4XEIG

Orthorhombic isomorph of bovine arp2/3 complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
135
Chain Sequence
FVDVDEYDENKFVDEDDGAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Crystals of the Arp2/3 complex in two new space groups with structural information about actin-related protein 2 and potential WASP binding sites.
pubmed doi rcsb
molecule tags Structural protein
total genus 37
structure length 135
sequence length 141
ec nomenclature
pdb deposition date 2014-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 4xeiG00
3DXMG 3UKUG 4XEIG 3UKRG 3ULEG 1U2VG 2P9KG 2P9UG 4JD2G 3RSEG 1TYQG 2P9PG 2P9NG 1K8KG 2P9SG 3DXKG 2P9LG 3DWLG 2P9IG
chains in the Genus database with same CATH superfamily
4HOSA 4L2YA 1UG3A 3LXUX 4HLLA 3LCAA 2Y0BG 5FQ7A 4DPRA 5KJKA 4G25A 1S70B 5AARA 4GTSA 3UT8A 5B3SE 5CCLA 3RRUA 4HI8A 1Z3XA 2R2LA 3W9FA 3ZYLA 2BKGA 1E8YA 4JPSA 2VGEA 3PNLB 1YA0A 1NI1A 2IOLA 4P29A 3CHOA 2IFUA 4O6FA 1OWPA 1D8DA 1W3BA 4QFVA 4TV3A 3OXFA 4BT8A 2I1JA 1H2TC 3V2OA 3QB2A 1DNPA 3ZN3A 1IKND 2MOWA 4U63A 3C72A 5HI7A 1GW6A 3NB2A 3C98A 2CG3A 4I1OB 4KBQA 1IXVA 4FLHA 2GRMA 4M3OA 4KT6B 3PH0C 5AENA 3CVNA 1H6OA 4A1GA 5AIJA 4NACA 5JJ6A 5CRVA 5EX0A 1EF1C 1UJJA 4GA2A 5DIZA 4JB8P 3PZ4A 1IHGA 1B89A 4FADA 4L23A 4GZCA 1FVFA 2BF0X 3QWVA 4GB9A 2Q7FA 3ABME 3V2XA 4M7CA 4J8SA 1L5JA 3O48A 3C3QA 1MYOA 4BSXA 3AS5A 1DVPA 4NURA 2WXNA 2CHXA 2XZDG 3IXEA 2GROB 3HRAA 1HU3A 1AWCB 2B6CA 3APCA 2RKKA 2IONA 5J08A 5CCMA 3G2WA 3UXGA 3UT7A 4F6RD 3LYAA 3ONLA 2LUHA 3V30A 1NL4A 3MCXA 3FTWA 3JQ0A 1K8KG 2P58C 2FBNA 4LG6A 4I9EA 3JQ1A 3QAQA 1H6KA 3ESLA 3QWPA 2MRIA 1MQSA 2B0OE 1UJKA 1Y8MA 3ZYQA 3L54A 2AW6A 4DX1A 3RSEG 4JW1A 4YDYA 4WAFA 2KXPC 2XEEA 3ZNGA 3L16A 2KATA 3HVEB 1OXJA 1PAQA 4FHJA 3GZ2A 4DX6D 4AP2A 1Z3YA 2JLBA 2QZAA 3QWWA 1TYQG 4DX5D 2XS8A 2I6HA 1OY3D 3FUEA 1MJ0A 1UN8A 1SZ9A 2KCVA 4JXTA 2EIME 4EQFA 5D66A 4UWGA 2AJAA 4E85A 4ZFHA 4GAAA 4YVQC 3AJIA 5CRUA 3FWVA 3TL5A 2GRPB 1E7UA 2LNIA 4MS6A 4F1PA 5KJNA 4TXPA 2V5FA 1IYGA 2RFMA 3TWRA 3U64A 3Q7AA 2IY0C 4YDWA 4RG6A 2F8YA 5H7PA 2FULA 4N3CA 4IN3B 4TXRA 4RLYA 5EKQD 1N94A 2XPIA 5ENPD 3QJZA 3R9AB 2AXVA 3SHFA 3UT4A 4XEIG 1N4PA 1JWFA 5KNGA 5ENRD 4I2ZA 4PH4B 4GTOA 3ZUVB 4U04A 2AWIA 4CEMA 3FEYA 4F7AA 4HXIA 5EX3A 3HVEA 4B89A 4B8AA 3EIJA 3DWLG 2XGOA 1OWMA 4HOQA 4GPKA 2DYRE 4HRLA 4JD2G 1ZB1A 3KAEA 3SY2A 2GW1A 4GMLA 2QYJA 4V3IA 1QZ2A 3CLJA 3S7DA 4FJZA 3HXEA 3HG0D 3LDZA 3MEKA 1QNFA 4JVSA 3CHMA 3TXMA 4YDEA 3CR3A 5AJDA 2P9KG 3S7JA 3L6AA 4FA6A 4A3VA 2H6IA 5T3RA 1O1RA 3R7RA 4H7XA 4GTTA 2V8SE 3CIAA 3OAWA 2J08A 5CEDB 3SD5A 4HOTA 3DPYA 4TUUA 3J5QB 4Z68A 3PUKA 4UQXA 3LVRE 2EILE 3FUNA 1AP7A 1KT0A 2LSUA 2E2EA 4FP7A 4ACLA 1NA3A 3SZ7A 5KCMA 5FJYA 4BTBA 5E75A 4GCOA 4MLPA 1X81A 3GZ1A 3JYSA 2ETAA 2J07A 3VLDA 2VQ2A 3U9WA 3UTMA 4JHKA 2ETCA 4J8EA 3MZLB 4GA1A 5LP0A 5CHEE 5JHAA 2J09A 5KNHD 3EIQC 2IO2C 5IY5E 4BX8A 5KWDA 5EILA 2WXRA 3R7QA 1FPPA 2EIKE 2BEDA 