4XEHA

Apo structure of kari from ignisphaera aggregans
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
327
structure length
326
Chain Sequence
b'AKIYKDEDISLEPIKNKTIAILGYGSQGRAWALNLRDSGLNVVVGLERQGDSWRRAIDDGFKPMYTKDAVAIADIIVFLVPDMVQKSLWLNSVKDFMKKGADLVFAHGFNIHFKIIEPPKDSDVYMIAPKSPGPIVRRSYEMGGGVPALVAVYQNVSGEALQKALAIAKGIGCARAGVIESTFKEETETDLFGEQVILVGGIMELIKASFETLVEEGYQPEVAYFETVNELKLIVDLIYEKGLTGMLRAVSDTAKYGGITVGKFIIDKSVRDKMKIVLERIRSGEFAREWIKEYERGMPTVFKELSELEGSTIETVGRKLREMMFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ketol-acid reductoisomerase
publication title Cofactor specificity motifs and the induced fit mechanism in class I ketol-acid reductoisomerases.
pubmed doi rcsb
source organism Ignisphaera aggregans
molecule tags Oxidoreductase
total genus 127
structure length 326
sequence length 327
ec nomenclature ec 1.1.1.383: Ketol-acid reductoisomerase (NAD(P)(+)).
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain
A PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.40 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like fold 4xehA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xehA01
2O3UA 4YWJA 3DONA 3QWBA 4NBUA 1PJBA 5ADHA 2V6BA 4BO4A 3ZN2A 3ADPA 3HDJA 5JCJD 2DU8A 4NFSA 4WLFA 2IRWA 2HJRA 1V8BA 1L7EA 3LT1A 1LU9A 1N92A 4KQXA 3NYWA 3TQHA 1DOHA 1UZMA 1XLTA 5A5EA 3K96A 4H7PA 5AQ1A 3IIEA 1RM3A 3CZMA 5HBRA 2GUGA 1BMDA 3L0DA 4HWKA 3DOCA 3CXRA 4CM4B 4K6FA 5G0SA 4EI2A 1BXGB 1ZSYA 1VKOA 4XYGA 4FDAA 5HS6A 4I5GA 4IY1A 1EVJA 3ZV3A 3WLFA 5TRTA 3LT0A 2PY6A 2AG5A 1W4ZA 4KUHA 3ONFA 4HFRA 3U4HA 4PG6A 5JO0A 2HDHA 4CM7A 5EQDA 4IDFA 2EGHA 3QVWA 3GHYA 2D8AA 4B3HA 3KYDA 4OSOA 4GSLA 2CF5A 4F45A 1PSDA 2VQ3A 1T26A 3RSHA 1E3SA 2NWQA 2VZ9A 4FJ0A 1V3VA 3JYLA 4TKMA 4PRLA 1VLLA 3U3XA 4IZHA 1T4DA 3F5SA 2FWMX 1TXGA 3PHJA 5CAEA 3JQFC 3VH4A 4AJEA 1P1IA 1BTOA 3PJGA 3P19A 3RKRA 1J6UA 5G0WA 4BO9A 3PYMA 4J6FA 1QRRA 5IG2A 2GPTA 4RLHA 1TVEA 5EMHA 3LC2O 3F5QA 3UKOA 1DJNA 1HDCA 4XQCA 5TJ9A 4ND3A 4CR7A 4GX1A 3VPHA 4MVJE 3M2PA 1R6DA 3K9QO 4HKTA 2WEKA 2EWMA 3RFVA 3WICA 4A5OA 2NACA 3MWEB 4NZ9A 3RFTA 1GYPA 1DO8A 1YBAA 4RPLA 1Y9EA 1R4NA 3QW2A 3DMTC 3JD2A 5ILGA 1ZCJA 1PL6A 4LMRA 3MJTA 2NQTA 3GZNB 3F9IA 4O5OA 1HKUA 1MC4A 4ITUA 1P74A 2HAEA 2HU2A 1GUFA 2ZYAA 1E3WA 1R15A 4AJOA 3BXXA 3HE3A 3DQPA 4FN4A 4I8XA 4DWVA 4RVGA 5JDIA 2IXAA 3UVEA 3IJRA 4PLGA 1MLDA 4CM8B 1MXHA 1OC4A 3PI7A 1U2DA 2YUTA 4XRGA 3MJ4A 4J1SA 3V2GA 1E3JA 4FFOA 4GKBA 4OH1A 4CQMB 1ZIDA 4WCFC 3GN2A 4AJJA 2O23A 1GQQA 2I9PA 1F8FA 4W4TA 3JQ8B 2YDXA 4KP7A 1BW9B 3CH6A 3ZHXA 3L9WA 2DTXA 4P4LA 5FI5A 4JK3A 2CY0A 3FTPA 2C5EA 1B2LA 2H1SA 3MCVA 4NMHA 1PQWA 1ISMA 1HF3A 1KBZA 3STHA 3HADA 2XOXA 3CZRA 4CV2A 1E7WA 1Y9AA 2OMEA 4CL3A 1DFGA 3EVNA 1IZ9A 3EW7A 2ET6A 1OI7A 1W6UA 1A4UA 2X7HA 3E03A 1WW8A 3PZRA 3RI3A 3T4XA 3ZWAA 5GZ3A 3QWIA 1DLIA 1LTHR 4N7RA 2YFQA 2X1HA 3RAJA 4AJ4A 1UDBA 1LC0A 1CF2O 2W2LD 4P38A 4RQTA 5TT1A 1FDTA 1SO8A 4C7KA 5K6AC 2RHRA 4UUPA 1BWSA 2O3RA 3EZYA 3W6ZA 2P91A 3F6YA 5IXYA 4XYEA 2B0JA 4D43A 1I33A 3B1KA 4BNXA 1MA0A 3DL2A 7ADHA 3RBVA 2O3SA 2EP7A 1DBVO 3E1KA 2Z1NA 3AWDA 3D1LA 3M1LA 1IHXA 1JN0A 3FR7A 1QYCA 4B4VA 3GLQA 3BZUA 4OQZA 3PDJA 2AA3A 3DR3A 3TL2A 1PJ3A 4WECA 1EK5A 2ZQZA 4DIOA 1LI4A 3QRWA 3HDHA 4FPXA 1EVIA 2O3JA 1YDEA 2GASA 1WWKA 3HDQA 1O5IA 2V65A 1S6YA 1OBFO 2ZTMA 4L0QA 3EDMA 3AU8A 3OA2A 4QX6A 5JDCC 3WX0A 4J4TA 5I7SA 1I2ZA 2W8ZA 4D79A 1WZEA 1I3NA 3BTVA 3CTMA 7MDHA 1YQDA 4GX5A 3H8VA 5GMOA 3WMWA 5ER6A 1V3UA 1VL0A 1GFSA 1U5AA 1LXCA 3H6KA 3JQGA 3ITDA 3LLVA 3F1LA 4R3NA 1LJ8A 1RWBA 2P9EA 3GUCA 3TOZA 4IDCA 1H9AA 2SCUA 1QV7A 4ZN6A 3DHYA 3LT4A 3FNHA 1BHSA 2HQ1A 3DO5A 1PGQA 2IYPA 3HJAA 4ZA2A 3VHRA 5I9MA 5JC1A 3MZ0A 3DWFA 2FSSA 5L53A 1T2CA 1BDMA 1HRDA 2O3TA 3IOYA 1NQ5A 1ENOA 3INTA 4RPGA 5K9ZA 4IINA 1PJLA 3GQVA 2VHXA 4ESOA 2J3JA 1TB4A 4EJ0A 2W2KA 3H5AA 3WGHA 1MB4A 3C7DB 3W8EA 5F1PA 3I9LA 1JKIA 4YJFA 5KJ1A 5CEEA 2NM0A 4XWYA 3A06A 4XD2A 3U0BA 1LUAA 3ANMA 1GR0A 1YO6A 3OH8A 1O95A 4RL6A 4CV3A 3OJOA 1ENZA 1BSVA 2VUSA 4CM4A 3WGIA 2B69A 4Y67A 3UFXA 1NR1A 1L1FA 1E3EA 3GDOA 3DBHA 2H9IA 5F5NA 3NTRA 4LVCA 1IYZA 1GEGA 3DAGA 2NU9A 4WCFB 4UVDA 3DTYA 2G76A 3ASVA 2DT5A 3K6JA 4L4RA 1PEDA 3UCXA 3IL2A 3QJ5A 1O8CA 3PHHA 3H4VA 1QYDA 3WQRA 1I10A 3KB6A 4L9RA 4R4JA 4JP3A 2I6TA 4OSPA 4PLVA 3LQFA 1GPDG 1DLJA 3C7AA 4A0SA 2NNLD 1K6JA 4I5DA 2VCYA 3ZWBA 4OAQA 4BO2A 4A10A 2GN6A 4ID9A 1H0KA 1Z7BA 3RASA 1E7YA 2J6IA 1ZO8A 3NDRA 3SC6A 2OOSA 1NTOA 3GG2A 1UJMA 3JQ7A 3RVDA 3Q11A 1NPYA 5ES3A 3U4IA 2CDCA 1U3UA 1M66A 2HK7A 4WUVA 5A02A 2BFMA 2BMAA 2P4HX 2VWHA 1CERA 2PGLA 3CEAA 4GAEA 2ZB8A 1KVUA 3FN4A 3DBLA 3ZW8A 3DFUA 1A9ZA 3E6AA 1UZLA 3K92A 2QYTA 3I52A 1I2BA 5JFOA 1RM0A 2ZKLA 3PDUA 1ZNQO 3NT2A 1Q0QA 3SLKA 1VE9A 4PZCA 3P7MA 1TEHA 3QVXA 2FR1A 4UEOA 2PH5A 5IDXA 5KKCA 1GQYA 2GN4A 2HO5A 1R12A 3HN7A 4N5MA 2WD7B 2PNFA 4TRNA 4A7PA 1IL0A 1PJCA 4FS3A 4R3WA 2O48X 3JV7A 1ONOA 5CFZA 3S1LA 3F4BA 1NFFA 5KTKA 2UVDA 1QMGA 3L77A 1BDBA 1UXHA 4RPKA 4IJWA 3CMCO 4BO0A 4EUHA 1TI7A 1RM4A 1DC3A 3PQFA 4CQMA 3ICCA 4RDIA 2AQKA 3OIDA 2JD2A 3ZWPA 1KC3A 1XQ6A 1U7HA 2OBYA 1X0VA 3A1NA 5A3VA 3K2BA 3JQ8A 1BW9A 4I08A 5TIIA 3X2FA 3DAPA 4XX0A 