4XEHA

Apo structure of kari from ignisphaera aggregans
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
327
structure length
326
Chain Sequence
AKIYKDEDISLEPIKNKTIAILGYGSQGRAWALNLRDSGLNVVVGLERQGDSWRRAIDDGFKPMYTKDAVAIADIIVFLVPDMVQKSLWLNSVKDFMKKGADLVFAHGFNIHFKIIEPPKDSDVYMIAPKSPGPIVRRSYEMGGGVPALVAVYQNVSGEALQKALAIAKGIGCARAGVIESTFKEETETDLFGEQVILVGGIMELIKASFETLVEEGYQPEVAYFETVNELKLIVDLIYEKGLTGMLRAVSDTAKYGGITVGKFIIDKSVRDKMKIVLERIRSGEFAREWIKEYERGMPTVFKELSELEGSTIETVGRKLREMMFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cofactor specificity motifs and the induced fit mechanism in class I ketol-acid reductoisomerases.
pubmed doi rcsb
source organism Ignisphaera aggregans
molecule tags Oxidoreductase
molecule keywords Ketol-acid reductoisomerase
total genus 127
structure length 326
sequence length 327
ec nomenclature ec 1.1.1.383: Ketol-acid reductoisomerase (NAD(P)(+)).
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain
A PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.40 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like fold 4xehA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xehA01
3ZN2A 4J7UA 1D1TA 2PH3A 3F6YA 5FI5A 5TNXA 4A26A 1I2BA 3UVEA 1J4AA 4IQ8A 4B8ZA 4PLPA 2PKRA 3MOGA 1C1DA 3HSKA 5JDCC 4E3ZA 1NVMB 4YAIA 2NU8A 4IXTA 3CPSA 2YJZA 2FZEA 2O3RA 5KWEA 2JHFA 3UAGA 1ISIA 1H6BA 1LSUA 3H9UA 1P1HA 2ZQZA 4KTTE 4YRDA 4GWGA 5ICSA 3NV9A 5HM8A 2GUGA 1BXGA 4B4VA 4WLOA 3JQBC 2J6IA 1LSJA 2O7SA 1T2CA 3E9NA 2FOIA 4WECA 2EG9A 4XR4A 4CV2A 2HUNA 4DIOA 2RHRA 1HT0A 4EUHA 4YJGA 5B12A 2WMDA 2VOEA 4IPTA 2NADA 4A2CA 1FDTA 2X0NA 1UR5A 1Z7EA 4TWRA 2BHLA 5JAIA 1BVRA 4D43A 3I9KA 4BO9A 2HMUA 2PZLA 2GR9A 2VTEA 2JL1A 2CZCA 2YFHA 1GPDG 1HYEA 3ITKA 4FC7A 4WLNA 1RPNA 2EJWA 1JKIA 3DEYX 2GPTA 4LRSB 3ORFA 2V6FA 2AE2A 2X1HA 1HF3A 1R15A 4JCOA 4ZHSA 5DULA 1GV1A 3IIEA 4XGNA 5FF9A 1JW9B 3JQBA 4K6FA 1Q1NA 3PYXA 2NACA 3LLVA 4YQZA 4LISA 2WE7A 4DQXA 3VZSA 4NFSA 4ZU3A 3N74A 7ADHA 4BOYA 1BHSA 3AFMA 1EVYA 3PFWO 4MIYA 2DTDA 2CVZA 5KKAA 4KP7A 5EERA 4OMUA 3KYDB 1DHRA 1KVQA 4FBGA 3SJ7A 1CJCA 2VHWA 2JCYA 1JQBA 4J43A 3W4IA 1DDOA 1XDWA 2X8LA 4QO7A 3D64A 1LTHR 1WMBA 2RCYA 3EC7A 3EMKA 3C7DB 1Z74A 3E6AA 2DBQA 3K96A 5C37A 4B3IA 4BNIA 1JA9A 4R3WA 5KVCA 3V2GA 4GX5A 3C7CB 5AQ1A 1E3JA 2W8ZA 3C1AA 4CUJA 4P4GA 3DWFA 2WDZA 2PK3A 3E5RA 2C59A 4NI5A 3S2GA 4KQXA 1YE3A 1GDHA 2PD3A 4CLXA 4YACA 5LC1A 4FD3A 3UH1A 2VNSA 3RUDA 3OQ6A 3CSDA 1YBAA 4OHUA 2SCUA 2HRZA 2J3JA 4J4HA 2EKQA 1E3IA 3K9QO 4JP3A 3A9WA 5DCUA 3ZNQA 3ZWBA 1YL5A 1R4MA 3LLSA 3QY9A 1IOLA 1KY4A 4L74A 1WAMA 1IULA 2H63A 3OIDA 4CQMA 3OA2A 1NNUA 4J2OA 3MJTA 4W9NC 4DA9A 2IODA 1ENZA 2QQ5A 3U4DA 1LUAA 4XRRA 3RWBA 2HCTA 4R9RA 3D3EA 3U4CA 3UF0A 4WNIA 3MCVA 4RQTA 4ZRMA 1SOVA 4ALIA 1FMCA 1K2WA 1IHXA 3DZJA 2HK9A 3DQPA 4UVGA 5HS6A 4GGOA 5A3JA 2YQ5A 4PLTA 4PG5A 4ALKA 3JV7A 1DOHA 2PFGA 4ZD6A 3RUIA 4YJFB 1YL6A 1V0JA 3WXBA 4BB5A 2J8ZA 5K6AA 2PV7A 5DCYA 5G4LA 1K6JA 1DIRA 1YQDA 3KEOA 3OP4A 3WBFA 5H83A 1Y6JA 3UCXA 3DBHA 2DAPA 3B1FA 3H4VA 4NMHA 2OP0A 4AVYA 3FHLA 1BXGB 1MFZA 2V7PA 2Y1FA 1VJTA 3K92A 1UJMA 3DOOA 4RPKA 1A9ZA 3L77A 4IJUA 2X58A 4OH1A 4CLEA 5JMWA 4FCCA 3PYMA 4L75A 2ZTMA 3G1TA 4Q3EA 4YAEA 4ALNA 3H5RA 4PRKA 2CNBA 1ISJA 3CMCO 3EGOA 1HRDA 3ROKA 3RCBA 4CQLB 4TKLA 4AJHA 1BG6A 1DC3A 2ZATA 1A9YA 3AI2A 3P19A 4XJTA 3QW2A 1KYQA 1ISHA 1HXHA 1J0XO 3BXXA 3LT2A 4TRRA 4ND3A 4MP6A 4XCVA 1WP4A 4R54A 3JQ9A 4IMPA 3L6DA 4NJOA 3Q2IA 5DP2A 3GVIA 2BFMA 5A9TA 2YDXA 3JQEA 4AICA 2OBYA 4O0LA 3VZRA 1P44A 2YHIB 4OXYA 3FR7A 1HLPA 4FSHA 4MVJE 3KLMX 2GERA 2QIOA 4NBVA 4MVJG 4G65A 2JD2A 1PJ3A 3JYLA 1IY8A 4BMNA 4NR0A 1KC1A 4PIVA 3DMTC 3FPCA 4OXKA 3KLPX 3O8QB 3N7UA 4RQUA 2FN7A 3GVPA 1W6UA 4ND1A 1XYGA 4Z0HO 1CF2O 3UW3A 2RIRA 4HUJA 4DLBA 4DMMA 3ZWNA 3OH8A 5JC1A 4I1IA 2FZWA 3LF2A 4ND2A 5IF3A 3WGTA 1NWHA 1KEPA 3TN7A 1ZMOA 1ENOA 4WNCA 3DZGA 3PHGA 4EEZA 4J2HA 4PG7A 3WICA 1QYWA 1LBEA 4OOFA 4D3SA 3PHIA 3E8XA 2VYVD 4AFNA 4ND5A 4TVBA 4B3HA 5A4DA 3TJRA 1PGJA 1R4NA 2VTDA 1R37A 2JFGA 2FPIA 2GN6A 1GYPA 1N5DA 1FF9A 3PHJA 1MC5A 2WSBA 5BSEA 4LSWA 3VHRA 4J90A 1HSZA 4OJNA 5A04A 2GO1A 3U62A 1EMDA 1CIVA 3ENKA 4GSKA 2OXIA 1GUZA 4GL4A 4W4TA 4PLZA 3BTSA 1KEUA 1P77A 1M67A 1PWXA 1P31A 2PZMA 3ZNPA 4CMKA 2FWMX 1A7KA 1E6UA 2PGLA 3LT0A 1ZJZA 3ADOA 1UAGA 1N9GB 4P38A 1FXSA 3AM4A 3PJGA 4Z0TA 1F06A 3WMXA 9LDTA 3RIHA 2GZ1A 3ZWOA 3W8FA 2CY0A 4Q3NA 4BO2A 4Z0PA 4NHEA 1ORRA 4BGVA 3FR8A 3LYLA 1ZK2A 2VUTA 4UVIA 3RC1A 1ZXLA 2OBNA 3I6QA 3R6DA 3IDSA 1Y5RA 2ZIZA 2ZTUA 1EZ4A 1LLDA 1SZJG 1SB9A 2BFPA 3LC7O 4FPXA 4MIEA 4S1VA 3WSVA 5IFLA 1LLUA 1T2DA 2Y1OA 4XGKA 3ZW9A 1HDOA 1NYTA 1Z73A 1J49A 5BR7A 1YRLA 1I5RA 3E5MA 4PVDA 3RUEA 2YYYA 4CM9D 1M6WA 4E31A 4CL8A 2X5OA 3FNGA 4BV8A 1R6DA 4G5HA 3DR3A 1GV0A 1QYCA 1CERA 3GAZA 3LT1A 5G0UA 1X13A 4GBJA 3GGGA 1B8PA 4M49A 1EFLA 4PLCA 3KBOA 4W6ZA 1DRUA 3KO8A 4K26A 4YJFA 4PG4A 3KOUA 3OHSX 2IZZA 4TRNA 2AEJA 2Y67A 1C1XB 1UXJA 5JBIA 4E5PA 2WYUA 1GYRA 1YVEI 4Q39A 1KOLA 2CFCA 4CV3A 3ZNOA 5LDHA 2C7VA 3DBHB 4X54A 4LMRA 4L0QA 4XQ9A 4BNFA 2YUTA 1GZ6A 4M89A 4R68A 1HDYA 3WOHA 2IYOA 3IKTA 3UFXA 3KYCA 2VOJA 4GX1A 4O59O 1E7QA 3JD4A 1BDMA 1E1KA 4BIIA 1H6DA 