5CMWA 4HORA 3CQGB 1JUQA 2WQ6A 1WM5A 5ITZF 4I43A 1E8ZA 4I1MA 3DSSA 3T5VA 3EHQA 4HI9A 2ONDA 4U0SA 5JJ7A 4CZ2D 4DI4A 3LVQE 5KJLA 2NXPA 4L2LA 2X6HA 3Q9UC 2KBXA 1MX6A 4B8CB 5FQ4A 3CKCA 1JWGA 3I3NA 1OWLA 3UINC 1S64A 5AYWD 3ULYA 4I1AA 3ASHA 4GA0A 1V55E 3MV3B 3EUVA 3S2AA 3G2UA 4I6EA 4J0UA 4ANUA 4HS2A 3ISMC 4KZ0A 2PM7A 3PNTB 2QYUA 2H6GA 4Y6WA 3ASOE 2XPYA 2ZXWE 4I6JA 4BWRA 3Q79A 4G2VA 3KD7A 5CECB 3TWXA 3QKYA 4ANWA 3NBNB 3V31A 4U8VD 3CK7A 3PE4A 3OXGA 5HQ8A 1TN7A 2L6JA 3ZGQA 1OT8A 2KCLA 3AG3E 2IO3C 4KMOA 1N0QA 5KBAA 2J9QA 2F37A 5LX8A 1KZOA 1YMPA 4G23A 1EYHA 5T4YA 4R7LA 3SO8A 2H6FA 2EIJE 1IHBA 3NF1A 4EECA 5D0OD 3MYVA 3FUHA 3GZSA 3W9GA 1XNFA 4OAUC 1FT1A 4LNBA 2WMOA 5EIDA 2OOEA 2C2LA 4ILGA 3ZYMA 3LEWA 3Q78A 5CERB 4ACKA 3FUDA 3JUIA 1N9AA 5B1BE 4N2SA 3FU0A 3TAXA 3SGHA 3PDNA 2CFZA 1TNYA 1N4RA 3DPDA 2V4LA 4PS7A 2BKKB 2WXFA 3GYZA 3TG4A 3ASGA 1WAO1 4JEUA 5G05J 5HS0A 1SZAA 4MBGA 4N3BA 5AAOA 4DX2A 4FJYA 5G04C 3UUXA 4G24A 5FZSA 4U96D 3ENEA 1XGWA 3FTZA 3TWVA 3U4TA 3CHSA 1LF8A 2WXOA 4BT9A 1HX8A 3DEOA 2IF4A 2E0IA 3ASFA 4KVMA 3O4ZA 3PZ3A 1OCZE 3RK6A 3ZYKA 3CVVA 2FO7A 4HOUA 1BI7B 3FTXA 2H6HA 4AY5A 2UY1B 3UIPC 3FU3A 3CKBA 1TEZA 2DYSE 4NRHB 4C48B 1IQRA 4CGWA 1E96B 3LPZA 2LXLA 2WQHA 4DRXE 3TWTA 3ABLE 3GW4A 4ANVA 4G1TA 2XENA 3MGBA 3T8KA 2UWJG 2R05A 4DX7D 4AM9A 3KS2A 4L1BA 3S7BA 4GTRA 3VTXA 3EU5A 3CHPA 1WY6A 1FT2A 5LFAA 3ABKE 3FFLA 3CGHA 3NQPA 4U07A 5D0QD 3JUEA 4HQDA 1TNBA 3RAUA 2KZTB 2EQXA 3UQ3A 3PS6A 1Z5SC 3CQCB 4GZ3A 2XQ0A 4UWKA 2VYIA 3NAWA 3T5XA 4RVBA 1Z6TA 1MX4A 2AVPA 4K5CA 2I9CA 3TG5A 3ZKJA 2YHEA 3RO2A 3F6QA 3UMVA 2WB2A 3D9JA 2I1KA 5DBKA 1LTXA 3CK8A 3FTYA 2NSZA 3FH8A 3B7RL 3DSVA 2XZTG 3ZHEB 1A5EA 1PC2A 4PDXA 5FZQA 3NZUA 2WMNA 4GTPA 2UY1A 4EPZA 2CHWA 1INZA 3EHNA 4I2WA 1BD8A 4CRWA 4X8QA 3EHMA 3UPVA 4GYOA 3ZEFA 4K5BA 4U7EB 1NFIE 2DWZA 2I2OA 1LD8A 3WXXA 1O1TA 3ZPJA 2BTDA 2XS1A 3IHYA 1HH8A 2OCCE 4GYWA 5G2NA 2GRLA 3G2TA 3ZIMA 2ZISA 1WG0A 4U95D 3FUJA 2GRRB 4WWOA 4D10C 2WPVA 2XCBA 3E37A 2X6JA 1DCEA 1QYMA 1OCOE 3E4BA 4AOFA 5HRYA 4WNDA 4GTVA 4A3TA 3QC1A 4XIFA 2OVFA 1E90A 4N5CA 1TR4A 4LCTA 3CVUA 1PY1A 3Q75A 4I6GA 3ZHEA 5BXUA 1U2VG 3OTNA 3CVPA 5JJTA 3HHMA 3HIZA 2Y69E 2HE0A 1KPSB 4G26A 4C0EA 1FCHA 3R9MA 3IBEA 2L9BA 4MKTA 4KZCA 1Y6IA 2ZGDA 2HYZA 3PZ1A 3FTSA 3FUIA 3DSUA 1HS6A 3TJPA 2X6KA 4TUMA 4XZ4A 1E8XA 3LS8A 3ULEG 4JC8A 4AIFA 4U8HA 1H2UA 1UN9A 5HKPA 3X2QE 3DBSA 5T8IA 1JCRA 4ANXA 3APDA 5CBOA 4A55A 1HG2A 1MX2A 1A17A 4UI9J 5EIBE 5G55A 3FTVA 3HXCA 3I4GA 1TNUA 2P9UG 3ONKA 3DRAA 4EHMA 3APFA 3U66A 2HR2A 5FTPA 2IJGX 4BY6A 4G8KA 3VLFA 3QK0A 4NIKA 4F53A 3E33A 4N2QA 2NYJA 1JCSA 4ATZD 1NZNA 2VGYA 4LSZE 2XHEA 4LRZA 3UI2A 2L6BA 1ZBPA 3D9IA 4L9PA 5FWQA 4MRUA 4GTQA 2XGMA 2WXKA 4CT0A 2QY7A 2WXLA 3SF4A 4BERA 1H0AA 4CDMA 3ML9A 3IV0A 2WQ7A 2MYOA 1BPOA 4EBAG 5LCWC 5EYPF 3RRMB 4B94A 2QFCA 1LD7A 4GZ6A 4BTAA 2GRNB 5B1AE 5A23A 2P9NG 3CVYA 3QARA 4UWLA 3I4RB 2FI7A 1TN8A 2GGFA 3SBTB 1SQMA 2AXUA 3JXIA 4GCNA 