2YV3A 3PHGA 3PWSA 4JROA 4WKGA 3GMDA 5JDIC 1ZEMA 4WLVA 2PV7A 4J2OA 1MFPA 4YB8A 2UUOA 3WG9A 5B4VA 3O38A 2JJYA 5THQA 4BNMA 2J3KA 5DCYA 4ALIA 4IQ8A 3VC7A 4AJIA 3ZHBA 1D3AA 3OM9A 4DBVO 1VJ0A 4RZIA 4NH4A 2RAFA 1PWXA 5CEJA 1WPQA 2WYUA 4RO0A 5FYDA 1KS9A 3TN7A 3EY4A 5CDTA 4XCVA 4PZDA 4E2XA 4GMFA 3EHEA 3CIFA 3VKUA 1XR3A 3TL3A 2PZKA 5C7IO 4XJSA 4XGNA 1LDGA 4TKLA 1U8FO 1KETA 2V6FA 4HNGA 4PFJA 4UUOA 4PLWA 4AVYA 2QYSA 3ZWNA 2X5KO 1M6WA 2NVUB 5G4KA 3DMYA 3MTJA 4L8VA 5CPFA 3WXBA 2QZZA 3DHNA 1B7GO 3MOIA 1HWYA 1QYWA 2CDAA 4XRRA 3PWZA 3HHPA 2Z1MA 1P1RA 1XKQA 3B1JA 1VI2A 4IBOA 4X54A 1EQ2A 5A4DA 3E5RA 3S2FA 3JYPA 1EQUA 5JCXA 4BO3A 2Q46A 3O03A 4DXHA 3WB9A 1B8PA 2X9VA 5FFFA 5IFLA 1HZJA 4J4BA 4BB5A 4J3FA 3HUDA 4CODB 3QVOA 4FJ2A 1VRWA 1DRVA 2Q2WA 3GR6A 5I8ZA 1JVBA 1EUZA 1D1TA 1N1EA 1YJQA 4CMCA 4XGIA 3H3JA 4CMJA 5EESA 4XYBA 3ZHZA 4INAA 4GPD1 1DDOA 1X7GA 5JS6A 4B4OA 3JQFA 4PVCA 4ALNA 5FWNA 3P5SA 3C24A 5LC1A 3ROKA 4LCJA 4OO3A 4N18A 2D59A 4UVEA 4DIBA 1Q7GA 4IXWA 2Z95A 3RUIA 4YXFA 4YT8A 1IB6A 1I3LA 4WNCA 1H6CA 3ZNQA 4XR9A 4IJUA 1UZNA 5I7EA 1CEQA 3ZW9A 1X0XA 3JQAB 3JSAA 3TPCA 1ZSNA 4BQRA 3TDKA 4LMPA 1Q2XA 4WE3A 1YJ8A 3KTDA 4TMFA 3VPXA 1GQ2A 2JHGA 2GYYA 3V5NA 2Q4BA 2GD1O 3OECA 4CMKA 1GU7A 2OGUA 3OJ0A 1ISGA 2VNSA 3EK2A 2O2SA 2EKLA 3OP4A 2BHLA 3AU9A 4B7XA 2X0JA 5ICSA 3M6IA 1HYGA 1NWCA 2YY7A 4OXKA 2HSDA 5IJZA 4WLOA 1D7OA 3A28A 2HCTA 3FI9A 2A9FA 1Y8RA 1ZZEA 2VRCD 3M1AA 1IY8A 4EDFA 4D0SA 3COSA 4J0FA 3B1FA 1FDWA 3P2OA 2C82A 4U0JA 1R4NB 3Q3CA 3DEYX 4FOOA 3UH1A 5DULA 3VKVA 5DBGA 5U4QA 4YRDA 1SCUA 3ETEA 4B4UA 4EEZA 3KSUA 1GADO 4OOFA 1T2EA 4CM9D 4HFMA 4URFA 3PHIA 4ZGWA 4Q39A 3GVIA 3H2ZA 5JY6A 1LDYA 1A27A 1KERA 3WR5A 3ZU5A 2JCYA 3GFBA 4FC7A 1EFKA 1QKIA 4J7CA 4LVUA 4Y6PA 4DMLA 3H5NA 3WBFA 1ZW1A 1LDMA 2EKPA 1C1XB 4IDEA 1AN9A 4Y8VA 3W1VA 4ND1A 4K28A 1LRKA 4ONEA 2GN8A 3OBBA 3ZWYA 4P4NA 3LK7A 3RUFA 3NTOA 1KEVA 1H6DA 1UXJA 2O7QA 3Q1LA 2YYYA 4AFNA 1I01A 1PQUA 1B0AA 3G1UA 3LU1A 3OQ1A 4NFHA 3OEYA 4M49A 1ISJA 4XIYA 3MTGA 3RBXA 1YQGA 2VHVA 4CMAA 1LLQA 4YT2A 5EINA 4TZKA 4FFRA 3HDYA 2VN8A 3AFNA 3JQBA 2BH9A 4CMBA 3GUYA 1P31A 4U0KA 5B37A 2PKQP 3FCOA 4GSKA 4PIVA 2GRAA 1LDBA 3PZBA 4UAGA 3VZRA 2AEJA 3HFSA 3SBOA 4R5HA 4R1NA 1GUYA 2D5AA 3RUDA 3WJAA 2Q1UA 4MINA 3SJUA 2X22A 5L45A 4BGEA 1LSJA 1QORA 4YT4A 2PWZA 2D2IA 4Q3BA 2UV8A 5CP8A 4M86A 4BQPA 2BFAA 1UAGA 2YQ4A 3O9ZA 4L74A 3L9XA 3PPIA 5F1KA 3ZH2A 2A4KA 2P9GA 5DOZA 1E1LA 5A9RA 5BR7A 4K1LA 1E1KA 3ZWOA 3JCZA 1HT0A 1BVUA 4R9RA 3WYCA 1HLPA 1P3DA 1KY4A 2X6TA 5L9AA 1EBUA 1HE5A 1JQBA 3IAHA 5DN9A 4CLOA 4I5FA 1NR7A 4QSMA 3DFZA 1ISFA 3NRCA 4IUYA 3VTZA 4MIYA 2DBZA 1XHLA 3HWRA 2Y0CA 3G0OA 3H9JA 3IUSA 3AUTA 1UAYA 3IJPA 2NVUA 1EEHA 4RF3A 3KV3O 4I5EA 3U49A 4UREA 4MVJI 1Z6ZA 1Q7BA 3JQEA 4WLNA 4Z0PA 4E12A 1SMKA 5GZ1A 2HRBA 1R0SA 4XB1A 3GVCA 1J4AA 4LCEA 4N5LA 5JMWA 1DRUA 3R0IA 1XCBA 1PR3A 2VT2A 3ZDFA 2LDBA 3AFMA 4FFLA 3WLEA 1C0IA 1HETA 1QYVA 1TT5A 3EUWA 5F5LA 1YWGO 2RCYA 5ER9A 4G81A 4NBTA 1NPDA 3KVOA 4WCDA 4WNIA 3RQSA 3C8MA 1XYGA 3ZNNA 2VYVA 4RJTA 1HTBA 4YT5A 3OICA 1U7TA 4FW8A 4Z9XA 1WDKA 3GGPA 2C0CA 4YJGB 4KOAA 4QFCA 4IM7A 1NXQA 3FWNA 1Q0LA 1EUDA 2W2KB 1A9YA 3NDJA 2D3TA 4PLPA 2RH8A 3PIIA 4I1IA 4IDGA 3GAZA 4I9NA 4NFYA 2E49A 4YR9A 3WIEA 4YJFB 3Q9NA 3LDHA 4W7IA 2J5RA 1LC3A 1OOEA 2DAPA 2CVZA 2FZEA 3C1AA 4E31A 3O8QA 2OL4A 1YRLA 4MP6A 1ZK2A 5T57A 5IZCA 1P9LA 2GDZA 4AJLA 3RC2A 3DBHB 2A35A 1DAPA 2RHCA 2X0RA 4PLCA 4A27A 4MVJG 4ZRNA 1PGOA 5H81A 1JTVA 2QW8A 1IHYA 1TA4A 1GPJA 1Y8QB 3AM4A 4MVJP 2NU8A 2Q2QA 2Q1SA 2Q50A 4GMGA 4L4XA 4BMVA 3JQAA 1LX6A 2J8ZA 4PCVA 1UP7A 3A14A 4YACA 4DQVA 1PZGA 1CIVA 2DPGA 3E48A 3GAFA 3L4SO 2PTGA 1RYDA 1DJQA 4CUKA 1Q0HA 3WIDA 4BNHA 4RF4A 4JJGA 4MVJM 4YAGA 3JQ7B 3AUUA 2JKVA 1RJWA 4AICA 4YJDA 4PLZA 1ZSVA 4DYDA 5KIAA 4CLDA 3S8MA 2BKAA 4HV4A 3OETA 3DBLB 1U3VA 3PQDA 4G65A 1PIWA 1EDZA 1A4IA 2NLOA 2YDYA 4RZHA 4R1SA 3IMFA 5MGBA 1U2GA 3D64A 2XAAA 3QE3A 3V2HA 4ZRMA 4ZQFA 3ZV6A 2ZTUA 1GAEO 2WM3A 2JFGA 2CDBA 1B16A 3ONEA 3GEDA 4ZU3A 4BO8A 1P33A 3G49A 1DIAA 4FBGA 1NAHA 2J5KA 3WGTA 3TZ6A 4RF5A 4RV9A 1E0DA 4L73A 1ZJYA 5ITVA 1ML3A 4YAKA 4D7AA 5KJCA 3RD5A 2XXBA 1C1XA 4M1QA 5TC4A 4NR0A 3DBVO 3QQPA 5I9NA 2I67A 3WS7A 1B3RA 2NVWA 3V1UA 3DDNA 6ADHA 4OKNA 4CLXA 2DFVA 1F0YA 4FSHA 4OHUA 4DBZA 2I76A 1PJ4A 4QO8A 2ZK7A 1X15A 1WZIA 2IZZA 1VL6A 3B6ZA 1PX0A 3SJ7A 3SXPA 2DVMA 4PN3A 4BV9A 5F21A 5A05A 4HFNA 2HMWA 4D42A 4RDHA 5DOVA 2VOJA 2DUUA 3GNQA 5A03A 1XEAA 5JYDA 4BNYA 1DXYA 1WDMA 1NQAO 1F8GA 3AY3A 3GY0A 4LK3A 2W98A 1DFIA 1KVRA 4BNGA 1UXIA 1B15A 1IPFA 5EL0A 1U1IA 1NHGA 5COAA 2P9CA 2DUWA 2FPGA 4CQLB 3NKLA 5G4KB 4Z6KA 1LLCA 5IDYA 4CMHA 2Q45A 2H6EA 5EQFA 3W6UA 4JGBA 3RFXA 4BKUA 4BO1A 1PJSA 1H2HA 1SEPA 4PRKA 1AE1A 1BXZA 4ZVVA 4UVHA 2CMDA 2YV1A 3K2EA 4M89A 4B3JA 4E32A 3I4FA 4E6PA 3JQBC 2PFGA 1FDUA 1W0CA 3ONDA 1R4MB 3GF4A 4FQ8A 1UUFA 2HMVA 1GDHA 2WWRA 4RQUA 2AE2A 5TSDA 3VDRA 4C7JA 1B3BA 4ZQGA 4HX5A 3JQDA 3KO8A 1RYEA 3EAGA 1GZ6A 3KYCA 3ZWCA 4AJHA 2EF1A 1EE2A 3I23A 5KKAA 4A2CA 4PG5A 1A7AA 1PJTA 2NTVA 2QRJA 2NUAA 4GI2A 1N2SA 1T25A 3I6IA 1ZBQA 1MP0A 3ZU3A 3HB4X 2OORA 2C2XA 2WE7A 3IP3A 1ZXLA 4GGOA 1SBYA 4F6LA 2C7GA 2JD0A 3U9LA 3BTSA 1Z82A 4ILKA 3AUSA 