4XF0A

Cysteine dioxygenase variant - c93a at ph 8.0 with cysteine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHAFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 57
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xf0A00
1ZREA 1UIKA 5JR7B 2I45A 3E97A 2O8QA 3DV8A 3B02A 1RL3A 5BY5A 2CV6A 1UW8A 3OGJA 4P9GA 1ZZBA 1L3JA 3I7DA 4XFBA 2DCTA 3LA3A 1LR5A 5FQ0A 1SEFA 2K9ZA 3EO6A 4TLFA 4XETA 2GH2A 4XFGA 1CAVB 4JV4A 3M70A 3VHRA 3NW4A 2UYBA 3UKVA 2QJVA 3LA2A 4D7TA 2IXCA 5I93A 2OZJA 2B9UA 3OCPA 4X6QB 1DZRA 5CU1A 2Z69A 1CAWA 3SCGA 1EY2A 1J3QA 4AVAA 3H7YA 1G6NA 1ZVFA 3UKNA 4LUMA 1GQHA 4META 1ZZCA 4I01A 2ET7A 3U10A 5FDBA 5F1RA 4RD7A 4A2UA 4AVBA 2FQPA 3KMHA 1YHFA 2H6BA 5I0UA 2F4PA 3MZHA 4XFAA 3ETQA 1VR3A 4ONUA 1NE4A 1SQ4A 3SHRA 4D7SA 4E2SA 2H6CA 4F7ZA 3GYDA 1J59A 4WBBA 3ROUA 4ZU4A 4PJYA 5T3NA 1VJ2A 2ZKLA 2PHLA 2IXIA 1DGRA 4IEXA 3CO2A 4FAGA 2E9QA 2BNNA 5BUVA 3H8UA 5J48A 1UCXA 4Z07A 4JTNA 1RUOA 5I8YA 5J7MA 3RYRA 2UY8A 4XF3A 3H3ZA 4YRDA 4MGIE 5J3UA 3RDIA 3S0MA 4HMZA 3NVCA 2GC3A 2EAAA 1LB2A 1ZX5A 4J1WA 4L2NA 1OMIA 1O3RA 3KGLA 4I3PA 4LEJA 2WC2A 1O3QA 2EA7A 4LTAA 2XL9A 4GULA 5C8WA 3TNQA 4HBNA 1XRUA 3RYKA 4XFHA 2PA7A 4Q0SA 3CLPA 3I59B 1Q43A 4R8HA 4BHPA 1ZZ7A 5HI0A 4KWKA 4XF4A 1UIJA 2Q1ZB 4Q29A 1WA4A 3L2HA 4OFGA 3FJSA 1O5UA 5EFUA 2H0VA 3IBMA 3SCFA 1YWKA 4I09A 1CAUB 1UPIA 3H1WA 4HVOA 1GQGA 4Q0PA 2Q4SA 1X8EA 5FLHA 1X7NA 1ZZ8A 2ATFA 1FI2A 3E6BA 2PYTA 5LRSA 3RZZA 3CL1A 5KHGA 1J3RA 2QNKA 4WZCA 5AVPA 2CAVA 2BYVE 1CX4A 3IDCB 4HN0A 2OZ6A 5LRRA 2HJIA 4AQ6A 5CADA 5KBFA 3KGZA 3H9AA 4MGZE 2FMYA 4QGLA 3DL3A 3HT2A 3FHIB 5FLIA 4KWLA 1O4TA 1H1MA 5I91A 1QXJA 1NE6A 1OFNA 1CAXB 3G7DA 2VPVA 4UXAA 5LEJA 3H3UA 4HVRA 3UKTA 5JCTA 2GC2A 2CAUA 3EQEA 1UD1A 2BEOA 1EP0A 4B29A 1YFWA 2KXLA 5E16A 1YUDA 4HN1A 4JTOA 4YARA 3IDBB 3HIFA 3KCCA 3RNSA 2PHDA 1ZRCA 4MV2A 4I0BA 3D0SA 2XLAA 3BB6A 4OLLA 5BXXA 3U0ZA 4IEZA 3OD0A 4EWEA 5BV6A 5LEKA 3ES4A 3PNAA 5BPXA 1RC6A 3CEWA 4IEWA 4YSFA 2EVXA 4E2GA 3E6DA 2UY9A 3FFQA 1ZZ6A 4MZUA 4QM9A 4XFIA 3PVBB 4IERA 1Q3EA 5JSPA 3EJKA 4CYDA 4XF0A 3WW2A 5FQ0B 4MX3A 2VECA 4FT8A 4EV0A 5JSOA 1ZNPA 2IXHA 2GC1A 1CAUA 4XFFA 2B5HA 5EZWA 1XE7A 3E5XA 5E1RA 2QVSB 3ACLA 2XKOA 3E5UA 1CAWB 4XF9A 2IXJA 1Q5OA 2K0GA 4IEYA 1NZCA 4IEPA 1O3SA 2GU9A 4UBHA 3FZ3A 3H50A 1ZZ9A 1TQ5A 2ZCWA 3NL1A 4LA2A 1CAVA 3LZZA 2IC1A 4PIYA 2QCSB 4HSJA 4N9IA 2PQQA 1DZTA 3MYXA 1SFNA 1NXMA 4X6RB 2XKPA 4E2QA 5KHHA 2Y0OA 1I6XA 4NVPA 2Z2SB 4BH9A 3O14A 4IEVA 4N9HA 4QMAA 3WW1A 4Z82A 4J1XA 4O9EA 2PFWA 3FE5A 4UBGA 3NKTA 3BCWA 5I0TA 3ES1A 4QGMA 4QM8A 2BGCA 2D5FA 2GZWA 4IETA 2OYZA 1DGWA 3BPZA 4LLOA 2ETEA 5I0SA 1FXZA 1PM7A 1Y3TA 4ORFA 1J3PA 3HQXA 5FPZA 1EPZA 4MH0E 3N4MA 3WW4A 2PAKA 3PLQA 4IEQA 4LA3A 3S7EA 4KU7A 3DKWA 1V70A 3LAGA 4I02A 3H1YA 5FLJA 3WW3A 4XEZA 2GC0A 5K8SA 4IESA 2XGXA 4FAHA 3ST7A 1O7FA 4ZU7A 2BNMA 5CVRA 4MGKE 2D5HA 2XLGA 1QY4A 4HLTA 2XL7A 2WFPA 2O1QA 5JAXA 1IPKA 1X8MA 1I5ZA 2HKXA 5I8TA 4Q0QA 1J1LA 1J58A 1YFYA 2MHFA 4HZFA 3JZVA 2D40A 1ZRFA 1RTVA 4KL1A 1YLLA 1O3TA 1QWRA 4L11A 4FBFA 4QGNA 1ZRDA 3M3IA 2Q30A 3I54A 4JVAA 4LUKA 3H1MA 5C6CA 1XE8A 2XHKA 2XLFA 3D0JA 3EBRA 4HSLA 1JUHA 1Y9QA 3IIAA 3MPBA 4QXKA 1EYBA 2QDRA 3CF6E 2V09A 4I2OA 2ET1A 4F8AA 4LULA 3SXWA 4EWAA 3RYPA 3I59A 1X82A 3NJZA 2CGPA 2PAEA 4I0AA 4Q0VA 3E5QA 4K8FA 1O5LA 4YYOA 5JSRA 3BU7A 5FPXA 3FX3A 5D1IA 2P17A 2B8MA 4IEOA 1OD5A 1U12A 4Q0UA 1RUNA 3EHKA 1HW5A 1RGSA 3R6SA 4MGYE 2IXKA 1WGPA 4MUVA 3DN7A 2BNOA 3USSA 2VQAA 2Q0AA 3QACA 4XFCA 1NYWA 1LKNA 3ELNA 4EWDA 1IPJA 2C0ZA 4ZU5A 3U11A 3BALA 4KU8A 3H7JA 4H7LA 3TNPB 5KHJA 5I8SA 3LOIA 1QXRA 1YFXA 4KWJA 3IWZA 1ZRRA 3FWEA 3E6CC 3S7IA 4QX5A 4AVCA 2D93A 2PTMA 3ZDSA 3OF1A 2MNGA 2IXLA 2OA2A 4EROA 3GBFA 1OI6A 3D82A 2MPFA 1CAXA 4DINB 3KSCA 2GAUA 2UYAA 4AQ2A 3LWCA 4AXOA 4BIFA 3MDPA 1VP6A 2PAMA 4PIXA 5I0RA 3HT1A 3SMHA 1H1IA 5FCCA 3OTFA 4HVQA 3NSTA 4IEUA 5KHIA 1WLTA 3LA7A 3C3VA 4WVZA 1CGPA 2N7GA 4BYYA 4XF1A 5KHKA 4YNIA 3RPQA 1PMIA 1YFUA 4O9GA 1FT9A 3QOPA 2OPKA 4R52A 3SCHA 3CJXA 4PIZA 1LRHA
chains in the Genus database with same CATH superfamily
5BNPB 3J7NA 3OPZA 2YROA 1GU3A 4G4FA 4LBLA 3JQWA 3KT1A 1H2MA 2EAKA 1MZEA 4CE8A 1LOGA 3PVNA 1QDOA 4YW7A 4AQTA 4UFJA 4AVVA 2Y6GA 3OGJA 1KFXL 1H6YA 4C1WA 3NRUA 2JD9A 1L3JA 1UXZA 2YFUA 2CHHA 1D4M3 5J09A 2VNVA 2K9ZA 2YC2A 3ZPOA 5K9YA 2JDAA 4DNYA 4Z8BA 3KV5A 2JDZA 1CAVB 3N9NA 4L0PA 4CXYA 2KA3A 1SBEA 3M70A 4AFDA 3VD9A 1C1FA 1CONA 2HWE2 2J22A 2WJSA 1URXA 3MGUA 4FPCA 3LA2A 4NHXA 5F32A 1RUD2 4ES9A 4D7TA 5A32A 1SBFA 1TVGA 2OZJA 2FBEA 3IMMA 1VBA3 4ASMB 4X6QB 5CU1A 1FPN2 1ENXA 2E7TA 3HMYA 3KV4A 1J3QA 4YM0A 3FUQA 2NMOA 1W0OA 3H7YA 2X10A 3UKNA 4CSWA 5F8PA 2D7FA 4LUMA 4C1XA 1JYVA 5L9VA 5GLTA 1J83A 4EQVA 3VZLA 2ET7A 1T2XA 2DCJA 5C3OA 5FDBA 5JMCA 3UK9A 4V2WA 1JZ7A 4HKOA 1SCSA 3M7AA 1HXS2 4LITA 2C6SA 4YM2A 2VQUA 5DDJ2 3GZUC 2H6BA 5A6ZA 3GBGA 4FO9A 3I2GA 3HPNA 1VR3A 4JGYC 4ONUA 3VZOA 4CU9A 1SQ4A 3MUZ1 1TNRA 3CZUA 3N3HA 4CEWA 5IWFA 1GZTA 2OIIA 1POV1 2W1WA 3MIBA 4GB33 2H0BA 4ZU4A 1VJ2A 2ZKLA 1DCSA 3U37A 3GZTB 2G9FA 3LE0A 2J1AA 1AXKA 4RL7A 1MS5A 3TN91 3CO2A 