3VOSA 2P68A 3HHPA 1HL3A 4UEOA 4OQYA 1AXEA 2IE0A 2XF8A 3N58A 3WGYA 4FFPA 4YRAA 4IDAA 5TQVA 3L9XA 4Q3CA 1RYDA 3I9JA 3JYPA 3O4RA 4P22A 4D42A 2W2KB 3HUDA 2QRLA 2H5LA 3GZNB 3VKVA 1ID1A 2X6TA 4E0BA 5KOIA 3KETA 5CFZA 2Y1GA 1LX6A 3ZDFA 2EGGA 1U7HA 1YBVA 2HU2A 3GH3A 3UXYA 4ROSA 5EQDA 1J5PA 4OKNA 4Z3DA 2VHYA 3EVNA 1PJQA 5MDHA 1KEWA 1EVJA 3WIEA 4UUNA 1P1KA 1TLTA 1UUFA 2E82A 2Z95A 3D4OA 3TZCA 2VRCD 1MG0A 3EHEA 3NKLA 3ZHBA 3GEDA 4KZPA 4R5MA 4W7HA 3CH6A 2VRCA 3I9MA 3C24A 3IC5A 4DPMA 3D4NA 4BNKA 3OJOA 4GKBA 2O4UX 3G0OA 1I8TA 2OMEA 4QECA 2O2SA 3INGA 5EPOA 3RUCA 2CDCA 5DDIP 3AM5A 4OM8A 2I66A 1A4UA 4NU5A 1R0KA 1F0YA 2DBVO 3DAFA 3KZVA 1E7WA 3PK0A 2PD4A 1ZH8A 5G0SA 3KB6A 1PJLA 3DTTA 3GPIA 2CMDA 2CVOA 3OEYA 4JX8A 3A14A 4XYLA 2HJRA 2PLAA 3FNEA 4E32A 1Y5MA 3QWBA 3ANLA 3H9JA 1F17A 5JAZA 1BW9B 4IDEA 1OZAA 3IQDB 4CQMB 4CMEA 3A1NA 1K6IA 3FD8A 4R1SA 2IXAA 1I24A 3E18A 3VZPA 3BHIA 4OIMA 4K1LA 1HE2A 4J9VA 1WZEA 3PJFA 2B4RO 5TGDA 4XQCA 2IDZA 4KUGA 2QZ9A 4A73A 5ES3A 3DBVO 1YGYA 4D45A 1UZLA 4LW8A 4NDNE 5ER6A 3C1OA 3O38A 4MVJP 4ZN6A 3PZRA 3BA1A 3CINA 4U8GA 5T5QA 2A4KA 2CDAA 1DC6A 3D3WA 4CM9A 3G79A 1NTOA 3JD1A 1VPDA 1CQIA 4LVCA 4XYBA 3B1JA 4KTVE 1MX3A 2EV9A 1WVGA 3NX4A 4J6FA 3F5SA 4OL9A 2FPPA 2G5CA 1BDBA 2QYTA 3EK2A 3RFVA 3RUFA 5A9RA 1KEVA 3QE3A 1QYDA 5B4UA 1V9LA 3O26A 4O6VA 1NQTA 1CYDA 4YEDA 2OFPA 4CPDA 4ZA2A 3G3EA 3TZQA 1GEGA 2DLDA 5JY6A 3GDGA 3AUAA 1YB1A 4ESOA 2DT5A 1M75A 3TFQA 3DHEA 3HG7A 1FDVA 4LGVA 3TSCA 4G2NA 5AYVA 4XZ3A 1PJCA 4Z3KA 1Y1PA 5I8WA 2YFQA 3LU1A 1MGOA 3NT2A 4RL6A 2FR0A 4LSMA 3ZWWA 1DJQA 2CF6A 3R3JA 3DFZA 5K0ZA 4H3VA 4ZVVA 4EEXA 4Y98A 2JCVA 4BO5A 4FW8A 3SEFA 5IN5A 2CVQA 1QKIA 2Q2VA 1YB5A 4FOSA 3CIFA 5F5NA 2ZJ0A 4UEKA 2Z1NA 3CZMA 3O8QA 3AUTA 3BMNB 2BH9A 2E6UX 3L4SO 2C7GA 2WWRA 3L4BC 1U8FO 3GNTA 4H16A 5H82A 3T4EA 1DC4A 5AXAA 4E5KA 2Q46A 1UXHA 4MVJM 4OYRA 3SXPA 1Q2XA 1SPXA 3GF4A 4QUKA 1ZK1A 1EFKA 4XR9A 3AI1A 5L7WA 3DHNA 3GRPA 1MV8A 3V8BA 4BMSA 3GZ4A 3QJ5A 4BGIA 5CP8A 4HX5A 3VKUA 4EUFA 1C0LA 5AXDA 3ETGA 4MP8A 1P9LA 3GZNA 4BO7A 4CMCA 4A5OA 4YVFA 3AOEA 5ADHA 1PQPA 4AJLA 1LDBA 4BKUA 3DZBA 2E49A 5AOVA 5CG2A 4DREA 1NM5A 1E6EA 5COBA 1RM3A 5ICMA 1L7EA 3RC9A 1IUKA 3QHAA 4BNZA 1EK5A 3NGLA 2IEBA 2X23A 4NBRA 4MVJF 3WR5A 2OZPA 1XWFA 5F5LA 4E2YA 4LVUA 3V2HA 3AU9A 2B69A 1JTVA 3MJ4A 1N2SA 4QT0A 3K8ZA 1M76A 1MFPA 1GEEA 2GZ3A 1BW9A 3BYZA 1Y8RB 4BGEA 3CXRA 3DBRB 3GVCA 4GI2A 3NEPX 1T4DA 5TT0A 4ZQHA 4HADA 5TX7A 4BL5A 2C20A 2Y0DA 2HO5A 1CWUA 4R16A 1UDAA 2JKVA 5ILGA 1HEUA 3BTVA 3VPGA 2AQ8A 3PFFA 2R00C 1WXDA 3KVOA 4RVFA 1N92A 4XYEA 2JJYA 3VH4A 1RM0A 2ZKLA 3W6UA 4YT2A 2Q3EA 1NHGA 3CKYA 3KTDA 4MVJI 3ZU2A 4WGGA 2O4CA 4MO2A 3EYWA 4YWJA 2NQTA 2Q2QA 4CM8B 2CF5A 4XEHA 2EP5A 3BHMA 3OEWA 1OI7A 1GR0A 5DBIA 5L7TA 4OSOA 1MC4A 4RF5A 4NNJA 3HZZA 5GZ6A 2JFHA 5C5IA 5KJEA 1JWBB 4Q3AA 2AG5A 4QO8A 4IINA 3H2ZA 2JFFA 1C1XA 3FWZA 4UUOA 3S1LA 2R6JA 4IDDA 5CDTA 1OC2A 1U4OA 2G0TA 4CQLA 2J5RA 2ZTVA 2O7QA 3ZV6A 1FDSA 5JAMA 3F4LA 1DC5A 3OA0A 1MXFA 1PJTA 3AFNA 4WPGA 4XQGA 2OUIA 1HLDA 2WYWA 2FMUA 2OL4A 4RVGA 1GADO 2JAPA 2W2LA 1QG6A 3HN7A 1Z45A 2AW5A 1R12A 5THQA 5KCZA 5JPIA 3FSRA 3VTFA 4YYZA 5L45A 3OETA 4H15A 1BSVA 3T7EA 1XSEA 2Y1DA 3ON5A 4YA6A 4HFNA 3PI7A 3RBZA 2AEMA 4OSPA 4YR9A 1LC3A 2PKQO 1TEHA 5HBRA 4EZBA 1B7GO 2HKIA 4EITA 1O95A 2PY6A 2UDPA 4CR7A 1JDJA 2XPCA 1V8BA 2NVBA 1HDZA 3ZGYA 1Y8QA 2B83A 1I3MA 2O3TA 4E2XA 1U2DA 2ET6A 1XIVA 3H9GA 3WFJA 3DXFA 1AXGA 3F3SA 5JCJA 4B3JA 3MWEB 1YH3A 3TF5A 3RJ9A 3H3JA 1DLIA 1EUDA 3WG9A 3GFBA 3IAHA 1H6AA 1LA2A 5FEUA 3WSWA 5T64A 4B79A 4BV9A 2IRWA 1AE1A 4BKPA 3PHHA 3TWOA 1VC2A 4BQPA 1JAXA 4IJVA 3HDJA 2BFAA 5DP1A 3D1LA 3O03A 4FC6A 3H7AA 1ZK4A 4D46A 1A4IA 1ZK3A 4FFNA 4AJNA 5KNLA 4Z9FA 4DWVA 5MGBA 5GY7A 4NJMB 3CTMA 1Q0HA 3GAFA 1B14A 3PWZA 1SMKA 5JSFA 3PJEA 5G0VA 4JROA 4E4YA 4RDHA 1E3WA 3FTNA 3NDIA 4BO1A 1E7YA 1LXCA 2Y66A 4O1MA 3T7CA 1JN0A 5FWNA 3Q11A 1PZGA 5JY1A 1B2LA 2HJSA 2X22A 4IJWA 3RI3A 2C2XA 5KJ1A 2VZ9A 5B4VA 4J4BA 4DUPA 2A92A 3ICPA 4HXYA 2IZ0A 2J3IA 1NX6A 2NSDA 1WNTA 3OIFA 2OO5A 1XGKA 3TZKA 1P1JA 1XR3A 1DJNA 1ULUA 1UP6A 3ZWPA 4N5NA 2HMSA 3BMCA 4B7CA 2UVDA 3VPFA 4CV1A 4BNUA 5KJ6A 4E30A 4L4XA 2VQ3A 5IZCC 3LC2O 1W8DA 4N54A 4U7WA 1RM5A 3M2TA 3IOYA 3ICCA 5TS3A 2ZB4A 4GSLA 4YXFA 5L3ZA 3BTOA 3JYNA 4NBWA 1VL6A 4CLDA 3M6IA 1DB3A 4GMFA 2VZ0A 3OIGA 1HYHA 1KY5A 1TB4A 1R4NB 1OMOA 1U8XX 1CEQA 2ZK7A 4A27A 1G0NA 4OOEA 1FDUA 1LQTA 1VL0A 2YZ7A 5EESA 2BI8A 3ZHXA 1GY8A 1O89A 4W82A 4BQRA 1I0ZA 4BNJA 4YJDA 4FN4A 2EERA 4RLSA 5JAQA 3RKUA 2VHZA 2HMVA 2NNLD 5HRUA 1D4FA 4FQ8A 4FJ2A 3W1VA 1AHHA 2JAHA 1H5QA 1FDWA 3KYBA 3ITDA 4WUVA 2PNFA 4N5LA 3H5AA 3HDYA 2HLPA 4HFJA 1E7MA 3GR6A 2P4HX 1LC0A 5BT9A 1EE9A 2VYNA 4YT4A 1X14A 3GLQA 4B4WA 3AJRA 3STHA 3ADPA 3FNFA 3GG9A 5IZCA 3RFTA 5DZSA 1D7OA 3NRCA 2E48A 2WD7B 2TMDA 1YDEA 1U3TA 3BMOA 2DUUA 3H9EO 3PRJA 3Q9NA 3V5NA 1GTMA 4R9SA 2P5UA 3WTCA 4WOJA 4MJLA 2D1YA 3HJAA 1GU7A 1E3SA 1EEHA 3AI3A 1ZW1A 1H2HA 4FFOA 1EDOA 1Z7BA 4YAKA 2NUAA 4D3FA 1H6CA 4B7UA 3C8MA 3MJVA 2WTBA 1IYZA 4DBZA 4NFHA 3WGIA 2ZB7A 1PGOA 4XQEA 1QXSA 1SEPA 2UAGA 3ANMA 5F21A 2P9EA 2EP7A 4CMAA 5COAA 2X4GA 3ZCXA 2UUOA 1ZCJA 1PL7A 4EJ0A 4RVUA 2O3UA 1NWCA 2HSDA 4TMFA 3CE6A 