4O63O 4CV1A 1M67A 1XELA 5JSFA 2B83A 1Q7CA 4NBWA 1SB8A 3OIFA 1ZEJA 2AQ8A 1YOVA 3LYLA 3Q2KA 4J0EA 4EYEA 1ADBA 2PZLA 3AM3A 3W4IA 3W4KA 1BGVA 4OQYA 2PKRA 5ICMA 3JYQA 3S2GA 4A26A 2HKIA 5JAMA 1SAYA 3HN2A 3AY7A 4YJGA 1KY5A 1R66A 2E37A 1JWBB 3X2EA 1LDNA 5A1TA 3GPDG 1I5RA 5DF1A 3E82A 3V1YA 4WPGA 4AJNA 2QIOA 4FD3A 4OL9A 3UUWA 5BNFA 3KZVA 2HLPA 2AEFA 1DEHA 5AXAA 2VZ8A 1OC2A 2R00A 4TRRA 3RWBA 2W4QA 4YVFA 1Y8RB 3WGOA 1EDOA 4BGVA 4DVJA 3VPFA 4ZICA 1HDRA 5T5QA 4J91A 5ENVA 1D1SA 3NX4A 2Q99A 3ANNA 4G5HA 5L51A 1D4FA 5BSGA 2C2YA 1N1GA 2Y99A 1Y8QA 3ETGA 3L6EA 1JAXA 3NJ4A 3TRIA 1MXFA 5JAIA 1FMCA 3GGOA 4HBGA 4MKRA 3D4PA 1EZ4A 1YDWA 3DHEA 2NU7A 2ZYGA 4YAIA 4RLSA 1ISIA 3TZKA 3PGJA 4FFNA 5L40A 2FHSA 2WTBA 3I4CA 1H94A 5IZCC 1PGPA 5IDQA 2FZWA 4R68A 3ENNA 1HXHA 1VKNA 2JFHA 3WGGA 1E6UA 4ND2A 2VYNA 1GYQA 1ZJZA 4E5NA 4MVJF 1LA2A 4DRYA 4PZEA 3TNLA 4YJHB 5TS3A 2YV2A 3RUHA 3PJFA 5G0TA 1A7KA 1YKFA 2GLXA 3OF2A 4IJKA 4S1VA 1PGNA 1U4SA 1UR5A 1MG0A 3DZIA 4WEOA 5EIOA 5U1PA 3F3SA 2JFFA 2AQHA 3WFJA 5CG2A 4MP8A 1WNTA 4AJ1A 4KDEA 4BNNA 1I2CA 3UHAA 3ST7A 1J5PA 1PS0A 1SPXA 3T7EA 2VWGA 3U62A 2WE8A 4HFJA 4BB6A 2YQ5A 1I3KA 4XKJA 3UN1A 1HYHA 3QV1A 3AJRA 4QO7A 2R2GA 3ULKA 3PYXA 3LC7O 5IN5A 4BO5A 4RVDA 1UH5A 4J7UA 1T2FA 3JD0A 3PEFA 4E5PA 3Q6IA 1AUPA 4EGFA 2D1YA 3FNEA 2VNAA 1KVQA 1O0SA 3GVHA 4W82A 4U8GA 4CLHA 5CDSA 1FXSA 4BOYA 3RUAA 1ENYA 2I5PO 2POQX 1MV8A 1HE2A 3WTCA 4WOKA 3DOJA 3I1JA 4MOWA 4CLRB 3E9MA 3GGGA 2FR8A 4BVAA 1T2AA 3OIGA 3JD1A 3ASUA 2PZMA 3WJ7A 4DREA 1BXKA 2P5UA 2WYWA 3D4OA 3ADOA 3SVTA 4CQMD 4RVHA 4HUJA 4CLOB 5T67A 3PVZA 5H83A 2Y0EA 4JBHA 3WYEA 2E4AA 1E92A 4IGEA 2O4UX 1PZEA 1MG5A 1Y7TA 1NYTA 4O6VA 3TF5A 3RKUA 3Q2IA 3QA9A 4CQLA 4EUEA 3IQDB 5TF4A 1X1EA 3JTMA 1F14A 3GRPA 4W6ZA 3RBZA 3DTTA 4NHEA 4WGGA 4G2NA 4YYZA 5A9SA 4U5QA 1HDXA 4E5MA 1NBOA 4TQGA 3N74A 1ISHA 4P8RA 4E2WA 5HS4A 3NAQA 2A92A 2IEDA 3A4VA 1PL8A 2NSDA 3AY6A 4RCVA 2GZ1A 1A5ZA 1JVSA 4KZPA 5DNAA 1GY8A 3N58A 1XWFA 4D44A 1TT5B 1XQ1A 2ZB4A 4RGBA 1R4MA 1DHRA 3W8FA 4BNVA 3BMNA 5KVVA 5JC8A 4Y6RA 3GVXA 5G4LA 2B5WA 1QSGA 4XQ9A 2Q2VA 4IS2A 1ID1A 4NJMB 5JW6A 2VHYA 1KEPA 3W8DA 5L7YA 1LLUA 2JHFA 5F1OA 3K31A 2EP5A 1Z73A 1GTMA 5TQVA 2O4CA 3ICPA 3BAZA 3TZCA 3PLRA 3O8QB 3JD4A 4JBIA 1PS8A 4BS9A 1N7GA 2JAPA 3E5MA 3PHLA 5L7WA 1ORRA 3H9GA 3HB5X 4GX2A 4KTTE 4Z3DA 4DYVA 5KOIA 2VHZA 2EW2A 1ONPA 4JJIA 4XYMA 5KJ6A 2A94A 5TX7A 1LBEA 4JCOA 3LLSA 4R16A 4GWGA 2VUTA 3RU7A 3ZV4A 3H9UA 4NK4A 4Y9DA 1G0OA 4E33A 3IP1A 1LLDA 4DPMA 1N7HA 4R41A 5DBIA 3AM5A 3DZFA 1YGYA 1JAYA 1E5QA 1V9LA 3OJFA 4BL5A 4W7HA 2C29D 3E8XA 4NBRA 4PLTA 1GYRA 4LGVA 1SNYA 1Y1PA 5TJHA 2XPCA 4H15A 2NADA 2F00A 3GPIA 2EJWA 4XDYA 1N8KA 1VL8A 5IZ4A 3ROQA 8ADHA 1OMOA 4W9NA 3UAGA 1DC5A 2ZJ0A 1I24A 3GMSA 4CM5A 2Z5LA 2AXQA 1NX6A 1E3LA 2G1UA 3GG9A 3AW9A 4IDAA 4YQZA 3DC2A 1XU7A 3C3XA 1AXEA 3NDIA 3MOGA 3HG7A 3S2EA 1C3VA 3HNPA 4BNLA 4EW6A 1Y81A 4M54A 1YH3A 2D5CA 1E6WA 2ZTLA 4LW8A 3VVBA 2EKQA 4QXMA 3OQ6A 3TFOA 9LDBA 1FDSA 1QLJA 4KQWA 3Q9UA 3TSCA 2R00C 2ZJ1A 3D7LA 3MJVA 2R6JA 4J1QA 4YAEA 2X5JO 4Z0HO 5EPOA 4F6CA 2GF2A 3UW3A 3DBRB 1WMBA 2VOEA 5C7OO 3U09A 4MKZA 3TJRA 1ULSA 3NEPX 2BF7A 4LN1A 3EVTA 1LSOA 3ZWXA 4CMGA 3MJSA 2LDXA 4MDHA 2PGJA 3UOGA 3HQ4O 4ZQHA 3INGA 4ZD6A 4B3IA 5LDHA 3H3FA 5JBIA 1ZK0A 1HDYA 2GSDA 4HXYA 1PR9A 4MJLA 4YJHA 4DLLA 5BNIA 1VJTA 3ZZNA 3GVPA 3ENKA 2JAHA 4ROSA 3GNTA 1EUCA 1F17A 4YPOA 4BNKA 4NU5A 2FP4A 4AJPA 5B4TA 4K6CA 3VZPA 5B4UA 1EE9A 3QVTA 2PH3A 3KEOA 4Q3EA 5ILOA 3ROMA 5CEFA 1NVGA 3ETDA 2HK9A 3O26A 3V1TC 5HTOA 4XDZA 1BVRA 3H65A 1AGNA 4LISA 4FFMA 3CE6A 2P68A 4F3YA 4OMUA 5AVOA 5KVQA 1E7QA 1SEVA 1ZK4A 4KMSA 2GO1A 3JQ9A 4CMEA 2DBVO 3GN1A 3OHSX 2I3AA 3UGKA 3BMOB 1NHWA 5CDGA 4K9DA 2JL1A 4R51A 4E2ZA 5IDWA 1ZFNA 4GVLA 1Q1NA 1HEUA 4WOJA 3INRA 1LQTA 4XA8A 3KBOA 3MJEA 3ZNPA 3WGZA 3ANLA 4YA6A 3SC4A 1K89A 4RF2A 1SC6A 4IJVA 4BHTA 2D4AA 1GCOA 3W4JA 4CLRA 3JQ6A 1GCUA 1Z7EA 3GA0A 1G0NA 2X58A 4R1TA 4JNKA 1VJ1A 2BGLA 2ZATA 3KYCB 4F46A 3K30A 2X0NA 5L95A 5A3JA 4GLOA 4RVFA 1YB1A 3F46A 4MVJA 2EJVA 1FJHA 5L3ZA 2Q1TA 1PQPA 2G5CA 4Z9FA 2WDZA 5C7LO 2B36A 4NDNE 2NTNA 3V8BA 1V0JA 3RC9A 5A5FA 4XYLA 3BMQA 2FRDA 2Y1FA 2BI8A 1T4BA 3H5RA 3I9JA 1DAOA 4S3MA 4U6SA 4BNJA 2B35A 4FGWA 3WQQA 2HRZA 4FIZA 4LRSB 5TGDA 2P4QA 3ZU4A 4WASA 4IIUA 2EW8A 3BMCB 3CKYA 4NK5A 3BHJA 1AHHA 2GN9A 3UICA 4IPTA 3VH2A 2J3IA 5K0ZA 4TROA 4CR6A 2W90A 1NVMB 1YOVB 4O1MA 3FNGA 3WYBA 1P0FA 2Y93A 1GV0A 3LF1A 4IXTA 3D4NA 3F1KA 4NBVA 3GC6A 5COQA 3F47A 5JCJA 3JYNA 3I3OA 5GZ6A 4NNJA 4JXKA 1SOWA 4KUEA 4YQYA 1I36A 3TFQA 3WNQA 3G17A 1E1NA 1GEEA 1H2BA 2HK8A 4TWRA 1YXMA 2OFPA 4NJMA 4R1UA 2VHWA 1XG5A 1EMDA 2BI7A 4JN6B 4NI5A 2BGMA 1NQTA 1VC2A 3PXXA 5EERA 9LDTA 1WXDA 3IS3A 1ZK1A 1L7DA 3AI2A 3WMXA 1ARZA 4Z9YA 1O89A 5JO9A 4R54A 4BGUA 4D0RA 2DBQA 2RBEA 4J43A 4AJ2A 1UXGA 3FBGA 3FSRA 2OUIA 3PP8A 5MDHA 2BRUA 2QZ9A 1E7RA 3OMLA 2VYVD 2YHIA 1B8VA 4KWHA 4XR4A 1DPGA 1WMAA 4MO2A 5BSHA 3UCFA 3QLJA 2G82A 5I7VA 4PGFA 2VT3A 2IYOA 4JIGA 2WJPA 4PG4A 4GH5A 3PGXA 3WSVA 2E48A 2HMSA 3MJCA 1AXGA 4FJ1A 3ZI0A 1X7DA 1YB5A 3D5TA 5DCWA 3JQCA 1F06A 1VSUA 3KUXA 4DTIA 2BFOA 1IZ0A 1RKXA 1SB9A 2DTEA 1HSOA 3PIDA 2CVOA 4H3VA 1KVSA 4FR5A 3CSDA 1NPTO 1Y6JA 2IODA 