3T9KA 3HYMB 2R17C 3T8MA 3P1UA 4APFA 5C2YA 4AY6A 4O1OA 4LNUD 2DIWA 5C1DA 1V54E 1E7VA 1ELWA 5ARFA 3WG7E 4DUIA 5AN8A 3SI5A 1EPUA 3FY4A 2A5UA 4EZJA 1OWOA 4FHKA 5FIOA 1N4SA 5JMND 3FULA 5A7DB 3CHQA 4GZDA 4JZYA 4OYSA 1X5BA 2WXJA 2R5SA 4DLOA 2PQRA 3L08A 4BEPA 2R59A 4F3VA 4JA7A 4BESA 3VLEA 3EJNA 4UWHA 3QNKA 2FO1E 1HO8A 3IHVA 2JABA 2RG8A 3P2BA 1QBQA 2IQCA 2RD0A 3Q73A 3CVWA 2WXPA 3J5PA 3N71A 4WNGA 5M72A 3EU9A 1FVHA 2PZIA 4DLQA 3B7UX 3DXKG 3E30A 3B7BA 5FZRA 3ZFWA 3EDTB 3L22A 5BNWA 3CEQA 4Q94A 5ARGA 4JHRA 1HF8A 3SFYA 2YNQA 4N3AA 2C0LA 3RRNB 3PE3A 3D9LA 4Y6CA 5G05C 3OXLA 4U8YD 4GMRA 4C9BB 1TJFA 2OV8A 3HXDA 4GYYA 3AU4A 3PEVB 2PNNA 3RJVA 1S63A 2P9IG 2Y4TA 3CSTA 4XKBA 3D9PA 3CVXA 3B7SA 3QOUA 3MX3A 3D3MA 2XGSA 3FUMA 1UW4B 3LJ3A 4KXKB 4W9RA 1ZU2A 3BQOA 1K1AA 4HFGA 4FU3A 4J8DA 3U3WA 3CSFA 1DCQA 4AEZC 3UKRG 1JCQA 4EBAA 2WVIA 3LY9A 2MHKA 3ZU7B 3JCKC 5FINA 4K03A 2WXQA 4Q96A 4FLBA 4J7WA 4XI0A 2LAHA 4DI3A 5EDSA 1G3NB 4LNGA 4BX9A 3LY7A 1O1SA 4IRUA 3D9OA 1YYHA 3BU8A 4ABNA 2A4ZA 4XI9A 3K9IA 4IYPA 5LOZA 2V5QC 3FU5A 5A6CA 4XE0A 1N54A 2M63A 4HRNA 4PS3A 4LUNU 2KC7A 3JXJA 3D9MA 1KZPA 2LO6A 4UUCA 3UM2A 3ML8A 3FUKA 4HLEA 5D2MC 3FH5A 5CMYA 3PZ2A 2VSOE 1NP7A 1EDUA 5BW8C 2J8SD 1VDYA 1HFAA 4CDRA 3UM1A 3NOGD 1YCSB 3KEAA 5AQ7A 1Q2ZA 3ZVVA 5ENTD 1BI8B 4HRMB 1KLXA 2IEJA 2R03A 3PZDA 4E6HA 1H6PA 4A1SA 1RW2A 2P2CP 1WDYA 5BV1A 3C5RA 3Q47B 3I5PA 3MKRA 2WXGA 3ASNE 4HNAD 3AG1E 5BV0A 5BPPA 1P5QA 1NA0A 3VTYA 2DVWA 2HM8A 1K3ZD 3TWSA 5EN5D 1U3DA 1SA4A 4ATGA 2Y3AA 2X6FA 2AXZA 3EHRA 3MKQB 2GRQB 4N39A 3IEGA 5G04J 4EZKA 2OVBA 3KSLA 4XX5A 1E8WA 4PUCA 5FQ6A 3SQVA 3PUJA 4JEHA 4IULA 3AG4E 3BEEA 3AS4A 3G2VA 1N0RA 5ENSD 2EINE 3Q49B 4H7YA 4APOA 3AAAC 2ILRA 4F1SA 1SVXA 3D9KA 4TRQA 4YNDA 3SBSA 4HVBA 2ZU6B 1TJCA 4UI9K 3BG0B 2OEVA 4I17A 2ZIRA 2PL2A 3B7TA 3FHEA 1ELRA 1U3CA 4U0UA 4CDNA 3TWWA 2X3MA 4YVOA 3E32A 5CBNA 2XRYA 3ZW3A 3BG1B 4WWNA 4KVOA 1OCRE 3AU5A 4ZHBA 3NOCD 4O60A 4UQZA 3UX4A 3ZXSA 4Q69A 2KZTA 3BUAA 2XRZA 2XEVA 4BFRA 1BU9A 3MKQA 4JA9A 2HO1A 3UKUG 4UI9C 4OAVB 1OWNA 4RG9A 3IKOB 2DBAA 3RO3A 3KSQA 3FUFA 3AS8A 2NC9A 3CV0A 5EYLA 2C0MA 3ASDA 5E76A 1KT1A 1N11A 1QQEA 4AVXA 4UQYA 2JEKA 3E34A 3ZXPA 1N4QA 3TWQA 4UWFA 5J90A 3AG2E 2IOSA 2DCPA 1TN6A 2YINA 2XPZA 4LEUA 2CG2A 3LY8A 2J4DA 5ANRA 4C0MA 3FP3A 5BXOA 1TNOA 2ZGGA 4A63B 5JHBA 5FQ8A 4URKA 1D8EA 4AXHA 3UM3A 2P9PG 3HXFA 4HB5A 5BT1A 3SNXA 3PRZA 3DSXA 3TXNA 3HDXA 3FH7A 4AJWA 1D9SA 1ELKA 2PM6A 4CYMD 1TNZA 1MHQA 4TXQA 5AQAA 4PS8A 1H19A 4XKCA 3Q7FA 2VGXB 4WNFA 4B93B 1SA5A 5FT9A 4DJAA 1OUVA 2CFUA 2CHZA 1UOHA 1H2VC 4GTMA 5AQBA 2ETBA 3MV2B 3Q15A 3Q5MA 3SFXA 3MA5A 5JA4D 2LAIA 1HG5A 4RQIA 1HE8A 5AQ9A 1BLXB 2WM9A 3DXMG 3PREA 4ME2A 3HXBA 3UM0A 3TWUA 4U0ZA 2FEZA 2F8XK 4J8YA 2WXHA 3Q9NC 2VSNA 1S0PA 3RKVA 1K1BA 1N52A 1OCCE 4BETA 4GMJA 3KEZA 2VTBB 2DZOA 2KM4A 2Y1LE 2Y4UA 2YHCA 3L17A 3FTUA 4QQIA 4CCAA 2V0PA 4J6IA 4I9CA 1SW6A 2WXMA 3PEUB 3G2SA 4CGVA 4OVVA 3RU0A 4B0ZA 4N5QA 