4H7PA 1VJ1A 2VRBA 3PZBA 1DRVA 4J3FA 1PIWA 2WEKA 2RH8A 1ZMTA 4XA8A 4QSMA 3CMMA 1HDXA 3AUSA 2E4AA 5JDIC 1ZSYA 4RDIA 2D8AA 3WNVA 1QORA 3L6OO 1JVSA 1NR1A 5G4KB 3DTYA 5TSDA 1TT5A 2J3HA 5JW6A 1LRLA 3VH2A 4DPKA 3LSYA 5HTOA 1VSUA 2FRDA 3ZWYA 4PLHA 5A9SB 5K6AC 1E1NA 2Y1CA 5I8ZA 4AJ1A 4NJMA 3EAGA 4DBVO 1B3BA 2C5AA 4GLOA 3F9IA 5IAAA 4AJJA 3C1TA 4J0FA 3LDHA 2QW8A 4PLFA 2VWPA 3WJ7A 3HQ4O 2DFVA 3JQAB 1BMDA 1K0UA 3Q6IA 4CUZA 2DQ4A 1DFGA 3DBLB 3GDFA 5A02A 4TZTA 4ZQFA 4XWYA 3FBGA 3KYDA 4RGBA 3UUWA 4XKJA 5KKCA 4ALMA 3WGZA 2ZB8A 3PDJA 4TVOA 4DC1A 2AMFA 1ISGA 3BMCB 1U4SA 5I9LA 4IGEA 3TOXA 2PWZA 1L7DA 2Q1WA 5L51A 1ZEMA 3ZV5A 1QRRA 4FOOA 2Q2WA 2W98A 4FFRA 2PGDA 1NPTO 3QVTA 3ZHZA 4BNGA 2VN8A 3GUYA 5C7IO 1ZSNA 3I9LA 3G49A 3TQHA 5U4QA 1NAHA 1E0DA 1Q7CA 1YXMA 3AY7A 2OP1A 2X9VA 3B70A 3LZ6A 4Q3BA 1HE5A 1LSSA 3FF4A 3HDQA 4ZQEA 2J5KA 2V6BA 2Y05A 3V1UA 4JJGA 3BMQA 1VLLA 4HWKA 3AW9A 5CG1A 2H1SA 4WLVA 5BSGA 5DBFA 3DOJA 4R01A 1DPGA 5A5FA 4GH5A 1EUCA 1R16A 1E5QA 3WJAA 4QEDA 3NT4A 4I5EA 3INTA 1LEHA 1X15A 4ZQBA 4BO8A 3ZWCA 5IXSA 5TT1A 4ID9A 3GEMA 1B15A 4DC0A 3LT4A 4HFMA 5EQFA 4GMGA 1AUPA 1PZHA 2YHUA 4WK6A 3GNSA 4GLLA 3QWHA 4DMLA 4E5NA 4JXKA 4I9NA 1QR6A 3GT0A 4K28A 4RCVA 1Q7BA 4M86A 4W7IA 4ZRNA 1F8FA 3ZV3A 5IDYA 1UXGA 1OOEA 3IJRA 5IDWA 1DAPA 2WD7A 5EN4A 4BNLA 4YAJA 3AWDA 2NTNA 1U3UA 1O5IA 4JJFA 4XRGA 3E03A 3WS7A 4FIZA 4CMIB 2F00A 1V6AA 3R3SA 4MVJA 3K6JA 3UN1A 2GASA 4KUHA 5I7FA 5J23A 3WQSB 4XD2A 1BXKA 3RU9A 4DPLA 4D7AA 1WLYA 1BRMA 3F47A 3ZW8A 1N1EA 3PDUA 1E3WB 1K3TA 3WWYA 1XHLA 3SLGA 1P1FA 3DZFA 1PJSA 1Z82A 3WGHA 3WMWA 2BGLA 1TT5B 3PPIA 5L40A 2QZZA 3B1KA 2NU6A 3EW7A 1U9JA 3PLNA 3VPXA 5CAEA 1ONNA 2Q50A 1YOVA 3GRKA 4JBIA 1ZBQA 2DU8A 3W4JA 3S2EA 1WDLA 2GDZA 1N9GA 4R1NA 1JLLA 4JGBA 1T2FA 4I8XA 1DO8A 3JQ8A 3ZHYA 1LU9A 1ZNQO 3SC4A 2BLLA 4OAQA 3OECA 2O48X 3AY3A 5FFFA 4NIMA 3COSA 3DBLA 2GN8A 2ZB3A 4A03A 3UICA 3OJLA 3RBVA 3K2EA 1HDGO 4GKVA 4XYGA 3VH1A 4BNMA 1CETA 3JD2A 1P45A 3JD3A 1F8GA 4E5MA 3LQFA 3UCFA 4PVCA 2BF7A 3FI9A 5I9NA 3JQAD 4J1TA 4DIBA 4CODB 4WCFA 5JNLA 5JDCA 1ZXBA 4Y6PA 4AJ4A 3VDQA 3K31A 3QVWA 3OJEA 5IDQA 4J1NA 2O23A 4BNXA 2VWQA 1VKNA 3A28A 3HN2A 4L73A 3F1LA 1E7SA 5ER9A 2Y1EA 3AM3A 1EE2A 2VYND 2Y0CA 1EUZA 1R4MB 3D5TA 4RPHA 4HV4A 4RVHA 3C85A 1NBOA 1XU7A 4JP2A 5THKA 4L76A 1QV7A 1S6YA 3U3XA 5BSHA 2FR1A 3GVXA 2FSVA 3OQ1A 4W9NA 2Q4EA 3WLEA 4PZDA 5BNIA 3WGGA 2DTXA 3RUAA 1TT7A 3F4BA 3W8DA 1SOWA 2I65A 3E82A 1UZMA 4WCFC 3DDNA 3LK7A 1ADGA 1K89A 1SCUA 3DL2A 1ADBA 1H9BA 4FFLA 4S3MA 3IUPA 1I2ZA 5GZ3A 4II3A 5DCWA 2G76A 3VTZA 4YAGA 1I3KA 1Q7GA 4J4TA 3RASA 2CSUA 1M2WA 3PGJA 4L4SA 4XIJA 1ULSA 2FY8A 3H9QA 4YJHB 3V1YA 3IP3A 3WQRA 2B4QA 4E12A 5JO0A 4GX0A 4J1QA 2F1KA 1ZEJA 4I5FA 4RVSA 4WJZA 3ZI0A 2X7HA 2B5VA 1LRJA 2DC1A 2VUUA 3FWNA 1C0PA 1OBFO 1P1IA 1CDOA 5L95A 3A06A 5COQA 1B0AA 3RC2A 2GLXA 1IPEA 1E6WA 2EEZA 3MJEA 2DFDA 2X0JA 5ENDA 1T2AA 1PS9A 3RKRA 3ULKA 4LRTB 1FK8A 4IQGA 4WEQA 2PGJA 3CEAA 5TF4A 3WNQA 4K6CA 4R4JA 1BWSA 1E7RA 1IPFA 2CDBA 4J7CA 5CEJA 3PIIA 3ZWVA 4PG6A 1TI7A 3PWKA 1X1EA 1DSSG 4RJTA 2D5AA 5A9SA 1YQXA 4WLEA 4JIGA 1PTJA 1HKUA 5C3MA 2BGMA 2VCYA 1RYEA 4PGFA 3L4BA 4CMEC 1PL8A 3ETDA 2IXBA 2Q45A 4WKGA 3ZWAA 4DXHA 1YBMA 1IE3A 2NU9A 5TIIA 1GZ4A 1HSOA 2BGKA 2PD6A 1XQ1A 1U7TA 4IS2A 1AN9A 1HZZA 2C29D 4JK3A 4R1TA 1XKQA 4BMVA 5F3RA 5CDUA 5EMHA 3OSUA 1ISFA 3I4FA 3P2YA 2CD9A 4NK5A 4RZHA 2D59A 1GPJA 1P0CA 2R2GA 1SO8A 2G17A 3W4KA 4RF3A 5DT9A 1Y81A 5CDSA 1LI4A 3WYEA 2AQHA 2J5QA 2BKAA 2EJVA 3WX0A 5DNAA 2GYYA 1PZFA 3QIVA 5DN9A 3S2IA 1O6ZA 1I10A 5KTKA 5BNFA 3BMQB 4D44A 1KVTA 5T8KA 3W6ZA 4JQCA 1A27A 2C0CA 3HFSA 3QV1A 5KIAA 1R0SA 1D8AA 4Y8VA 2FR8A 4YT5A 1EBUA 4W99A 4NQZA 2P9CA 5KJCA 1TXGA 3T4XA 4CM8A 1UP7A 2EW2A 2J3KA 4GWKA 5TLSA 3HDHA 3K73O 4DLLA 4DTIA 2FSSA 4CQMD 1H9AA 3HE3A 1GCOA 1PJ4A 1E1LA 5I7EA 3JYOA 3MWDB 1AGNA 1ENPA 3BIOA 2EIHA 3Q1LA 2Y0EA 5B4TA 2UYYA 1IZ0A 3AUUA 3NJ4A 2B37A 5JLAA 5ILOA 3PYLA 1UP4A 4ILKA 3RAJA 3RJ5A 3VC7A 4BNYA 4B8WA 4FR5A 5IZ4A 1G1AA 1QYXA 1MXHA 5U1PA 2WE8A 3RSHA 1BTOA 3QWIA 1T24A 4YPOA 4CMIA 1OAAA 1JVBA 3TRIA 3ENNA 3HADA 1GQYA 4EJ6A 1VKOA 1U3VA 1VE9A 4A10A 4TZKA 2D4AA 4KDEA 1T25A 1W73A 2QG4A 4EGFA 3DZHA 3BMNA 3TOZA 4DYDA 1U1IA 4TROA 3TL2A 3MOIA 3QSGA 2BMAA 4E33A 1EQUA 3K5PA 2ZJ1A 2ZQYA 1QLHA 3ZV4A 1DRWA 4CLHA 8ADHA 4KQWA 4PLWA 3AU8A 5DOVA 1X0VA 1Y9EA 1PR3A 2YDYA 4R3NA 3DHYA 3SC6A 1YOVB 4AJEA 2I5PO 4MVJD 3SX2A 1U3WA 2UV8A 4YDRA 2Q4BA 1DBVO 1DIGA 2C54A 5I9MA 1LDMA 5JDIA 1P0FA 3RD5A 2XAAA 1XU9A 5KVSA 2G1UA 1G6KA 2DTEA 2QX7A 3E9MA 2JCXA 3IS3A 4XB2A 2AXQA 4F6CA 5JE8A 2NWQA 1H2BA 2PZJA 2POQX 3UHAA 2P91A 3UCEA 3QWAA 3H5NA 5F1OA 4CM7A 1HWYA 5G4KA 3FTPA 1B3RA 4AJPA 5A06A 4CM4B 2Q99A 4OGWA 3GEGA 5G0TA 3NAQA 2O3SA 3GN2A 1P33A 3TL3A 4AL4A 2H6EA 2PZKA 3WDSA 2ZYGA 3GN1A 5C7OO 4CR6A 1PJ2A 2GCGA 3D7LA 3I23A 5HWSA 1LDEA 2ZYDA 1HYGA 1P1RA 4EI2A 4Q9NA 1MB4A 2D3TA 2X0RA 4E2ZA 3IKVA 5IG2A 5EIOA 3H2SA 5EL0A 1JU9A 1B26A 1K6XA 1P74A 5CEEA 2NQ8A 3U4IA 4RV9A 1ONPA 3ETEA 3ZWMA 2I3AA 3JQAA 3ROQA 5JYDA 4LK3A 5TC4A 4FB5A 4GVLA 1HE4A 1H0KA 4IJKA 2Q1TA 3U49A 3ASVA 3NGXA 1IB6A 3HFGA 1KC3A 4Y9DA 2YY7A 1N7HA 3PWSA 4UVHA 1S7CA 1KVRA 4AJ2A 4B4OA 1IZ9A 1PZEA 3ROPA 3VH3A 