3M2TA 1CJCA 2EHDA 1WP4A 2YHUA 2DFDA 2HUNA 1C0LA 5JAQA 1P45A 3S2IA 4XZ3A 1KC1A 3UXYA 4EJMA 4EITA 5U9CA 3T4EA 1O6ZA 2E6UX 5JY1A 2OP1A 2BFPA 5FEUA 4FOSA 4GGPA 3JQAD 1IULA 4AL4A 2QHXA 3R3JA 4R69A 3SX2A 1DIRA 2ZIZA 8LDHA 4R9SA 1M75A 3K73O 1GUZA 4DIFA 2PD6A 1PGJA 3A9WA 4IQ0A 1JW9B 1JLLA 2DLDA 4TZTA 1UP4A 4OJNA 1QYXA 2VZ0A 1NVTA 3PYLA 3PQEA 4W9NC 2HMTA 2VTDA 3ZNOA 1YE3A 4HY3A 5AYVA 3RUCA 5JNLA 4R5MA 1R16A 2DPHA 4QFDA 3DBRA 5FI3A 5JAZA 3L6DA 4NPCA 3KETA 2FMUA 1CQJA 3CUKA 3GDFA 2JCVA 3UCEA 4CMIB 5KJFA 5T6BA 2G17A 1PJQA 1DIGA 4BKPA 4CL8A 2VUUA 4E30A 1K6IA 2X9NA 4LRTB 5AXCA 1JDJA 2DM6A 4QUKA 4U6QA 2H63A 4XEHA 1KIFA 1SZJG 3H2SA 2CFCA 3D5QA 1FDVA 1XU9A 2C54A 3SLGA 2DKNA 3NTQA 3WWZA 2PK3A 2BLLA 3S55A 4OXNA 4UUMA 2AE1A 2ILTA 2IZ0A 4M55A 2P2SA 5C37A 3KLMX 5DT9A 2UDPA 4WEQA 2Y68A 1NP3A 3G1TA 1J49A 4WLUA 3L07A 3SEFA 3U5TA 4GLLA 3DB2A 1V35A 3I9OA 3KEQA 3L4BA 4CM3A 1E3IA 1YONA 1ZVMA 2ZQYA 4D3FA 1DFHA 1ZMOA 2W2LA 3CPSA 1EFLA 3I6QA 5IAAA 2I3GA 1LRJA 1NFQA 4BUCA 4DPKA 1P1HA 2V7PA 4BNFA 4KDFA 4KUGA 2Y1DA 1B26A 1KEUA 5C5IA 3FR8A 4XJTA 4NJOA 1HDOA 1LSSA 3BA1A 3WGQA 5HWSA 4CPDA 3BMOA 4D41A 4CUJA 5A9SB 5ENDA 5CG1A 5DDIP 4MP3A 1C1DB 2GNAA 1NFRA 1XIVA 3GNSA 1JWAB 1JU9A 2PGDA 3MWDB 2ZTVA 3U4DA 5L4SA 2C20A 4IMPA 4NG5A 4OKIA 3OQBA 1K0UA 2CF6A 5GY7A 1U4OA 3TZQA 3WBBA 5IF3A 1PTJA 2CSUA 3JQ9C 4CMEC 1I8TA 4OXYA 3BMNB 1ADGA 3QIVA 5JXWA 5COBA 1H5QA 2F1KA 1HSZA 1JKJA 1M76A 2TMGA 2EGGA 3WNVA 3RU9A 3UF0A 3QHAA 3C1TA 5CHEA 3FPLA 1ZKMA 3E9NA 4IS3A 4FB5A 2Q4EA 2D0IA 2IEBA 1B14A 1O94A 4MKXA 4IGFA 3JYOA 4DL9A 4IZIA 2Y0DA 3FF4A 1VSVA 4BNZA 1HE4A 3R6DA 4OM8A 4P4GA 4ZJUA 4QT0A 4QTZA 3BMCA 1I32A 1HZZA 2C5AA 5CDYA 4PVDA 2OBNA 2O3QA 3WDSA 1NASA 1YB4A 3H9EO 1U3TA 3DZHA 3HSKA 1YL6A 1XGKA 2PR2A 2BD0A 3NGLA 1QG6A 1E77A 3O4RA 4FGSA 4XGKA 4J16A 3FHLA 1AHIA 3NT5A 4KTVE 1OZAA 1PWZA 4L4SA 4Q3CA 4XQGA 4N54A 1E1MA 1XDWA 2QX7A 2YJZA 5THKA 4TRMA 2CVQA 4TSKA 3VDQA 3KRTA 2EERA 5I7FA 2X5OA 5HRUA 4JP2A 2ZCVA 3PJDA 1FK8A 3AI3A 1A72A 2Y67A 5IXSA 2AW5A 2Q3EA 3LC1O 2TMDA 3LT2A 4QEDA 1HDZA 2QRKA 4B79A 2JD1A 5C3MA 2VRBA 2UAGA 2EIHA 3KHUA 4E3ZA 3BTUA 3WFIA 2PD3A 4ZQEA 3R1IA 5AXBA 3RJ5A 4J1TA 1GL3A 1E6EA 2CUKA 3TOXA 3IDSA 1X7HA 1Y5MA 3KSZO 4XIJA 3FWZA 5IN4A 5BSEA 4MVJH 3PWKA 4O59O 2HMUA 3RROA 5JMPA 1HLDA 4B4WA 4XQEA 1WDLA 4B8WA 1PZFA 2X4GA 4HP8A 5BNTA 2AHRA 4ALJA 1BXGA 1LQUA 4CM6A 5DCUA 4BIIA 5TT0A 2Y1OA 1DIHA 2HJSA 2OHXA 3GHHA 5T8KA 3ZHYA 5KNLA 5CPBA 1VPDA 3G79A 2O7SA 5EN4A 1NAIA 2OZPA 2RH4A 3FBTA 2ZB7A 2WSBA 4Q3NA 4D46A 4DLBA 4JJFA 4GL4A 1HDGO 2Q49A 3PFFA 4LSMA 4RORA 3RC7A 1BG6A 2Y1GA 3KXDA 5B1YA 3QWFA 3KLPX 4DUPA 5BQFA 4IDBA 4D3SA 4MIEA 3ZGYA 1XSEA 4BNWA 4CUZA 4P22A 4MIOA 5B12A 4E5YA 2E82A 2I65A 3HZZA 4IMRA 1E7SA 1GZ4A 5CDUA 1UDCA 4DC0A 4GKVA 3OEWA 1ZXBA 1F12A 3ORFA 2QQ5A 1P44A 4J4HA 2C7VA 2VYND 4QECA 1YBMA 1H9BA 3ZWWA 3DOOA 4NU6A 5JE8A 3PLNA 3EZLA 1LEHA 1PS9A 1WLYA 2AMFA 1IOLA 3L6OO 1NNUA 1A71A 1MGOA 1YS4A 1MUUA 3AI1A 3QWAA 4DLAA 4E0BA 4B7UA 4BNTA 4CMIA 2QG4A 4Y98A 3D3WB 1K3TA 3OA0A 3PK0A 1LSUA 4MPDA 5KJEA 3GZNA 4UULA 4B8ZA 4U7WA 1LDEA 2CNBA 4E4YA 4ND4A 3TWOA 4RPHA 1PJ2A 5TNXA 3I83A 2DTDA 3PRJA 5KWEA 1T2DA 3RCBA 1KVTA 1CRWG 4AG3A 1GV1A 1T24A 2GZ2A 4CM8A 1TLTA 3BIOA 1C0KA 2GERA 3WGYA 4WLEA 5HA5A 4Q3AA 3B70A 2OXIA 5I9LA 3C85A 3QWHA 5J23A 3KSDO 1OAAA 1R37A 2YFHA 3FNFA 3NUGA 4OGWA 5DP1A 1IE3A 4I9UA 3OJEA 3VOSA 5A04A 1YQXA 3IUPA 4E21A 3D3EA 1R0LA 1E5LA 1TT7A 4ALKA 3ZU2A 3DZKA 4ND5A 4YTEA 2BELA 3IC5A 4BKOA 1YL5A 3GT0A 4J7XA 3BMQB 5DP2A 1MX3A 3H9QA 4YBZA 4GBJA 2I99A 1ENPA 2IE0A 4GVXA 3GEGA 4Q3DA 5KVSA 3PFWO 2PLAA 2FR0A 3AOEA 3K8ZA 1C1DA 3GDGA 3L4BC 3OSUA 5ITWA 1P1JA 2UUPA 3I9KA 4OIMA 2RIRA 1PZHA 1MFZA 1PU2A 1WAMA 3PTZA 4ALMA 1JKFA 2DQ4A 5AXDA 2NVBA 4JBGA 4EUFA 4BO7A 5A06A 1Z74A 3GFGA 4M87A 1C0PA 1CDOA 3U4CA 1GZ3A 5G2OA 4A73A 4D3DA 1LRLA 3WTBA 1CYDA 1LNQA 1ONNA 1QV6A 1YVEI 4C4OA 2VTEA 4OOEA 1NQOA 5L4LA 4FC6A 5F3RA 1MC5A 1U28A 1N9GB 3DXFA 1B8UA 4HNHA 4Z3KA 4FFPA 2ZB3A 1K5HA 1QLHA 3WOHA 3IKVA 3VAZA 4BKQA 4I9HA 1EVYA 3GRKA 4E5KA 1GD1O 1KEWA 4ZQBA 3NJ8A 2YHIB 3D0OA 4CR8A 2XF8A 2Q1WA 3CMMA 5KCZA 3CINA 3TZHA 2IDZA 5LCXA 2O2YA 1R0KA 2DC1A 3EMKA 3ZWMA 2WD8A 5JLAA 1I3MA 2IXBA 3ROPA 4DMMA 1J0XO 6LDHA 2PZJA 3T7CA 5TLSA 3NV9A 2JCXA 4TRJA 4JLWA 1CETA 4J90A 3Q0EA 2V6MA 1C14A 4BNUA 1H6AA 1X13A 4JX8A 3AOGA 4DC1A 4JQCA 3I9NA 4BNIA 1W8DA 1K6XA 2GGSA 3F4LA 2J3HA 3FRJA 3ABIA 1UXKA 4YDRA 3VZQA 4R01A 2GR9A 5JPIA 1M6HA 1Z75A 1ZUD1 2B37A 2EXXA 2EG9A 2NTJA 1ZK3A 1U5CA 2BGKA 3KYDB 2NV6A 3GEMA 2VRCA 1HYEA 2Y1CA 4KWIA 4UEKA 4O0LA 3DZBA 1KYQA 2WMDA 3BHMA 4UVGA 4PG7A 3QY9A 4RPJA 3VZSA 3DMTA 2GZ3A 1DSSG 3AK4A 4Z0TA 4J2HA 1ULUA 1P1FA 4L75A 4E13A 3C1OA 4CM9A 4CM1A 1ADFA 2B4TO 2OP0A 3EYWA 3GK3A 3WQSB 1V3TA 3PJEA 4ALLA 3JD3A 4ZHSA 4II2A 4OYRA 2NQ8A 3DZGA 4EZBA 1U8XX 2X23A 1RM5A 2B4QA 1T1RA 2CZCA 4EJ6A 1VM6A 4B7CA 3MEQA 2VWPA 4J9VA 2PA3A 4TVOA 2P5YA 3LSYA 5JYEA 1NM5A 2IZ1A 2H5LA 3BHIA 5BT9A 2QRLA 2YZ7A 4WCFA 1FF9A 5T64A 4M8SA 4W99A 4E2YA 4GQAA 3LVFO 4XB2A 4YRAA 4IIVA 1E3WB 4UEJA 4RVUA 1Z45A 4II3A 3LZ6A 4UUNA 5FF9A 2ZCUA 3LF2A 4YCAA 1V6AA 1UP6A 2V6GA 3GOHA 4PLHA 5G0VA 3AUAA 5T8KC 2PKQO 4CV0A 4DQUA 1N5DA 4AJKA 