5ENNA 4WUYA 1JPLA 4NQ0A 3TGOA 2A5EA 3URZA 3CHRA 3MJWA 4FC8A 4FULA 3DSTA 4K5AB 1HZ4A 3LJNA 4JHJA 1DC2A 4GU5A 3C3RA 4BSZB 5ENOD 4EZLA 3FEXA 3RIBA 2VGXA 2XCCA 3L82A 4WNEA 5BUZA 2F0YA 3SFZA 1HXIA 3S7FA 4O1PA 5KJMA 2IU1A 2KCKA 4K0RA 3CVQA 3LKUA 4L7TA 1RZ4A 2L0TB 3D9NA 4G11A 2RFAA 3L9TA 4WWPA 2VSYA 2FF4A 3QDNA 3Q4AB 2LSVA 5ANLA 2PQNA 2P9SG 2VTBA 4LERA 4CT4A 4ILHB 3DSWA 2YQ8A 2OEWA 3FDHA 3B13A 5LCWJ 1IQUA 1O5MA 4AV7A 2DZNA 3ZRHA 3NZSA 3CK9A 2LXMA 3L13A 3CVLA 2BUGA 2L0IA 2X38A 4YDOA 4G8LA 4RSYA 3FU6A 5CEAA 3B95A 2XEHA 1N95A 3C3OA 4DK5A 2P9LG 5ENQD 2V4HC 3D9HA 2X6IA 2VSXE 5AJLA 2VJ8A 4GPMA 2QC9A 4GZ5A 3UIOC 3PVLA 4KYOB 4ILIA 4OVUA 3ULQA 2R02A 3ESKA 3V79K 2WXIA 1MZCA 4HBDA 4J8FA 2J4BA 4JL0A 2J49A 3DEPA
chains in the Genus database with same CATH topology
3DXMG 3UKUG 4XEIG 3UKRG 3ULEG 1U2VG 2P9KG 2P9UG 4JD2G 3RSEG 1TYQG 2P9PG 2P9NG 1K8KG 2P9SG 3DXKG 2P9LG 3DWLG 2P9IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXM G;  3UKU G;  4XEI G;  3UKR G;  3ULE G;  1U2V G;  2P9K G;  2P9U G;  4JD2 G;  3RSE G;  1TYQ G;  2P9P G;  2P9N G;  1K8K G;  2P9S G;  3DXK G;  2P9L G;  3DWL G;  2P9I G; 
#chains in the Genus database with same CATH topology
 4HOS A;  4L2Y A;  1UG3 A;  3LXU X;  4HLL A;  3LCA A;  2Y0B G;  5FQ7 A;  4DPR A;  5KJK A;  4G25 A;  1S70 B;  5AAR A;  4GTS A;  3UT8 A;  5B3S E;  5CCL A;  3RRU A;  4HI8 A;  1Z3X A;  2R2L A;  3W9F A;  3ZYL A;  2BKG A;  1E8Y A;  4JPS A;  2VGE A;  3PNL B;  1YA0 A;  1NI1 A;  2IOL A;  4P29 A;  3CHO A;  2IFU A;  4O6F A;  1OWP A;  1D8D A;  1W3B A;  4QFV A;  4TV3 A;  3OXF A;  4BT8 A;  2I1J A;  1H2T C;  3V2O A;  3QB2 A;  1DNP A;  3ZN3 A;  1IKN D;  2MOW A;  4U63 A;  3C72 A;  5HI7 A;  1GW6 A;  3NB2 A;  3C98 A;  2CG3 A;  4I1O B;  4KBQ A;  1IXV A;  4FLH A;  2GRM A;  4M3O A;  4KT6 B;  3PH0 C;  5AEN A;  3CVN A;  1H6O A;  4A1G A;  5AIJ A;  4NAC A;  5JJ6 A;  5CRV A;  5EX0 A;  1EF1 C;  1UJJ A;  4GA2 A;  5DIZ A;  4JB8 P;  3PZ4 A;  1IHG A;  1B89 A;  4FAD A;  4L23 A;  4GZC A;  1FVF A;  2BF0 X;  3QWV A;  4GB9 A;  2Q7F A;  3ABM E;  3V2X A;  4M7C A;  4J8S A;  1L5J A;  3O48 A;  3C3Q A;  1MYO A;  4BSX A;  3AS5 A;  1DVP A;  4NUR A;  2WXN A;  2CHX A;  2XZD G;  3IXE A;  2GRO B;  3HRA A;  1HU3 A;  1AWC B;  2B6C A;  3APC A;  2RKK A;  2ION A;  5J08 A;  5CCM A;  3G2W A;  3UXG A;  3UT7 A;  4F6R D;  3LYA A;  3ONL A;  2LUH A;  3V30 A;  1NL4 A;  3MCX A;  3FTW A;  3JQ0 A;  1K8K G;  2P58 C;  2FBN A;  4LG6 A;  4I9E A;  3JQ1 A;  3QAQ A;  1H6K A;  3ESL A;  3QWP A;  2MRI A;  1MQS A;  2B0O E;  1UJK A;  1Y8M A;  3ZYQ A;  3L54 A;  2AW6 A;  4DX1 A;  3RSE G;  4JW1 A;  4YDY A;  4WAF A;  2KXP C;  2XEE A;  3ZNG A;  3L16 A;  2KAT A;  3HVE B;  1OXJ A;  1PAQ A;  4FHJ A;  3GZ2 A;  4DX6 D;  4AP2 A;  1Z3Y A;  2JLB A;  2QZA A;  3QWW A;  1TYQ G;  4DX5 D;  2XS8 A;  2I6H A;  1OY3 D;  3FUE A;  1MJ0 A;  1UN8 A;  1SZ9 A;  2KCV A;  4JXT A;  2EIM E;  4EQF A;  5D66 A;  4UWG A;  2AJA