1XG5A 2HMWA 2VNAA 3KV3O 4RORA 1DIAA 3EUWA 4NK4A 4R69A 2FP4A 2FHSA 1IHYA 1HTBA 3U09A 4GAEA 4BB6A 2VUSA 1N7GA 3R0IA 3FPLA 1ZUD1 4N5MA 1VRWA 3PLRA 1PWZA 1E5LA 4UREA 4DRYA 3GHHA 4CM6A 2NTJA 4J49A 1NPYA 3HWRA 3MJSA 4I08A 1YONA 4IBOA 4GVXA 1MUUA 5LCXA 3I1JA 3PTZA 2C5EA 4E5YA 2OGUA 3X2FA 1C1DB 2VT2A 2GZ2A 5H81A 1ENYA 1T2EA 1NFFA 2JD1A 3RU7A 4C7KA 1JKJA 4QXMA 5G0WA 1B8VA 2BI7A 4LCEA 1ZFNA 4L4RA 2DM6A 4RPGA 3U9LA 3H3FA 3ZU3A 1M6HA 5T57A 4D0RA 5I7VA 2D2IA 2BFOA 1H94A 4OO3A 1CQJA 1LLCA 1X7DA 1NPDA 5T8KC 3QQPA 3TDKA 4IUYA 3NJ8A 3DMTA 4PLVA 4EW6A 3QRWA 3WB9A 4R5HA 5JMPA 3IJPA 2GSDA 1DIBA 3VDRA 4Y6RA 1N1GA 4FGSA 2LDBA 4E21A 1YJQA 1WPQA 1WMAA 4EDFA 5LDGA 4M1QA 1NFQA 4J9UE 3WLFA 4DVJA 1Y9AA 3EY4A 1BGVA 3MTJA 3JQDA 3RBXA 4Y67A 2AA3A 3WYBA 4ZICA 3INRA 3VVCA 3R1IA 5AXBA 4ONEA 4MIOA 6LDHA 8LDHA 4WLFA 3P7MA 4CM3A 1E3EA 5CDGA 5KJFA 4MINA 3I5MA 4J16A 4UVEA 2V6MA 4ALLA 2I9PA 1I30A 3DZKA 4HY3A 4II2A 3WFIA 4F6LA 1D3AA 4BNNA 3FRJA 2I99A 3RC7A 2YV3A 2G82A 1T26A 2HMTA 4D79A 1RWBA 4FJ1A 5IJZA 5IN4A 4F45A 2C07A 1EBFA 3GFGA 3OICA 4WCDA 2VYVA 3GVHA 3RVDA 1Q0QA 3PQEA 3DFUA 4BGUA 2WJPA 3L0DA 2HQ1A 5CPFA 1HE3A 4O5OA 2GRAA 6ADHA 1KETA 4NG5A 1ZVMA 3DONA 4MKXA 3S2FA 3RQSA 4N18A 2VZ8A 3DAPA 1L1FA 4M87A 4HNGA 2CUKA 1W4ZA 2ZYAA 2HDHA 3PQFA 2IYPA 1QSGA 1MG5A 3DAGA 3F46A 1Z75A 2E37A 2O3JA 1SBYA 3MEQA 4WOKA 4YT8A 5I7SA 3GC6A 1AHIA 3G1UA 4QX6A 5TRTA 3KHUA 1GYQA 3WWZA 3QVOA 1EDZA 2W90A 4FFMA 1SB8A 4JBHA 1ISMA 2C2YA 4XYMA 5T67A 2VHVA 3BAZA 1GUYA 1OFGA 1D1SA 4HP8A 3VVBA 5KVVA 4C4OA 2BELA 1A5ZA 2P4QA 1XELA 3SBOA 4ALJA 3L07A 4EBFA 5L9AA 4UUMA 1C0IA 2DKNA 1GD1O 3CZRA 4CM5A 4EYEA 3IP1A 3KRTA 4KOAA 1MA0A 4CUKA 4J1SA 4E2WA 5CDYA 4KWHA 4D0SA 1X1TA 3OJFA 1PSDA 2X5JO 1SNYA 3I9OA 4YRBA 2PH5A 4BHTA 3JSAA 1NVGA 2GD1O 1HZJA 2V65A 4IDFA 4BVAA 3SVTA 3UKOA 1VM6A 5TJ9A 2Q1UA 4PN3A 1ML3A 1NASA 2NV6A 3BZUA 4F46A 4U6QA 5A1TA 3DB2A 1I01A 3V2UA 4YB8A 4EJMA 3HB4X 4PG8A 2O2YA 1X7HA 5G2OA 2AEFA 1U28A 3ASUA 3C7AA 3KM0A 4R41A 4PLGA 1I2CA 2IZ1A 2DUWA 4HBGA 2EF1A 4HNHA 2C82A 2YW9A 3GMDA 3JQ7A 3M1LA 3WTBA 2PA3A 5JC8A 4DYVA 1LDYA 1P3DA 4FGWA 4HKTA 2EWMA 3D5QA 4TQGA 3I6IA 2WYVA 3RFXA 1PGQA 1E1MA 4A0SA 4BKRA 5JXWA 4BNWA 2YHIA 3KSZO 2H9IA 3VZQA 1N8KA 3WQQA 1MP0A 5L4SA 4CV0A 3AOEC 1I36A 3Q3CA 4CMGA 4IDGA 4NFYA 3L9WA 1BXZA 1HDCA 1JAYA 1LSOA 1NHWA 3DZIA 3I9NA 3KSUA 3PVZA 1PJBA 1A72A 4IQ0A 5AVOA 3FNHA 2D5CA 5FYDA 1C14A 2RHCA 4BNHA 3JTMA 3JQCA 3KYCB 2O50A 1PQWA 1R66A 4Y6SA 2YQ4A 4CMJA 1T4BA 4IM7A 2QYSA 3I4CA 4C7JA 2HRBA 4TRJA 1NQOA 5K9ZA 5U9CA 4PFJA 4BNVA 4BKOA 3IMFA 3QP9A 3EZYA 3KXDA 4QFCA 3S55A 4D3DA 3SLKA 1Q0LA 3BHJA 2BRUA 2NVUA 1KIFA 1RJWA 4BKQA 1UH5A 1EVZA 3GG2A 3QA9A 4JBGA 4UAGA 5ENVA 3BTUA 2W2KA 4HFRA 3DC2A 2Q49A 4ZJUA 2Y99A 5L4NA 3VAZA 5CEFA 3DOCA 1DFHA 3ROMA 1NAIA 4B4UA 4CLOB 1ONOA 4N7RA 1UDCA 4NBTA 4YCAA 2DPHA 5A05A 3OM9A 4K9DA 2UUPA 1GZ3A 1QP8A 1ZIDA 1SEVA 4U0JA 4L8VA 2PR2A 2TMGA 3E9QA 3G17A 3VPSA 4CM1A 2QRJA 1JWAB 4Z9YA 2RH4A 2X9GA 4NH4A 4LMPA 4B7XA 4IIUA 4P8RA 1UXIA 1SAYA 3QWFA 3NUGA 2GN4A 1V3TA 5L53A 1YQGA 4MOWA 2XOXA 1LDGA 3MJCA 3NT5A 3NTOA 4I9UA 4QFDA 4URFA 2X0IA 4Z9XA 4CJXA 1KVSA 2GF2A 2A94A 1PL6A 3ABIA 3CUKA 4IY1A 1QV6A 4IS3A 4AJOA 3GHYA 1LNQA 1O9BA 2D0IA 4QTZA 3JCZA 3ZU4A 4UULA 1WDMA 4NZ9A 3EDMA 1NR7A 3H6KA 1U5AA 4MP3A 1DFIA 1DHTA 4IDBA 4IZHA 1TA4A 4M8SA 4RF2A 2QHXA 2NU7A 3HB5X 3Q9UA 5F1PA 3ZU5A 4WASA 3O9ZA 1GCUA 2VHXA 1B16A 1K5HA 2LDXA 3LC1O 1I33A 3PGXA 1V35A 2A9FA 2B0JA 5DOZA 2X86A 2Q1SA 1PS8A 4CLRB 5GZ1A 4E6PA 5AXCA 3PIDA 5GMOA 3GOHA 1A7AA 3H65A 4ITUA 1ZK0A 5A3VA 3DMYA 4PZEA 4PCVA 4XIYA 2VWHA 4XB1A 4YJHA 1QLJA 1T1RA 4U0KA 1VJ0A 1GAEO 2W4QA 4IDCA 2JHGA 1YO6A 2AQKA 4DIFA 5JYEA 4TSKA 4GPD1 4J0EA 3KUXA 3D3WB 1ADFA 1DXYA 1Y8QB 2O3QA 3TPCA 5JCJD 3JQGA 3SJUA 3X2EA 5JS6A 3ZNNA 1KBZA 3M2PA 1IL0A 2W2LD 4KDFA 4P4NA 1ZKMA 4MVJH 3JQFC 1ARZA 1U2GA 3A4VA 1ZO8A 2DBZA 2XXBA 3I3OA 4INAA 3OJ0A 1ZZEA 4XX0A 4YQYA 3JQ7B 1T1SA 2ZTLA 3ONDA 1YL7A 2B36A 4R1UA 4CL3A 3C3XA 2OOSA 1O0SA 4IMRA 1PQUA 4FJ0A 5F1KA 2NM0A 4GGPA 4IIVA 1R0LA 1YB4A 2EKPA 3U4HA 1UDBA 2NTVA 3LVFO 1I32A 3B20A 3KEQA 4R51A 4LN1A 4D41A 3JYQA 3K30A 1GQQA 3AY6A 1XLTA 3U5TA 1NXQA 2XXJA 2ZCVA 1YS4A 2ZCUA 2P5YA 4UEJA 5TJHA 1SC6A 1EK6A 1GFSA 4OQZA 1EVIA 3S8MA 5EJ2A 1XEAA 1F14A 2DPGA 3QVSA 3K2BA 1YJ8A 1NP3A 4U6SA 2A35A 1LLQA 4PZCA 4WEOA 3H8VA 1O8CA 2EW8A 2I6TA 3GQVA 4JLWA 4M55A 1HETA 4YTEA 2NVUB 1NFRA 1PR9A 5B37A 2ILTA 4A7PA 2RBEA 1PGNA 1XCBA 7MDHA 4XDYA 1DAOA 1F12A 1Z6ZA 3M1AA 3PHLA 4MKZA 3P2OA 3GNQA 2PKQP 1XQ6A 1NQAO 5CHEA 4YBZA 5A03A 4BO4A 4BNTA 1EQ2A 3QLJA 2VT3A 3GMSA 4LCJA 1DIHA 4FDAA 1X7GA 4CM4A 4PLYA 4U5QA 2I67A 4GQAA 4KWIA 4L9RA 4BUCA 5HA5A 3TZHA 2P2SA 3D4PA 4J7XA 2HK8A 2R00A 1C0KA 1V3VA 3OFSA 3JQ9C 4TRMA 4RO0A 5L7YA 4IGFA 4ZQGA 2X9NA 2EGHA 3RUHA 4BS9A 3JQ6A 5KVQA 5EINA 1PU2A 5FI3A 1HDRA 1NQ5A 4AJIA 1LQUA 1W0CA 1M66A 4I5GA 3OBBA 3P5SA 3L6EA 4CMHA 3NYWA 3V1TC 1PEDA 5IDXA 4XDZA 1H93A 3I83A 1Y8RA 1BVUA 1Y7TA 2OHXA 3UGKA 4F3YA 1KVUA 3E48A 1QYVA 3PJDA 4WE3A 3E1KA 4RVDA 4RF4A 1FJHA 2HK7A 4FS3A 3ZZNA 9LDBA 3JD0A 1DEHA 2WM3A 2Z5LA 3U0BA 5A5EA 1WDKA 3EVTA 1A71A 2VWGA 4CMBA 4CLRA 3OMLA 1PX0A 3NDJA 3NTRA 2HAEA 3BMOB 3RROA 3FCOA 