4HA 2YBEA 2HK7A 2C5LA 3SQMA 4G1VA 3KB8A 3W79A 1EK6A 1GTG1 2YKGA 4IMPA 5E9JA 4EUNA 2W6IA 4XGKA 5G4LA 4EG8A 2G0NA 1ZITA 4JJ4A 4LA4A 2CD7A 1ZONA 1LBEA 4KK4A 2B0CA 3KOMA 4MRAA 3S5UA 2OFXA 2GBFA 4XGRA 2ZJ5A 3BZWA 2WQ7A 2VFAA 5LB4A 3Q8WA 1JVBA 1FNBA 2G71A 3LX4A 3ZGYA 4NY1A 2MINB 5CHYA 5IXJA 1QYCA 2A4MA 1IEXA 4Q4JA 3P94A 1DUSA 5CAEA 3PDJA 1MH1A 2OO3A 3GEEA 3H4MA 1H8HD 1ACMA 1I24A 4OGWA 1TJPB 1NM5A 4LJSA 2O3SA 3QG1A 4HQNA 4DRXA 4JJFA 4DWVA 3EEOA 1XR3A 1GSIA 2C1XA 3D0KA 5CB6A 2FWPA 4H6XA 1FRVA 1ECJA 1W75A 2IXEA 3H2GA 3DAOA 5J2TF 4AF6A 3U40A 3EW9A 1LNQA 4P5DA 1KJQA 4DLXA 1NJ6A 3ZN2A 1AA6A 4QUGA 1R0WA 2ZB8A 2W90A 4B3DA 2EKDA 2GCIA 2R87A 1B43A 3ZXIA 4EM6A 4LHWA 2DPMA 1FLDA 4X3CA 2X3FA 1DCFA 1AO3A 3K5WA 2VRCD 2ORVA 2O0MA 1BX0A 3A1FA 3H9GA 2W2LD 1C3OA 1Q7EA 3NHLA 4Q16A 2V7GA 4OJKA 2D0OB 4E2WA 4OBBA 5LUAA 3Q12A 2Z5GA 4X9XA 2QZSA 3I9OA 4Q9DA 4AIRA 3I1JA 5LYJF 2OILA 3KR1A 4DCJA 4D3SA 5JXGA 2GBLA 3DKIA 4I08A 4CT0A 4EI7A 1TTTA 2QLJA 5K2MA 2ZYVX 3TB6A 4MUNA 4PRZA 4NZNA 2IIPA 3LPMA 4U7TB 2CWWA 5KVAA 2JFXA 4ZV4A 1Q0SA 3P2IA 5LP6F 2UYGA 4Z3DA 3JAMA 1I6KA 3ETEA 3C5HA 3H18A 3NVAA 1H93A 1QDEA 3U7HB 3EXEB 4MW0A 3ZWYA 4B4OA 4KIWA 1J8YF 3N07A 3G7NA 4GYKA 3TX2A 3S68A 2CWDA 4RFSA 1ZMBA 1N6PA 3EXHB 5AJTA 3C16C 3GN1A 5D8DA 2HBQA 3HN7A 5ED4A 2FE4A 3ZU2A 1MDBA 3E82A 3P4YA 1ISJA 5JFTA 4PM4A 2HYDA 3QI7A 3GLGB 3A36A 2F43A 2O8EB 3ZD7A 3NHFA 3HSSA 1XZLA 4J4TA 4RFVA 4IJQA 3E5HA 4AZSA 3VMFA 2R6FA 3M5PA 3OOJA 4F9EA 3LE8A 2CVPA 3DZKA 4O4JF 4YDRA 3W4JA 1GKKA 3C3CA 3IHLA 2PUFA 3WGMA 4FFWA 1QRRA 4E03A 4AZ3B 3URMA 1NAHA 4QL3A 5JYBA 4XDYA 3EEFA 5F76A 1ZK0A 4ANFA 3VKVA 1CEXA 4AN1A 4LWPA 1G59A 2UVQA 1KDPA 1XEWY 2FVYA 1P4GA 3KB1A 1JE1A 1EG7A 4F04A 3CIFA 3HWSA 4LEIA 1A7UA 1MG0A 4M9SA 5IS2A 1QGOA 3K1ZA 1T0HB 3NV9A 3U9SA 2Y92A 4WW0A 3ZK9A 2QTLA 2WYIA 1RQ7A 2OFWA 4R1NA 1YXMA 3IMCA 5HFNA 4HRXA 4Q03A 5BUSA 1OFGA 3QOFA 1RYBA 1M1YB 3EW7A 4FGLA 4LNAA 3EZNA 3EIHA 3VC1A 3T7RA 4WK0B 1WUIS 3A25A 1RPAA 1HMYA 2GN1A 2VPYA 2O2ZA 3GHYA 3H65A 4TMFA 2ZYUX 