A;  4E85 A;  4ZFH A;  4GAA A;  4YVQ C;  3AJI A;  5CRU A;  3FWV A;  3TL5 A;  2GRP B;  1E7U A;  2LNI A;  4MS6 A;  4F1P A;  5KJN A;  4TXP A;  2V5F A;  1IYG A;  2RFM A;  3TWR A;  3U64 A;  3Q7A A;  2IY0 C;  4YDW A;  4RG6 A;  2F8Y A;  5H7P A;  2FUL A;  4N3C A;  4IN3 B;  4TXR A;  4RLY A;  5EKQ D;  1N94 A;  2XPI A;  5ENP D;  3QJZ A;  3R9A B;  2AXV A;  3SHF A;  3UT4 A;  4XEI G;  1N4P A;  1JWF A;  5KNG A;  5ENR D;  4I2Z A;  4PH4 B;  4GTO A;  3ZUV B;  4U04 A;  2AWI A;  4CEM A;  3FEY A;  4F7A A;  4HXI A;  5EX3 A;  3HVE A;  4B89 A;  4B8A A;  3EIJ A;  3DWL G;  2XGO A;  1OWM A;  4HOQ A;  4GPK A;  2DYR E;  4HRL A;  4JD2 G;  1ZB1 A;  3KAE A;  3SY2 A;  2GW1 A;  4GML A;  2QYJ A;  4V3I A;  1QZ2 A;  3CLJ A;  3S7D A;  4FJZ A;  3HXE A;  3HG0 D;  3LDZ A;  3MEK A;  1QNF A;  4JVS A;  3CHM A;  3TXM A;  4YDE A;  3CR3 A;  5AJD A;  2P9K G;  3S7J A;  3L6A A;  4FA6 A;  4A3V A;  2H6I A;  5T3R A;  1O1R A;  3R7R A;  4H7X A;  4GTT A;  2V8S E;  3CIA A;  3OAW A;  2J08 A;  5CED B;  3SD5 A;  4HOT A;  3DPY A;  4TUU A;  3J5Q B;  4Z68 A;  3PUK A;  4UQX A;  3LVR E;  2EIL E;  3FUN A;  1AP7 A;  1KT0 A;  2LSU A;  2E2E A;  4FP7 A;  4ACL A;  1NA3 A;  3SZ7 A;  5KCM A;  5FJY A;  4BTB A;  5E75 A;  4GCO A;  4MLP A;  1X81 A;  3GZ1 A;  3JYS A;  2ETA A;  2J07 A;  3VLD A;  2VQ2 A;  3U9W A;  3UTM A;  4JHK A;  2ETC A;  4J8E A;  3MZL B;  4GA1 A;  5LP0 A;  5CHE E;  5JHA A;  2J09 A;  5KNH D;  3EIQ C;  2IO2 C;  5IY5 E;  4BX8 A;  5KWD A;  5EIL A;  2WXR A;  3R7Q A;  1FPP A;  2EIK E;  2BED A;  5CMW A;  4HOR A;  3CQG B;  1JUQ A;  2WQ6 A;  1WM5 A;  5ITZ F;  4I43 A;  1E8Z A;  4I1M A;  3DSS A;  3T5V A;  3EHQ A;  4HI9 A;  2OND A;  4U0S A;  5JJ7 A;  4CZ2 D;  4DI4 A;  3LVQ E;  5KJL A;  2NXP A;  4L2L A;  2X6H A;  3Q9U C;  2KBX A;  1MX6 A;  4B8C B;  5FQ4 A;  3CKC A;  1JWG A;  3I3N A;  1OWL A;  3UIN C;  1S64 A;  5AYW D;  3ULY A;  4I1A A;  3ASH A;  4GA0 A;  1V55 E;  3MV3 B;  3EUV A;  3S2A A;  3G2U A;  4I6E A;  4J0U A;  4ANU A;  4HS2 A;  3ISM C;  4KZ0 A;  2PM7 A;  3PNT B;  2QYU A;  2H6G A;  4Y6W A;  3ASO E;  2XPY A;  2ZXW E;  4I6J A;  4BWR A;  3Q79 A;  4G2V A;  3KD7 A;  5CEC B;  3TWX A;  3QKY A;  4ANW A;  3NBN B;  3V31 A;  4U8V D;  3CK7 A;  3PE4 A;  3OXG A;  5HQ8 A;  1TN7 A;  2L6J A;  3ZGQ A;  1OT8 A;  2KCL A;  3AG3 E;  2IO3 C;  4KMO A;  1N0Q A;  5KBA A;  2J9Q A;  2F37 A;  5LX8 A;  1KZO A;  1YMP A;  4G23 A;  1EYH A;  5T4Y A;  4R7L A;  3SO8 A;  2H6F A;  2EIJ E;  1IHB A;  3NF1 A;  4EEC A;  5D0O D;  3MYV A;  3FUH A;  3GZS A;  3W9G A;  1XNF A;  4OAU C;  1FT1 A;  4LNB A;  2WMO A;  5EID A;  2OOE A;  2C2L A;  4ILG A;  3ZYM A;  3LEW A;  3Q78 A;  5CER B;  4ACK A;  3FUD A;  3JUI A;  1N9A A;  5B1B E;  4N2S A;  3FU0 A;  3TAX A;  3SGH A;  3PDN A;  2CFZ A;  1TNY A;  1N4R A;  3DPD A;  2V4L A;  4PS7 A;  2BKK B;  2WXF A;  3GYZ A;  3TG4 A;  3ASG A;  1WAO 1;  4JEU A;  5G05 J;  5HS0 A;  1SZA A;  4MBG A;  4N3B A;  5AAO A;  4DX2 A;  