1TMF1 1BEV2 5IVEA 2WNUB 5F2WA 1VBD2 2JDHA 1H1AA 4RGAA 3ITQA 1UCXA 4JGZA 2WSUA 5FBJA 1RUOA 3AB0A 4M00A 1GANA 2PMWB 4QPGA 2HWF2 2DCYA 2Y33A 5FZ6A 2W3JA 2JDNA 3KB5A 1OURA 3LEKA 4XF3A 3LSDA 4CP0A 5C4WC 1BJQA 1ACCA 5K0UA 2UURA 4NHKA 2WNVC 3OD4A 4GMP0 1QH7A 4UFIA 5HCAA 4QQOA 3J7HA 2GNBA 1W2TA 3FL7A 2GP5A 2AR6A 2OS2A 4A6SA 3VDBA 1Z7S3 2XJTA 4ITCA 5FYYA 3CJIC 1FPN1 4MG2A 3AJYA 3NVCA 2A6VA 4BJ0A 1MQTC 5JXHA 1OOPB 1S0DA 2B45X 5CNAA 1ZX5A 3R0RA 5GZDA 2RJLA 1K5MB 3SH3A 4DB5A 4Y1YA 3M3EA 3KGLA 1UMHA 2ZPXA 1EAH2 3NAPB 2VUDA 1E5HA 1H8VA 1LHUA 2EXKA 1W9FA 5FZOA 1UXXX 1X9PA 2RE9A 2YU1A 3NV1A 2RDNA 4NPRA 1QOSA 1OPMA 2ID4A 4HBNA 4IE5A 5GKAC 3RYKA 3PJQA 2RS31 1ZBE3 2AC1A 4XFHA 4GAZA 1G8WA 3QLQA 4WVWA 2J1EA 1A34A 2Y6HA 3CLPA 3GCWA 3I59B 4RQPA 2NP0A 4NAOA 1Q43A 2WNOA 1B35A 2WQ8A 5A3NA 2Q8OA 4AI1A 3K2OA 4CCMA 1BEV1 1CIWA 1WA4A 2LRPA 2WT2A 3VL8A 1PM4A 4HOOA 4NHMA 5EFUA 1LU2A 3IBMA 3JXSA 3H3LA 4RA0A 2CY6A 1YWKA 1QJU1 3IMNA 1V6NA 3POWA 4K1ZA 4XJAA 3S57A 2BV4A 4ZS3A 4HVOA 4TZDA 3IM0A 3DYMA 2ZS6B 3K46A 1Q8QA 4Q0PA 2BQPA 3I2FA 2ZMNA 4NAMA 5ISLA 3D6EA 1MZ6A 1WD3A 1ND3A 1GZWB 5EWSA 3HVDA 2ATFA 3PMEA 4DXTA 2PYTA 1UOGA 1W04A 4KH9A 3RZZA 3O1PA 4JDOA 1XNBA 2QNKA 3PUSA 4ARXA 3PTRB 2CAVA 4PQ9A 4OI0A 4COZA 3IDCB 1W6QA 5CADA 2HJIA 4TTGA 4MGZE 5A6QA 2ADDA 4IV1C 3WNOA 3HT2A 3T0BA 2ZABA 3VZNA 3RJ2X 5FLIA 1AYM1 3B3QE 3P3NA 2BBAA 1X9TA 1ALYA 5L7OC 1LEMA 4A41A 1CAXB 3T0DA 1OH3A 1NCRB 4BXSV 1W9YA 1GQPA 3WQBA 5ACA1 2V4VA 5LEJA 1NLSA 2A3WA 4LK6A 1G7YA 2AENA 2VD7A 3SEEA 3UKTA 3UGFA 4W8JA 3V64A 1DGRN 1UD1A 2HWE3 5LBEA 3AFKA 2A71A 3KWVA 5FMOL 5GJ6A 4B29A 5E16A 3AZZA 4CDUA 2VMEA 4EJRA 1RUD3 2ORXA 3K3NA 2VVFA 3U14A 4FTEA 5LA9A 1UU4A 1WCDJ 2PHXA 5C8CC 4FTSA 1W6MA 2Y26A 3N9QA 5JI7A 3OBTA 4QPIC 1R083 2JE7A 2Q8CA 5A7SA 1E5SA 4LIUA 2JG8B 1EUTA 3WSOA 1VAVA 4MV2A 5A6YA 2YBSA 3OPWA 3GNEA 4U2AA 3VBUB 4QWNA 2VTXA 3WDWA 4XUOA 3VBSC 3U0ZA 4IEZA 5DQ0A 1A8DA 3N9PA 4N43B 4AGVA 1YO8A 2E6VA 5FTTC 1WCKA 1GUIA 3HNYM 5IW0A 3ES4A 3ZLIA 1HXS3 1LGNA 1ZM1A 4NPLA 4YVWC 5BPXA 4EZ4A 1RC6A 2R6QA 2A1XA 2R1DA 2VZQA 1OSGA 2VZOA 1GICA 4IEWA 1QNWA 2LTNA 2ES3A 4L9BA 3E6DA 4B7KA 2HWC2 2UY9A 4XFIA 3AKPA 4XOGA 3CHXA 3OG2A 1Q3EA 4RGGA 2ZA9A 4CYDA 4XF0A 1BMV1 4OULA 3WNKA 4W6WA 4EV0A 4CU8A 5FOJB 2QDNA 1ZNPA 1AR61 4QX7A 2RM22 5EJ1B 5F6LB 4LMFA 1KQRA 4BA6A 4AE2A 4DXZA 5IAXA 1OBNA 3OYWB 5LBCA 2B5HA 4EN6B 1OXCA 2JDPA 3E5XA 1W6PA 4JKKA 5EZWA 3HQUA 5A32B 4NWVA 1S0JA 4FXKB 1D2SA 2YHJA 3WG2A 4ASKA 4E9KA 3ACLA 3C7HA 2UWAA 4XF9A 5E6HA 4C0HA 1SFPA 2AH2A 3I3DA 1POV0 4FOYA 4RS5B 1UZVA 2VTFA 3WLUA 1LEDA 1QQP2 2A75A 2K0GA 2NZ9A 5T52A 4IEPA 2AYHA 4CPBA 1R093 4UBHA 3TRSB 4AOCA 3FZ3A 3H50A 4A42A 1NG0A 2AREA 1RUF1 3NL1A 3DF0A 2C4XA 3IDAA 3VKNA 4C0BA 3M3OA 3H8XA 3ZMNA 4GWNA 2BPA2 2Z4FA 1OHFA 1M06G 5FZCA 3AKRA 3MF9A 4EE2A 1O6UA 1TME3 2C9AA 4IUGA 1EAH3 4CEWB 2XKPA 1KJLA 4F83A 3EXUA 2Y0OA 1I6XA 1N1SA 4NVPA 3ZYPA 1UZZA 1ASJ1 4ZXEA 1I5PA 2JIJA 3O0WA 4Z82A 4XZPA 5EP9A 3HNBM 2PFWA 4UBGA 4YGDA 4JGZB 3ES1A 1O59A 1COV2 1W9WA 4QPGB 4QM8A 3HOBA 1BBT3 1QJZA 2W91A 1DGWA 3D5OA 1GWKA 1CR7A 1RYYA 4FQZA 4LLOA 4S2HA 5I0SA 3BU0A 1FXZA 5K0UB 2WLPA 4ORFA 4XDPA 2XH6A 3ATGA 2RDQA 3KLSA 3POYA 5FWEA 3N4MA 3U75A 1REDA 4E4HA 4CU6A 1RHI1 1N3OA 4JRLA 5IVYA 3VKMA 3WUDA 5C4WA 1RUJ2 4OI1A 2PHUA 3JB8A 4LHKA 4EN0A 2WNVA 4NIIA 4D69A 1DFQA 4PF1A 2ZTNA 1WUVA 4PDWC 5FLJA 1JOJA 4XCAA 4D8MA 3I3MA 2GMPA 2GC0A 1NZIA 2WO3A 2QE3A 5FP3A 5FZOB 1UOJA 4Q4X1 5F3IA 5IVBA 1MQTA 4OI4A 3I3BA 1QY4A 3ECQA 3D8CA 1UPSA 2XL7A 3I8TA 3QCWA 4HLTA 2AUYA 2YZ4A 2NPIA 3JUUA 3U4SA 5DXDA 3HJRA 4PBOA 3OOXA 2NYYA 5F5QA 3T4VA 4B1LA 1X8MA 1PZ7A 2P3KA 1I5ZA 1NA1A 2HKXA 3S5QA 1Q8VA 3OPTA 2A73B 4RQPB 3JBG1 4CDWC 4CDXC 3UGHA 1C28A 1GV9A 1B35B 2VZPA 3WD5A 4YZ5A 2MHFA 2ZOEB 4W65A 5ANQA 3M2MA 4Q1RA 2ZMLA 4UT5A 5FMBA 2OKXA 5IAVA 3MW3A 2YMZA 3VDCA 4FP3A 5FK7A 3PUAA 2VG9A 4L11A 3IB3A 3M3IA 4BQ3A 4M0HA 1WMXA 2XLFA 1UF2C 3JD71 1N3PA 4LBNA 1Y9QA 2VNRA 2ZMKA 3IIAA 3MI8A 1GZCA 5B4NA 1EYBA 1H4HA 1MZFA 3W20A 2KM2A 2V09A 3UL2A 3C7FA 1CVNA 2W47A 4DS0A 3O1UA 1NCQC 4LULA 3SXWA 1LODA 4EWAA 5L19A 1XNCA 2YDEA 2WINB 2HEVF 2ZHMA 3I4IA 2PAEA 3LDBA 1ND3B 2X53S 2FDFA 1QIQA 2RDSA 3KV6A 3FLPA 5FPXA 1R1ZA 4LE4A 1YCIA 2X09A 5FXVA 4BWOA 1RUJ1 1ZYBA 2F6BA 2LS6A 4CCCA 3M3QA 4PQQA 5IATA 4RHV1 1OD5A 4CCEA 2W95A 4Q0UA 1W6QB 1HW5A 2DURA 1LOFC 3R6SA 5IK5A 3AKSA 1KD7A 5LK7B 5EQUA 2R062 4XXAA 3W21A 1CWPA 3NV3A 3U4XA 3QACA 4JHZA 4Y1UA 5F5AA 5FXWA 2HWC3 1NYWA 1W8OA 3ELNA 3NNMA 1RUI1 4NO4A 4BMEA 2C0ZA 5JXGA 2WZR1 5IK7A 3VDDC 5FP4A 4IV1A 2DYCA 1AHSA 1APNA 4H7LA 4L99A 3ZN5A 5DAXA 5I8SA 4Q5OA 1IG3A 3WDYA 4LO5B 5L7OA 3BTZA 3ZSMA 2XUEA 4EN8B 4FPEA 2AEYA 4OUEA 3S7IA 5JOZA 4LHSA 4QKDA 2PTMA 3POBA 4XBQA 2VUJA 5EXOA 4AVTA 3OF1A 5ABJC 1OUXA 3D3AA 4LBQD 5JXIA 5FZ9A 1LU1A 3GBFA 3HBKA 1UQXA 4CRQA 2ZZQA 4X8NA 1QQP3 2I2SA 3SC7X 1PMJX 4AG4A 4AQ2A 4TLGA 3LIHA 1OUSA 1I1EA 2EIBA 1U0AA 1ULEA 3R05A 2XOMA 5C8CA 4AXOA 1GOHA 3MDPA 1EV13 1JYXA 1MS8A 2JB8A 3SMHA 1UL9A 3OTFA 5GLZA 3MLLA 3WDVA 4HVQA 4IV3B 3T2OA 4IEUA 2V5YA 4DIQA 1F31A 3KD4A 5KHIA 