1ZJYA 5BNTA 1DLJA 1WW8A 1RKXA 3NTQA 4IZIA 4YJGB 3JQFA 5JO9A 3Q0EA 1J6UA 2P9GA 3GUCA 3AK4A 3JQGB 2BD0A 4RPLA 4UUPA 2Y93A 2WD8A 2NLOA 1LDNA 4DL9A 3IUSA 4ZGWA 3AOGA 2DBRA 1YWGO 1PS0A 4CR8A 3WGQA 2AQIA 4BO6A 5B1YA 2Z1MA 4JJIA 4OKIA 4Z6KA 2AG8A 3ANNA 3GPDG 1B8UA 5ITVA 3LF1A 4M54A 3GK3A 2IEDA 2B4TO 4G81A 1UAYA 3FBTA 2I76A 2GN9A 4DQUA 1JKFA 3PEFA 2YV1A 4J91A 4TKMA 1E92A 5L4LA 2EXXA 2OORA 3TFOA 4CLOA 3GGOA 4XJSA 1CRWG 1NVTA 2NVWA 1LRKA 5HS4A 4BO0A 3WBBA 2QRKA 4P4LA 1O94A 3B6ZA 1KS9A 1C3VA 2B5WA 3NDRA 4RLHA 4XGIA 4PRLA 3WGOA 3GDOA 4JN6B 3EZLA 4O63O 2AHRA 1U5CA 2Y68A 2RAFA 4ND4A 1VSVA 1OC4A 1ADCA 3PQDA 1KERA 3D0OA 2DVMA 4EUEA 4KUEA 1I3NA 4OXNA 3TNLA 2EHDA 3OF2A 1VL8A 5JFOA 4Q3DA 1ZSVA 3F5QA 1GL3A 1WWKA 3IL2A 5T6BA 2YV2A 2GNAA 4RZIA 3DBRA 3DO5A 3TZ6A 4DGSA 3ZH2A 4DLAA 3PP8A 1YDWA 4QQRA 3PXXA 1YKFA 4IXWA 1MLDA 2PTGA 4DQVA 2FPGA 3W8EA 5C7LO 4NPCA 2X5KO 2GGSA 3HNPA 3Q2KA 4GX2A 4NU6A 3WYCA 4BO3A 3JQ8B 1GUFA 3GY0A 1QMGA 4JNKA 1GQ2A 2JD0A 4AG3A 3ONEA 5IXYA 1E3LA 1TVEA 4RPJA 2V6GA 3VPHA 3I52A 4KMSA 4UVDA 3MTGA 4E13A 1G0OA 3GA0A 3QVXA 5CPBA 3UOGA 2EKLA 4MKRA 5BQFA 1V3UA 5DBGA 4I5DA 1X0XA 1LJ8A 5DF1A 1VI2A 4WCFB 3ST7A 3KSDO 1UZNA 2AE1A 4MPDA 2I3GA 3ONFA 4AJKA 5BSFA 1PGPA 1UXKA 3ZWXA 3WIDA 5ITWA 3MZ0A 4MDHA 3FN4A 3GGPA 1E77A 1WZIA 4WLUA 1I3LA 1RM4A 3F1KA 1XA0A 4NBUA 2B35A 5JCXA 4I9HA 3OQBA
chains in the Genus database with same CATH superfamily
3IJEB 1DAHA 3P9KA 2OC9A 1D1TA 1XU4A 1YDMA 4HDMB 3K1YA 1NI5A 5TNXA 1O58A 2IQ5A 5CVTA 3UVEA 3EIFA 1P7YA 4PLPA 5HKKA 2XYVA 1KQPA 2JIZA 1NVMB 2P1RA 1P17A 3PFCA 5HQ3B 5GJBA 1OGJA 3WLTA 4C3OB 2WFLA 2YJZA 3S40A 5B1DA 2QRPA 2JHFA 4ALKA 4KACA 1ISIA 3FHCB 2CBGA 4A0HA 3H9UA 1C7RA 1EM8B 3JVUA 3BH7A 3P4XA 3NV9A 4HXEB 4NULA 4YRDA 4KLCA 4G63A 4M83A 1VA5A 4RTLA 4KGVA 4WLOA 1SCIA 2J6IA 3RHFA 1PTJC 1WXGA 4E7PA 4KO1S 1DX6A 1C29B 1R9GA 3OZUA 3TLBA 1RW4A 4IX9A 1FVOA 2XA9A 1TJ3A 1UBSB 2EG9A 3AHJA 4XR4A 4IILA 1AA6A 1W581 4TWAA 4DIOA 1UBLS 1PSZA 4OQLA 5FPTA 3UMJA 3ZC3A 3B8HA 1NM5C 4EUHA 4ZIRA 5B12A 4I8IA 1R64A 4QOJA 4A2CA 1H1LA 4MQEA 2X0NA 3A1WA 1Z47A 2JATA 3FZEA 2WVHA 1FSFA 3X1ZA 3KJGA 4CTKA 3S29A 2F9LA 1XRNA 5LZ4A 3I9KA 3JQQA 3H6GA 3F67A 5HQJA 2VTEA 4ENSA 1XRSB 3PNLA 2YFHA 1Q1QA 3HY6A 1HYEA 3ITKA 4PZ9A 3HB0A 4X3CA 1F7VA 4LQ4A 1GR1A 2BP7B 2WSIA 5KSYA 1KAGA 1MTOA 3DEYX 4MUIA 4ZZ0A 5CB4F 2XLCA 1WPRA 4NE9A 3HUFA 4QUAA 2F8MA 3DAOA 5DULA 1HT3A 4U02A 1ZIYA 5HGJA 5JXGA 3A04A 4K6FA 1QG0A 2X5NA 1A8PA 2IU3A 4OG2A 2NACA 2A6PA 4Y0AA 4C5AA 2O19A 2Q3HA 2OLKA 4YQZA 4LZJA 2QTVA 1BWRA 1X92A 1IWBB 2WE7A 3OMXA 3VZSA 4ZU3A 3N74A 2HA4A 2NUAB 2E4ZA 2IY9A 7ADHA 3LKVA 5E1OA 3B6IA 4O4LB 3CEPB 1JECA 1TJYA 3EIWA 4ZVQA 3Q8WA 3TLKA 1DELA 4P5PA 1NNLA 2CVZA 2F3QA 2YCLA 1DKUA 1OZFA 5ESXA 5DHQA 5BW8A 2V98A 4HEJA 4AF7A 3OEHD 5JIBA 4OMUA 4LK2A 2WINI 3DCYA 1N3YA 2VHWA 5JH7B 1G8HA 2IUYA 3VGJA 3PD7A 4ZZ3A 2O8DA 4PNZA 2M6RA 1DDOA 1XDWA 2MSCB 1DOAA 2X8LA 3D64A 3GFTA 1LTHR 4IGKA 1AMOA 1C8KA 4XM2A 3E6AA 3K96A 5A4AA 1VMAA 5C37A 4N6OA 3WKBA 4R3WA 2IIPA 5KVCA 3V2GA 4JWKA 1SBIA 4OQMA 1NOKA 1SQGA 5K3BA 2QU8A 4GXTA 4B85A 5JCOC 4AQ7A 4L7VA 2XHEA 1AS0A 3U39A 3LUAA 1OT3A 1KAMA 3LI2A 4F2HA 2RGCA 1JFVA 1DBRA 3BILA 1JDUA 2C59A 2YXLA 4M9SA 4PXAA 5TGZA 2AYZA 1ODIA 4B4KA 1N2HA 2JAUA 1GDHA 2C9BA 2P11A 5LC1A 3U3RA 1JYEA 4M9RA 4BLQA 5BW4A 2C7RA 2G9ZA 4NMLA 3RUDA 5ECWA 2QZ4A 3L43A 1P2GA 3TKYA 1YBAA 4DNXA 1HLGA 5HJ7A 1KZ7B 4J4HA 1JDNA 5K51A 3OM0A 4I6EA 2HMYB 2XVZA 3E0XA 4QNNA 3ER8A 2XLBA 1EXNA 3LLSA 5T3YA 1FTNA 2AC7A 3B36A 2PZEA 4L74A 1QKJA 1WAMA 1IULA 5HF5A 3TKAA 5H4HA 2OFOA 1E4EB 3ECCA 1Z26A 1NNUA 3DGEC 1T4GA 3OA2A 4JI4B 4PC7A 4ME6A 4OHBA 4NOKA 3EUEA 1E0SA 1ENZA 3OQJA 1QIMA 4GPBA 1JHPA 2HCTA 4ISCA 4YP5A 3U4CA 3MS2A 3UF0A 3QELB 4MTCA 1EP1B 2JFXA 3MCVA 4RQTA 4ZRMA 4C7XA 3NBMA 3DLIA 1FMCA 1PW7A 1G19A 2YFKA 3QFRA 4PGMA 4UVGA 2VVTA 4GGOA 2HRRA 5KTTA 2EG5A 2YQ5A 2CJYA 1J0CA 1FFAA 2HSZA 2Y9MB 3JV7A 3P4YA 1T9DA 2R44A 4WKPA 4ZD6A 4YJFB 2B99A 3RUIA 4URVR 4J6EA 4W9RA 3WXBA 4AURA 3FOWA 3I62A 1AV7A 1WL8A 4BB5A 5K6AA 5GADl 5UKDA 1DIRA 1R6UA 3DCNA 1YZNA 4OQ4A 4JA2A 5CJ2A 5K0NA 2PL1A 3P0IA 4XWWA 2OEPA 2H7VA 3DVAA 3OP4A 3F2IA 1Y6JA 3FPGA 2OYRA 3B1FA 3IXMA 2QW0X 3BB3A 5BQPA 3TM4A 3VZDA 1CG6A 2H1OA 1B23P 1CULC 1UJMA 3DOOA 1CQPA 1YZHA 3L77A 3Q40A 4OH1A 1Z17A 4IO0A 4MCHA 4Q37A 3EVFA 3PYMA 2NIPA 2RFLA 2ZTMA 3FPEA 4HQ6A 4L75A 4YAEA 4IWNA 4ZT7A 2COUA 3T5BA 1UMKA 4KV7A 4PRKA 2CNBA 1RPZA 2QQEA 1HRDA 3WB1A 4YPVA 3CX8A 4LVNA 4CKEB 1ORWA 4Q4JA 1DC3A 3WGVA 1U2SA 3ANTA 3BXXA 2NSYA 4MGHA 2ZJZA 3A3KA 4RPIA 1L5VA 1T3TA 4K7JA 3JQ9A 4IMPA 2CXXA 2H08A 2QD1A 1MZVA 3D6TB 3Q2IA 4NJOA 1KEKA 4EHAA 1SWVA 2C7PA 2V0GA 1FYFA 4L07A 2YDXA 3BWEA 1CB7A 3L5OA 3M9LA 1A8HA 4JZYA 5JROA 2VJBA 2OBYA 5JWRA 3KJNA 2QJTA 3HUEA 3VZRA 4I6GA 1NBIA 2DHDA 2QLNA 3NTXA 4HH4A 3FR7A 1QIHA 3OTIA 1XTUA 2QROA 4DLRA 4MVJE 6PFKA 1YUNA 5ALWA 3KLMX 4B2LA 1FRZA 1NVFA 4AAYA 2FSFA 3A3OA 3CO0S 4IWYA 4MVXA 1E8DA 1XPUA 2AOUB 1N2CB 1PJ3A 1QOPB 1YU6A 2ETXA 2NO6A 1GG9A 1TUEA 1JG3A 4KQIA 3FPCA 2ANBA 1K88A 3VZCA 1P62B 1QO0A 1V8DA 1EHIA 4RE6A 3O8QB 4EUKA 2ATXA 2QDXA 5FTJA 4JJAA 2K7FA 3FCSB 2OCLA 1XYGA 1IK4A 3GJZA 3MTQA 2RIRA 3Q7SA 4KIFA 1ML4A 3NBFA 