4FJY A;  5G04 C;  3UUX A;  4G24 A;  5FZS A;  4U96 D;  3ENE A;  1XGW A;  3FTZ A;  3TWV A;  3U4T A;  3CHS A;  1LF8 A;  2WXO A;  4BT9 A;  1HX8 A;  3DEO A;  2IF4 A;  2E0I A;  3ASF A;  4KVM A;  3O4Z A;  3PZ3 A;  1OCZ E;  3RK6 A;  3ZYK A;  3CVV A;  2FO7 A;  4HOU A;  1BI7 B;  3FTX A;  2H6H A;  4AY5 A;  2UY1 B;  3UIP C;  3FU3 A;  3CKB A;  1TEZ A;  2DYS E;  4NRH B;  4C48 B;  1IQR A;  4CGW A;  1E96 B;  3LPZ A;  2LXL A;  2WQH A;  4DRX E;  3TWT A;  3ABL E;  3GW4 A;  4ANV A;  4G1T A;  2XEN A;  3MGB A;  3T8K A;  2UWJ G;  2R05 A;  4DX7 D;  4AM9 A;  3KS2 A;  4L1B A;  3S7B A;  4GTR A;  3VTX A;  3EU5 A;  3CHP A;  1WY6 A;  1FT2 A;  5LFA A;  3ABK E;  3FFL A;  3CGH A;  3NQP A;  4U07 A;  5D0Q D;  3JUE A;  4HQD A;  1TNB A;  3RAU A;  2KZT B;  2EQX A;  3UQ3 A;  3PS6 A;  1Z5S C;  3CQC B;  4GZ3 A;  2XQ0 A;  4UWK A;  2VYI A;  3NAW A;  3T5X A;  4RVB A;  1Z6T A;  1MX4 A;  2AVP A;  4K5C A;  2I9C A;  3TG5 A;  3ZKJ A;  2YHE A;  3RO2 A;  3F6Q A;  3UMV A;  2WB2 A;  3D9J A;  2I1K A;  5DBK A;  1LTX A;  3CK8 A;  3FTY A;  2NSZ A;  3FH8 A;  3B7R L;  3DSV A;  2XZT G;  3ZHE B;  1A5E A;  1PC2 A;  4PDX A;  5FZQ A;  3NZU A;  2WMN A;  4GTP A;  2UY1 A;  4EPZ A;  2CHW A;  1INZ A;  3EHN A;  4I2W A;  1BD8 A;  4CRW A;  4X8Q A;  3EHM A;  3UPV A;  4GYO A;  3ZEF A;  4K5B A;  4U7E B;  1NFI E;  2DWZ A;  2I2O A;  1LD8 A;  3WXX A;  1O1T A;  3ZPJ A;  2BTD A;  2XS1 A;  3IHY A;  1HH8 A;  2OCC E;  4GYW A;  5G2N A;  2GRL A;  3G2T A;  3ZIM A;  2ZIS A;  1WG0 A;  4U95 D;  3FUJ A;  2GRR B;  4WWO A;  4D10 C;  2WPV A;  2XCB A;  3E37 A;  2X6J A;  1DCE A;  1QYM A;  1OCO E;  3E4B A;  4AOF A;  5HRY A;  4WND A;  4GTV A;  4A3T A;  3QC1 A;  4XIF A;  2OVF A;  1E90 A;  4N5C A;  1TR4 A;  4LCT A;  3CVU A;  1PY1 A;  3Q75 A;  4I6G A;  3ZHE A;  5BXU A;  1U2V G;  3OTN A;  3CVP A;  5JJT A;  3HHM A;  3HIZ A;  2Y69 E;  2HE0 A;  1KPS B;  4G26 A;  4C0E A;  1FCH A;  3R9M A;  3IBE A;  2L9B A;  4MKT A;  4KZC A;  1Y6I A;  2ZGD A;  2HYZ A;  3PZ1 A;  3FTS A;  3FUI A;  3DSU A;  1HS6 A;  3TJP A;  2X6K A;  4TUM A;  4XZ4 A;  1E8X A;  3LS8 A;  3ULE G;  4JC8 A;  4AIF A;  4U8H A;  1H2U A;  1UN9 A;  5HKP A;  3X2Q E;  3DBS A;  5T8I A;  1JCR A;  4ANX A;  3APD A;  5CBO A;  4A55 A;  1HG2 A;  1MX2 A;  1A17 A;  4UI9 J;  5EIB E;  5G55 A;  3FTV A;  3HXC A;  3I4G A;  1TNU A;  2P9U G;  3ONK A;  3DRA A;  4EHM A;  3APF A;  3U66 A;  2HR2 A;  5FTP A;  2IJG X;  4BY6 A;  4G8K A;  3VLF A;  3QK0 A;  4NIK A;  4F53 A;  3E33 A;  4N2Q A;  2NYJ A;  1JCS A;  4ATZ D;  1NZN A;  2VGY A;  4LSZ E;  2XHE A;  4LRZ A;  3UI2 A;  2L6B A;  1ZBP A;  3D9I A;  4L9P A;  5FWQ A;  4MRU A;  4GTQ A;  2XGM A;  2WXK A;  4CT0 A;  2QY7 A;  2WXL A;  3SF4 A;  4BER A;  1H0A A;  4CDM A;  3ML9 A;  3IV0 A;  2WQ7 A;  2MYO A;  1BPO A;  4EBA G;  5LCW C;  5EYP F;  3RRM B;  4B94 A;  2QFC A;  1LD7 A;  4GZ6 A;  4BTA A;  2GRN B;  5B1A E;  5A23 A;  2P9N G;  3CVY A;  3QAR A;  4UWL A;  3I4R B;  2FI7 