1GZ4A 5C7IO 5CFLA 2C9MA 3AZQA 1R1DA 3QF4A 3VAZA 1J8MF 1L4LA 3FYHA 3U1VA 1GGJA 3HEAA 2K87A 2BFEA 2QTBA 4DBLC 4FKMA 4JOQA 3QA9A 1DJLA 1KXZA 2PO7A 2P1RA 1BMFD 3SAJA 3ZY3A 2CDCA 3MVEA 5I9MA 5I01A 2EKQA 1JQEA 3PTZA 1KJJA 1ZIXA 1XWFA 2P91A 1TQ2A 3ECAA 1RPJA 4O1IA 4E2FA 4AY4A 2RIRA 3H3FA 1DQYA 1QH8A 3L07A 3MCZA 4ITVA 4O4LB 3RLIA 1O89A 4ENQA 3FROA 1TU3A 3WQHA 2WKRA 3ASVA 3DEHA 5C9ZA 1P60A 1FTQA 2JIQA 1Q7TA 2Z2IA 2O0KA 1COZA 1Y63A 4FONA 4IDEA 1A8SA 3V1LA 4X64B 2PUHA 5HOQA 1UXHA 1RWXA 5F2EA 1GQOA 1F3OA 3K05A 1E1QD 5DGIA 3J81k 2ZXFA 1I10A 1Z8DA 3FDJA 8ATCA 4Y67A 3JD3A 1KPIA 3RTCA 3LT0A 1W0KA 4LY6A 3C3DA 4D4HA 3N0TA 3B7GA 2ZUBA 1ZSVA 4GRIA 2IPOA 1V6AA 3AHIA 3ONVA 5HBGA 3FMPB 5FNVA 4IJVA 3IB6A 2K7ZA 1JYSA 2ORED 3AWDA 1JAZA 1DKMA 1M83A 1QCDA 1XTKA 4Z7JA 4EARA 1FVFA 1ZDMA 4HEA6 2SKDA 3GRYA 5JSZA 2OC4A 2J5XA 2YV1A 3HU5A 3KT3A 1OV4A 2QPLA 3KZKA 3P27A 1USWA 3QJGA 2VQ3A 5A05A 5DCLA 4WXMA 1U3VA 3TLYA 5IFLA 1NONA 1FSGA 1Z4OA 2A9JA 4MWZA 2EBHX 2OUKA 3L1VA 3OCUA 3TAUA 1YBFA 2Y1XA 3G13A 4TLEA 2BFFA 3RSHA 3F8TA 1UWLA 1QX3A 2FFQA 2X0KA 5H83A 5L3SB 5ESRA 2JDID 4KRGA 3HBNA 4YAUA 1R12A 3V6MA 2PA0A 2VQSA 4P4NA 1MW9X 2X4LA 4UHKA 1ZNQO 3CEJA 3LUCA 4G6ZA 5DCYA 5L3RA 3BK1A 4BUCA 2AI3A 1W2WB 4FHGA 1HL7A 1QVZA 1Y1RA 1F8XA 2NZJA 2ZJ1A 2F8TA 1PSZA 3QA3E 2XTJA 2IYSA 1JLKA 3S0JA 3UJ7A 2G4VA 4RF3A 4B3JA 4LZAA 6Q21A 1OMOA 4P4LA 2W83A 3CR8A 2AVDA 4Q0MA 5AJZA 1W5SA 3DWIA 4TVOA 4LQDA 4P6VF 4HDRB 3EQ8A 3MGAA 1A5ZA 2JFGA 5AKKA 1ISGA 4MQ4A 3UY4A 2JJYA 1Q1NA 4ARUA 5JFGA 4IVRA 2QLMA 3HZHA 4D9IA 3KKOA 3OCXA 4X93A 2VA9A 2AV6A 4UUOA 5TQ2B 2O59A 3GT7A 3EGOA 4D0LB 3O8CA 2NACA 3UH0A 2ZITA 5HEKA 1HE4A 1Z12A 5I4KA 1PRYA 4TRMA 1N77A 1ZG3A 5FPPA 2G1PA 1GT91 1D4OA 1C9EA 2XAAA 4PPNA 1HI9A 3AM4A 3OKCA 1Y0BA 2FFAA 5T4EA 5JS8A 3KZNA 3BJZA 3OY2A 1B42A 1U1DA 2JEZA 1E2EA 4RKQA 4ACAA 4JT9A 5HKKA 4BY9E 3RKSA 1GA1A 3TLCA 4C7KA 5E4YA 1FK8A 1USVA 3DNMA 4LZZA 4MUFA 4BEBA 1GL3A 4U7HA 3HACA 1ZEMA 3P4XA 2ERXA 1IDOA 2I2BA 5BQ3A 2D7CA 1DGQA 3GAMA 4KQHA 2F48A 