2W6CX 3T0FA 5JC1A 4N41A 3HM9A 2GK7A 5IF3A 4RQBA 1T3SA 3FWHA 1NWHA 4BX0A 3TN7A 1FJ2A 2PBFA 4G25A 1N5KA 1X7ZB 3SR3A 2XQGA 1OE0A 1WZCA 3BHNA 2IV2X 4ZDIA 3DZGA 5K0BA 2A9QA 1VBNA 1M0TA 3HUUA 3NM5A 4N9WA 4O2BA 4G41A 2HQOA 5DNYB 3QEMA 4BXOB 3WIBA 2JFNA 1V1MB 3HJNA 1KA9H 2CLIB 3LUHA 1SXJB 1UBRS 3AEYA 4K9LA 3WRWA 2XQKA 3NU1A 1K97A 3E8XA 3REGA 3B85A 1YA6A 4WZ6A 5FBKA 3C4VA 3ZJ5A 4PZLA 4B3HA 2QV0A 4MWTA 1M6YA 4JQSA 2R87A 5D5QA 1R4NA 2XT9A 1R37A 3T8YA 3MT0A 5TARA 4L3OA 2X0FA 3WDKA 1GYPA 3PHJA 3QBTA 5JFGA 4YMLA 3ZDBA 1J22A 1UK6A 2NZWA 2GQ0A 2IYFA 2Z0MA 3GGDA 3OU7A 4OJNA 3VHRA 2GO1A 2AXPA 3K2IA 4JODA 4TLDA 4C08A 5A04A 3TG8A 2AVDA 2B4AA 2A84A 1GUZA 3TB6A 1Q1GA 2AEEA 1OXMA 3OO0A 5IC5A 3N2KA 1UOPA 2C0QA 4KFTA 4UNRA 3SC2B 4QYIB 1U2PA 2HPHA 5H3LA 1A7KA 2PGLA 4FYVA 4TN1A 1ZJZA 5ITZA 1UAGA 1OB2A 1R3UA 3O4IA 4LPSA 9ATCA 3PJGA 1QHFA 4I50F 3PJRA 3WMXA 2J6HA 4ZMSA 3W8FA 1M1YE 4TS1A 1G3IA 3OY7A 4YP7A 4Q9LA 4BO2A 1XEWY 1HNWB 4NHEA 3LO5A 2H0QA 1ORRA 3BWYA 3L6CA 4K2AA 4B9AA 4X6UA 3FR8A 3LYLA 2VUTA 3ABSB 4UVIA 3RC1A 3KR1A 3NNSA 3IP9A 1IHPA 3QXSA 3KK0A 1KSHA 2JGDB 1EZ4A 1SZJG 2BFPA 1TM7E 3LC7O 4FPXA 5DI3B 2I2CA 3LIPA 2PVPA 3AZPA 4L28A 1ZD8A 3BGSA 4P2GA 2R65A 3BIXA 2GBGA 1HDOA 3DD5A 4B87A 1J49A 2HCBA 5DYGA 1I5RA 3EXEA 2QX9A 3LLMA 1M6WA 4QXPA 3LBYA 5LWHA 1OHHA 2NU7B 4WNYA 5FO1A 1VXRA 2DLNA 2WW8A 1DEOA 3HSYA 2GJ9A 3KOMA 3KVVA 4GC9A 4M7PA 1O7JA 4CL8A 5AKLA 3DR3A 4KXUA 5JS7A 3DOFA 1Z37A 1X13A 2E3JA 2IF0A 3F8WA 4I4TB 1T8YA 4PLCA 2G1KA 5HJEA 2JGDA 1TKRA 3LWZA 3QXHA 5CJPA 1DRUA 3MTEA 4K26A 3UBTA 4WERA 1WETA 1W85A 2ZBUA 2JVKA 3OHSX 2V4MA 1T8UA 3SAJA 2FFJA 1JDVA 2IZZA 4EG8A 2QRZA 1IOWA 3F5FA 1TCAA 4RDCA 1KNXA 2B4KA 2DB3A 3NKFA 5G1PA 5KTPA 1PLKA 1IXZA 3CTPA 4QLBA 3I5UA 3CR8A 2WYUA 3STWA 1GYRA 4Q39A 1R2QA 2CFCA 4R8VA 2A0YA 3IBGA 2DZDA 1TEXA 4LHEA 3TQIA 5BR8B 1OH8A 2F1OA 2HB6A 3DBHB 4LMRA 4ARBA 1TVKB 3IMEA 2ZSEA 3QF4A 2YUTA 3IALA 2GXAA 2JLQA 4R68A 2ZBGA 1EU1A 2WWXA 4LYGA 1K8XB 2FKNA 3TD6A 4CDRA 1Z8DA 1KAQA 1NVBA 4NV1A 1E7QA 3IYLW 3N9IA 1KXJA 2J0EA 2UUAB 1H6DA 1E9CA 1P4GA 5HEKA 3RAGA 3VOSA 3ZQJA 4EPXA 1YS7A 4NCAA 3HHPA 3ZLUA 2AW3A 3JR7A 3WK5A 4W8HA 3NCHA 3OFKA 2IE0A 2Q5HA 3N58A 5CTAA 1L5GB 4DC9A 3WGYA 2O2CA 4LJ6A 4RK0A 4GM4A 5HKAA 1Z4QA 1FFBA 3A26A 5CVEA 2JGJA 2WAXA 1G7CA 2LRHA 4QEKA 5TQVA 4NCIA 4UNNA 3L9XA 4Q3CA 3I9JA 4C5CA 5L3VA 1SXQA 2CK3D 4HCJA 2MINB 1RP7A 3MXOA 2W2KB 4H4DA 1AH2A 1WF6A 2H4HA 2X6TA 1ZVKA 1YVPA 3F97A 3U0VA 2OECA 4Q15A 2HU2A 3GH3A 5F5XA 3UXYA 1TAQA 3BE6A 4F8EA 1Y9JA 3R3VA 4JC4A 4OKNA 4Z3DA 4QGFA 3ILYA 1X7XB 2CC2A 3TMYA 1BN7A 1N6LA 1USKA 4UUNA 1P1KA 2E82A 3F4KA 1I4OA 1WXFA 1JFRA 3TZCA 3NKLA 1KI4A 2A5JA 2XMDA 5B2FA 1TU3A 2MR6A 3CH6A 3OLCX 4BWFB 1Q6ZA 1FDIA 3I9MA 3IC5A 1WHSA 3H19A 2BR5A 3D5EA 1B6GA 2GZAA 2O4UX 3E3NA 1I8TA 1T36B 3NHJA 1W49A 4QXOA 4TS3A 4KAJA 3INGA 5CIWA 2IIVA 1J25A 3ORYA 4OM8A 1YR2A 4NU5A 2I4NA 1CF9A 2JGRA 2UZIR 5JI3E 4V0ME 3KZVA 5HCNA 1E7WA 2FLWA 2PD4A 4PWYA 2ODAA 4F11A 4MV6A 3PQ4A 3GPIA 2YMQA 3DEKA 3A14A 5T4FA 4E32A 3LVQE 1NXVA 2G4VA 3I4LA 1C9JA 3ANLA 3EXFA 3B48A 1YBHA 2WIDA 5IMSA 1BW9B 2VPQA 2JLCA 3HJHA 1FBTA 4CQMB 2ODQA 2W2MA 1UMDB 2X4DA 1GZSA 1XD9A 4LJ7A 5CR9A 3CFYA 1UIRA 2PZFA 4R1SA 4KR9A 3W90A 5C0OE 1BX0A 3EC2A 2VPPA 3FPAA 4OIMA 4F5EA 1FP2A 1HE2A 3OX3A 1U02A 3KQVA 1WZEA 4J9VA 2J87A 4RMHA 3L1HA 4X3OA 2IDZA 5TVGA 4KUGA 3D0RA 1FYVA 2H8KA 2WHPA 3QTBA 5BSWA 4R1LA 1GAJA 3Q6MA 3PS9A 4BJHB 4RBNA 4HN2A 2Q7OE 3C1OA 3AVUA 2VHEA 3IR7A 3BA1A 3CINA 4U8GA 2HD4A 3NCTA 1UM8A 3ORRA 5GV7A 4IR7A 1NZDA 3SJBA 1IQPA 5BN4A 2LWIA 1V1JA 1V9CA 2BGNA 1JV2B 3D3WA 1U0SY 1Y1QA 1Z6AA 1KZ6A 2V45A 1VPDA 3EF0A 4ZYVA 2ZSFA 4F92B 3VC2A 1MX3A 1L5QA 1ESZA 3F5SA 5K6TA 1CTQA 4KGZA 4F4IA 2RMKA 2FPPA 2VHTA 1QO7A 1BDBA 3C4JA 3KJHA 1YI0A 2RGBA 3B9PA 1AT1A 5AKZA 2AUNA 1F7UA 4MV3A 1GL9B 2QN3A 1KEVA 3U7GA 1WUJS 4WGFA 3EFBA 2EHJA 3GJ6A 4EPRA 1CP3A 1L4LA 1TM5E 2HXGA 1E6CA 1NVKA 3AUAA 1Q20A 3I3SR 4RCYA 3WJ2A 2Q5CA 2R2AA 4HB0A 3TFQA 3QPWA 2OZVA 4EFLA 5FOQA 5HGXA 3IOCA 2PG3A 4WI1A 2DWQA 2Z3WA 4ARVA 2WFZA 3P96A 1CR6A 1LBHA 1VLMA 3LU1A 3NVMB 2ECPA 4HHEA 3O31A 5CT9A 1UQUA 3VSBA 1VHQA 4TYYA 4BFYA 3DFZA 4RK7A 2IHZA 1IEWA 1Z12A 2IOHA 4H3VA 4H7JA 4EEXA 2PIAA 1L5NA 3SEFA 5FKJA 2GBFA 4MW9A 3RT7A 4CT5A 1M6VA 2J07A 3LPMA 3R7DA 3H5TA 3CIFA 4EA9A 3KQKA 4AP9A 4TSRA 4WA8A 4LFCB 1UZUA 2HEGA 2Z1NA 1PNOA 2BHTA 1E3TA 2YIMA 3CZMA 1UJ5A 2Y6UA 4DLXA 3VNUA 2DR0A 2IPMA 3CX4A 3L4BC 4E5KA 5H82A 4JXJA 1DC4A 3WV4A 3O8CA 2Q46A 5AUOB 1Z56C 3SXPA 4I4LA 2VS1A 2XMCA 1SPXA 3I6ZA 3STUA 4QUKA 1UBOS 4K9SA 2OK7A 4X64B 4XR9A 4A1OA 4FFWA 1L3IA 3AI1A 4FP9A 3LO8A 4MR7B 3GRPA 4BMSA 4G86A 3A3YA 4Q4AA 3L5KA 1GO2A 3RTAA 2RARA 1WZNA 2B6HA 2CCKA 1NW4A 2MU1A 3FZGA 5C31A 1VA4A 3V7FA 5ALGA 1RYNA 2FRVA 4MP8A 1P9LA 1D2GA 2FW0A 2C4TA 2AIRA 1WNFA 3QHQA 1EG7A 4EG1A 5TPWA 2FRXA 5ADVA 4BO7A 4CMCA 1W34A 4YVFA 1Y1TA 4FFSA 5ADHA 3V8NA 5WRFA 3QI2A 3NBAA 4HEHA 5FNVF 1MJGM 3GCGA 5COBA 2J7PD 3NNDA 1Y0BA 4PSUA 1HFEL 2CBZA 3LWDA 5CHYA 5CD1A 1OA1A 1QIDA 3TXXA 3E7XA 3QHAA 4BNZA 2AC2A 2FDXA 2IEBA 4F4DA 2G7MC 1TUIA 2PAAA 5AVTA 1XWFA 3JWJA 1CY4A 3SF8A 1GL7A 4F9GA 1SKAA 1M76A 3ZHQA 4GXNA 3JWHA 4XWAA 3DQQA 3TLAA 3MUEA 3U7EB 