A;  1TN8 A;  2GGF A;  3SBT B;  1SQM A;  2AXU A;  3JXI A;  4GCN A;  3T9K A;  3HYM B;  2R17 C;  3T8M A;  3P1U A;  4APF A;  5C2Y A;  4AY6 A;  4O1O A;  4LNU D;  2DIW A;  5C1D A;  1V54 E;  1E7V A;  1ELW A;  5ARF A;  3WG7 E;  4DUI A;  5AN8 A;  3SI5 A;  1EPU A;  3FY4 A;  2A5U A;  4EZJ A;  1OWO A;  4FHK A;  5FIO A;  1N4S A;  5JMN D;  3FUL A;  5A7D B;  3CHQ A;  4GZD A;  4JZY A;  4OYS A;  1X5B A;  2WXJ A;  2R5S A;  4DLO A;  2PQR A;  3L08 A;  4BEP A;  2R59 A;  4F3V A;  4JA7 A;  4BES A;  3VLE A;  3EJN A;  4UWH A;  3QNK A;  2FO1 E;  1HO8 A;  3IHV A;  2JAB A;  2RG8 A;  3P2B A;  1QBQ A;  2IQC A;  2RD0 A;  3Q73 A;  3CVW A;  2WXP A;  3J5P A;  3N71 A;  4WNG A;  5M72 A;  3EU9 A;  1FVH A;  2PZI A;  4DLQ A;  3B7U X;  3DXK G;  3E30 A;  3B7B A;  5FZR A;  3ZFW A;  3EDT B;  3L22 A;  5BNW A;  3CEQ A;  4Q94 A;  5ARG A;  4JHR A;  1HF8 A;  3SFY A;  2YNQ A;  4N3A A;  2C0L A;  3RRN B;  3PE3 A;  3D9L A;  4Y6C A;  5G05 C;  3OXL A;  4U8Y D;  4GMR A;  4C9B B;  1TJF A;  2OV8 A;  3HXD A;  4GYY A;  3AU4 A;  3PEV B;  2PNN A;  3RJV A;  1S63 A;  2P9I G;  2Y4T A;  3CST A;  4XKB A;  3D9P A;  3CVX A;  3B7S A;  3QOU A;  3MX3 A;  3D3M A;  2XGS A;  3FUM A;  1UW4 B;  3LJ3 A;  4KXK B;  4W9R A;  1ZU2 A;  3BQO A;  1K1A A;  4HFG A;  4FU3 A;  4J8D A;  3U3W A;  3CSF A;  1DCQ A;  4AEZ C;  3UKR G;  1JCQ A;  4EBA A;  2WVI A;  3LY9 A;  2MHK A;  3ZU7 B;  3JCK C;  5FIN A;  4K03 A;  2WXQ A;  4Q96 A;  4FLB A;  4J7W A;  4XI0 A;  2LAH A;  4DI3 A;  5EDS A;  1G3N B;  4LNG A;  4BX9 A;  3LY7 A;  1O1S A;  4IRU A;  3D9O A;  1YYH A;  3BU8 A;  4ABN A;  2A4Z A;  4XI9 A;  3K9I A;  4IYP A;  5LOZ A;  2V5Q C;  3FU5 A;  5A6C A;  4XE0 A;  1N54 A;  2M63 A;  4HRN A;  4PS3 A;  4LUN U;  2KC7 A;  3JXJ A;  3D9M A;  1KZP A;  2LO6 A;  4UUC A;  3UM2 A;  3ML8 A;  3FUK A;  4HLE A;  5D2M C;  3FH5 A;  5CMY A;  3PZ2 A;  2VSO E;  1NP7 A;  1EDU A;  5BW8 C;  2J8S D;  1VDY A;  1HFA A;  4CDR A;  3UM1 A;  3NOG D;  1YCS B;  3KEA A;  5AQ7 A;  1Q2Z A;  3ZVV A;  5ENT D;  1BI8 B;  4HRM B;  1KLX A;  2IEJ A;  2R03 A;  3PZD A;  4E6H A;  1H6P A;  4A1S A;  1RW2 A;  2P2C P;  1WDY A;  5BV1 A;  3C5R A;  3Q47 B;  3I5P A;  3MKR A;  2WXG A;  3ASN E;  4HNA D;  3AG1 E;  5BV0 A;  5BPP A;  1P5Q A;  1NA0 A;  3VTY A;  2DVW A;  2HM8 A;  1K3Z D;  3TWS A;  5EN5 D;  1U3D A;  1SA4 A;  4ATG A;  2Y3A A;  2X6F A;  2AXZ A;  3EHR A;  3MKQ B;  2GRQ B;  4N39 A;  3IEG A;  5G04 J;  4EZK A;  2OVB A;  3KSL A;  4XX5 A;  1E8W A;  4PUC A;  5FQ6 A;  3SQV A;  3PUJ A;  4JEH A;  4IUL A;  3AG4 E;  3BEE A;  3AS4 A;  3G2V A;  1N0R A;  5ENS D;  2EIN E;  3Q49 B;  4H7Y A;  4APO A;  3AAA C;  2ILR A;  4F1S A;  1SVX A;  3D9K A;  4TRQ A;  4YND A;  3SBS A;  4HVB A;  2ZU6 B;  1TJC A;  4UI9 K;  3BG0 B;  2OEV A;  4I17 A;  2ZIR A;  2PL2 A;  3B7T A;  3FHE A;  1ELR A;  1U3C A;  4U0U A;  4CDN A;  3TWW A;  2X3M A;  4YVO A;  3E32 A;  5CBN A;  2XRY A;  3ZW3 A;  3BG1 B;  4WWN A;  4KVO A;  1OCR E;  