3O26A 4QULA 4POOA 2YWCA 4D2IA 5B7QA 4JIMA 4ZU3A 5I9LA 3G2LA 5IZCC 1IOZA 5AW6A 5K0CA 1Z47A 2HIMA 5EUBA 4KK3A 3FBWA 4HAZA 2EL7A 3NVDA 4MINA 4OF4A 4BTEA 3KK0A 3PL5A 5ICEA 2J32A 5DIZA 2DF8A 3OIDA 4RIFA 3H5IA 2AD1A 2C9YA 3MWGA 4Q4DA 1ENYA 2P69A 1GV1A 4WKPA 3WMXA 3OP4A 4LGYA 1O08A 2JCSA 1L4MA 2PRSA 1OLSB 3IDFA 5LKRA 4V3CA 2XD4A 4DR6B 3I92A 1NRIA 3SXUB 3L6DA 4IX1A 4CPDA 1OBHA 3IB3A 2OESA 4M9QA 1N7GA 2J45A 2ZM5A 4TV8F 1XRJA 4WACA 1XDGA 5TRTA 3EJ6A 5IK2D 1GYRA 1I2MA 1KJNA 1ZZGA 5G4KA 4DLRA 4QGAA 1Q1BA 5FOUA 3WLOA 4A73A 5JMPA 4LF5B 4I19A 4KN6A 2XT6A 1VKNA 4XE5A 5EYPB 2CY0A 1REQA 1ZD8A 2G63A 3A06A 4NBVA 3GK3A 4INAA 1FYFA 1JAHA 1HTBA 4O2RA 3HL4A 3WLIA 3DBRA 2CN1A 1BMQA 2XHZA 5CDSA 3HUDA 3EMBA 2IZOA 3QVJA 4MARA 5IT5A 4TS3A 3A32A 4Q1FA 3RAPR 1E1DA 3DT8A 3H1AA 2DY0A 4NCIA 1HE1C 1QU2A 5UKDA 1RXEA 4N5DA 1X15A 4RTKA 4YP1A 5MF6A 2Q5OA 1C3EA 1LZKA 2CBZA 4EHDA 2D2EA 1NHGA 1GZSA 1CS0A 2BH9A 4ZO6A 4E6EA 1AKUA 3O3CA 3OAAA 3UT5A 3O9VA 1C4WA 1PWZA 4AVYA 5BWNA 4MCJA 4JC5A 1JDJA 1N1MA 3T3EA 2IE0A 2FUKA 1GN9A 4L51A 2XRYA 5ED0A 2ZI6A 3D3WA 3IRUA 4CM7A 3NANA 4NCXA 2V3WA 2ZAOA 4GOND 2QA5A 5J23A 4D8UA 2O1SA 1ZJ4A 3GJYA 1Z8NA 1KEEA 3T4PA 1FSSA 3N2KB 1GPWB 3EVZA 4R40A 4OAOA 3VYVA 2GZDA 4JD5A 2BTQB 4LSWA 2LRHA 5CX4A 3G8YA 4XUGB 2KSQA 3D4PA 3KPWA 3BZBA 4QQFA 5MN4A 1XEXB 1RRCA 1EEXB 1V9CA 4EFDA 1ZZEA 2BBOA 2OCYC 1QU3A 3P0HA 4FBGA 2ECFA 4FX2A 5CDFA 4RTRA 2BMEA 4MKXA 4Z0NA 3CX3A 4AK9A 4EF6A 1RDFA 3ZHBA 2EP5A 1KETA 2EGHA 2NNWB 2YVUA 1XXLA 4H2DA 4MV8A 1W5BA 4B79A 2D00A 5L4LA 4RU1A 3AHDA 3TCKA 1KI6A 2G04A 2DHCA 3AT1A 3TLAA 3OQOA 2WFAA 4MUIA 2RDMA 3N2YA 3TW8B 3K9BA 1SG9A 2H17A 3CWQA 4KN5A 4LRXA 4QOFA 4MEAA 4QPCA 4WCDA 3STWA 3BVPA 1BEUB 4MQFB 2OO5A 3AUSA 2Q99A 3K4PA 3WXBA 3ZNOA 5AKHA 4ADSG 1C4XA 1T25A 2Q9CA 4MIYA 1G18A 1LA2A 1UPCA 1CJBA 1UH5A 3DF9A 2Z3ZA 3ZCXA 2XUQA 4EYQA 1XDWA 1WW8A 1CWUA 5LQUA 3HCPA 1UXJA 2PJDA 3CURA 4JP8A 1U7WA 4U2KA 4NCHA 2RH9B 2VPIA 4B81A 5DTRA 3GUUA 1PJ3A 2HNAA 3M3HA 4YECA 3W04A 3WWZA 1VB5A 4PGFA 1U7PA 3SQLA 