3VBSA 2E33A 2RS53 4WZFA 1WLTA 3W5NA 1LGBA 1D0GA 2YC0A 5ERLA 3RZMA 2PLV1 1SZBA 4XF1A 5KHKA 2ZZJA 2OVUA 4GKYA 1GOFA 3AXDA 4PF5A 5A7WB 3ZSJA 1PMIA 1YFUA 4OI2A 1TE1B 3QOPA 5FZAA 4IW3A 1W2OA 3GBWA 1R1A3 2OPKA 1LULA 4AEDA 3ZOIA 1LNSA 5FZIA 1W6PB 1LRHA 3BODA 1COV3 5A7OA 4QPWA 1Y4WA 2WLQA 2CYFA 2Y38A 5T5JA 4O61A 4QB2A 2I45A 3E97A 2O8QA 1VBA2 3DV8A 5IJRA 3B02A 4AI8A 5H9QA 2CV6A 3AMPA 3GZEA 4R9AA 1ZZBA 4AFCA 3AMHA 3DUIA 5FYZA 4C8DA 2DCTA 4FPKA 2V4AA 3LA3A 5FQ0A 3ON7A 4TLFA 2B42B 1GP4A 2BFUL 2WBKA 2P6HA 3ZYBA 4XFGA 4JV4A 4AI9A 4XIOA 3O5SA 3TAYA 2WA4A 5DUVA 2WS91 3VHRA 1UYXA 2EIEA 1QJX3 1KFUL 1AR83 5CB7A 3VBRC 3ZFEA 4ET7A 5KXDA 3GM8A 4Q8KA 2IXCA 1D0HA 1YQ2A 2B9UA 1H0BA 1UKRA 3OCPA 5FO7B 3Q9OA 2XBO1 2A3XA 4FTBA 1EY2A 3HN3A 4TYSA 3WDTA 1FOD1 1RUC3 4MGQA 5DAVA 5L9BA 1FAYA 3MFAA 4KI5M 5A3WA 1ZZCA 1W0NA 2WSVA 1RUE2 1FATA 4QQHA 4R9CA 4FXGB 3NJYA 3T1MA 4A2UA 4UFHA 2FQPA 4BIOA 2A6WA 3KMHA 4COUA 1YHFA 1Q8PA 4XHBA 4E4ZA 5C3SA 3MZHA 1MS0A 4N7UA 4XFAA 3ETQA 2VNOA 1D4M1 1NE4A 1CZTA 1GBGA 1UWWA 2ZX4A 3MIFA 2RR12 5FYIA 1J59A 4Q2FA 4W50A 2JKXA 5LASA 4DQAA 4KG0A 1HRI1 4JZRA 2ZGPA 2PHLA 3CBNA 3LEMA 1QMJA 2JDUA 2YV8A 3VHPA 3V0AA 3GCXA 4YFZA 1Z7S2 1NT0A 5C4WB 2E9QA 1LJ7A 2BZDA 2P6CA 1ENRA 4LKDA 3X29B 3H8UA 5D2AA 5J48A 4Z07A 3POIA 3GXUA 4KNCA 3LCPA 5AC93 3H42B 5CEHA 1L7RA 1JOBA 3H3ZA 4AFAA 3KHCA 4K1YA 1MQTB 1ZA7A 2VBPA 5EYXA 1TNFA 4MGIE 4PDWA 2ZEZA 3VKFC 1PHMA 4AF9A 4JRAA 1ND2C 3OGVA 1W39A 4G9SB 5J3UA 3RDIA 5FO9B 1ZBE2 3S0MA 1NA1B 5DG1A 4EZHA 4FPHA 2R063 3VV1A 2VNGA 5JPMB 2GNTA 4NRQA 1PGL2 4GB31 5JZGA 4LIVA 4L2NA 4FFIA 4P9IA 3AVRA 4NJ4A 1VALA 1KS4A 3BOWA 2W46A 5C3RA 5LBFA 3IAQA 3LEIA 1HB3A 1V9U2 4LOTA 4CDXA 1RUG2 1BK1A 2BVBA 1PO13 1MS3A 5FJKA 1CX1A 3WHTA 4KGGA 2GDFA 1XRUA 2WO7A 2GNMA 2QQNA 5F5IA 2ZGTA 2P5BA 3AYDA 2OUHA 4NPMA 4K21A 3VD7A 5FYHA 4MHRA 3CQOA 1XYOA 3FHAA 5LATA 2ZBJA 4A4AA 5FY8A 4CEYA 3O0XA 3AFGA 1NUKA 2HWD2 5F6KA 3T3YA 5DZEA 1RB8G 3RWNA 2BOJA 4KWKA 4XF4A 1AR92 3WG4A 1JZ2A 1G86A 2E53A 1PGW1 3ETPA 5GM0A 1NY72 5CFDC 1GSLA 2H0VA 2JKBA 4LE3A 1CD3G 2O8OA 4Z2AA 4ZZ5A 1FYUA 2DU1A 3PJYA 4I09A 2R042 1BXHA 1CAUB 1UPIA 3AMNA 3NKGA 5CBLA 5H9SA 2DU0A 5FPLA 1LOAA 1F15A 1JZ3A 3O0VA 5H9PA 2JJ6A 2NLRA 5E89A 1QJY2 1WLDA 4QAWA 1ZZ8A 4Y22A 1ZBA2 1SHWB 3IT8A 1LOFA 1WW5A 1FI2A 1ZRIA 2BUKA 1OQEA 2R7EB 1PVC3 3I3EA 1ZBE1 4IV1B 4Y4RA 1LGCA 3Q8FA 4GALA 4XACA 2QQOA 2P37A 4N8MA 4QX0A 3VD5A 3ZXLA 4PLNA 3ACGA 5AVPA 4AI3A 1CX4A 2ZGQA 3USUA 1UU6A 3K4ZA 4HN0A 4YVSC 5T54A 5KBFA 3H9AA 2WAOA 2FMYA 2UU8A 1HRV2 2W1SA 4O65A 3VDDA 2D3RA 1W03A 3ASIA 1YXWA 4E4SA 1HDKA 3M3CA 4BISA 3Q8CA 4Y33A 4UW6A 2J42A 1R082 4GQ7A 4LK7A 1OLME 1HB2A 3ILNA 2ZEXA 3G7DA 4HFSA 4DY5A 4XCBA 4Q4V2 2EIGA 2X29A 4AEMA 3LSEA 2E7QA 1RINA 3H3UA 4B4QA 5C8CB 3T2PA 5JCTA 2VZSA 2GC2A 2VW1A 3KF5A 2RS13 4ZXKA 3AL5A 1CPMA 5A3LA 2JIGA 2JB4A 3AK0A 3NNFA 3GDBA 1IKQA 5FZ7A 3VBSB 2K2SA 3VZKA 3IDBB 3SKVA 1OPOA 1Z78A 2ZHLA 3BGAA 3UV9A 5F5CA 3HIFA 3KT7A 4NUBA 2VVEA 3DCQA 4D6SA 2PHDA 4O7XA 4P9JA 5FZBA 5C9AC 2JG9C 5FP8A 3BB6A 4OLLA 3DGTA 4QB1A 5JOYA 3EYPA 3OUIA 1RUE3 2KD7A 4NHYA 5GLVA 2VCMA 3AZXA 4AEDB 5JOXA 5LEKA 5FOBB 2P2KA 4N53B 3RZGA 1O8SA 3PUHA 3I2OA 3V0BB 5L73A 3NV2A 1W06A 3CEWA 4LO6B 1F4AA 4F3JA 4FPFA 1POQA 4XYXA 3PL0A 2ZHNA 3ZXDA 1ZZ6A 2X5IC 4RFRB 2RR13 4IE6A 4XDOA 3ZN4A 1RIRA 1W8UA 4DZGA 4IERA 2ZACA 2HWE1 3FFZA 5JSPA 3N9LA 2D6OX 3WNXA 3WW2A 3LDKA 5FQ0B 2KR2A 4NMIA 1W6NA 1KDMA 1O4ZA 1RUD1 1PX4A 3VKOA 1R092 1UO9A 1UYYA 3NJVA 4XBLA 2IXHA 2FDHA 2ZGOA 3OGGA 4MYEA 5IYYA 1HJGA 1XBFA 1AYN3 1R081 1H9PA 4ZS2A 5FBZA 3IKWA 2VVDA 1WD4A 2Q8EA 3ZFEB 1XE7A 4AYUA 1G9CA 1JI6A 2DBNA 1Y9GA 5EJ3A 4RGKA 3MEPA 1PZ8A 3E5UA 3FMGA 5FYSA 5FKBA 4CDQA 1BKZA 1TME2 3AMQA 4RR3C 5LK5A 1L7QA 2WN2A 2LUWA 4FPJA 1Q5OA 1HQNA 1HXS1 4XUTA 5DDJ1 4IEYA 4KQ7A 4HT1T 2OT7A 5FAXA 3VBRA 1DQ0A 1G9AA 5DAWA 3WXPA 1E57A 4BLJA 3RWKX 4QXBA 5FYUA 3WUCA 1ZZ9A 3NMBA 3S5AA 4DY3A 2ZCWA 2I74A 4YM1A 2IC1A 4HSJA 3BPSA 3NWKA 5EV7A 4D3WA 5JMOA 2PQQA 5K4LA 3RMYA 1DZTA 4Y4YA 1SFNA 4M4PA 4QQ2A 1V00A 4NIHA 1BBT2 5FK8A 4X6RB 1Y7BA 3WP5A 2NM1A 4XJWA 3J4UH 4L8QA 5F3CA 4JKMA 5JDBA 2BJSA 3IPVA 2JX9A 3W59A 5KHHA 4Y1VA 1V9U3 1KXGA 2L9LA 4Y5Z0 1RUG3 1VBD1 2Z2SB 2C1FA 4CA9A 2WN3A 2WO2A 4S2DA 3WF2A 4J1XA 2HWF1 4TWTA 3W9AA 4E8CA 3THDA 3WCRA 1UOBA 4BDVB 4QHZA 1FV2A 4BK4A 4DRVA 3HAGA 4QGMA 1OA3A 3T1LA 2BGCA 3MUY1 4IETA 3ZDVA 2HWD3 4P9YA 2IZWA 4OMCA 1R091 3ILFA 3BKZA 1AR93 3P1IA 2ETEA 1MACA 3KHBA 3I97A 1Y3TA 2QQIA 4XMAA 4UI9L 5SV5A 1JW6A 2SBAA 4RN5A 2WA3A 4PLMA 3WW4A 5F37A 2XDVA 5B2GB 4BZ4A 2R043 3ZM8A 1HQWA 4GZ9A 4IE0A 4LA3A 4WVMA 2DFBA 4NRMA 1JHNA 4HXCA 1EAH1 5KXBA 1K12A 1RXFA 3H0OA 1CZSA 1NOVA 3MBWA 2DDUA 2YGLA 3N36A 5EYYA 3S7EA 4CP9A 5JZGB 3LAGA 1QJY3 4I02A 3OBZA 3H1YA 5LW9A 1W8TA 1ZBA3 1QGLA 2YPJA 4AFMA 2R49A 4BU2A 3K77A 4FFGA 5IHRA 1AXZA 1ND2A 5GZFA 3TEXA 4WM7C 1O7FA 2XG3A 4HKLA 1SFYA 4ZU7A 2X8KA 3K48A 2D5HA 1VRH2 2XLGA 1IG0A 3B9CA 4LORA 2WT0A 4Y24A 4IGPA 1JN2P 2WRAA 5CAZA 2RV9A 3W5MA 2WFPA 2DVFA 5JAXA 2PHTA 3DPRA 1HRV3 2ZXQA 5LA1A 1AX2A 3OEBA 4CEYB 1JUIA 1OF3A 1YFYA 3SH5A 