2J5QA 3FD8A 1D8AA 3OJLA 4N5NA 5A9TA 1U9JA 2FPPA 4PLFA 2X9GA 3I5MA 4IQGA 3ZCXA 1P77A 3QVSA 1XA0A 5LDGA 3KM0A 1IUKA 1E7MA 4BKRA 4DA9A 4WJZA 2FPIA 4WK6A 5H82A 3RC1A 4PG8A 4FCCA 5K6AA 1X1TA 2ZYDA 3VVCA 3WWYA 1S7CA 5DBFA 2EEZA 4TVBA 1RPNA 2EV9A 3ITKA 3VPGA 3D3WA 1YL7A 3VH3A 3NT4A 2AG8A 1G6KA 2AQIA 1I0ZA 3BYZA 2G0TA 2XXJA 1EK6A 1QXSA 1EBFA 1K2WA 3ZWVA 1ADCA 5I8WA 3ON5A 2WD7A 4Q9NA 1YBVA 3G3EA 3GZ4A 5DZSA 5G0UA 1DB3A 1QR6A 2I66A 3HFGA 4YEDA 1UDAA 2UYYA 5L4NA 5KVCA 3R3SA 2CD9A 2VWQA 2FOIA 3NGXA 3V2UA 4HADA 2FN7A 5AOVA 1W73A 1H6BA 4J1NA 1KOLA 4DPLA 1M2WA 1SOVA 4J49A 1BRMA 3RJ9A 4BGIA 3KOUA 4GWKA 2Y66A 3WSWA 1JA9A 1QP8A 3QSGA 1DHTA 3RUEA 4A03A 5JDCA 2B5VA 3DAFA 3GH3A 2DBRA 4YRBA 2FY8A 1DC6A 3ZV5A 1P1KA 3RIHA 3OFSA 4BMSA 1CWUA 1DRWA 3E18A 4BMNA 2C59A 2NU6A 3EC7A 1HL3A 4RVSA 1U3WA 1PL7A 2PD4A 1H93A 3FTNA 2YW9A 4EEXA 2X8LA 1DC4A 4EBFA 2GCGA 3EGOA 4NQZA 3DZJA 1IPEA 3KYBA 4MVJD 2WYVA 5L7TA 1NWHA 3VPSA 4DQXA 2Y05A 3K5PA 1EVZA 4NIMA 1ZMTA 2X0IA 3C7CB 4DGSA 4J9UE 3FPCA 4GX0A 1X14A 3JQGB 1I30A 1T1SA 3IKTA 4LSWA 2O50A 2OO5A 1ZH8A 1CQIA 3E9QA 3N7UA 3P2YA 4IDDA 1DIBA 4PLYA 3QP9A 5BSFA 4BO6A 2FSVA 4CJXA 1Y5RA 2B4RO 3BTOA 4D45A 3AOEC 3VH1A 4UVIA 1HE3A 2C07A 3H7AA 1G1AA 1O9BA 4QQRA 3VTFA 1OFGA 4CLEA 2Y1EA 4Y6SA 5HM8A 4YAJA 1P0CA 4L76A 4H16A 2X86A 5EJ2A 4BV8A 3B20A 4K26A 3I9MA 1N9GA 1WVGA 2AEMA
chains in the Genus database with same CATH superfamily
1Q3KA 4HDOB 4MW5A 3JZFA 5HVNA 1ZH4A 4H7DA 5ADHA 5CNJA 5LZ5A 1RQGA 1XNHA 4JC4A 2GHQA 2PSEA 4RHFA 4KO1S 1COZA 1Z3IX 3HDJA 3QJYA 1NYRA 4QTXA 2ARKA 1JAZA 4NFSA 2IZ6A 2IRWA 3T61A 2HPZA 2OHOA 2W2TA 4UXJA 3WYGA 1BFDA 2P62A 4KQXA 3TQHA 1DOHA 2HA7A 4I99A 5KO2A 4TV9B 1USVA 5AQ1A 1Y7LA 2ZJYA 3MW8A 4RY2A 2ADMA 3IIIA 3COZA 3DHVA 4BMXA 1A4XA 1HEYA 2YIVX 4O4IB 1ZL0A 3DOCA 2IDMA 3BVPA 2CHFA 2V55B 4RVCA 4CM4B 4K6FA 1Z38A 3V7YA 4R98A 3LO8A 4XYGA 1RKBA 3HTXA 2G1KA 4I5GA 5JRZA 2VNJA 3PGKA 1RQPA 1H1DA 2ID7A 1F38A 1M3SA 4P34A 3SEZA 4A0HA 3A2MA 2JGEA 3R9XA 4PONA 2HNAA 2PY6A 2VRWA 2XQGA 3ONFA 3RS7A 5KWIA 2CL7X 4LTDA 5JO0A 1W93A 4BC1A 1BMQA 3HGTA 2MSCB 2DWCA 2EGHA 3PGMA 3QM1A 3QVWA 3I76A 4US2R 5DXJA 3P9SA 4DXAA 3BFPA 3V3KA 4BCCA 3K9HA 2QRHA 1TU4A 5C4MA 3S6JA 3RRJA 4F45A 2H2HA 1E3SA 1E9SA 1FRZA 3R3XA 2JLVA 4JV5B 4Z8XA 1V3VA 2GM5A 4TKMA 2HZ7A 3MRSA 1J0AA 1MT0A 3L49A 2OHGA 3F5SA 2PDAA 3OT5A 3DM9B 3W2GA 4AO6A 3Q8LA 1HI9A 3RKRA 3P19A 1QF7A 4LHWA 2W70A 3FLBA 3JZIA 4MRVA 4BO9A 3R5TA 2FB9A 1UPUA 3AG6A 5EMHA 1I4WA 1WMSA 4G0OA 1XEXA 3FGNA 2HWYA 5AW8A 3UKOA 3QE9Y 1MQ8B 1MIOA 2BGTA 4XQCA 4TTIA 4LYAA 1FC0A 2JGIA 4CR7A 1L1RA 4GX1A 3VPHA 4C87A 13PKA 1IWPB 1R6DA 3PXBA 3K9QO 5FBLB 4YP7A 1DBWA 3W79A 3TQTA 4F92B 2ZIVB 1J1IA 2EWMA 3WICA 2XWSA 3KFLA 5SV2A 3H5TA 4A2PA 3UV7A 2X8WA 4XDGA 3RFTA 1GYPA 1T3ZA 1L7BA 4M8NE 1Y9EA 1XC7A 5ILGA 3DMTC 2QAIA 2XTZA 3DVAA 4O02B 5DM60 1XCMA 1ZN9A 4RZ3A 2L17A 2XITA 4O5OA 3VR4H 1FTGA 1P7WA 2WJAA 3X3HA 5BUZA 2I8LA 5EP4A 4ITUA 1P74A 1XV5A 4HSGA 5AKYA 4E22A 2I3DA 2WNIA 1YZYA 1GUFA 1BD4A 2WVAA 2KB0A 3EG5A 2F90A 1WCIB 3DJFA 4ZEWA 3DQPA 3ZVNA 1B0PA 3IOEA 4C05A 2M6LA 1DINA 5AJVB 1KS2A 4M8IA 4UATA 4QC2A 4MWDA 4D74A 3IJRA 1MLDA 4CM8B 2RONA 1MXHA 1OC4A 2NX2A 3PI7A 721PA 4IIYA 3W0LB 1GRCA 4INPA 4V2IA 3MJ4A 4J1SA 3BXOA 5TE9A 1PW5A 3RIXA 4DDTA 4KHPB 2JA1A 4HNRA 4J0KA 1I9GA 3CLSC 4E5DA 4R9UC 4NDAA 2H57A 1RTKA 2O23A 3KEFA 4TL6A 3LCJA 3MQFA 3QOFA 4NBSA 2C2OA 4QEKA 1NNLA 2O0LA 3QFTA 2YDXA 1L3BA 5HKKA 1BW9B 3ZHXA 1M6NA 1RCUA 3KPUA 2ZKIA 2PVSA 2Y2UA 1BWPA 4P4LA 3G6KA 4A4DA 4JK3A 3MCVA 4NMHA 4CIWA 1B2LA 1DJOA 2H1SA 3OZGA 5IUJC 5EGSA 2PKXA 2FX2A 2WA1A 1KBZA 4NCBA 621PA 1DO2A 4HPJB 3GLIE 4GDMA 2XOXA 1ZI6A 1REQA 3BB4A 1QQ7A 4RQAA 3EVNA 1IZ9A 2XB9A 1CTQA 2QOEA 4DDKA 2RD2A 2EQ5A 2GEVA 3PZRA 1WOYA 3RI3A 3ZWAA 5B2FA 2W5UA 3QJGA 5FUVA 1DEKA 4EH1A 3TKYA 1DLIA 1LTHR 3KR0A 2YFQA 3WGLA 4M8KA 2HQSA 9MHTA 3K0SA 2PTHA 1LC0A 5TT1A 1NOJA 5DYNA 3Q3IA 1UT6A 1F9AA 3QOXA 2YXNA 4TYMA 3AR3A 1RWQA 4Q4CA 1RXCA 3TQFA 4OHKA 4RUKA 3D0KA 1U8EA 3QKUA 1KDZA 3HKDA 3FUTA 1EK1A 2B0JA 4INOA 1I33A 1GTSA 3OVMA 2IU3A 3MJFA 2QJRA 4HWSA 4UBNA 5T3YA 1JFTA 3DL2A 3H9BA 3ELYA 3IHKA 5IH3A 4FDTA 1VCNA 2XYVA 3E1KA 1W94A 2DFPA 1UT5A 4WH0A 1HV8A 5JZ9A 1JN0A 3AP3A 1DJPA 3FR7A 1XYYA 4DCOA 5ARBA 3UWKA 2ZUEA 3BWYA 4B4VA 2C77A 4BJ6A 4GFDA 3GLFE 3PDJA 2AA3A 4HJXA 4DOMA 3IEXA 1Y6FA 3SQXA 2HD4A 3MUFA 5DKFA 4ZVKA 1EK5A 1RJDA 2AMJA 1UOOA 4I1OA 2ZRLA 4LIPD 2IF0A 5HJ2A 4MUYA 10MHA 4DMGA 1B2RA 3QRWA 4FPXA 4QYWA 2H0RA 4HZIA 4K6HA 5JWOA 3E84A 2DH6A 3GCDA 1ZUNB 4DCVA 5CCBA 3L02A 5BW8A 3DAOA 3FCXA 1OBFO 4JU8A 1CS4C 3HSSA 3EIWA 5AVUA 4L0QA 3CFYA 1XVLA 1GQOA 2CK3A 2QTTA 2CUTA 1J2TA 1S9DA 3BTVA 4D79A 2Z2KA 4G1FA 1IUNA 4GX5A 1NLMA 4N7BA 4OHVA 3WMWA 1KO1A 4D99A 5LWQA 3RFCA 1GDTA 2ZSKA 3MCUA 1O94D 5DXAA 2YN4A 5CTAA 3F1LA 3TSWA 4C0LA 4EZEA 2JH9A 4W5JA 3GLGA 1BA3A 3L1VA 3AHIA 1DUIA 4DKXA 1X9HA 1PD1A 3PNOA 2YJNA 5A2GA 2XXAB 1P39A 3B5EA 4LDZA 3ZDCA 4ZCRA 4MI3A 3EX7C 2ZBDA 3DHYA 3FG9A 1C4KA 3FCCA 1PGQA 1CQWA 1BKDR 2OXEA 3VHRA 5HG0A 2HA3A 4CGZA 2RHGB 3ED5A 4OFBA 4N9QA 3DWFA 1TYBE 4O4HB 2D0OB 3SVZA 4V0ME 1WKCA 2WWFA 1YZUA 1FQWA 1YS1X 1OGIA 1BDMA 3ANXA 3DWIA 4GMDA 4XVHA 3H8SA 3INTA 2V1XA 