3ZDFA 4YMLA 5F33A 3BIOA 5CK4A 5K1ZA 4AP9A 4L73A 4PSKA 4YHHB 3ZBQA 1EESA 3SF8A 2NVOA 4LGVA 4BNNA 2WBLC 1KRWA 2NTJA 2W2OA 3BS4A 3UMGA 3X1KA 3ZE6A 2AC2A 4NDAA 2GCNA 2UU9B 4XX1A 1ZGJA 4IPTA 2QRPA 5HIMA 5T3UA 5SYMA 4HAIA 4C2UA 1JIJA 4A0HA 1NMSA 2C0QA 2QG6A 3FNQA 4OFZA 5A3JA 1R3DA 3DLAA 2YS7A 4IBOA 5EKUA 3RTBA 3WLKX 3W8RA 2H1VA 4MYHA 3ZXXA 1Y4SA 2R25B 2Q3LA 3FTNA 3AC0A 4IH1A 1PR6A 5F35A 2ECOA 3SEQA 1TC2A 4DLPA 1TYDE 4BV8A 3ZV6A 4DDWA 1IY1A 2FX5A 3ZHYA 1ADFA 4JJ7A 4CQJA 4IIGA 2IXFA 2BGGA 3LHFA 1JX6A 3GEIA 1FTGA 3HYCA 1CQJA 3M0EA 4RA6A 3H0EA 4R4JA 2G36A 3N2LA 5ITZA 3AW9A 5CA1B 1N6HA 1TCVA 3PRYA 1N2SA 1KS9A 1PO7A 1MF7A 1RM3A 4HUTA 4JLKA 4MS4A 1GHTA 1H94A 2DSTA 3QTTA 3LOQA 1KC1A 4ZQEA 3K4QA 3RS4A 4GYYA 3HS3A 3B3GA 4J90A 3RS2A 5H8WA 2EEPA 1YK0A 1KKMA 2OV3A 3PPVA 3ESCA 1VECA 4C03A 2ORWA 1ND5A 4F71A 2WTMA 4ZEOA 1E1CB 3K53A 4PQFA 4A36A 2HA4A 4I6GA 3DBLA 1GEEA 4L07A 4FDTA 5CCXA 1M8GA 2ZAGA 3ISTA 2BD0A 4RESA 3T94A 2GNPA 5IHXA 3R9IA 3SYMA 2VXOA 4E1AA 2I34A 4H7KA 4PZZA 1H6BA 1RKVA 1GQ2A 3UB3A 3IDZA 4B5KA 4I9FA 1L1FA 4B3CA 1WMAA 1RM0A 2V9PA 1UT5A 3NIDB 3I2YX 3L8CA 3Q87B 4HH3C 1HKUA 4EPRA 2RB4A 3S8EA 1EP3B 1L2TA 1MPXA 1W4CA 4OYLA 4QPPA 4R6XA 5DMXA 4Z5XA 1M72A 3O4JA 4ROSA 1PR2A 2QTZA 4KACA 4GSKA 4YP7A 5KMGA 1GTJ1 5AXDA 4QM6A 1RJDA 1XJWA 2VUIB 3B38A 3RADC 3I9V1 1Z33A 1XZBA 4CUJA 2F1HA 4Y7DA 3IAS6 2PSFA 3Q7EA 4EI2A 3O8BA 3V3KA 3B6MA 4EG7A 4HO1X 1JA0A 1PT7A 4FYHA 4C08A 4GQIA 1AH2A 4IIJA 1IZ9A 2OZKA 2NUPB 4M1WA 4QSHA 3WYGA 2C5FA 2PO5A 2WJPA 4ER3A 2J6CA 4NMLA 1ZC4A 2F3TA 2JHAA 3HQ4O 4DUZB 1WMFA 4W5RA 1WVMA 2QVYX 1YI0A 4MRRA 5JS2A 3WLRA 1RMTA 4Z1OA 1CR0A 2YWFA 3BHJA 4G07A 1GFWA 2WU8A 3TMAA 5TPWA 2F7SA 2VPPA 1FE8A 3BXOA 3N39C 1V2HE 2FG6C 1CIPA 1ARZA 2GZMA 5DM4A 1R15A 3WKDA 2CUKA 3WB1A 4IQ0A 4L2IA 1Z5GA 1JWAB 1S3SA 3L6CA 2DFNA 2ID4A 2I1VB 4TWBA 4C14A 1I01A 3UMCA 4IDNA 1G20A 2ZBGA 1U8AA 4UE3S 4DIUA 2F55A 4F6RA 3F6EX 2EJTA 4CLRB 4PAGA 3TUJC 4YYEA 2PZBA 1W47A 5C1BA 2A5LA 3AERA 4G0MA 2ACEA 2WZCA 4I6JA 3O4FA 4PC7A 