4COWA 1TMF3 4KL1A 1NLRA 1AXYA 1YLLA 1YIFA 2VCBA 2QQWA 3MPPG 4Q4V3 4BQ2A 2DVBA 4GH4C 2G9ZA 5GZEA 4FBFA 1ZRDA 4Y5TA 1N3QA 5GALA 5C6CA 3A7QA 3O1VA 3LQCA 3OY8A 1K42A 2XJSA 4HSLA 2DUPA 5DAPA 1QOOA 4UF0A 3MPBA 4QXKA 5FYCA 3THCA 4D0QA 4DXSA 2QDRA 3K4DA 1PK6C 3ZYHA 1H4GA 4NWWA 3PIJA 4DFSA 4I2OA 4FSJA 1VE0A 4F8AA 5CFDA 2C24A 3R4UA 3WY6A 2RMU3 3KVAA 4OHVA 4Y22B 5H9RA 3RYPA 3NJZA 2CGPA 3ZIXA 5FXZA 4D6RA 3VBOC 4EN7B 4FI9A 2FDIA 1S0FA 2IUWA 3TB0A 4EYUA 2DF7A 3WQ1A 3BU7A 4MLOA 5JSRA 3FX3A 1WBFA 2XWJB 5CFCA 4V1PA 2B8MA 3K75B 1C5HA 5EJZB 2JECA 3ZYJB 3HBZA 3USUB 2LM3A 3UT0A 4FCAA 4OHXA 4W6XA 3MIEA 2VM9A 3VDDB 4Y3OA 4CUGA 5FPAA 3AXEA 5HXMA 4FP2A 4ATFA 4U36A 4JDMA 4X8PA 3RFRA 1VRBA 5IVFA 1SLIA 1JS9A 3BUCA 1LCLA 2OXBA 4ARYA 2ZX0A 3AP5A 4BQXA 4FOQA 4YVSA 3T2TA 5KWRA 2WNUC 4J25A 1BZWA 1AX0A 4BE3A 4KU8A 1UYPA 2BOIA 3PU3A 3LF7A 4GA9A 2RJ2A 2VOTA 4LQRA 4ASLA 1JBCA 3RZKA 2VZ3A 3TYJA 2MEV2 2XVGA 3TNPB 3BI3A 3MF6A 1EV12 3ZO0B 4XUQA 3ME2A 2QQMA 1F4HA 1QJFA 1QXRA 3LOIA 1MVQA 3IWZA 1O91A 4B8EA 3FWEA 2P3YA 2B39A 3GF6A 1DU3D 1DG6A 1NKGA 2JXAA 2RJKA 3QBQA 4LR4A 4MGSA 1HB1A 3VKLA 3WX5A 5K7PA 2RS52 1ONAA 2OA2A 2YG0A 2J1VA 2QQUA 3POJA 4KWUA 1G9DA 3J9SA 2XONA 1JODA 2B7YA 3WR0A 1DDLA 1RJ8A 2GAUA 3N35A 1DYPA 4AGRA 1SLCA 2ADEA 3CU7A 2VZTA 2VE1A 2TUNA 3MW2A 4MVTA 3LWCA 1MS9A 4JGYA 1K5MC 2WWSA 3WEZA 3OBAA 3I2JA 4OHWA 1VP6A 4BIFA 4PIXA 1R1A2 2HWC1 5I0RA 1LOEA 4CUBA 1H1IA 1GWLA 3WV6A 1UX7A 5C9AA 2JG9A 1SMVA 2D6NA 3PIGA 1RVF2 2WZ8A 1V0AA 1UZWA 1Y9MA 3FUOA 4GWIA 5LBBA 1HLCA 2RM21 3LA7A 3MIHA 3C3VA 4M3CF 2A6YA 1BK0A 1CGPA 4I0WB 1LTEA 2WFF2 3POEA 1W6NB 4YNIA 1XPWA 5FZLA 5A7QA 4MXWA 2PELA 4CCDA 2E63A 3C7OA 1CJDA 4XJ9A 3MFCA 1W9TA 4R52A 1OT5A 2E7AA 1LESA 4MO3M 3LD8A 2D3PA 3CJXA 3ZXGA 5FWJA 1QJX2 3TEWA 1AR82 1QQP1 2VW2A 4NN0A 5JR7B 3B9IA 5LA0A 5FUPA 1ULCA 4CDQB 3HEIA 3ACIA 2RVAA 2E31A 5LB6A 4YLZA 1H2KA 1UW8A 3O12A 2D6LX 4LBJA 2AACA 4P9GA 4TSVA 4YW5A 3CJIA 5FP9A 4LKEA 3SEPA 1XSQA 2VZVA 5IFTA 4BQWA 2P3JA 3ZSLA 1RUC2 2ZEWA 3POSA 4I30A 4XJ8A 1LR5A 3RJRA 4LO8A 1S0BA 4IQPA 2GH2A 1E5IA 3PURA 4BQYA 3FLTA 5FY5A 4K40A 4RR3A 2CSGA 5J36A 3NW4A 3UKVA 2QJVA 2F4LA 2VZ1A 2VMIA 3DXTA 1YQ8A 4RFT0 1SLBA 4QX2A 5FUIA 3TBDA 2FDKA 4HG6B 5KC6A 5DMYA 4URAA 4KG8A 4BQ1A 3IPVB 4DEQA 1CAWA 3SCGA 4W6YA 1F2NA 4P9XA 1WMFA 1QOTA 2OQ7A 1XC6A 4AVAA 4BCUA 4DO0A 1KDKA 5A6XA 3MHZA 1US3A 1TG7A 4SLIA 1VRH3 1U5YA 1C4RA 1COV1 1GQHA 4META 1XNDA 4I01A 5D8AC 1UY2A 2CGOA 1VBE2 4AW7A 5F1RA 4RD7A 5FYTA 4Q8LA 1AZDA 1BLZA 3J7MA 1NCRC 5D21A 5I0UA 2E51A 2F4PA 3TWIA 3J8F2 2JWPA 1AR63 1PMHX 3WP4A 4K9SA 2WT1A 4BM8A 3GALA 5AC92 1KGYA 2HH9A 3PMSA 4PJYA 1C8M2 1P8JA 2XMLA 2YB7A 4Y5SA 3ZFFC 5IVJA 1DGRA 2PQSA 4IEXA 4IXLA 2VXJA 3ZYFA 4WVMB 1D4VB 5HV0A 1YC61 5JIAA 1I9RA 4C90A 1FNZA 1QXPA 2XUMA 4NR1A 2JG8C 1SDDB 1M4WA 2BNNA 3ZN6A 4IDZA 2XR4A 1RUC1 3VBUC 1WLWA 1WA6X 1JMUB 5J7MA 1QEXA 1RUF3 2ENRA 3VBFC 1ND2B 3I2IA 4N43C 5DPNA 2UY8A 2B4KA 1RUH2 2ZAHA 4GXLA 1OA2A 4YRDA 4ATEA 3O1RA 1MEC2 4B3NA 2DCZA 5IVCA 1NAEA 2JDKA 2WDBA 1Z0HA 1MS4A 2K46A 2YC4A 3KS7A 1RMU2 2JE9A 1PO12 5FUNA 1OLQA 3ZVXA 1SBDA 5DUXA 3DPRB 1VBC3 1OKOA 4CDUB 4OMDA 5FZGA 2GC3A 4OHZA 2EAAA 3N7MA 3C8XA 3PDQA 1GWMA 1W6MB 3AZYA 1UY1A 2DV9A 1OMIA 4YWAA 3KM5A 3CZJA 4I3PA 4LEJA 2WC2A 4UAPA 3VGIA 5CYYA 4LTAA 1S2KA 2XL9A 4QD2A 3OY8B 2QUOA 5A3TA 4YW6A 5C8WA 1EPWA 2MEV3 1DZQA 3WP6A 1XJAA 4QPIA 4RYDA 3A0NA 4M4RA 5FZ4A 5AC91 4B4RA 1ENSA 1LENA 2PA7A 4RS5C 5CFDB 1GKBA 3AP4A 2VZUA 3TOJA 2DVDA 4GH4A 1OVSA 1W2NA 1WBLA 1HN1A 2G9GA 3KZ4C 5BNNC 2VBDA 2ARAA 3A0KA 3ORJA 3PVOA 4QXCA 5A70A 4COVA 1UZYA 3OGRA 1AL22 5CA6A 1PX3A 1UIJA 3V56A 1PK6A 4Q29A 4WV8A 3O1OA 4UFKA 2DUOA 5CFCB 3L2HA 1W8HA 1A3KA 1PVC2 4YVWA 2D6PA 2OUJA 2R061 3UYJA 4QHOA 3ZR5A 1O4YA 2CU5A 2Y6KA 4QKFA 1PNGA 3SCFA 1XQNA 4XQDA 5FJHA 3FC0A 5HXVA 1SACA 5A7PA 3VBOA 2EXIA 2VMDA 4CEWC 1GQGA 4LBQA 5I0DA 2RHPA 3F95A 3UJQA 5LZ6A 5DAQA 3RQ0A 3GHMA 3KF3A 1RVF3 1IS3A 1X7NA 1PO11 4ZHNA 4YVSB 1PO22 1FMD2 4QDSA 5F7UA 2VXRA 3OUHA 2GMMA 2WFF3 2F17A 1J1TA 1YYNA 4FPYA 2Y0IA 2ZEYA 3UJOA 1W28A 1J3RA 1V6LA 4OUSA 3O1TA 2BWCA 4WZCA 2R0HA 5KXEA 1FV3A 1ULOA 2BYVE 3OGSA 2Z42A 1SPPA 4YG6A 5FZHA 3I2HA 5F3GA 3ZFGC 3N9OA 2RS12 5LRRA 3WP3A 5KC5A 3KGZA 2TEPA 2WNUA 4QGLA 3DL3A 5JR2A 1VAMA 5LWBA 1MPXA 2LROA 3LPGA 4P00B 3JD73 3VBHC 2ZX3A 1UAIA 5FZEA 2VOVA 5A1FA 4KWLA 5HPOA 2FHRA 1O4TA 4QU1A 4NOTA 5JLVA 1H1MA 4FQ4A 1QXJA 4BPZA 5I91A 5M0TA 1OFNA 1XU1A 3B7MA 4COYA 1YJKA 1UOFA 2HWB2 2VR4A 1QF3A 1XOYA 1H6XA 2QQPA 4XAEA 4JGYB 3S6PA 3A4UA 4LLFA 2CAUA 3L9JT 3EQEA 4CCKA 3B5LB 3PHMA 5E8AA 1GFF2 1JYWA 2BEOA 1AR73 2DTWA 2DVGA 2JG9B 1PVC1 4P02B 4HN1A 1UN1A 2W87A 3QH7A 4JTOA 3B69A 4KGQA 4QX3A 5DUWA 3WOGA 4AI0A 2JDMA 4Q4Y2 4YARA 2QQLA 3IIIA 1K5MA 3ZIWA 2FCVA 3KCCA 3RNSA 3I3QA 4XMIA 1ZRCA 2Q1FA 1UZ0A 1N47A 3KVBA 5J96B 4I0BA 1BHGA 4NIDA 2XLAA 1S2BA 4YZ4A 4LOSA 1CQ9A 3RZLA 1VBE3 4NIAA 5BV6A 1VBA1 2FDJA 2A6ZA 3JB4C 1AYN2 1XB9A 2R072 3PNAA 1YQ6A 5CKMA 3LPFA 5C3QA 1ST8A 2RG4A 2WNVB 2WUHA 3HNMA 3J8F3 1HQLA 4L92A 4YG0A 2EVXA 3ABZA 4YSFA 3ZYGA 3S30A 3CKHA 3OUJA 1F5JA 2ZGNA 