4B0OA 1P6XA 5FBRB 1VPLA 4KWEA 1UWVA 5A3QA 5F23A 2FQXA 2Y0DA 1EX9A 4DBLE 5MF6A 1A1SA 3PL5A 3H5OA 1HEUA 1Z4PX 3PGA1 1KJWA 4FGLA 4JR1A 1FX0A 2VDKB 1NXWA 4N3NA 3VGPA 3N8GA 3WYDA 5CB4B 3KVOA 2ZXUA 3C3BA 2JJYA 3VH4A 4YT2A 5EKDA 4JELA 1NVDA 1NHGA 3KTDA 1OD6A 1PG5A 4PPGA 4CIVA 1T0JB 4WK4B 3H2IA 5E1DA 1TO2E 4KX3A 3EVCA 1PKEA 3OEWA 1WXXA 2EP5A 3O47A 4CFZA 4L2IB 5KTRA 1SCUB 5F98A 2Y76A 3IAM6 4HDMA 1POXA 4OSOA 1MC4A 4RF5A 3W8RA 2D06A 1KDRA 2FN8A 2CHUA 5AKYA 5GZ6A 5K8LA 1DARA 1JDTA 4PYIA 2AG5A 4BFTA 4TTRA 2PT7A 5AT1A 2A9VA 1EWKA 3T5AA 2G06A 2CMFA 3GOQA 3O7MA 5AKKA 5C8VA 3T54A 1WS6A 4X93A 5CDTA 1U4OA 5G40A 3RC3A 2J5RA 3QI7A 4DCCA 4GS5A 4H6XA 1TFRA 3W2HA 3F4LA 3HA7A 1DC5A 2G07A 3FGOA 3OA0A 3NTUA 5JUWA 3T9CA 4ESVA 1NVAA 3H2GA 2VCEA 1HLDA 4OQFA 1NOJA 2H2AA 1B6TA 2JAPA 1HG1A 3LW8A 1NG1A 2W2LA 1MABA 1NKVA 1QG6A 4UHCA 3IR6A 3CNNA 1Z45A 3T1NA 1R12A 4HX9A 5KCZA 5JPIA 3ZS8A 2QTGA 1XB2A 3LRXA 5K4AA 4Z0NA 3A05A 5KU1A 1IVNA 4N9QA 1SU4A 2E55A 2D2FA 2VG8A 3CSSA 3OE7D 3ON5A 2PL5A 4HFNA 4LXUA 4AJLA 4F2GA 1H4SA 2LP4Y 3SEQA 1J97A 1FUKA 1OYYA 4YR9A 1T9HA 3O94A 2J0UB 4Y2VA 5IS2A 2HM7A 3PPYA 2HWWA 4IRUB 4EITA 2BFFA 1N8TA 3ZGYA 4L3VA 4AB1A 3UYKA 4HYEA 1EZZA 2Z09A 4CG2A 1UKVY 4EP1A 3THWB 1SZPA 1TL7C 2E4YA 2B2NA 3JVEA 4WT7A 3W5JA 3WFJA 3W7VA 5BSRA 3KKZA 2HY7A 3F3SA 5JCJA 4LVOA 4B3JA 3MWEB 2DERA 1SD2A 1AQNA 3RTBA 2RC5A 5EKSA 1DLIA 1EUDA 1QKKA 2FGKA 2QOEA 1L5MA 3GFBA 4V1CA 3V4OA 1TO1E 4Z4FA 1M9NA 3L8GA 3PEUA 2REQA 4K40A 5FEUA 3AB7A 4PNEA 5T64A 1OTYA 2XD9A 2DBYA 5LNK1 3TL6A 4RM2A 1GZUA 4BUZA 1BXRB 1O97C 1EFCA 1IAVA 4IJVA 3HDJA 3KEMA 3OVMA 2IUEA 2I4IA 4XD7A 2RHGB 4BAGA 4FC6A 1PK7A 1V26A 5JBNA 4FFNA 5KNLA 2JLRA 5MGBA 2Q29A 1F2UB 4NWIA 1H69A 2VDRB 3I42A 3L79A 4HB4A 4QOHA 2XCIA 1Q0HA 3GAFA 3GBSA 3LLUA 4MQ5A 1L5HA 3VNQA 1Y3DE 4QOFA 3WGJA 2CJFA 2B5OA 1KYYA 5CNIA 4DV5B 5ED4A 2EKZA 2TS1A 3OEHA 3PWZA 4RDHA 1RAHA 3FTNA 4BFLA 1FP6A 1AA9A 3FOEC 1LXCA 2Y66A 5LD2B 1L7QA 5FWNA 3EG5A 1AUOA 2IHYA 2KLBA 1B2LA 4L9SA 5T4HA 2QAGC 2X22A 2G0AA 2XWPA 3KBBA 3U6BA 1XLUA 3QVGB 2O8DB 4AY4A 5L8VA 4XARA 2XMSA 3LHIA 5CXSA 3D2LA 4AY2A 2J3IA 1XNQB 1KOFA 4DUGD 3WZLA 2I4LA 2OO5A 3D0QA 3LY9A 4N3BA 1VE6A 4AMUA 1XR3A 3KAQA 4EF5A 1IY2A 3ICEA 1U7OA 2QLBA 1NBHA 5K2OA 1WBDA 1E2KA 5GONA 1H2XA 4FFVA 2HMSA 4Q93A 3BMCA 5LZ9A 5MN6A 1MHTA 4BRUA 2PFSA 4R0NA 2IJGX 2M6LA 3ZI7A 2V55B 4CV1A 5KJ6A 1WE2A 1II8B 4M9XA 3VI3B 1VCHA 4HWGA 1DQSA 5JNRA 1MIOA 4QVKA 4UXIA 1RM5A 3TLCA 3ICCA 4NAUA 5TS3A 1SA0B 1C4OA 2JC3A 1T9GS 1WKBA 4O2RA 4C89A 4NBWA 2WA2A 3RLFA 4C30A 4CLDA 5F3DA 5KKNB 5K1ZA 3FWKA 4GMFA 4EX6A 2J41A 4I1VA 1XCMA 1WUHS 2EWVA 3WNBA 2R0QC 1R4NB 2MDTA 5TEWA 1Y34E 3SX4A 3T3IA 3TOSA 3ESCA 5KNDA 2XQJA 4A27A 3MSCA 4OOEA 2BFBB 3OO1A 3IEMA 1CHDA 1BX3A 2YZ7A 1Z2CA 2YASA 4MWCA 3ZHXA 1G3RA 1AY0A 1MX1A 1ODTC 2QDKA 3UXHA 1VMIA 1V5GA 2HF2A 2VPYA 1Q77A 4B80A 4L08A 4WN9A 4V39A 1M1ZA 2ZI7A 3GLIE 2MSEB 4M0UA 4MYRA 2Q9UA 2XNDA 4BATA 1CS0B 1KJNA 2JAHA 3EIEA 1O6CA 2F3RA 3PICA 5E4TA 2OWEA 3LUDA 3UJDA 4J0HA 5TB5A 1YVRA 3E1GA 3QMVA 2XKJE 3HDYA 2REXB 2HLPA 1Y4ZA 3GR6A 4H6VA 2P4HX 1LC0A 4JLJA 4FINA 1LVGA 1JQDA 2YIDA 4IEEA 1X14A 3FKSA 2AI2A 3LYUA 3I09A 3RYFB 4A4DA 5C9ZA 5B53A 3CUWA 3STHA 1J56A 1D8TA 4CKYA 4UATA 3U48A 2A59A 1BO6A 4Q3KA 2C9MA 2C3OA 1U2GC 3MYRA 3OOWA 4E6EA 3R6TA 4Q4HA 1XZNA 5B6PA 2WD7B 1IATA 1U3TA 4HUQB 4DG8A 3COVA 4WBNB 3OKPA 1H0SA 3GT7A 3MB5A 3PRJA 4QBTA 4RKFA 1FS5A 5BUZA 1ZY2A 2OHHA 3FCAA 3NC0C 2Z56A 1Q0RA 4MJLA 1BAPA 1GU7A 1E3SA 2F3TA 4FWBA 4GP6A 1ZW1A 2EP8A 2H65A 4N3GA 5ALYA 3OLQA 5JZMA 4ICIA 3RYFA 3SK0A 4ER5A 1H6CA 2CFOA 2R751 2IUSA 3CNQS 4NQRA 3RS9A 2WTBA 1B73A 1ESEA 2O2GA 2PQ6A 2X3FA 4KVAA 2AFVA 5EP3A 4C3UA 4Q4AB 3ANMA 3SR0A 1HR0B 4CMAA 2FSGA 3FPFA 5EXDA 2I7XA 3R0XA 4GOOD 5EWLA 3BG5A 1JDZA 1PL7A 1J33A 4EJ0A 2OGWA 4RVUA 1XI2A 3CLUC 4C07A 5AIBA 3CE6A 1F48A 3UOWA 2X14A 1DRVA 4C4TA 4H4CA 1RMQA 1PIWA 5KYKA 1RZRD 4FHFA 4GVPA 4LJ4A 2HNAA 4AXBA 5HIJA 3DV0B 3QX3A 3CMMA 5DLDA 4MWDA 3ZKWB 1HDXA 3AUSA 1ZSYA 1XTVA 2JHCA 2GARA 2B6NA 1QORA 1JVSA 1T5LA 3K6KA 2Z3VA 1KMQA 1XL1A 3TCKA 4QTTB 2QAGA 2L19A 3KG2A 4B3BA 4MV9A 4LOJA 2YWCA 2Y9PB 4PYQA 4UHDA 2WT4A 5D84A 4QC2A 2JA2A 2FRDA 4UCQA 3GLVA 3ZWYA 1CEXA 4MUNA 2NZJA 4I5IA 3WLQA 5FNVB 2A0UA 5I8ZA 1UJ2A 2KWIA 2PMCA 1L7MA 2GK4A 4DBVO 2G6BA 4E07A 2C5AA 4FMDB 2IDKA 4CZ2A 2Z04A 3K6RA 4GMDA 4TMXA 1XRPA 3EULA 3F9IA 3H05A 4NJEA 4WADA 3C1TA 3ESXA 3O1IC 3BFKA 1I1OA 1CFJA 2HF9A 4K9OA 2Y0PA 4BAUA 3AG6A 4LDRA 2R86A 3DMDA 3IV6A 3FMGA 4O4HA 4AJJA 4DLTA 2RK6A 1JJVA 3LUGA 2VFAA 1DFGA 4RANA 3FUCA 3HBAA 1RRFA 3MN1A 4N03A 3SM9A 5J58A 1NBAA 1X6VA 1CUEA 5ADWA 4PANA 2JANA 5CXUA 4L50A 4U3JB 3WL6A 3ELUA 2GRUA 3JALA 3IPLA 4UUBA 4XKJA 4EHLA 3DF7A 5HSGA 4MUBA 3SQWA 4ALMA 5EZSA 3WGZA 2ZB8A 1VG1A 4TVOA 1ISGA 4G5FA 1LBSA 4IGEA 1L7DA 1EFAA 3WRYC 4WKOA 1G5HA 1XTSA 4TKVB 4AK9A 1X1SA 1AZSC 2Q2WA 1BC5A 1TFUA 2BKLA 2W98A 4GC5A 4MUHA 4MICA 5JCZA 1E61A 5KYTA 4C14A 4BNGA 5JJLA 2VN8A 2GJAA 6GPBA 3F6CA 3CIOA 1NJ2A 1ZSNA 3I9LA 4CMIB 4M1WA 1XJQA 1XMPA 5TV2A 5JWHA 2CMGA 1AUVA 5CYGA 3AY7A 1PEKE 2OP1A 3ESDA 3IOBA 4RK4A 2H00A 3B70A 3LZ6A 4Q3BA 5DO9A 2BIFA 4IV8A 2XUGA 2SCUB 1W19A 2BEVB 2J5KA 3HDQA 2V6BA 3PDWA 