1G1MA 3GVXA 3ZR4B 2CW5A 3EZXA 5CX1B 3H5OA 1J2EA 2FR1A 3EA4A 4AD8A 3PJRA 4UNQA 4U6NA 5ALEA 4WZBA 1RMYA 4I4TF 5DHSA 5DISB 5FBHA 5FA6A 4NPHA 1CIVA 2OV1A 2P5TB 2NU8B 2BFDB 4IDBA 1ULHA 4MQ5A 3WIOA 5LFAA 2JIMA 3TM4A 4MV9A 2PRZA 3WRYA 1JLMA 4NDZA 4R68A 3ST7A 4PFKA 2JCXA 1NBIA 2P3SA 1Z0JA 4M1YA 1GTZA 4A82A 1P4SA 4PXSA 2C0CA 2AKAB 2Q7XA 3FIUA 2ZWOA 3C5CA 1Y4AE 4MVJM 4W7HA 1WS6A 2EYUA 1I4DD 2ZYTX 3MPOA 2OCGA 4OO3A 3T9CA 5HTOA 3R7WB 5CM2Z 4B6OA 1U2RA 1S89A 2H31A 1PF7E 3JD4A 4FN5A 3JZIA 1DHTA 1Y8QA 4MVJG 4CHTA 2NU6A 4FE4A 4KFTA 1GWNA 1FU8A 1XU7A 1A95A 1TGYA 4B80A 3ZZTA 2G0TA 5KDDA 4W8GA 1D3AA 1U7ZA 2FMXA 4HBGA 3W1WA 2BKXA 2R60A 1TD9A 3DOCA 4LHYA 3X2EA 3THYB 5A5GA 2VRBA 4OVKA 2R6GA 1LB1B 3C43A 4R51A 5AK3A 5FUYA 2QRLA 1ISMA 2JLQA 3OPYA 4Q93A 1NXSA 1Y5MA 2OHFA 2QRKA 2OGTA 2Y27A 3BWDD 4GP7A 3VI4B 4E5MA 5FWYA 3IOCA 3PGA1 2WU3A 4KPUA 4QQRA 3KEOA 1JQDA 2V0CA 3DFZA 4GT1A 4L9AA 4YRPA 5DM70 1ONNA 5CDYA 1N2CB 3KVYA 3T4XA 2QRVB 4LE1A 2BISA 3UMJA 3ICEA 4RTPA 2A3NA 1T4MA 2QJWA 2V1XA 4MKRA 2BFOA 1ZIDA 2I7DA 4CRWB 3EBLA 4EKDA 1CRLA 3T9FA 1BA3A 3FDFA 1PT6A 4JVMA 1PZGA 1KO5A 3HWRA 1JXMA 2FWIA 3D1VA 1XCGB 2F1OA 3ZDEA 4DWWA 1W0KD 2R6R1 1TIPA 3F5FA 2VUUA 1PEKE 1RWNA 1U9IC 4MMXB 4BNDA 4ZMSA 3LUPA 2KJQA 2QRUA 5I47A 4FFDA 2HT1A 1KFJB 4BLPA 4NJEA 3BA1A 3P9NA 3C3MA 2NGRA 2JFHA 4I1RA 4TT8A 3FYUC 1FXWA 2NO9A 3WVNA 2AKYA 1NF2A 4KO4S 1JFTA 5M5BA 2CD9A 1OZGA 3MS7A 5FEMA 3TXXA 2JW5A 4A0RA 4RBNA 2FPGB 3JQFA 3HMKA 3RJTA 1H66A 1KZ6A 4K9SA 1Z28A 1XDSA 2PMKA 4JI7B 3SQXA 1KH1A 3IQFA 1CHDA 2E5FA 2JCYA 5LZ5A 1FUIA 3L1UA 2C04A 4HLUC 1RI2A 4ER5A 2Q2VA 4FD2A 2Q29A 4B34A 521PA 5AJVB 1R8YA 3CF0A 5E9QA 2AFIE 3E70C 1A77A 4NE2A 4BVKA 4QLOA 4WFJA 4C0LA 1J8VA 4CW7A 3C0KA 3OOYA 1GA4A 1IUPA 1KP3A 4J07A 2F1RA 4DE5A 5L7WA 5CA0A 4IZOA 3C7AA 3JAKA 3NPAA 5AW5A 1SQGA 4BO2A 5KYGA 5BR4A 1F2UB 2PD4A 4BMOB 2EFJA 1TU0A 4F96A 1I8TA 1KJZA 1NIJA 3CZ5A 3KR0A 1Z7YA 1XHFA 3K30A 1DAIA 1XTRA 1P1JA 2VN8A 4M0EA 4NZZA 3QPBA 1KXJA 1WTCA 3E6AA 1E3QA 1N25A 4BRZA 5JY6A 1Z45A 