4MZUA 3WCSA 1S2EA 3N7JA 1WW6A 3CJIB 4IGQA 3P5BA 3VLBB 3NJXA 2XJRA 3EJKA 3VD4A 4Q4W3 2YBKA 1C8M3 3ZKUA 3C7EA 1LHWA 4JX0A 2J1UA 4MHUA 5EHDA 5A1AA 1W3XA 5LY1A 1HIXA 4LO7A 4QU2A 3I49A 4RR3B 3UNPA 2GC1A 4XFFA 4A3ZA 1GLHA 2JE8A 4OHYA 4DXRA 1ENQA 2P4EA 1LECA 1XNKA 3P3PA 5E1RA 3SLIA 2XJPA 2QVSB 1PIV3 2IVJA 1N1YA 5A3OA 1J84A 1CAWB 2W68A 1RUE1 1RUH3 1VBB3 1X33A 4CP1A 1GZWA 3ZSKA 2WWJA 3L2YA 1MEC3 4GWMA 3APBA 3LB9A 2R1BA 4FPGA 4CDWA 1DYOA 1NZCA 1UY4A 1RMU3 4L97A 1O3SA 2GU9A 3Q8AA 4OQ9A 1LOBA 1OLRA 4C91A 4HL0A 5BNQA 1TQ5A 5FMDA 4LA2A 4IE7A 3LZZA 4Z1VA 2VQTA 2RR11 3GJBA 4YW4A 4PIYA 2QCSB 4N9IA 2YXSA 2YGMA 1W99A 3HWJA 5FY4A 4AAXA 5D8AA 1AUYA 2VAUA 3CNAA 2DWRA 3WF1A 4A6OA 2W08A 3WINE 2FZ2A 4BQ5A 1AL0G 1Z7S1 3LFIA 1AYN1 4XZUG 2CWSA 4YGBA 1NCQA 2YYOA 1NCRA 2ZKNA 4LHNA 1TZOA 1JU3A 4XE9A 4IEVA 4N9HA 4QMAA 3RI8A 5DZFA 3H8OA 3CIHA 1X50A 5CIRA 5FXXA 3WQ0A 5C7GA 4P14A 2QFEA 3HN1A 4XBNA 3ZN6B 4BOWA 5I0TA 1KJRA 2GSYA 4SBVA 2D97A 1HX6A 5C5TA 2D5FA 4MSVA 5A3MA 1OF4A 2B9VA 3ZFFA 3K3OA 2WKKA 4TN7A 5T5PA 1AL23 2W2IA 1JYCA 3Q8BA 4XIKA 2JG8A 2UWCA 2Q1MA 4XVHA 4P9LA 3OEAA 5FPZA 2ZX1A 1H2LA 4IV3C 1EPZA 4MH0E 4GJZA 3VBUA 1PGL1 3KCYA 2XBO3 1WCQA 2PAKA 3PLQA 2W1QA 2WZEA 3VBFA 3PUQA 2GN7A 4IEQA 1Q8OA 4N43A 2WNEA 4XTMA 5L7OB 1Q56A 5FV3A 4KU7A 3JCIA 3SKJE 3MW4A 4NROA 4MXVA 1V70A 1V9U1 4GMP3 1RUG1 5ANNA 3UGGA 3TN92 3WW3A 1C3HA 1PO23 1TMF2 1FMD3 4XEZA 3ZSEA 5J1XA 3ENRA 4IESA 5KR7A 4LXLA 2BW8A 3O1MA 4NHLA 4FAHA 3URFA 2JEMA 1DQ1A 1SG3A 3ST7A 4UFMA 5BYNA 3VHNA 4D6QA 2BNMA 4MGKE 4E27A 1ULDA 1KS5A 5JXJA 4QPIB 5ABJA 3PVEA 2HWD1 2BRTA 5DZGA 2P3IA 4Q1PA 1AR91 1DYKA 1HRI3 5SV8A 2I07B 4GH4B 4Q26A 3BVCA 3THTA 3OYWA 4H7MA 4AK3A 2IFRA 4V2VA 1NY71 4QT6A 1VB2A 5CFCC 2BP6A 5I8TA 2RMU2 1GYKA 2YY1A 4LPLA 3DYPA 4JHTA 1YJLA 3JZVA 3V65A 3WNLA 1REFA 1ZRFA 1PK6B 3BIWE 5FZ0A 2R041 2EXJA 1QH6A 4YVWB 1O3TA 2FD8A 1PGSA 2HWB3 4RS5A 3OJBA 1H8TC 3LIGA 4QGNA 4LUKA 3J26N 5A7NA 1DIWA 1U5XA 5BNNA 2HEYF 3EBRA 1JUHA 1QJY1 3VBOB 1E5RA 4LBQB 1ZBA1 1QHDA 3CF6E 4FVVA 2ET1A 1ULGA 4Y20A 5FZMA 5GLUA 4AEKA 4OQ8A 4XUPA 5JVVA 4Q4Y3 1DF0A 3W58A 1SLTA 1XYNA 1Y43B 2WABA 4I0AA 2OX0A 3E5QA 2RS32 1O5LA 3N9MA 3E1F1 4AHZA 2D3SA 4YYOA 2GNDA 3T09A 2W94A 4N90A 2BDRA 1CESA 2P17A 4ES8A 1HRV1 4PBPA 1OFSA 3BTAA 1REEA 1F5FA 1BVP1 1SPPB 3GZAA 4QB6A 4XJZA 2R0FA 5BNOC 3TEZA 2DBIA 4INDA 4YM3A 2XVKA 2ZGRA 4MGYE 5HCBA 3AYAA 3ZXJA 2R073 1WGPA 4MUVA 1S0IA 2BNOA 4Q4V1 4GWJA 1GP5A 1AX1A 1V6JA 2Q0AA 1QJU2 1GNYA 2VO5A 4XFCA 5FZ1A 1LKNA 1SCRA 2LALA 5LY2A 1IPJA 4EWDA 4QDRA 3ZFGA 4ZU5A 3U1XA 3U11A 1G9BA 2OQ6A 3BALA 3H7JA 4XC9A 4ZPIA 3WDUA 2D98A 4LBOA 5CZKA 4IE4A 3VBHA 5FO8B 4Y26A 2RMU1 3ZMOA 1ULPA 4K3UA 5JI9A 1YI9A 3HR9A 3T2QA 2R30A 1YFXA 2EXHA 2LW8A 4GIQA 4KWJA 4YGCA 3T4HB 4M3CA 4AL9A 4TXWA 3ZXFA 2VUAA 4ISQA 2J1RA 2D93A 3ZKYA 3ZDSA 2MNGA 3ZX7A 5JIUA 2SLIA 4EROA 4B7EA 1GR3A 3AMMA 3RZJA 2Y64A 5CKNA 1V6KA 1NA1C 3T0AA 5FPUA 3KSCA 5GZGA 4CXWA 2UYAA 3CDZB 3T30A 4ZKTB 2X05A 1AYM2 2XQRA 3V0AB 4LHLA 1WLCA 4EN9B 3QH6A 2XJQA 1NQJA 3ZXKA 1HN0A 2PAMA 4AI2A 4CCLA 4JQRA 5F39A 3HT1A 2QQKA 5FCCA 1A8MA 1FX5A 5ACA2 1S0EA 3NSTA 3PUIA 2ZGUA 2VH9A 2EIDA 1CIYA 4JCKA 1JZ6A 3TEYA 3LFMA 1X36A 4Y1ZA 1K5JA 4YW3A 4CCOA 3WHUA 4CTEA 5FKCA 4BYYA 1W3VA 4PDWB 4GD4A 4O9GA 1W8FA 4R9DA 4WM8C 3RVHA 1C1LA 2GH8A 1TME1 1AF9A 4P5HA 1YRZA 3T08A 4JAAA 4D7YA 4AAPA 3THPA 4AZZA 1IGOA 1ZREA 1UIKA 4YZ1A 1T6BX 2VMHA 2XWBB 2W9XA 4YG3A 1XU2A 5A33A 4E8DA 2TNFA 3BYWA 3H8RA 4CCNA 2Y6JA 1RL3A 1H2NA 5BY5A 1JZ4A 3VUOA 3WQ7A 4BK5A 4CDWB 2XJVA 4CDXB 1OC1A 2CGNA 2J1SA 2W92A 3I7DA 3MICA 1ODNA 1XXNA 4XFBA 5BNPC 3WVJA 1SEFA 2ARXA 1DGLA 1PVXA 2DUQA 2FCUA 1GNHA 2ZGSA 3EO6A 1GMMA 3VL9A 2XXZA 3R4DB 4XETA 2BVVA 2Y34A 5C70A 1BBT1 1YI7A 2Y6FA 3ALQA 4QXHA 5JUVA 3MLJA 4B1MA 1POV3 1BMV2 2UYBA 3IN9A 3WDXA 1WW4A 4OCTA 2VCAA 5DG2A 5I93A 3ILRA 3CMGA 3WG3A 1AR62 5D8AB 5G05L 3TN93 5J98B 1DZRA 2Z69A 3FHQA 1IQAA 1DLLA 1XSRA 4AHYA 3HQRA 4CUAA 5IK8A 2C5DA 5T5OA 3HD8B 4Z2WA 1NCQB 3WF0A 2VTXJ 1G6NA 1DQ5A 1ZVFA 2VUCA 4Q27A 3SISA 4BMBA 3AKQA 2EALA 1OD3A 3U10A 1HB4A 4FPOB 3AVSA 2JENA 1D7PM 4AVBA 1D2QA 4M0NA 1DP0A 3Q8EA 2D44A 1IQDC 1GOGA 3FN9A 3ZFFB 4WVVA 3IZOA 2CL2A 2IFWA 2ZGMA 5IVVA 1RUF2 2G4IA 2VU9A 3SHRA 4D7SA 3AZVA 2H6CA 3JU9A 4E2SA 1FPN3 4F7ZA 2A3YA 2HEWF 3GYDA 3WNMA 2HLEA 4WBBA 1SDWA 3ROUA 4FFHA 5T3NA 2ARCA 4B4PA 4DEVA 5A1LA 4HPKA 2IXIA 1BQPA 1QJEA 3VBFB 2VMCA 3P6BA 2JD4A 4LKFA 4FAGA 1VBC2 5DDJ3 4YW2A 1ODMA 4CPBD 1A6CA 2G19A 5BUVA 4Z92B 1ASJ2 3O1SA 1YNAA 1WW7A 4IV3A 4JTNA 1VRH1 2GN3A 4AVSA 5I8YA 4MOAA 3WZ1A 2RS33 4AEDC 4ZZ8A 3RYRA 1DQ4A 1W2AX 3MLKA 3PU8A 3GJAA 4N53C 1HV0A 4XABA 5DUUA 4A7ZA 2WQ4A 3MV01 2VOWA 5A7WA 2OPWA 5ABJB 4NE9A 4D94A 2CDPA 1W8NA 2XJUA 1C8NA 1BEV3 4UW5A 4XUNA 2GALA 3VDAA 3ZYRA 4HMZA 4UW3A 1VBD3 2HBTA 5FMCA 4QX8A 3J7LA 5F9TA 1LB2A 4J1WA 3UESA 1QJU3 1VIWB 5CISA 2FDGA 1NLQA 2HWF3 1RHI2 1RXGA 2BWAA 2Y6LA 1VMJA 3N7LA 1O3RA 2DCKA 4AGGA 5FY0A 2UWBA 2VC9A 4P9WA 1V6MA 4G3YC 1O3QA 4XJUA 4BXFA 2EA7A 3NQHA 5FMOS 3ZFEC 1R64A 1WMDA 4GULA 5BNNB 1OOPC 1W8ZA 3TNQA 1IZ3A 5FIXA 2VJXA 3BIEA 