1D6JA 1EWKA 1ZCZA 1PFQA 2W6QA 3Q7EA 4WXRA 1FFEA 1XP5A 1PJLA 3V9AA 2FSVC 1GGVA 3MQ2A 3NV7A 4G86A 2C98A 4EL5A 5KYTA 2G1PA 1QVWA 4MEAA 4FGZA 2DR0A 3EUEA 1KQPA 5F1PA 4ITRC 5EQTA 3ZI7A 4XUGB 3H11A 1SPBS 2HWKA 5DK6A 3EA4A 1YO6A 4PHFA 4BRSA 1X8XA 2VUSA 2FWJA 4LXUA 4LV5B 4N5DA 3SIRA 1UWLA 4Y67A 3UFXA 2ZSIA 2NUTA 2PWYA 3AF5A 3CBQA 2C9YA 5HQ3A 4JLUA 5LQKA 1E3EA 1R8JA 3AT1A 2F43A 3B6MA 4WXHA 3T41A 4B5KA 3DBHA 4C1BA 3TRJA 1NVEA 3RS0A 4QDTA 2IHYA 2QRPA 3WNDA 2ECFA 4WFQA 2WHEA 4IH9A 2EFEB 4PZ9A 2TMYA 1CKEA 3HL4A 4G8CA 2G76A 2V74B 3ASVA 4XD7A 3S28A 1RI3A 1XVAA 3O1IC 1SCUB 2REBA 4EY7A 3H4VA 1G2OA 4L2IA 2XRYA 2RB5A 4BP8A 4N01A 1Z63A 4KXXA 1XRSB 1H2WA 2RGGA 5LP1A 3ZIAA 1YA6A 1QH1B 1GPDG 3JW8A 1G4AE 4A0SA 3D2AA 2EG5A 521PA 1RHUA 1RWNA 3ZWBA 4OAQA 4GR4A 1E5TA 2ZQ5A 3OX3A 3UWSA 1LW6E 4AQ7A 2HA2A 3SC6A 1NTOA 1Z0JA 3V8PA 3IHWA 4LY3A 4YJ3A 3Q11A 1NPYA 3JASB 3AERB 1TNDA 1OXBB 3HHEA 4UNQA 5E3IA 3P32A 4EMUA 2BFMA 3P0RA 1QQ6A 2BMAA 2VZEA 2CDNA 5CFOA 3CEAA 4IX1A 4R2XA 2ZSJA 2XUDA 3JVVA 1ESNA 1KVUA 3TD9A 3K9NA 2A0XA 2FMFA 1ZICA 3NASA 4ASUA 1YE8A 4O2LA 1LB1B 2O1EA 2PEYA 1I2BA 3KWFA 3MJHA 3QU2A 1AO0A 1EGQA 1UPCA 1RM0A 2ZKLA 3ESCA 3PDUA 1ACLA 2D06A 3NDPA 1VE9A 3NYRA 2D5IA 3OP1A 4WBSA 3FLAA 4PZCA 3SLKA 3V1MA 5KKCA 3H4IA 5IDXA 1H0SA 1Z7YA 1VLQA 4TTRA 2CB0A 4F86A 2PMKA 3RYTC 1GQYA 2HO5A 2WT9A 5FR2A 1Q19A 1H0RA 1VGQA 2OFWA 2WD7B 4ZV9A 4EIWA 4TRNA 1IL0A 3PICA 1VHJA 4C0KA 2O2HA 4FS3A 4R3WA 5KHOC 3JV7A 4ND8B 4B4DA 5D00A 4ZJZA 4FE3A 4YRPA 4EHDA 1SXPA 3LIIA 2VP5A 3NXKA 3L77A 4RPKA 3VPCA 1AKEA 4JP5A 1QHFA 4YLGA 1XXLA 4BJ3A 1QG4A 1VLHA 5H0IA 2VIIA 3WDMA 1LTQA 3KIPA 4TSFA 2AFIE 1RLOA 4INJA 4IH4A 2RK4A 3E7XA 1M2VB 1RAFA 1YTUA 4RHYA 1H3NA 1X0VA 2WWHA 3A1NA 1OT3A 3K16A 1NVUQ 2ZULA 2H4WA 4I08A 4IQ4A 4ZEXA 5TIIA 2IYZA 4M0DA 2PUJA 5AJZA 4MDEA 3M33A 4KQKA 5HX7A 5KOJA 5F4BA 4BNMA 2AV6A 3AW8A 4TMVA 2GAAA 4IQ8A 3VC7A 1Q83A 2OHFA 1D3AA 1XDDA 3CWQA 3OM9A 3IIKA 4H27A 4PCLA 3THSA 1N34B 1RPTA 1PWXA 4ZT2A 1WPQA 3SS9X 4RO0A 3P2KA 5FYDA 3TN7A 2XDQB 1SHUX 2QMYA 4N49A 1L6RA 2HQOA 5JVDF 4J3JA 4PZDA 4C2AA 1T34A 4ECAA 1Z5OA 5I45A 3VNRA 4RC9A 4AKGA 1PG5A 4QULA 3SNHA 2D4HA 3MQ4A 1DBRA 2C2WA 4DANA 1N75A 1R6TA 3K20A 3BMXA 1EFDN 1U8FO 2V6FA 3RRNA 3O92A 2WWVD 3ZWNA 3I04M 1BHJA 4CQMB 1Y1LA 3OCXA 2I78A 3OLYA 2QM7A 3B52X 1G20E 2ZT8A 3WXBA 3ILVA 2QZZA 2XRFA 1WCWA 2RH9B 1OTXA 3S7TA 3PWZA 3PC8C 1KNXA 3R9IA 4LDJA 4LFAB 3DLPX 4DMFA 1W85B 1MOPA 2I4IA 2YCBA 2Z4TA 3FB1A 3O73A 3VTAA 4IBOA 3U31A 1CS0A 3A4MA 4FDLA 3WGKA 1KYIA 1JT2A 1WJGA 4D92A 1TFUA 1EQ2A 2NO7A 2WIFA 2J0SA 1FNCA 3E5RA 3S2FA 3A6PC 5LQNA 3IKMB 1BCSB 1OTHA 5AFSA 3AJ8A 5KYWB 3F0TA 4P9NA 2N3ZA 4UASA 2WG1A 3AUKA 4C6TB 1STOA 4AIIA 2Q46A 2I2AA 3O03A 4IWNA 2HIMA 1FW6A 5J4YA 5DHSA 5FFFA 5BN5A 5FWDA 2DR2A 4CMAA 1HZJA 1FYVA 1VHTA 1OWLA 3W2FA 1GR1A 3BBPA 3EUFA 1T9HA 3HUDA 3KZXA 3EAQA 1X8LA 1NBHA 1ZOIA 4QUHA 3KQYA 3DFMA 3ZW7A 4ETNA 4CODB 1X1SA 4Q24A 3EBLA 2ZSFA 3QVOA 1GA1A 4FJ2A 1U9IA 2FN8A 5EKXA 3WLIA 5BSTA 1JFSA 4QUJA 4ZI7F 3DEJA 3HRKA 4KVGA 4PZ0A 1UKAA 4ZOEA 3K0KA 2YRWA 2RH5A 3OO1A 2GVDC 4WJKB 1A4RA 2G7ZA 5FOQA 1USIA 4OH7A 2H2FA 2QX8A 4LAFA 5JS6A 2ZPTX 5BN1A 2EFYA 1Q3HA 3C24A 4LCJA 2YIMA 4OO3A 2ZUFA 3DLCA 3UNXA 1JTFA 1ACMA 5AM5A 2CV1A 3NTLA 3E7DA 2FPLA 1Y80A 2OV2A 2VF4X 1YR6A 2W83A 1V7ZA 3HYLA 3IYLW 4YRIA 1ULZA 4B71A 3WWCA 3DKKA 3KQQA 5I7EA 3NBZC 3JSAA 1Z47A 2PZEA 3AYXB 4KQCA 3R6TA 1ZPDA 1ZSNA 3DUWA 3L1JA 3IEPA 4UMDA 4BQQA 1PFWA 2C3UA 3DDHA 3DPSA 3V5NA 4M9ZA 3ILYA 2Q4BA 1C3OB 3FMGA 5CAEB 2XEDA 4CMKA 3EQ6A 2VNSA 4CXMA 2JK1A 4D9HA 2J1LA 1E2MA 2HLNA 4R2KA 4WESA 4LXXA 4C4AA 3AU9A 3LH5A 5AI9A 4D3XA 4EPWA 4LF7B 4QICA 5ICSA 1LFDB 4LYFA 1N9KA 2YY7A 1VL1A 1X19A 5A3RA 1WQ3A 2WTUA 2HSDA 2V1UA 4W5OA 3W6NA 1SG0A 3LI2A 3VDMA 3B7PA 2Q3MA 4ZOLB 4GKAA 2PRSA 2IEGA 3LUAA 3N8HA 1N2GA 1U7UA 1U8ZA 1ZZEA 3IE2A 4POOA 1KOFA 1SOMA 3FJOA 4FCWA 2BPOA 1QCYA 5FDFA 2MSDB 4ENQA 1F2UB 1NJ8A 2HN9A 1Y1RA 3ECCA 2C2KA 3COSA 4J0FA 3MK31 4RD4A 1BE0A 4ZPJA 1O6BA 3SX4A 1Z9BA 2HHCA 3C3PA 3P2OA 3F3MA 4Z8YA 4J3NA 4BLOA 3GGSA 2CL0X 3VJLA 3DEYX 4FOOA 1Z88A 4GC5A 3RYHB 1WU7A 3ETEA 4Y6GB 1N0VC 4EEZA 2B3TA 4EI9A 1RU3A 3BX1A 3K32A 3LY9A 4MUHA 4O0MA 5EWJB 1WLSA 4HFMA 1QANA 4URFA 4E11A 4KPYA 5JY6A 1DRKA 3VO1A 3E58A 4L0MA 4LBVA 3N7TA 1KERA 5B6IA 2HB6A 3OLCX 2WBLC 1U9CA 1UBOS 3WR5A 4CTMA 3GFBA 4FC7A 4LVUA 3WQBA 1ABEA 5IULC 3T7DA 3HWX1 3DL0A 3AEQA 4OXQA 3K4PA 3ABOB 5KNBD 1Q6YA 2EKPA 4GUAA 1YKSA 3MD0A 4FVTA 4MV5A 5JLJA 4Y8VA 2ZAOA 5DWDA 4K28A 1RQ7A 2YH2A 2WU0A 2FUG1 5BOSB 2PMFA 5GIPE 3OBBA 3H86A 3M5WA 4P4NA 3IESA 3LK7A 3NNDA 3RUFA 2XMQA 4BEVA 1TQDA 3ENQA 1IXSB 1OAKA 3NTOA 3ZKWB 1MPTA 4N6NA 1YBFA 1DG9A 2NOAA 1KEVA 2OZLA 1GKLA 1ZQ1A 5JJCA 3FETA 2IY9A 1VKHA 1SVOA 3FPKA 3VR5A 4G0UA 2LKDA 2QV0A 2OG1A 1GKYA 3OEYA 2AD5A 3IIJA 3AGPA 4M49A 4X60A 1ISJA 2X76A 4XIYA 2A57A 2CKMA 3I92A 3F3YA 5AWFC 2IA5A 4RYLA 3A4LA 3ILHA 1K4MA 3LQ1A 3RSLA 4BAZA 1SQFA 2IW1A 5EJ8A 3R7BA 4RNDB 1V5WA 1EGVB 2WC1A 1CFZA 2XR1A 4I5IA 4TT3A 3ZJVA 2FK7A 1MDFA 1KIAA 3FMVA 1ZUHA 3J81A 4IJMA 4D8XA 4K81B 2IP2A 2PKQP 4JWTA 4QOHA 4U0KA 3A1DA 3W34A 4ECEA 1ODIA 1LDBA 4EHAA 2IE8A 1Y1KE 2XYQA 3JU3A 2HBQA 1TVKA 3IEKA 3QEKA 5HXAA 4GOOD 