4X41A 2OBYA 1CC1S 3RG2A 1SXHA 3PA8A 1MJFA 4RQAA 1QDLB 3WFZA 4U8GA 1I7DA 1THZA 1I51A 4F60A 2ZBFA 1UZNA 3KVOA 3KYIB 4N3AA 3ZZ1A 1E5XA 1FFXB 2WTXA 3OTHA 5JCPA 1P80A 2DQZA 4UBLA 1GFSA 1LPBB 4FGSA 1XTBA 2XI4A 4A0SA 1ZM4A 3OC0A 9ABPA 1CD5A 2GD1O 3CZ4A 2NZUG 3DAFA 4GWGA 4Y6QA 3A27A 3INGA 3LZ6A 3H04A 4J0EA 1GNTA 4UEKA 1MFPA 1P73A 1K5GA 3VXKA 3G6KA 3VSEA 3X1ZA 1MQ9A 2O0LA 1YFJA 4YQZA 2NZYA 1HGXA 3A6GA 3K6JA 1SEPA 3MILA 3BB4A 4E4TA 2AJLI 4LYJA 2P41A 2UUAB 1BZYA 3CUKA 3KB6A 4OGFA 2JIRA 4JJEA 3F7NA 1CQPA 2HWXA 4M8KA 1DJMA 4EYEA 3LBAA 4F6CA 4B4WA 1GQFA 5FPSA 2E4UA 2AF4C 3CLRD 3ILVA 4G2NA 3SS9X 3CFYA 4DHWA 1K8XB 5E7QA 1J99A 3U3JA 4Z86A 2MMCA 1HM5A 3IAHA 2CVFA 5CD9A 2O8DA 1W85B 3PD1A 4ZHQA 2OCAA 1NVDA 2SECE 3QUAA 2OWEA 2XRMA 4UD2A 1NQVA 1WWKA 4L08A 4OJNA 3TOZA 3RC3A 4DMFA 3P0IA 4IJUA 1JV2B 1T1IA 3GFQA 1OXXK 4D4LA 2CMDA 1QONA 3K16A 2W22A 4RK5A 3HABA 2NUTA 4AROA 5JXWA 4DZTA 2ZTSA 4G56A 1CLUA 1SQSA 2X3YA 3WLLA 1QKIA 4QELA 1G4AE 2J7PA 3NIWA 3O82A 4FMPA 4J75A 5LLSA 5A4FS 1N5KA 1KPHA 4OP3A 3GLHE 1AF4A 1GLVA 1AQYA 2C92A 4ZAWA 3LJKA 2FZWA 2Y1WA 4IDGA 4HS4A 2W70A 1BIFA 3OCZA 4P7FA 5FV4A 4ZALA 1Z74A 4Q4LA 4BPBA 3BTOA 1LS1A 1MIOA 1Z38A 3BSYA 3DBHA 4OU4A 3ZHVA 1SVSA 2H63A 4KFUA 5BQPA 5DI3A 4Q3DA 1S8NA 3OA0A 3WL7A 1LPPA 2YV3A 4R2MA 1Z6TA 1RTKA 4BGVA 1JHXA 4LOIA 3IA2A 3OAAD 4M6WA 4R2WA 1K7EB 1PV2A 4H17A 3MOIA 2AOTB 1W36B 5KX5B 1AN0A 3DONA 4LY9A 1ZJ5A 2PG3A 1TX4B 1Q2UA 3KEQA 2X41A 4JYCA 3G5UA 4FFOA 2POQX 4YP5A 3ZHRA 4FE7A 5C52B 2ZTMA 2ORIA 4YQFA 2YIJA 3N59A 3MLAA 1GRCA 3JWGA 3PR2B 1NG1A 2HLDD 4KQXA 3U3DA 1TJ3A 4R7GA 4ZI3A 4Z51A 1D2RA 4R9SA 1J2JA 4RM2A 1EUQA 1GU7A 1K7CA 2IUTA 2BM0A 3ZHSA 2QTHA 3QEAZ 5BWOA 4C4OA 1OWNA 1X7ZB 1DOZA 3K92A 1NMQA 1Q77A 5ALGA 1QB8A 4ZI7A 4JWTA 5L40A 4KR2A 3WIBA 3NRCA 4JSYA 3FUWA 2R79A 3GT4A 3H2SA 3RIMA 4PPGA 2KI5A 1FX1A 3OUTA 3QKUA 3G0BA 4CGYA 4LNUB 2F9MA 1VRCA 3TLMA 1E9AA 1NVEA 4HAXA 5G1PA 4N9WA 4WGGA 5K8UA 3M6XA 4Q15A 4ZHSA 3M1YA 1XNRB 2A57A 1Z0FA 4M0FA 3RC9A 2QD3A 2RJ3A 4IHJF 1P9WA 