4HK9A 4LJHA 5EIYB 3AP7A 4Q4X2 2ORZA 5FP7A 3NAPC 4Q0SA 2D43A 4Y20B 1BYHA 4CVUA 4OZXA 5FYMA 1H8TA 2EICA 4M3CE 4A7YA 2WYFA 4NIGA 4R8HA 4N7IA 1ZZ7A 4BHPA 5HI0A 1US2A 1IPSA 2Q1ZB 1GNZA 1VBC1 3OSDA 4OFGA 3JBG2 2VCCA 3FJSA 4QHBA 1JZ8A 1O5UA 1S0CA 3AKTA 1AYM3 2E32A 2V5DA 3MO4A 1VB4A 1VAKA 4QPYA 5T5LA 3F2ZA 5C33A 3BTYA 1LOCA 2X5IA 4GJYA 3H1WA 3VZJA 4DRRA 1OA4A 3EMRA 5ACA3 4ZONA 2Q4SA 4H2AA 1YIPA 4AQSA 3JD72 4BB3A 5FR3A 1X8EA 1QNYA 1EUUA 3DYOA 3NNGA 4M01A 5FLHA 5HV4A 3ZFGB 5BNOA 1B09A 4K6BA 3RRDA 2MEV1 4DMIA 1EV11 1GZ9A 4HONA 4UW4A 2AEZA 2PXJA 4CP2A 3B00A 3E6BA 4R4XA 1BCXA 3U07A 5IT6A 5LRSA 3VBRB 3CL1A 3VBHB 5KHGA 5C3PA 2AGSA 1XE0A 3AYCA 3K51A 3I2KA 5T55A 3RI9A 1DBNA 2O14A 2RS51 1W0PA 1O8PA 1JOPA 2OZ6A 3LDRA 4JDNA 4UYBA 4AQ6A 5A80A 2BU9A 3G6JB 2Y8KA 4LKSA 4M3CB 1U5IA 1AR72 1W6OA 2HYKA 4AHWA 5HBAA 4RHV2 3FHIB 1AJOA 1IS4A 1WCSA 4A44A 1H30A 1YQCA 3BTXA 3A23A 2VMFA 1KRIA 1NE6A 2ZGKA 1CJPA 1R1A1 5LA2A 1C5IA 5JPNB 5L36A 2VPVA 4FFFA 2WO1A 1A78A 4IL7A 4UXAA 5C5UA 4QX1A 2Z5WA 1VLNA 5JZGC 4HVRA 4OUMA 2O0OA 3ZXEA 1RUI2 1RVF1 4H14A 5GLWA 1F9KA 4GKXA 3INAA 4KMQA 1YEWA 1BVVA 3NNLA 4QQLA 1OKQA 1FNYA 2WZR2 4XQ4A 3WNPA 2CWMA 3ZYIB 1CN1A 1EP0A 1QKQA 4R9BA 1YFWA 2KXLA 4QDQA 1DLCA 4XPVA 1YUDA 3VB9A 4BLIA 4K8RB 2WFF1 1HKDA 5LCWL 1STMA 4KBZA 3MIGA 4YFWA 5TSWA 5J37A 2EF6A 5FRAA 3AZWA 3JQXA 3D0SA 1UY0A 2FCTA 2GMEA 3MV11 4Q4W2 4YW1A 3KQRA 4CEYC 1QJX1 1VMHA 1AR81 5BXXA 2CDOA 3OD0A 5FY9A 4EWEA 4PCRA 3C7GA 3UETA 3K4AA 4PI2A 1AJKA 1QDCA 1TEIA 2V73A 3A21A 5AFEA 1H9WA 1HV1A 2QZ2A 2A6XA 3M8LA 5FZ8A 4CP9B 4AWDA 5A33B 3I2DA 4QQPA 4XAAA 4A45A 4W4ZA 5FYVA 4ISRA 5T50A 1PIV2 4E2GA 4I3GA 4WM8A 3FFQA 4QM9A 1T6GC 3PVBB 5FZFA 1VBB2 2Q5TA 2JICA 2YFZA 2BTVC 3C2UA 1AR71 5CKQA 4MX3A 2VECA 2WIIB 3OBRA 5FY7A 4FT8A 5JSOA 1JTZX 2VOKA 1NX9A 1WCUA 1IHMA 2D6KA 2J1TA 3B93A 2XHNA 1CAUA 5IK4A 1S4CA 2E26A 4WM7A 2PHWA 2PLV2 1I3HA 1K3IA 2P34A 4CXXA 1ASJ3 2B46X 3R4SA 2QBXA 5FFOC 3QD6A 2GP3A 5BNPA 5A3UA 2WAAA 4A7KA 1WWYA 2W39A 1DGWX 1DQ2A 1S55A 2XKOA 3FBYA 2IXJA 1VBE1 1MR5A 2J7MA 4JKLA 1G9FA 1KEXA 1MZ5A 3EB7A 5F3EA 4XTPA 3RS6A 1NXD1 1XNTA 1Q8SA 3BN6A 3J8F1 4UF0B 2RM23 5CG8A 4HK8A 5F2SA 2VZRA 1CAVA 4CCJA 4J6GA 1VPHA 3KCXA 3OB8A 5A3PA 3B01A 4XDQA 5E88A 3WF3A 1LHVA 2A7AA 2PN5A 3MYXA 4Q4W1 1C8M1 1NXMA 2XB6C 1RHI3 4A3XA 4PLOA 4E4DX 1UNBA 2ARBA 5FPVA 2WS92 2BERA 4PHZA 4XXPA 2VY0A 4E2QA 5HCHA 1LAJA 5C71A 3N7KA 4DPNA 4H3WA 4OYUA 4BH9A 4HPKB 1PZ9A 1W9SA 3O14A 1IKPA 4R4ZA 1KITA 3WW1A 4YZ2A 2G1MA 1PIV1 2XBO2 3RMXA 1OVPA 1PNFA 4O9EA 4Q4X3 1F35A 1K45A 1RUH1 3FE5A 1VBB1 3NKTA 1FOD2 2PHRA 3BCWA 1LHOA 1MEC1 1S1AA 2IVIB 2VULA 3KT4A 4K7JA 3VHOA 5AFBA 2GZWA 1RMU1 2OYZA 3AX4A 2CTVA 2BGPA 3BPZA 4P08A 2A70A 2W1UA 2R16A 5HCFA 1PM7A 2VQ0A 1GP6A 2P1BA 3JBG3 4AHXA 3RZHA 4JGZC 1J3PA 3HQXA 4K20A 4OVEA 1D4M2 5CG9A 4BQ4A 4QPGC 2C9KA 1JHJA 4AEJA 5DABA 2WL1A 1YQ5A 3PTYA 1IS5A 1V6IA 3ZPYA 2NQYA 2XPJA 4DUWA 1HRI2 4YPJA 4N53A 3NO8A 5K0UC 3DKWA 1QU0A 5APAA 3V0BA 3LGRA 1OLMA 5K8SA 5IUQA 3SNMA 1RJ7A 4UWDA 2XGXA 4XQWA 4IGOA 3NNJA 1S0GA 1VMFA 2ZJCA 4AFBA 2ZHKA 5L9RA 3ZXAC 4CZSA 5CVRA 2VMGA 4OZOA 4JC1A 2FMDA 3VZMA 2NN8A 4CDQC 2VW0A 2A5ZA 3FLRA 1AL21 1W05A 2O1QA 1IPKA 1RUJ3 2DFCA 2QQVA 4S2FA 2QKDA 1H8TB 2IWGB 2VBBA 3ZR6A 4RHV3 4H55A 5C9AB 4DUXA 4Q0QA 1J1LA 1OOPA 1DQ6A 1ZA4A 1J58A 2FZ1A 4Y1XA 3ACHA 5FY1A 4HZFA 2W52A 2D40A 4PT6A 2WYSA 1RTVA 4PI0A 1OQ1A 2ZAAA 3NAPA 1QWRA 1IS6A 4ZY9A 2VGDA 2HYXA 4GB32 2Q30A 3I54A 4JVAA 4MXWB 4RQPC 3H1MA 1XE8A 2XHKA 3D0JA 3AL6A 1B35C 1RUI3 4GMP1 3SH4A 5JWPA 2X5IB 3AP6A 4P5YA 1JYTA 2WZR3 1PO21 1FMD1 2ZX2A 1RITA 2TBVA 1JYIA 4QKBA 3MIDA 3M4FA 3RSJA 2YPDA 1X82A 3I59A 2Q8DA 5BNOB 3AC0A 1CZVA 1JYNA 2CNAA 5G04L 2XQXA 2BBVA 4Q0VA 4K8FA 1N1VA 4CU7A 1JZ5A 1MS1A 3VD3A 1SLLA 2QTWB 2RS11 1UX6A 5D1IA 5B4XA 1W2UA 4IEOA 1NQDA 1IOAA 4CUCA 3DECA 2PHFA 4HETA 1UMZA 2Z79A 4DUVA 2YBPA 2W0XA 3SQOA 3LOBA 1LHNA 4XURA 3WNNA 1U12A 1RUNA 1L7LA 3AM2A 1RGSA 1ND3C 3EHKA 2JDYA 4FOVA 3GGLA 2IXKA 5AVAA 1PGW2 1W6OB 4HANA 3DN7A 1JXNA 1W90A 1UU5A 3FBMA 2HWB1 2WR9A 5FZKA 2BGOA 2VQAA 3USSA 4MGTA 1ULFA 5KXCA 1XNAA 3A22A 2NMNA 1OQDA 4FPLA 5GZCA 2BFUS 3AP9A 3SITA 2DVAA 2HBUA 1U5ZA 5EPAA 4XW3A 2D6MA 3POGA 4LT5A 4UOJA 4LBKA 1WMEA 2RDRA 2ZGLA 1XYPA 3IDEA 5DN2A 4MADA 4Q4Y1 4KBBA 4YGEA 3GHNA 5FZDA 5KHJA 2R32A 4AR2A 2C26A 3RGBA 1WZXA 2PLV3 2YU2A 2Y60A 1UMIA 4HKWA 1DHKB 1ZRRA 1V6OA 2V72A 2QQJA 4YZ3A 3NV4A 3WF4A 1WKYA 3D4KA 3M1HA 3WT3A 3E6CC 4QX5A 5FYBA 4AVCA 5FREA 3WG1A 3VN4A 3BOPA 1F8VA 2ILMA 2IXLA 4RSUA 5FPBA 1OI6A 3DPRC 4JQTA 4CDUC 5FZ3A 1C57A 3D82A 2MPFA 1CAXA 2R071 4DINB 2VOXA 3LEGA 3LKJA 4LO4B 1JU4A 4FOWA 2DTYA 3AYEA 2WZPP 2W5FA 1MVEA 3ACFA 3B94A 3IAPA 3KQ4B 5IFPA 1SLAA 2OW4A 1UYZA 5JOWA 2WQZC 4DOUA 2XVLA 2QZ3A 3U78A 2YUEA 1HJFA 1W8WA 3DEMA 4WM8B 3KV9A 4URTA 3AJZA 2WS93 4LBMA 1UKGA 1JH5A 4WVZA 1CPNA 2WWUA 2N7GA 3RG0A 3RPQA 1AVBA 4LNVA 2AZ5A 2VL4A 1FT9A 1UY3A 3POFA 4QKNA 2ERFA 4UFLA 1OH4A 4S2GA 3O7OA 3DKQA 4WM7B 3SCHA 3DXUA 4NRPA 1N1TA 1FOD3 4XILA 4PIZA 4XHXA
chains in the Genus database with same CATH topology