3G0DA 2GKOA 3R9KA 1EX1A 4XX1A 2NO5A 5K3AA 4I3HA 3A6ZA 1TM2A 4NYJR 1OI2A 3UA3A 3IEPA 3M4NA 2HA5A 4Y2YA 3DOJA 2CZGA 4CI0B 4IYJA 2J9YB 5A5FA 4GH5A 2BFBA 1EUCA 4NEQA 2EL7A 4UTZA 1E5QA 2B34A 5KNBD 2XB6A 5EA2A 2VXOA 3TTSA 3TECE 1MO5A 3AEKB 3INTA 1P5JA 4FYWA 2AJ8A 4QQFA 1NBWB 4ZQBA 1X1RA 3R7SA 1QQ5A 2I87A 3L7MA 4X5OA 4BO8A 5C52B 1LZLA 1SUCA 1Z5GA 2BKEA 2JIMA 2ODTX 3KV1A 3NM4A 3GWZA 4UEWA 1ISSA 3HXOA 1QP7A 3OUUA 3PNKA 3NPMA 4DC0A 3L6BA 1Y7IA 2JJ8A 1YTLA 3MIZA 1EVLA 3IBSA 4EZIA 4BLTA 1N36B 1N4AA 5ALXA 3GNSA 4MS1A 3BH6A 3LPNA 4M38A 4E5NA 3HXQA 4YMTA 4WOBA 1T3LA 1KEEB 1RQXA 3IQGX 4PZPA 1QR6A 3GT0A 2C5BA 4K28A 1Q7BA 3Q85A 1EDEA 4DCUA 4WQMA 3UGTA 3ZHCA 1M1XB 4FE7A 1PLJA 5JV5A 2HTFA 1G18A 1OLXB 1HQKA 5IDWA 1ZAYA 4JQYA 2EFJA 1KGSA 2HO4A 1MX9A 1MD9A 2QMEA 4GICA 4KZKA 2WD7A 4IICA 1PVOA 2H2DA 4RJLA 1U3UA 4MUMA 3DEFA 1EJ2A 2BMFA 4BKMA 1O5IA 4JJFA 3LCMA 4M1KA 3GLGB 2WF9A 1V71A 2C96A 3WS7A 1INLA 4EA7A 1SG6A 1OVMA 1XAJA 1Z18A 2IA5A 2WHRA 3K1ZA 3OPNA 1A2KC 2F00A 4CGYA 3B2EA 4MYUA 4X60A 2WF6A 3NWJA 1B0PA 1S3GA 1S7GA 3IP5A 1ODJA 5EVJA 3VYTB 2X1MA 1U1EA 2TYSB 4D9HA 1I51A 4ES6A 5D01A 2CNWD 2WC1A 4EYKA 1V39A 4NEGA 4UTXA 4XD2A 1BMFA 5EHIA 3NETA 4JEUA 2P3SA 4RNCA 1FFDA 2BJWA 2M1XA 1E3WB 5EUCA 1UPAA 1K3TA 1E2HA 2L18A 1FOEB 3FF1A 4LJSA 1NDUA 3WGHA 3CWQA 1JE1A 3MQ2A 3TW8A 2JI4A 3KHKA 4GLBA 4ZK6A 1TT5B 5ALJA 2XHZA 3RIXA 1GUAA 5A2QA 5K0FA 3FDIA 1JS1X 4GOMD 3VPXA 1U7ZA 3PVCA 5CT4A 4ARIA 5JSQA 3UMSA 4ZOQI 4PQFA 4C04A 4FEYA 2PGOA 4JBIA 2DU8A 3LCUA 1NUSA 4DDUA 2H5EA 2WSYB 3O2SB 1RBYA 3S2EA 1V6SA 3F6PA 4KBGA 3W3ZB 4ZYXA 4CKBA 1B41A 4YMHA 3V7NA 3AHIA 4DMUB 1GZDA 3ZHYA 1TYDE 2O2IA 4M21A 5I5EA 3GT4A 3L92A 4OAQA 4PBTA 2O48X 3AY3A 3SNKA 1JG2A 3BRSA 3COSA 2UVPA 4YJKA 2VTVA 2GN8A 2VHUA 1OBOA 4UNQA 1UC9A 2XMZA 3RBVA 3K2EA 5BQ5A 2BSXA 5ENZA 3WLAA 4GKVA 4KXVA 1EGVB 1AURA 2P8JA 3K2QA 2JGIA 3JD2A 1IJEA 1UCFA 3MQ4A 4WMLA 1P45A 4LY9A 1F8GA 3PI6A 2HFJA 4E5MA 3EIXA 5SV2A 2J46A 1KQFA 4Y2JA 5LMZA 3NRJA 1U90A 2CYAA 4G1MB 5K3SA 4GOXA 4WESB 4CU5A 5LKAA 3K71B 3A58B 4JI8B 4AG5A 5BV2P 3THSA 3B53X 3PPVA 3A4NA 3H2BA 4TV8F 3MPOA 1YRBA 2GPWA 3CXUA 3G82C 2EDAA 3SZ3A 1WVIA 3WRXC 1RT9A 4PHCA 4AJ4A 3DDZX 3K0AA 4WXMA 4S12A 3QVWA 4YMIA 2FSVC 1ACLA 1H4TA 1J0DA 3PA8A 5GIOE 5JZSA 4BNXA 4KVZA 2BWJA 3HN2A 1F2TA 1C7IA 2FYTA 4HQ0A 4Y2TA 3N28A 3F1LA 1KSFX 5EIAA 2Q6IA 2Y1EA 4FB4A 1EE2A 4R7TA 2Y0CA 4QXQA 1JEQA 2OZEA 521PA 3TIIA 4UNSA 2EBHX 4UCWA 4DJTA 2XCOA 2F3SA 2HPVA 3SZOA 5THKA 2CKDA 1BROA 3ETLA 1THTA 5ITZB 4OUDB 2XEDA 3B6KA 2E87A 2FSVA 4KN9S 1HOXA 4W9NA 1SHKA 2NU8B 3WLEA 1ODFA 2W4MA 5BMVB 4JYZA 1KYWA 4JH0A 1ZDMA 5H4GA 3QG5A 1SOWA 1ZCFA 2I65A 4ZVPA 4X1OA 1JI3A 1R9JA 2QW1A 3BDAA 2BFEA 3EH2A 3CWCA 4JENA 3FTEA 4FZRA 3IBTA 1LV8A 3UC9A 5B3LA 2O06A 2NPFA 3RK1A 1YJXA 3AR3A 4PQYA 3V97A 5CTJA 5DSZA 3KSBC 2BEKA 1SVIA 1Z34A 3OHMA 3VTZA 3DDHA 2ADOA 2GFQA 4Y2GA 1M2WA 4L4SA 4U2GA 1NDHA 3ZGNA 1XZEA 1K7FB 3N2NA 2O54A 3H9QA 1EM6A 1YIAA 2ZS8A 2YHAA 3V4RA 3PKIA 3OP1A 1GUBA 2ZUFA 1W36B 3D8HA 3WQRA 1CUZA 2PLWA 3E3AA 1F5NA 3BOSA 2W2NA 4I5FA 4BJ3A 4KXNA 1GQRA 4FZ5A 3CF0A 4WJZA 1QV9A 3R5KA 3E5HA 2PRKA 2RG1A 5E2IA 1RHJA 1RXVA 2KSQA 3OPMA 3DE6X 4LE1A 5MHTA 1KOJA 2XEXA 5LMUB 1HO3A 2FPOA 3FWNA 1C0PA 3VU9B 3CRW1 3E8SA 3A06A 4AIRA 3T99A 4ZKDA 3L4JA 3FW1A 3I0MA 3RC2A 4IL5A 1SVWA 4NXNB 3MJEA 2DFDA 1PYDA 3E2IA 3OG9A 3CNEA 1T2AA 1W25A 2HC9A 4MW2A 2OY0A 2XYPA 3DMNA 4IQGA 4BWVA 3HKCB 3HL0A 1MNQA 1ZUNA 4FYKA 4KXLA 4RA9A 3CJTA 2JFYA 4IHJF 1TD9A 3ZX4A 4K6CA 4ZEXA 1BWSA 1E7RA 2ZJ2A 3T0GA 4MDEA 2OCKA 1NX9A 3S27A 2W4IA 1TUBA 1QC5B 2B1IA 2AZMA 4JB0A 2VEOA 3CLSD 1U81A 1SC3A 3RTCA 2KI5A 1PT8A 3KT0A 1BWQA 3NBUA 4EUSA 5KNCA 3VA7A 1J70A 5EMLA 3O8NA 1CV2A 1NIPA 1IM5A 3LPLA 3RNOA 1MHPA 4JIGA 5D6OA 1RPAA 3B5IA 3TSAA 3DLCA 3O82A 1CIJA 4DJDC 5HZGA 4DB2A 4PGFA 5D3MB 1QG2A 3NYIA 1QGZA 4CMEC 5FV4A 4DXHA 3ZWAA 3EBLA 4WKGA 1Y98A 1YBMA 4KPGA 2QGFA 3K9GA 4RMIA 4WZBB 5AI0A 4RA9B 3RIMA 4FEAA 1GKIA 3NOXA 3ELYA 1GZ4A 2H07A 2AR0A 2XA1A 3MINA 4BMXA 4F2WA 3U7RA 3GLHB 4RC9A 4JLBA 1U3FA 1EAMA 1AN9A 4JV5B 3DFKA 4KG7A 3HI6A 5JJBA 5EMHA 4O4LF 1G8FA 4N8SA 5BXYA 1ISFA 1JLRA 2RC6A 3PX3A 2GZHA 5AVYA 5I4BA 1AIPA 1EWTA 1Y8CA 4LTNA 4P7GA 2I4OA 4CN8A 1UADA 5EUQB 1PTKA 1BKDR 1DKQA 1P0CA 1QVAA 1SO8A 1MOPA 2ZE7A 4P33A 2P8SA 4LECA 1JYSA 3WWDA 4RF3A 4Y9RA 1AM4D 5F7ZA 1Y81A 4HTFA 3ECSA 1Q1AA 3WYEA 4I14A 4NBKA 5K0EA 3IHLA 2IEZA 2X3YA 3U4AA 1ZRNA 2BKAA 4XM1A 4NONA 2GETA 2XQVA 5CXXA 2HQSA 3V3TA 2XYHA 3MMSA 5FI0B 5DM60 1WSAA 4RD1A 3QFHA 1V95A 2PYIA 3WMRA 4ARZB 4YLYA 2AS0A 4D44A 4ZAGA 3VJKA 1A27A 2GT1A 4CKCB 4OP2A 2I3BA 3L7BA 2ZJ4A 2A1UA 1R0SA 5KIAA 1WZ2A 5FL3A 2E6KA 1EBUA 3AR8A 4ZAWA 2QNRA 3GRUA 2XUHA 5DX1A 1XDGA 4OFBA 4CM8A 1UP7A 4EBBA 4ID3A 2WNHA 1XOIA 3MLAA 3K73O 1N5OX 1FCJA 4G26A 5FTNA 2CEKA 5AM5A 2C8LA 2XCUA 3A6LA 5EXXA 2I2XB 3R8XA 4EF4A 3ISTA 3DUFB 3PQ6A 4GG1A 4RAQA 4YJ2B 1H9AA 2HYDA 4RJJA 3SFZA 1JQLB 1M34A 1O6GA 1PJ4A 3AW8A 3ME5A 1RRCA 3MWDB 3TAXA 2RGNA 4CE6A 3TBFA 1ENPA 2BH2A 1N2JA 2G9RA 2Y0EA 4FXPA 4KQKA 4MXDA 4M1OA 4BEJA 4TLLB 1IZ0A 3NJ4A 5JLAA 5ILOA 5DYWA 4L27A 2E4XA 4B8WA 2GXSA 4YUAA 4FR5A 2C00A 2QTHA 3QBJA 4KQGA 2WE8A 2VDUE 2W7TA 4LBWA 3RSHA 3QWIA 2ZR9A