2I6XA 3VHXA 3U16A 3EIOA 2DAPA 4FB4A 3HMQA 1VJDA 3ROQA 3A4NA 4C2BA 4DDKA 3HA7A 4F06A 4TYMA 4N01A 4UASA 1CUSA 4PZEA 1QGYA 3V3TA 1TXGA 2EC5A 5KSZA 3IL2A 4ZI7F 5D3MA 3D6FA 4YRSA 1C0IA 1XTSA 1RQRA 3PITA 3M4YA 4G63A 3TGWA 4BKOA 1IEVA 4EELA 4AKIA 4XYGA 3F3YA 5L7YA 4R6WA 4RKFA 3TQHA 4O2BB 4QKQA 1T1RA 2B2CA 1JG2A 2E2WA 4Q3CA 1R37A 1L8LA 3GDHA 2V65A 4QXOA 4NOLA 4Z7OB 4WINA 4X8MA 4FFVA 5CH5A 3O2JA 3FYDA 1MABB 2GD2A 1MHTA 1FVXA 2OBNA 1UDRA 3L0IB 2OQVA 5IH3A 4TYPA 4AF8A 5AW7A 1P5RA 5KVSA 4EYGA 4JP5A 3GJ3A 2Z98A 4MNTA 2RFLA 1ZBDA 3ZKAA 1BOOA 4CFZA 4ZZ3A 3IMEA 3OJFA 3HJTA 1RADA 4YMIA 4LVUA 4BQIA 2ZPUA 1JDBB 1YRYE 4TSRA 2QI9F 2DT8A 2QM7A 3WBJA 1X80A 2I2WA 2NO6A 3KD2A 2O8VA 4W63A 2X9NA 2YZ7A 3N6XA 4GZ3A 2A7QA 3PRHA 5C4GB 5ALWA 4EGCB 5KKNB 3TAXA 1QQAA 2Q1WA 4NEGA 2O9JA 3L1IA 1II0A 4O33A 4WA8A 3PCXA 5AOCA 4RGYA 2QV0A 3U49A 2QQGA 1BN7A 4D4KA 3VH1A 4GSLA 3FR7A 1T1GA 3NT5A 1DWQA 3UA4A 4E4YA 2REOA 1E4EB 3V34A 2H54A 1YDGA 2MTBA 4IILA 4II7A 2XZLA 4OQZA 3EISA 3ZWKA 3EDRA 3ZY2A 5A06A 2FF5A 4IRXA 1XVVA 2ZUVA 3VAYA 4NFSA 5J47A 5JDCC 1MV5A 3MWLA 3TPFA 1J24A 1H23A 3KJFA 5LA6F 1T9AA 3FMGA 1GNQA 1RBYA 1VHTA 2CDRA 4I46A 5AW4A 3MJVA 3O4VA 1HZZA 1Q92A 3QYJA 1ZHFA 5C8YB 5ALIA 1QLHA 2XYQA 1W4LA 1G2QA 1I2BA 4G4SP 1V8OA 1DQRA 1O3YA 1T1JA 2GCOA 1LRKA 1FDOA 2VHEA 3HL0A 4DKXA 2Y05A 2XKBA 4FNGA 2OGSA 4IKEA 1HQYE 3LA8A 1O95A 1Q2XA 4NCJA 2HTFA 3MXOA 4RSGA 3HYRA 4HNUA 5KVCA 3ZCUA 3RYFA 5KTOA 4RWEA 5JNLA 4LMRA 2O48X 5EWMB 1R8JA 4NJMA 2HQBA 3GP8A 4M88A 3QMMA 4TTSA 1XD9A 4BBJA 1NN1A 1NKTA 2LP4Y 3ZHXA 6GPBA 1SHUX 3LY5A 2WMOB 1Z22A 4JY7A 1O94C 1P31A 1AV6A 2XVAA 5I7AA 1W30A 3VTAA 3GVHA 2C4NA 3PHBE 10MHA 3VYUB 2DFKB 1WABA 4JJIA 4RMJA 2WTEA 3RPEA 4ZV7A 4OQLA 4IXTA 2WYOA 3OEED 2YTZA 4HK4A 4ZOCA 1RRPA 4N6OA 5JARA 4ARIA 1SQ6A 2J46A 1WDTA 2J6IA 3X1YA 4B85A 4PRKA 4MWBA 4PSUA 4AMUA 1QF6A 4XB6B 4GIBA 3VZQA 1JG4A 2J5BA 2G72A 2NZ8A 3EJWA 4P92A 2QUJA 3FYTA 1PR4A 3LLSA 4OLFA 4X5OA 3S4YA 3X1XA 1I3NA 3I4FA 4U7FA 1JSZA 1NUQA 2RKWA 1JKJB 2FMFA 5BNZA 