5BNPB 3OPZA 2YROA 4G4FA 4LBLA 3JQWA 3KT1A 1H2MA 2EAKA 1MZEA 1LOGA 3PVNA 1QDOA 4AQTA 4AVVA 3OGJA 1KFXL 4C1WA 1L3JA 1D4M3 5J09A 2K9ZA 5K9YA 4DNYA 4Z8BA 2JDZA 1CAVB 2KA3A 1SBEA 3M70A 4AFDA 1C1FA 1CONA 2HWE2 2WJSA 3MGUA 1URXA 4FPCA 3LA2A 1RUD2 4ES9A 4D7TA 5A32A 1SBFA 2OZJA 2FBEA 1VBA3 4ASMB 4X6QB 5CU1A 1FPN2 1ENXA 2E7TA 3HMYA 1J3QA 4YM0A 3FUQA 2NMOA 1W0OA 3H7YA 3UKNA 4C1XA 2D7FA 4LUMA 5GLTA 3VZLA 2ET7A 2DCJA 5FDBA 5JMCA 3UK9A 4HKOA 1SCSA 3M7AA 1HXS2 4YM2A 5DDJ2 3GZUC 2H6BA 3GBGA 4FO9A 1VR3A 4JGYC 4ONUA 3VZOA 1SQ4A 1TNRA 3N3HA 4CEWA 2OIIA 1POV1 3MIBA 4GB33 2H0BA 4ZU4A 1VJ2A 2ZKLA 3GZTB 2G9FA 1AXKA 4RL7A 1MS5A 3TN91 3CO2A 1TMF1 1BEV2 2WNUB 1VBD2 1H1AA 4RGAA 1UCXA 4JGZA 2WSUA 1RUOA 3AB0A 4M00A 1GANA 4QPGA 2HWF2 2DCYA 3KB5A 4XF3A 3LSDA 4CP0A 5C4WC 1BJQA 5K0UA 2UURA 4NHKA 2WNVC 3OD4A 4GMP0 1QH7A 5HCAA 4QQOA 2GNBA 2AR6A 1Z7S3 2XJTA 4ITCA 3CJIC 1FPN1 3AJYA 3NVCA 2A6VA 1MQTC 1OOPB 1S0DA 2B45X 5CNAA 1ZX5A 3R0RA 5GZDA 2RJLA 1K5MB 3SH3A 4DB5A 4Y1YA 3M3EA 3KGLA 2ZPXA 1EAH2 3NAPB 1H8VA 1LHUA 2EXKA 2RE9A 3NV1A 4NPRA 1QOSA 1OPMA 4HBNA 5GKAC 3RYKA 3PJQA 2RS31 1ZBE3 4XFHA 1G8WA 3QLQA 4WVWA 3CLPA 3I59B 4RQPA 2NP0A 1Q43A 1B35A 2Q8OA 4AI1A 1BEV1 1CIWA 1WA4A 2WT2A 3VL8A 5EFUA 4NHMA 1LU2A 3IBMA 4RA0A 2CY6A 1YWKA 1QJU1 3IMNA 1V6NA 3POWA 4K1ZA 4XJAA 4HVOA 4TZDA 3IM0A 2ZS6B 1Q8QA 4Q0PA 2BQPA 2ZMNA 3D6EA 1MZ6A 1WD3A 1ND3A 1GZWB 5EWSA 2ATFA 3PMEA 2PYTA 4KH9A 3RZZA 4JDOA 1XNBA 2QNKA 2CAVA 4PQ9A 4OI0A 4COZA 3IDCB 1W6QA 5CADA 2HJIA 4MGZE 4IV1C 3HT2A 2ZABA 3VZNA 3RJ2X 5FLIA 1AYM1 3B3QE 3P3NA 1ALYA 5L7OC 1LEMA 1CAXB 1NCRB 5ACA1 5LEJA 1NLSA 2A3WA 1G7YA 2AENA 3UKTA 3V64A 1DGRN 1UD1A 2HWE3 3AFKA 2A71A 5FMOL 5GJ6A 4B29A 4CDUA 5E16A 3AZZA 4EJRA 1RUD3 2VVFA 4FTEA 1UU4A 1WCDJ 2PHXA 5C8CC 4FTSA 1W6MA 2Y26A 5JI7A 3OBTA 4QPIC 1R083 2JE7A 2JG8B 1VAVA 4MV2A 3GNEA 4U2AA 3VBUB 3WDWA 3U0ZA 3VBSC 4IEZA 1A8DA 4N43B 4AGVA 1YO8A 2E6VA 5FTTC 1WCKA 3ES4A 1HXS3 1LGNA 1ZM1A 4YVWC 5BPXA 1RC6A 2R6QA 2R1DA 1OSGA 1GICA 4IEWA 1QNWA 2LTNA 2ES3A 4L9BA 3E6DA 4B7KA 2HWC2 2UY9A 4XFIA 3AKPA 4XOGA 1Q3EA 4RGGA 2ZA9A 4CYDA 4XF0A 1BMV1 4OULA 4W6WA 4EV0A 5FOJB 2QDNA 1ZNPA 1AR61 2RM22 5F6LB 1KQRA 4BA6A 4AE2A 4DXZA 3OYWB 2B5HA 4EN6B 5EZWA 3E5XA 1W6PA 5A32B 4NWVA 1S0JA 4FXKB 1D2SA 2YHJA 3WG2A 4E9KA 3ACLA 2UWAA 4XF9A 4C0HA 2AH2A 1POV0 4FOYA 4RS5B 3WLUA 1LEDA 1QQP2 2A75A 2K0GA 2NZ9A 5T52A 4IEPA 2AYHA 1R093 4UBHA 3TRSB 3FZ3A 3H50A 1NG0A 2AREA 1RUF1 3NL1A 3DF0A 3VKNA 4C0BA 3M3OA 2BPA2 3ZMNA 4GWNA 1OHFA 1M06G 3AKRA 3MF9A 1TME3 2C9AA 4CEWB 1EAH3 2XKPA 1KJLA 4F83A 3EXUA 2Y0OA 1I6XA 1N1SA 4NVPA 3ZYPA 1UZZA 1ASJ1 3O0WA 4Z82A 4XZPA 2PFWA 4UBGA 4YGDA 4JGZB 3ES1A 1COV2 4QPGB 4QM8A 1BBT3 1QJZA 1DGWA 3D5OA 1CR7A 4FQZA 4LLOA 4S2HA 5I0SA 1FXZA 5K0UB 2WLPA 4ORFA 2XH6A 3ATGA 3KLSA 3POYA 3N4MA 1REDA 1RHI1 1N3OA 4JRLA 3VKMA 3WUDA 5C4WA 1RUJ2 4OI1A 2PHUA 3JB8A 4LHKA 4EN0A 2WNVA 4D69A 1DFQA 2ZTNA 1WUVA 4PDWC 5FLJA 1JOJA 2GMPA 2GC0A 2QE3A 4Q4X1 1MQTA 4OI4A 1QY4A 3ECQA 3D8CA 1UPSA 2XL7A 3I8TA 3QCWA 4HLTA 2AUYA 2YZ4A 2NPIA 3JUUA 5DXDA 5F5QA 4PBOA 2NYYA 1X8MA 1PZ7A 2P3KA 1I5ZA 1NA1A 2HKXA 4CDWC 1Q8VA 4RQPB 2A73B 4CDXC 3JBG1 1C28A 1GV9A 1B35B 3WD5A 4YZ5A 2MHFA 2ZOEB 4W65A 3M2MA 4Q1RA 2ZMLA 3MW3A 2YMZA 4FP3A 4L11A 2VG9A 3M3IA 4M0HA 2XLFA 1UF2C 3JD71 1N3PA 4LBNA 1Y9QA 2VNRA 2ZMKA 3IIAA 3MI8A 1GZCA 1EYBA 1H4HA 1MZFA 2KM2A 2V09A 3UL2A 1CVNA 4DS0A 1NCQC 4LULA 3SXWA 1LODA 4EWAA 5L19A 1XNCA 2YDEA 2WINB 2HEVF 2ZHMA 3I4IA 2PAEA 1ND3B 2X53S 3FLPA 5FPXA 1R1ZA 4LE4A 1YCIA 4BWOA 1RUJ1 1ZYBA 2F6BA 3M3QA 4RHV1 1OD5A 4Q0UA 1W6QB 1HW5A 2DURA 1LOFC 3R6SA 5IK5A 3AKSA 1KD7A 5LK7B 2R062 4XXAA 3NV3A 3U4XA 3QACA 4Y1UA 2HWC3 1NYWA 4NO4A 3ELNA 1RUI1 4BMEA 2C0ZA 5IK7A 2WZR1 3VDDC 4IV1A 2DYCA 1AHSA 1APNA 4H7LA 4L99A 3ZN5A 5I8SA 3WDYA 5L7OA 4LO5B 3ZSMA 4EN8B 4FPEA 3S7IA 5JOZA 2PTMA 5ABJC 4XBQA 2VUJA 5EXOA 4AVTA 3OF1A 4LBQD 1LU1A 3GBFA 4CRQA 2ZZQA 4X8NA 1QQP3 2I2SA 4AG4A 4AQ2A 1I1EA 1U0AA 1ULEA 3R05A 5C8CA 4AXOA 3MDPA 1EV13 1MS8A 3SMHA 1UL9A 3OTFA 5GLZA 3MLLA 3WDVA 4HVQA 4IV3B 4IEUA 2V5YA 5KHIA 1F31A 3KD4A 3VBSA 2RS53 4WZFA 1WLTA 1LGBA 1D0GA 2YC0A 2PLV1 4XF1A 5KHKA 2ZZJA 2OVUA 4GKYA 4PF5A 3AXDA 3ZSJA 1PMIA 1YFUA 4OI2A 1TE1B 3QOPA 3GBWA 1R1A3 2OPKA 1LULA 4AEDA 1W6PB 1LRHA 3BODA 1COV3 2WLQA 2CYFA 2Y38A 5T5JA 2I45A 3E97A 2O8QA 1VBA2 3DV8A 3B02A 4AI8A 5H9QA 2CV6A 3AMPA 4R9AA 1ZZBA 4AFCA 3AMHA 3DUIA 2DCTA 4FPKA 3LA3A 5FQ0A 4TLFA 2B42B 2BFUL 4XFGA 4JV4A 4XIOA 3O5SA 3TAYA 2WA4A 5DUVA 2WS91 3VHRA 1QJX3 1KFUL 1AR83 5CB7A 3VBRC 3ZFEA 5KXDA 4Q8KA 2IXCA 1D0HA 2B9UA 1H0BA 1UKRA 3OCPA 5FO7B 3Q9OA 2XBO1 2A3XA 4FTBA 1EY2A 4TYSA 3WDTA 1FOD1 1RUC3 1FAYA 3MFAA 1ZZCA 2WSVA 1RUE2 1FATA 4QQHA 4R9CA 4FXGB 3T1MA 4A2UA 2FQPA 4BIOA 2A6WA 3KMHA 4COUA 1YHFA 1Q8PA 4XHBA 4E4ZA 3MZHA 1MS0A 4N7UA 4XFAA 3ETQA 2VNOA 1D4M1 1NE4A 1GBGA 2ZX4A 3MIFA 2RR12 1J59A 4Q2FA 4DQAA 4KG0A 1HRI1 2ZGPA 2PHLA 3VHPA 1QMJA 2YV8A 3V0AA 4YFZA 1Z7S2 5C4WB 2E9QA 1LJ7A 1ENRA 3X29B 3H8UA 5J48A 4Z07A 4KNCA 3LCPA 5AC93 4AFAA 3H3ZA 4K1YA 1MQTB 5EYXA 1TNFA 4MGIE 4PDWA 3VKFC 1PHMA 4AF9A 4JRAA 1ND2C 4G9SB 