3AU5 A;  4ZHB A;  3NOC D;  4O60 A;  4UQZ A;  3UX4 A;  3ZXS A;  4Q69 A;  2KZT A;  3BUA A;  2XRZ A;  2XEV A;  4BFR A;  1BU9 A;  3MKQ A;  4JA9 A;  2HO1 A;  3UKU G;  4UI9 C;  4OAV B;  1OWN A;  4RG9 A;  3IKO B;  2DBA A;  3RO3 A;  3KSQ A;  3FUF A;  3AS8 A;  2NC9 A;  3CV0 A;  5EYL A;  2C0M A;  3ASD A;  5E76 A;  1KT1 A;  1N11 A;  1QQE A;  4AVX A;  4UQY A;  2JEK A;  3E34 A;  3ZXP A;  1N4Q A;  3TWQ A;  4UWF A;  5J90 A;  3AG2 E;  2IOS A;  2DCP A;  1TN6 A;  2YIN A;  2XPZ A;  4LEU A;  2CG2 A;  3LY8 A;  2J4D A;  5ANR A;  4C0M A;  3FP3 A;  5BXO A;  1TNO A;  2ZGG A;  4A63 B;  5JHB A;  5FQ8 A;  4URK A;  1D8E A;  4AXH A;  3UM3 A;  2P9P G;  3HXF A;  4HB5 A;  5BT1 A;  3SNX A;  3PRZ A;  3DSX A;  3TXN A;  3HDX A;  3FH7 A;  4AJW A;  1D9S A;  1ELK A;  2PM6 A;  4CYM D;  1TNZ A;  1MHQ A;  4TXQ A;  5AQA A;  4PS8 A;  1H19 A;  4XKC A;  3Q7F A;  2VGX B;  4WNF A;  4B93 B;  1SA5 A;  5FT9 A;  4DJA A;  1OUV A;  2CFU A;  2CHZ A;  1UOH A;  1H2V C;  4GTM A;  5AQB A;  2ETB A;  3MV2 B;  3Q15 A;  3Q5M A;  3SFX A;  3MA5 A;  5JA4 D;  2LAI A;  1HG5 A;  4RQI A;  1HE8 A;  5AQ9 A;  1BLX B;  2WM9 A;  3DXM G;  3PRE A;  4ME2 A;  3HXB A;  3UM0 A;  3TWU A;  4U0Z A;  2FEZ A;  2F8X K;  4J8Y A;  2WXH A;  3Q9N C;  2VSN A;  1S0P A;  3RKV A;  1K1B A;  1N52 A;  1OCC E;  4BET A;  4GMJ A;  3KEZ A;  2VTB B;  2DZO A;  2KM4 A;  2Y1L E;  2Y4U A;  2YHC A;  3L17 A;  3FTU A;  4QQI A;  4CCA A;  2V0P A;  4J6I A;  4I9C A;  1SW6 A;  2WXM A;  3PEU B;  3G2S A;  4CGV A;  4OVV A;  3RU0 A;  4B0Z A;  4N5Q A;  5ENN A;  4WUY A;  1JPL A;  4NQ0 A;  3TGO A;  2A5E A;  3URZ A;  3CHR A;  3MJW A;  4FC8 A;  4FUL A;  3DST A;  4K5A B;  1HZ4 A;  3LJN A;  4JHJ A;  1DC2 A;  4GU5 A;  3C3R A;  4BSZ B;  5ENO D;  4EZL A;  3FEX A;  3RIB A;  2VGX A;  2XCC A;  3L82 A;  4WNE A;  5BUZ A;  2F0Y A;  3SFZ A;  1HXI A;  3S7F A;  4O1P A;  5KJM A;  2IU1 A;  2KCK A;  4K0R A;  3CVQ A;  3LKU A;  4L7T A;  1RZ4 A;  2L0T B;  3D9N A;  4G11 A;  2RFA A;  3L9T A;  4WWP A;  2VSY A;  2FF4 A;  3QDN A;  3Q4A B;  2LSV A;  5ANL A;  2PQN A;  2P9S G;  2VTB A;  4LER A;  4CT4 A;  4ILH B;  3DSW A;  2YQ8 A;  2OEW A;  3FDH A;  3B13 A;  5LCW J;  1IQU A;  1O5M A;  4AV7 A;  2DZN A;  3ZRH A;  3NZS A;  3CK9 A;  2LXM A;  3L13 A;  3CVL A;  2BUG A;  2L0I A;  2X38 A;  4YDO A;  4G8L A;  4RSY A;  3FU6 A;  5CEA A;  3B95 A;  2XEH A;  1N95 A;  3C3O A;  4DK5 A;  2P9L G;  5ENQ D;  2V4H C;  3D9H A;  2X6I A;  2VSX E;  5AJL A;  2VJ8 A;  4GPM A;  2QC9 A;  4GZ5 A;  3UIO C;  3PVL A;  4KYO B;  4ILI A;  4OVU A;  3ULQ A;  2R02 A;  3ESK A;  3V79 K;  2WXI A;  1MZC A;  4HBD A;  4J8F A;  2J4B A;  4JL0 A;  2J49 A;  3DEP A; 
#chains in the Genus database with same CATH homology
 3DXM G;  3UKU G;  4XEI G;  3UKR G;  3ULE G;  1U2V G;  2P9K G;  2P9U G;  4JD2 G;  3RSE G;  1TYQ G;  2P9P G;  2P9N G;  1K8K G;  2P9S G;  3DXK G;  2P9L G;  3DWL G;  2P9I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...