4DA7A 1UC8A 3GRKA 3TIFA 1V6CA 3OX3A 4Q7QA 3Q7RA 3EX7C 3KHSA 2C00A 2NV0A 1AX9A 1XAGA 1B14A 1H2ZA 2FEMA 5LP6B 3BSSA 2E4WA 2WIDA 3W7VA 4FFPA 1YE5A 4DJDC 5JR3A 1JAIA 1U5AA 1GAJA 1KSFX 2G80A 1L6RA 3DV0B 4GQAA 1OI4A 2BKLA 3EVDA 3H6KA 1QZZA 5ITWA 3NBZC 3LDGA 1GGNA 1UJBA 4WLVA 1Y1KE 1YC5A 3ESDA 3M34A 2B3DA 3CISA 3O7WA 3PNSA 2F9FA 4B7AA 1F7VA 1GFZA 1SC1A 3IT1A 3OKPA 3ZXYA 1KEPA 2C2HA 4X6XA 1O58A 3W5CA 2EATA 3KIPA 3CLSC 3D1JA 1D04A 3LK7A 2HF9A 4US2R 2ZWIA 3A0RB 1O4WA 2X13A 2H4XA 3G5TA 3L7JA 3OF3A 4FHZA 2WE7A 4NONA 2WAOA 3TJMA 3UQZA 5A62A 3CVYA 4PIPA 3UMSA 1EXMA 2C4MA 1VGQA 1XU9A 1O9GA 3DW1X 3U2QA 1XZGA 1IM8A 2GF0A 2VF2A 3EFEA 4P4UA 1U2QA 1CUVA 3NTQA 3OHMA 4X7BA 2W00A 1J21A 2YN2A 3NKLA 3U3RA 1QNFA 5DOVA 1Y5RA 6PFKA 1KH2A 3T0FA 1L4KA 1XLTC 3NTVA 3QWIA 5AI6A 1OV6A 1ZIPA 4UCXA 2QORA 4P84A 2WHPB 3FTQA 2YV4A 3DKKA 3NVMB 4B73A 1VPEA 2G8LA 4U2FA 4FZRA 4PXYA 4DV4B 2C83A 5JISA 3CLUD 2ZW9A 4IUCS 3WGGA 1FTSA 2AA3A 2DFDA 4KBGA 3KLOA 3PCTA 2NT3A 5AHXA 5FPHA 3ACCA 2DBRA 2RGAA 2ZBQA 3GJ7A 4WKOA 2VCYA 4OSPA 4Q18A 1U3TA 1HMPA 1UCFA 4IIBA 5BSGA 2QS9A 2VP9A 3KDAA 2WJWA 1WDKA 5F1OA 1WKVA 5AP9A 3TS1A 4AFNA 4BWVA 4KJXA 3U7JA 5KYXB 4LRUA 3NM4A 3FPJA 4IZHA 4P0TA 3H1TA 1G6KA 1IAVA 5JASA 4DDHA 1DIOB 1QKJA 2R1TA 2AHRA 1KI3A 3GRFA 4B1FA 2D7DA 2RCNA 1EAYA 3CUSA 5AK0A 1NZFA 2MMGA 3FCYA 4PAWA 3V9PA 5LCXA 2XPCA 3HCNA 3L92A 2MSWA 1OH8A 3GD7A 4MICA 1YU9A 4JL5A 2JIZA 5JMOA 5KKCA 4LQLA 2R6ZA 4W5JA 1QG6A 2XECA 3RVSA 1E77A 1ZUNB 2I3AA 2CZCA 2PRIA 3GAFA 3IEUA 4WNYA 3QP9A 4S24A 4ZD6A 3WZMA 4AW9A 2KB0A 5LBIA 3RUPA 4GBED 4OQFA 4UMFA 4E6PA 1OX4B 3E22B 1QP7A 3DFUA 2W2KA 2RARA 3KS9A 1YKSA 1PUJA 2OGUA 1LBSA 1ZD9A 2VLBA 3ANNA 3CCCA 3MXTA 3P52A 5H59A 1E0KA 3KHTA 1V39A 4IV8A 3L1HA 2G6BA 2IC5A 2EKLA 3UJAA 4DIFA 4TZKA 2X0EA 3HWWA 1N3YA 3SIRA 1PAUA 4WZ6A 1HE8B 3VHRA 3KTOA 1B16A 1U2GC 3IAM1 2DBVO 4RZQA 1RWVA 1Y81A 1SXGA 2Y93A 4JELA 4MR7A 5KTTA 1G7SA 2OFPA 2ZG6A 3MGKA 3EVCA 1R0SA 1U1FA 1A9XB 2UZ0A 3AOGA 2GERA 2WJGA 4UMEA 2YOHA 2RGWA 2BFBB 3DCIA 3CNOA