1W39A 5J3UA 3RDIA 5FO9B 1ZBE2 3S0MA 1NA1B 5DG1A 4FPHA 2R063 3VV1A 2VNGA 5JPMB 2GNTA 1PGL2 4GB31 5JZGA 4L2NA 4P9IA 1VALA 1KS4A 3BOWA 1V9U2 4CDXA 1RUG2 1BK1A 2BVBA 1PO13 1MS3A 3WHTA 4KGGA 2GDFA 1XRUA 2GNMA 2ZGTA 3AYDA 2OUHA 4K21A 1XYOA 2ZBJA 4CEYA 3O0XA 3AFGA 5F6KA 2HWD2 5DZEA 1RB8G 3RWNA 4KWKA 4XF4A 1AR92 3WG4A 1G86A 2E53A 1PGW1 5GM0A 5CFDC 1NY72 1GSLA 2H0VA 2JKBA 4LE3A 1CD3G 2O8OA 1FYUA 2DU1A 3PJYA 4I09A 2R042 1BXHA 1CAUB 1UPIA 3AMNA 3NKGA 5CBLA 5H9SA 2DU0A 1LOAA 3O0VA 5H9PA 2JJ6A 2NLRA 5E89A 1QJY2 1WLDA 4Y22A 1ZZ8A 1ZBA2 3IT8A 1LOFA 1WW5A 1FI2A 2BUKA 1OQEA 4IV1B 1PVC3 1ZBE1 1LGCA 4GALA 2P37A 3ZXLA 4PLNA 5AVPA 4AI3A 1CX4A 2ZGQA 3USUA 1UU6A 4YVSC 4HN0A 5T54A 5KBFA 3H9AA 2FMYA 2UU8A 1HRV2 3VDDA 2D3RA 3ASIA 1YXWA 4E4SA 1HDKA 3M3CA 4UW6A 1R082 4GQ7A 3ILNA 3G7DA 4HFSA 4DY5A 4Q4V2 2EIGA 2X29A 4AEMA 3LSEA 2E7QA 1RINA 3H3UA 4B4QA 5C8CB 5JCTA 2GC2A 2VW1A 2RS13 4ZXKA 1CPMA 5A3LA 3AK0A 1IKQA 3VBSB 2K2SA 3VZKA 3IDBB 1OPOA 1Z78A 2ZHLA 3UV9A 3HIFA 3KT7A 2VVEA 2PHDA 4P9JA 5C9AC 2JG9C 3BB6A 4OLLA 3DGTA 5JOYA 1RUE3 5GLVA 5JOXA 3AZXA 4AEDB 5LEKA 5FOBB 2P2KA 4N53B 3V0BB 5L73A 3NV2A 3CEWA 4LO6B 4F3JA 4FPFA 4XYXA 2ZHNA 3ZXDA 1ZZ6A 2X5IC 4DZGA 2RR13 3ZN4A 1RIRA 4IERA 2ZACA 2HWE1 3FFZA 5JSPA 2D6OX 3WNXA 3WW2A 5FQ0B 1W6NA 1KDMA 1O4ZA 1RUD1 3VKOA 1R092 4XBLA 2IXHA 2ZGOA 3OGGA 4MYEA 1AYN3 1R081 1H9PA 5FBZA 3IKWA 2VVDA 1WD4A 4AYUA 3ZFEB 1XE7A 1G9CA 5EJ3A 3MEPA 1PZ8A 3E5UA 3FMGA 4CDQA 1BKZA 1TME2 3AMQA 4RR3C 5LK5A 2LUWA 4FPJA 1Q5OA 1HQNA 1HXS1 5DDJ1 4IEYA 4KQ7A 4HT1T 5FAXA 3VBRA 1G9AA 1DQ0A 3WXPA 1E57A 4BLJA 3WUCA 1ZZ9A 4DY3A 2ZCWA 2I74A 4YM1A 2IC1A 4HSJA 3NWKA 5EV7A 4D3WA 2PQQA 3RMYA 1DZTA 4Y4YA 1SFNA 4QQ2A 1V00A 1BBT2 4X6RB 1Y7BA 3WP5A 2NM1A 4XJWA 3J4UH 4L8QA 5JDBA 3IPVA 2JX9A 3W59A 5KHHA 4Y1VA 1V9U3 1KXGA 4Y5Z0 1RUG3 1VBD1 2Z2SB 2C1FA 4S2DA 4J1XA 2HWF1 4TWTA 3W9AA 3WCRA 1FV2A 4DRVA 3HAGA 4QGMA 1OA3A 3T1LA 2BGCA 4IETA 2HWD3 4P9YA 2IZWA 1R091 3ILFA 1AR93 2ETEA 1MACA 1Y3TA 4XMAA 5SV5A 1JW6A 2SBAA 2WA3A 4PLMA 3WW4A 5B2GB 4BZ4A 2R043 1HQWA 4LA3A 4WVMA 2DFBA 1JHNA 1EAH1 5KXBA 3H0OA 3S7EA 3N36A 1NOVA 5EYYA 2YGLA 5JZGB 3LAGA 1QJY3 4I02A 3H1YA 1ZBA3 1QGLA 2YPJA 4AFMA 2R49A 1AXZA 1ND2A 5GZFA 4WM7C 1O7FA 2XG3A 4HKLA 1SFYA 4ZU7A 2X8KA 3K48A 2D5HA 1VRH2 2XLGA 3B9CA 2WT0A 4Y24A 1JN2P 5CAZA 2WFPA 2DVFA 5JAXA 2PHTA 3DPRA 1HRV3 1AX2A 4CEYB 1JUIA 1YFYA 3SH5A 4COWA 1TMF3 4KL1A 1NLRA 1AXYA 1YLLA 1YIFA 3MPPG 4Q4V3 2DVBA 4GH4C 5GZEA 4FBFA 1ZRDA 1N3QA 5GALA 5C6CA 3OY8A 2XJSA 4HSLA 2DUPA 1QOOA 3MPBA 4QXKA 2QDRA 1PK6C 1H4GA 4NWWA 4DFSA 4I2OA 4FSJA 4F8AA 5CFDA 3R4UA 3WY6A 2RMU3 3RYPA 4OHVA 4Y22B 5H9RA 3NJZA 2CGPA 3ZIXA 3VBOC 4EN7B 1S0FA 3TB0A 5JSRA 2DF7A 3WQ1A 3BU7A 4MLOA 3FX3A 1WBFA 2XWJB 5CFCA 4V1PA 2B8MA 1C5HA 2JECA 3ZYJB 3HBZA 3USUB 2LM3A 4FCAA 4OHXA 4W6XA 3MIEA 3VDDB 3AXEA 4FP2A 4ATFA 4U36A 4JDMA 4X8PA 1SLIA 1LCLA 2ZX0A 3AP5A 4FOQA 4YVSA 3T2TA 5KWRA 2WNUC 1BZWA 1AX0A 4BE3A 4KU8A 4GA9A 4ASLA 1JBCA 3TYJA 2MEV2 2XVGA 3TNPB 3MF6A 1EV12 3ZO0B 3ME2A 3LOIA 1QXRA 1MVQA 3IWZA 1O91A 4B8EA 3FWEA 2B39A 3GF6A 1DU3D 1DG6A 2JXAA 2RJKA 4LR4A 3QBQA 5K7PA 3VKLA 3WX5A 2RS52 1ONAA 2OA2A 1G9DA 3J9SA 3WR0A 2B7YA 1DDLA 1RJ8A 2GAUA 3N35A 1DYPA 4AGRA 1SLCA 3CU7A 2TUNA 3MW2A 4MVTA 3LWCA 1MS9A 4JGYA 1K5MC 2WWSA 4BIFA 4OHWA 1VP6A 4PIXA 1R1A2 2HWC1 5I0RA 1LOEA 1H1IA 3WV6A 5C9AA 2JG9A 1SMVA 2D6NA 1RVF2 3FUOA 1HLCA 2RM21 3LA7A 3MIHA 3C3VA 4M3CF 2A6YA 1CGPA 4I0WB 1LTEA 2WFF2 1W6NB 4YNIA 4MXWA 2PELA 2E63A 1CJDA 4XJ9A 3MFCA 4R52A 2E7AA 1LESA 2D3PA 3CJXA 3ZXGA 1QJX2 1AR82 1QQP1 2VW2A 4NN0A 5JR7B 3B9IA 1ULCA 4CDQB 4YLZA 1H2KA 1UW8A 3O12A 2D6LX 4LBJA 4P9GA 4TSVA 4YW5A 3CJIA 2P3JA 3ZSLA 1RUC2 3POSA 4I30A 4XJ8A 1LR5A 3RJRA 4LO8A 1S0BA 4IQPA 2GH2A 3FLTA 4K40A 4RR3A 5J36A 3NW4A 3UKVA 2QJVA 2VMIA 4RFT0 1SLBA 3TBDA 5KC6A 4KG8A 4BQ1A 3IPVB 1CAWA 3SCGA 4W6YA 1F2NA 4P9XA 1WMFA 1QOTA 4BCUA 4AVAA 1KDKA 4SLIA 1VRH3 1U5YA 1C4RA 1COV1 1GQHA 4META 1XNDA 4I01A 5D8AC 2CGOA 1VBE2 4AW7A 5F1RA 4RD7A 4Q8LA 1AZDA 1NCRC 5I0UA 2E51A 2F4PA 3TWIA 3J8F2 1AR63 3WP4A 4K9SA 2WT1A 4BM8A 3GALA 5AC92 3PMSA 4PJYA 1C8M2 3ZFFC 1DGRA 4IEXA 4IXLA 4WVMB 1D4VB 5JIAA 1I9RA 4C90A 1FNZA 1QXPA 2XUMA 4NR1A 2JG8C 1M4WA 2BNNA 3ZN6A 1RUC1 3VBUC 1WLWA 5J7MA 1RUF3 2ENRA 3VBFC 1ND2B 4N43C 2UY8A 1RUH2 2ZAHA 4GXLA 1OA2A 4YRDA 4ATEA 1MEC2 4B3NA 2DCZA 1Z0HA 1MS4A 3KS7A 1RMU2 2JE9A 1PO12 1OLQA 3ZVXA 1SBDA 5DUXA 3DPRB 1VBC3 4CDUB 2GC3A 4OHZA 2EAAA 3N7MA 1W6MB 3AZYA 2DV9A 1OMIA 3KM5A 4I3PA 4LEJA 2WC2A 3VGIA 4LTAA 1S2KA 2XL9A 4QD2A 3OY8B 2QUOA 5C8WA 1EPWA 2MEV3 1DZQA 3WP6A 4QPIA 3A0NA 5AC91 4B4RA 1ENSA 1LENA 2PA7A 4RS5C 5CFDB 1GKBA 3AP4A 3TOJA 2DVDA 4GH4A 1WBLA 2G9GA 3KZ4C 5BNNC 3A0KA 3PVOA 4COVA 1UZYA 1AL22 5CA6A 3V56A 1UIJA 1PK6A 4Q29A 4WV8A 2DUOA 5CFCB 3L2HA 4YVWA 1A3KA 1PVC2 2D6PA 2OUJA 2R061 1O4YA 1PNGA 3SCFA 1XQNA 4XQDA 3FC0A 5HXVA 1SACA 3VBOA 2EXIA 4CEWC 1GQGA 4LBQA 2RHPA 3UJQA 3RQ0A 3GHMA 1RVF3 1IS3A 1X7NA 1PO11 4YVSB 1PO22 1FMD2 2VXRA 2GMMA 2WFF3 1J1TA 1YYNA 4FPYA 2Y0IA 3UJOA 1J3RA 1V6LA 4OUSA 2BWCA 4WZCA 2R0HA 5KXEA 1FV3A 2BYVE