2PKWA 1YR3A 2D5AA 1JBKA 5F9FA 1PR0A 2Q1UA 1BOFA 2GPWA 3I1FA 4MINA 3EVCA 3KQOA 2AZ4A 3GFPA 3NEAA 2A86A 1XN1A 2FQQA 4BGEA 3VNSA 2JEYA 1K63A 1W0KA 5AVVA 1NQUA 3WISA 1LSJA 1L2TA 2C9ZA 3DDWA 1RXEA 4Q3BA 1E2EA 5CW2A 3NHSA 3PEVA 5CYOA 5DM4A 3R8CA 4BQPA 1TD1A 2HK6A 2YQ4A 1O9HA 3BD9A 3PPIA 4YRJA 4MTLA 2RHHA 1RI5A 3W7VA 2XH8A 1E1LA 1E1KA 3ZWOA 4JLDA 2GPBA 1B4DA 1IJFA 3JCZA 3I12A 3HCRA 4HATA 2Q2OA 3MBOA 1P61B 1KY4A 4HX2A 1NW7A 1P9OA 1T5HX 3VOAA 3O4IA 3DTVB 3TZBA 1PAUA 4O8ZA 2FG5A 4KR3A 1K98A 3M81A 1YZ3A 3N7AA 2YVLA 1KZ9A 5B5SA 3THWA 2DBZA 2Y0CA 1ORIA 3A9VA 4WY8A 3O1JC 1NJFA 1U7DA 2BC9A 1CY1A 1Z7GA 3AUTA 3IJPA 5LDDC 1GNTA 4YRMA 4CN8A 4NENB 2WOJA 1Z4JA 3D6FA 3ICVA 4I5EA 1V2HE 2JFOA 1QRUA 4W8OA 4O08A 2JI9A 1Z6ZA 4Y2TA 1Q7BA 5ITZA 1V5GA 1MAAA 1BDJA 1I4OA 1R0SA 3DLTA 1QZZA 1JP7A 2FP3A 2Z09A 4LCEA 3NBQA 1DRUA 3JATB 2VT2A 3PE3A 1QZXA 2VG8A 3G5TA 3AFMA 4CTJA 4CKBB 1C0IA 1TT5A 1QYVA 3H42B 2Q0XA 4OAOA 1YWGO 2R751 4F38A 4NBTA 2R1TB 1NPDA 3RADC 1NVVR 4C22A 5DLDA 4BWYA 3OICA 4Z9XA 5KWSA 3RS3A 2H4YA 1US8B 3I3SR 3N2GB 1TUEA 2OD2A 2VP4A 4QFCA 5KDOA 1WZ2A 1SUCA 4GOKA 4HG2A 4A1OA 5BWCA 1Q0LA 3MCZA 2W2KB 4PZLA 1A9YA 4DA8A 4EF6A 2D3TA 1DGQA 3PIIA 4IDGA 2HU5A 2VJQA 3WIEA 1L8XA 2MCFA 1AC5A 3JAKA 3ZGNA 5IMSA 5JSQA 1KZGB 1RQ2A 1SVKA 2J5RA 4N8SA 2IZOA 1W29A 1LC3A 1OOEA 1QX3A 2DAPA 2CVZA 1T9GS 5ULLA 5C9ZA 3Q4GA 4UJ3A 3FW1A 5KTOA 5DYTA 2QG9A 3C1AA 2C4VA 4KQGA 1L4EA 3R0QA 2B8EA 3G8YA 4GMXA 3OBIA 3ZE1B 1IXRC 3P27A 2FTKE 2GDZA 5E1BA 1KO7A 1OWNA 2XX3A 3HO8A 1NC3A 3RHTA 1HORA 3HVUA 3W1EA 5K05A 5JRDS 2RHCA 1AV6A 3L6UA 5IWAB 5MN6A 4GPBA 1PGOA 1ZCBA 2C0PA 5JVDA 2RGAA 2ZG6A 2QW8A 4KXYA 1SZDA 2PMCA 2G09A 2X19A 1Z29A 4PO9A 4ZKEA 3V8VA 4I55F 1XK6A 1YC5A 5DSZA 4L4XA 5TF0A 3BD8A 4BMVA 1JFRA 3JQAA 3FOCA 3NVAA 1YR7A 5BWOA 2KS6A 1F2DA 1BMFD 5EEGA 2O2XA 3PC7A 3PFCA 5M04A 5BYBA 1CUJA 2HHJA 5C0OE 2F1RA 4KXMA 1CIVA 3GLTA 2GWHA 4XOIA 3OPYA 2RC5A 4BTEA 4BWGA 1UJ4A 4M9QA 3VJMA 4YUAA 3LUFA 1PW7A 1RYDA 5EY5B 4CUKA 1DEAA 1RFGE 5I7SA 1Q0HA 4G0MA 5F3DA 4L27A 3DE3X 1G6Q1 4MVJM 4WDQA 3JQ7B 1XN4A 1TTPB 3ZCQA 3BA6A 4BE4A 5CNIA 1WG8A 4DE5A 1DZIA 1MRSA 3N28A 2O0MA 1RJWA 4OBWA 4X8LA 2C58A 2JLSA 2HIHA 3S8MA 4DUGD 3A3KA 2E7ZA 4P0QB 2VDWA 1TAHA 5C5EA 1EDZA 1G6OA 3HXTA 4RZHA 4R1SA 5AJUA 2JFUA 4BVFA 3IMFA 1U2GA 4WACA 2XAAA 1NRIA 1CUAA 3LY7A 2QD1A 3THXB 3DGFC 4RESA 3PHBE 3RJMA 3VJKA 2FEXA 2DUNA 4V3CA 5IK2D 5JQGA 5E0KB 1LJUA 1LS6A 2JFGA 2CDBA 1FFXA 2GEUA 1XNQB 3GEDA 1LZLA 3DEHA 4ZI7A 4EHHA 2Z4RA 4FBGA 3TI9A 1A98A 5LMNB 1NAHA 3LMKA 3NUZA 2BJVA 3KU1A 3LHFA 4RIEA 1KHTA 3LPCA 1E9VA 3M34A 5ITVA 4QOJA 4RZXA 3N8IA 2IOFK 1UAAA 2ZSHA 1VCHA 4G23A 1TIKA 4YAKA 1U3FA 4Y0AA 4KWTA 1C1XA 3KQWA 1BS2A 1RYMA 1ZM7A 1MVOA 4MRRA 3R5KA 4OLHA 3QQPA 5I9NA 2QDKA 2H5JA 4D6YA 1B3RA 1P81A 1E3DA 2ODTX 2WQZA 3R7NA 1F20A 3SHWA 3ER8A 1XQWA 3BQMB 2KE5A 5A7GA 4OU5A 5HK8A 2DFVA 4DV6B 4B75A 4ZOBA 3EA0A 2EKBA 1NMXA 4D4HA 3KALA 4AYXA 5EWMB 4BX8A 4CEJB 2ZK7A 1SUFA 3UJAA 1R10A 3BS4A 3N2LA 4O3FA 4ZCSA 3DMGA 1TW3A 3NHKA 3B6ZA 3EARA 1RTTA 1G17A 1ZHOA 5HF6A 2VBFA 2NYRA 1G8PA 1M8KA 4D80A 5JH7B 5IT9A 4FOPA 3B5IA 4ZEVA 3GRFA 3L05A 1RQLA 1JGTA 4D42A 3OC0A 3Q5GA 5DOVA 2XWPA 2FFQA 2XGOA 3GI1A 2YWXA 3GNQA 3R20A 3NC1C 5JYDA 4M1MA 1DXYA 1SHLA 1I14A 3O5AA 1U3DA 3LFTA 3L8EA 3L7LA 3PD0A 5LLTA 3AY3A 1UXIA 4RFSB 4UNRA 1KH2A 4EYGA 1MH9A 1OIVA 2UYGA 4FXPA 1BQEA 1IPFA 1NKTA 3H18A 1KI7A 1FX0B 5A5DA 4X6YA 4R8RA 2P9CA 1T0JB 2AW3A 2DUWA 4A1FA 1GVNB 4LE0A 1P5JA 3WGJA 3GWGA 4H1HA 4EJSC 1IN8A 1W47A 1QNFA 4V02A 2Q45A 4BQSA 2H6EA 2BJWA 4COKA 4HAWA 5BXQC 1MAVA 1H2HA 1PJSA 2XMDA 3ACDA 4Z2AA 3VYVA 4PRKA 1XZHA 1WW2A 2XUQA 3VSCA 1BXZA 2WYHA 1E99A 1DBIA 4HLUC 1DX6A 3H1TA 3K1AB 5K8VA 1FDUA 1YCHA 3WL3A 4EO7A 1PUJA 3RYCB 3CJRA 3NBFA 4Y18A 5ALXA 4LYDA 1QB7A 2C9OA 5AM3A 1VJGA 3X43A 4RQUA 1XQYA 1BHO1 2AK2A 4UM8B 1B3BA 4Q7JB 5TSDA 4B3GA 4CEHA 2VHCA 4HX5A 3MF4A 4B2IA 3ZWCA 5JFTA 3KYCA 4NTZA 3QLVC 4AT1A 2ZBUA 4JOQA 2P9JA 4JUDX 1EE2A 1Z22A 4MW1A 1GZHB 1RPJA 2QRJA 4OYLA 5AICA 2HV9A 2C96A 2E5WA 4Q1EA 3WLJA 5HGXA 1N2SA 4G89A 1OH6A 3DT6A 2GCPA 3EIUA 1HQCA 4JLMA 3VX3A 1WTCA 3K9GA 1D2AA 4KIWA 4RA6A 3LTEA 4ZVSA 2OORA 2QPAA 2EF0A 3SJAA 1Z6YA 1KKMA 4HAUA 4DMCA 1LWOA 3B9QA 4N0EA 1CB7A 4AN4A 2RGDA 4RADA 1A95A 2C7GA 2NXWA 3QMMA 3MD9A 4OB7A 4F6LA 1IN6A 3I9V1 3BTSA 4ZO8A 3U9LA 3VR5H 4CZ2A 5IJ9A 3ZGVA 2H3EA 5JAUA 2ZFUA 4QXQA 4EDHA 1SUBA 4O63O 1DQPA 4LXYA 1SKAA 4YUZA 2UYOA 1MD9A 2CE7A 3EVZA 4UCQA 3G8CA 5F35A 2WNHA 1S3IA 3EB9A 3G5AA 3DUFA 1ZEJA 2IYLD 3KHKA 4NZPA 4O4JB 2Q7DA 3ZBQA 5IANA 4QU8A 5FRDA 1DKOA 3W4IA 1UDXA 4RTLA 3IR6A 3B6IA 4QBFA 1M6VB 3IUYA 3EUAA 2PKRA 3AWIA 1H8ED 4HSEA 5F12A 3IP9A 4B32A 2HKIA 2FZKA 1D9XA 1KH1A 2YNMA 3Q1KA 3HN2A 3SAJA 3ZUGA 4ZYZA 2GDJA 4YJGA 4MPRA 1G8MA 1EP1B 1JWBB 2GRUA 2PSJA 3PGA1 3RS4A 4Z54A 4QJBA 1HR0B 4PS0A 1I5RA 5KPDA 4PTLA 4Z4GA 2YXBA 4DSUA 4GOND 4OV6B 3SDBA 4OL9A 4N0QA 2DJ5A 4PXAA 3VSAA 2ISQA 2AEFA 5AUPB 1DO0A 1JIKA 2QU8A 3SBXA 3ZZUA 2CL6X 3OOYA 1JSZA 2ATCA 1W8IA 4TRRA 3RWBA 2R87A 4Y6LA 2XHZA 3DCIA 4Q5IA 4YVFA 3S1AA 4DLSA 1KGDA 2QN9A 3KLBA 2XIJA 3CCBA 3ESBA 1Z35A 1WEHA 3EBPA 3GP3A 3LOPA 5LUBA 4DVJA 5JUWA 2R65A 2ZRJA 5ALOA 2E9SA 1WBDA 2Z56A 3EWIA 5T5QA 1R5BA 4J91A 1JHYA 2ODEA 2TYSB 3BILA 3NX4A 2Q99A 2PUTA 3C0KA 3N39C 1XKLA 4LJ6A 3ZE0B 2ZJ4A 4N1AA 1TGYA 1XNGA 3UK7A 5L51A 2R2AA 1KJ9A 3ETGA 3KZ1E 2IHJA 3LUKA 3TRIA 2R25B 3E8MA 4FLEA 3V48A 3ZE2B 1NATA 2XWJI 2MOKA 5SYNA 5K7SA 1FMCA 5EE3A 1V11B 2DBYA 2IC5A 1J1UA 2GBLA 1EZ4A 1SKYE 3DHEA 1O95D 2NU7A 4RLQA 1U7XA 4FI3F 3PGJA 4FFNA 2BRUC 5L40A 1D2CA 3I4CA 1PGPA 5HQTA 5K3DA 2Q5CA 4R68A 4Q7MB 2E4VA 2V8BA 2RHMA 2YY5A 5KSOA 2Q41A 4REQA 1VKNA 2PZ8A 1YHNA 3UKDA 2VBIA 4QG7A 3RU3A 1ZS9A 3OUZA 4LQCA 4HDSA 1CLEA 5CJ2A 3AIMA 5TS3A 3SC3A 2YV2A 3NIDB 3RUHA 1VG8A 2VK9A 2FLVA 3SMQA 1OH7A 2D1FA 3DF9A 3BE4A 2R6ZA 3OF2A 2V0CA 3G23A 4PM4A 2B82A 4B85A 1U4SA 4X62B 1UR5A 4FB4A 3B8HA 3EFHA 3K9WA 5U1PA 2IELA 3BSFA 2PBZA 1T29A 3F3SA 4ZI5A 3HABA 3P8ZA 3DMDA 4JLKA 5FBWB 4F5EA 4LYGA 1KI8A 3OTOB 4BFWA 5CG2A 1TJ5A 1WKBA 5D5QA 4AJ1A 2VZLA 2C7BA 3UHAA 2Y1XA 1H4VB 2WIKA 1ZKDA 4HTAA 3UJ7A 4UDOA 1SPXA 3M7IA 2W2PA 5ALSA 4MW9A 2NIPA 1DNPA 1GZUA 3AESA 2LW7A 3MWFA 3U62A 2XBLA 1I3KA 3WK9A 1FLDA 1GPAA 1HYHA 5KU7A 4XFKA 3SBDA 2OBLA 4QO7A 3PXEA 4BO5A 1A5TA 1A8QA 1KDYA 4F2HA 3AF3A 2EJBA 2IPNA 1J20A 1XAJA 2MMCA 1SBZA 4KXNA 5KC9A 1PNQA 4KW7A 1KVQA 4LDNA 1V1MA 2TECE 4DNFA 4IVQA 4B81A 4I55A 2CXTA 1CZKA 3RUAA 1XAHA 5FAXA 3A10A 2GETA 3V80A 5JMOA 2WUDA 2HH9A 4OHOA 4WOKA 3WTCA 3CQ9A 6ABPA 2G8NA 2HC9A 1L9XA 1TJNA 2CHVA 2HTEA 2W58A 3E9MA 4K40A 2FR8A 2HREA 3GEEA 4YRTA 4AP9A 4M9SA 3K0BA 2PUCA 1UM9A 3TRDA 4M9CA 2VSOA 3I8OA 4ID3A 4B5LA 1TO2E 4G1BA 2PUBA 4X85A 1RVDA 2P5UA 2OWDA 3ZCUA 5C53B 2NO6A 2EFCB 3D4OA 3SVTA 3VKGA 2PLNA 5FBRB 1K7CA 1WSWA 3BCUA 3D7KA 5A3SA 4CFYA 2O5RA 2IKQA 5D01A 1A97A 1WXQA 2ZITA 1M0WA 2ZB2A 5HCIA 1TF5A 2D6FA 4HN2A 3SLRA 2FEMA 3WKBA 1JLRA 1I3CA 1R1DA 3TDMA 2ZR9A 1A3CA 2ZGVA 3ND7A 3H16A 3VPAA 1BKYA 4X1KB 4RZUA 5D7BA 3QFCA 5GJCA 1FDRA 1OWPA 1ORVA 1A7UA 3BCHA 4JAVC 4EUEA 1OH8A 1F14A 1WMEA 1C29B 1R6XA 2FG7C 3DTTA 3P97A 4JSRA 4ZVOA 3EMBA 2IUUA 3V4OA 4YYZA 3MAJA 2F4NA 2GH1A 2GXQA 1E8MA 2GEDA 4Q15A 4TQGA 4BLUA 1G8SA 3N74A 4TN1A 1Z8HA 4X00A 1L5FA 1N2CE 4P8RA 1EGMB 3T1OA 5HS4A 5JRJA 1Z13A 1KSFX 2A92A 2Z57A 3PXDA 3VH3A 4AZ0A 2J5BA 2OM2A 2GZ1A 1A5ZA 1C30B 1FYXA 1JVSA 1GY8A 4KZPA 1D6SA 4WKPA 5CIWA 5D87A 4D44A 4OQEA 3QV2A 2EATA 3EC1A 2EBWA 1QJ4A 5ELMA 4BFXA 3THOA 3FOEC 4I46A 5AKEA 3NBKA 3W8FA 2X8BA 1U6IA 3WYFA 4BNVA 3BMNA 4EFLA 5IWCA 3GZJA 1F7VA 4Q1BA 3NUQA 2JFBA 3I39X 1SOAA 4KGXA 4TS3A 2B5WA 3FTQA 1KBQA 1R6AA 1QSGA 2XAUA 1T5OA 1YS9A 3C3WA 1QG2A 4IS2A 1ID1A 4NJMB 4UJ5A 3DZ8A 3HKCB 5CB4F 1P4HA 4CMHA 3IP8A 1KNQA 1SU4A 3S70A 2CMFA 1ST3A 2CNWA 4JY7A 1FW8A 2BMJA 1Z5WA 1Z6AA 3KAQA 4XWTA 4CT0A 3NG1A 5L7YA 5TDHA 4MQ5A 1IXZA 3GJ7A 2B8NA 4I9FA 1GKUB 1PG2A 3K31A 2SICE 3GLUA 3KT0A 2RG1A 1GTMA 2H17A 1S02A 1Z3CA 3M6FA 4HEHA 4WWHA 3SXUB 1IM2A 1U0LA 3BBLA 3PLRA 4JBIA 1ZJWA 5GWXA 4UU8A 2W37A 2ZI3A 3PR2B 3OZEA 4Q12A 5BWMA 1MKYA 2JAPA 3CX8A 3E5MA 4WZBB 1ORRA 1IPHA 3HB5X 4KTTE 2VO1A 2WJ6A 3D3JA 5DGTA 3K1TA 5JS1A 1XZPA 3MXOA 3F3KA 1G21A 1TGVA 5ALPA 4DYVA 5KOIA 3CNHA 4K6MA 1ONPA 2WJVA 5EE5B 1E5DA 4XYMA 2G25A 3K0CA 3ZVMA 4KSBA 3LLSA 1XTKA 1UBRS 1W2HA 1ZX1A 4GWGA 4NK4A 4Y9DA 5CHYA 5CDFE 4UE2A 3V1LA 1R00A 3G9UA 2H1CA 3I2IA 1JEQA 4G0XA 3UJHA 2OQ2A 5FTMA 4BUZA 3AG5A 4JDPA 2CJWA 3L3BA 2I8AA 1FQJA 4QGAA 4AY5A 3B1YA 2DP4E 2YWFA 3ZLJA 3A58B 2ZU6A 3AM5A 3KOZA 1N1MA 1PZMA 1E5QA 2FZ5A 4JOSA 5FBQB 3ZZ0A 4BL5A 4W7HA 4NBRA 1W1UA 1ZIPA 4RPCA 2CV0A 2RGNC 4LGVA 3WV5A 1SNYA 4L15A 1R8SA 2OR3A 3IUJA 4J03A 2C5LA 3RIMA 5TJHA 1TO1E 3TD2A 5AUNB 1D0SA 4WBXC 2A5YB 4XDYA 2W8BB 1AK2A 2ZOSA 3PT9A 2IVFA 3INYA 4Q0MA 2MSLA 3KQPA 3ZTWA 4MXDA 4C6RA 3ES9A 2N1MA 2G71A 3GMSA 5IT0A 2VA8A 3U3ZA 1G8AA 3WHPA 4AC9A 1NX6A 2G1UA 5BQ5A 5B1EA 5ED0A 3O2QB 4YQZA 1Z0DA 3SNKA 5JHHB 2NV2B 3DC2A 1AXEA 3NDIA 3MOGA 3H2YA 1R8YA 4LC9A 1GSAA 1U63A 3HNPA 2XRZA 4IJ6A 2XA2A 1OASA 2OPBA 4S1TA 1PFYA 4NCXA 3K3PA 3HKEA 3IR5A 4H3KB 3VVBA 1KEEB 1USKA 1XLWA 1G3IA 3F5DA 4QXMA 4LGYA 4MUKA 3TW6A 3KKOA 1FDSA 2CHUA 2YRFA 3Q9UA 2ZYIA 5TGTA 3JRNA 2R00C 3D7LA 4P92A 1AA6A 4YAEA 4E51A 4NY1A 2JIZA 3KL2A 1ZD9A 3CEMA 5CT8A 3AL3A 2PA0A 2VOEA 3U09A 5REQA 1NJ2A 4FZJA 1G42A 1GLNA 2P1ZA 4ZIRA 3C5EA 4LN1A 5DXFA 5AI8A 4C7BA 4WFKA 1ILEA 3T34A 5CLHA 3MSCA 3HQ4O 3IT3A 4IQFA 4B3IA 5LDHA 2CVHA 3ZD6A 1XDSA 1GTG1 1HDYA 1ZK0A 3T9AA 4HXYA 3L6CA 2DPLA 1VIAA 4E14A 1U90A 4MYUA 1HE8B 2VF2A 2OBFA 3OWOA 3MINB 1NMQA 4K9SA 2R1ZA 1KARA 1EUCA 4B9EA 5E8JA 3AL0C 1X7YB 4NU5A 2GXUA 5I7WA 2ODNA 2X13A 1GG9A 2QP3A 3GFSA 3QUAA 5B4TA 1MGPA 1YJAA 3I28A 1GGKA 3QVTA 3MCTA 4HB4A 2QMOA 1BVYF 3B60A 1N5MA 4J76A 4EVSA 1NQVA 1QFSA 4MS1B 3SIXA 1NVGA 5AI5A 3O26A 1TU3A 3VR6D 1HT3A 4F21A 3ZVKA 1GG8A 2PL1A 1C80A 1FUIA 2O8DB 4XDZA 1V9CA 1Z0UA 2P75A 2BFFA 3OOJA 3H65A 1AGNA 4LISA 4G3XA 3S68A 3ZXUB 4EJ2A 3TGLA 4D4MA 3CE6A 1CSEE 1G38A 3OE5A 4B40A 3ZY5A 4G1UC 5AVOA 4YRSA 4PGMA 1ZK4A 4KMSA 1GZSA 4OHMA 4RIIA 2P30A 2W6JD 4B84A 2DBVO 1LPNA 3RC3A 3LRTA 4HYEA 2I3AA 3I37X 2JL1A 2NAPA 4GXQA 1GG2A 3IUBA 4IRUB 4R51A 4E2ZA 1ML4A 1B6GA 4FUQA 1KJYA 2H4FA 1XF9A 5GONF 3INRA 1JDBB 3EEIA 4O25A 2XOEA 3DC7A 1L8AA 3MJEA 1T6YA 3PUZA 3WGZA 3ZNPA 4D0GA 1TZMA 4L28A 3U7JA 3SC4A 3G02A 1K89A 3LP5A 3ETJA 4IJVA 4CLRA 1PEKE 4HH0A