4XF3A

Cysteine dioxygenase variant - y157f at ph 8.0 with cysteine and dithionite
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 54
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xf3A00
1O3TA 4R8HA 3BB6A 3NKTA 3BPZA 4BIFA 4E2SA 1ZRFA 4J1XA 3KGLA 4HVOA 1IPKA 4JTNA 5D1IA 4KL1A 4PJYA 1J3RA 2ZCWA 2D93A 5CVRA 3FE5A 1ZNPA 1UCXA 1O5UA 2PA7A 3H1WA 4JVAA 4Q0VA 2MPFA 3O14A 2ETEA 4J1WA 5KHIA 5I8TA 1ZZBA 2KXLA 3CF6E 1CGPA 3EO6A 2VQAA 2PHDA 3H1YA 4LUKA 5I93A 4I0AA 1LKNA 2D5FA 3H3UA 2IC1A 3E5QA 1ZX5A 1RUNA 1NXMA 1CAVB 4Q29A 3IDBB 3SCFA 1L3JA 2Q0AA 4YSFA 1ZVFA 1ZZ9A 4LA2A 1WA4A 1YFWA 2ET1A 1EYBA 2IXIA 3DL3A 4QM9A 4WZCA 4ZU7A 3EHKA 2GC3A 2FQPA 1LR5A 1SEFA 2B8MA 1FI2A 1X7NA 4I02A 4I09A 4B29A 1O4TA 2Q30A 4IEZA 1YFUA 4HSLA 4EWDA 1PMIA 1RTVA 4HMZA 1OFNA 1LRHA 1PM7A 3C3VA 3WW2A 4EROA 2IXCA 3H7YA 2FMYA 2K9ZA 2PTMA 2I45A 5FQ0B 4IEWA 1RUOA 1ZRDA 3ES1A 1O7FA 3DV8A 1UIKA 3M3IA 2V09A 1ZZ6A 1ZZCA 2OA2A 1Q3EA 1DZTA 5I0SA 1J59A 5E16A 3RNSA 3OD0A 2BYVE 5BV6A 4AVAA 4NVPA 3SCHA 1CAVA 2EVXA 4XFAA 2UY8A 4I0BA 4ORFA 4OLLA 3LAGA 2OZJA 5I0UA 1EP0A 2QJVA 3QACA 4L11A 3FX3A 3FHIB 5HI0A 1SFNA 3ST7A 4XF1A 3CO2A 3HIFA 4UBGA 5JAXA 3IBMA 4HBNA 4FAHA 5CU1A 4WBBA 1CAWA 4QGMA 4META 2WFPA 4IEYA 2OYZA 2GC0A 4EWAA 5KHGA 3E97A 2OPKA 3TNPB 1TQ5A 4DINB 5LEJA 4LLOA 4KWLA 4AQ2A 3D0SA 4P9GA 4Q0QA 5FLHA 2ATFA 4AQ6A 1YWKA 2PYTA 3NW4A 2XHKA 3PNAA 1I5ZA 4AVCA 3E5XA 2XLGA 4IEPA 1UD1A 4QX5A 5BUVA 3WW3A 4EV0A 1ZRCA 2BNMA 4I01A 5C8WA 3LA2A 1GQHA 2H6BA 2QVSB 1ZZ8A 3EBRA 4Z82A 1YLLA 1WLTA 4EWEA 3VHRA 4R52A 4HSJA 2Z2SB 2VECA 5JCTA 4MH0E 2BNOA 3JZVA 3FWEA 2ET7A 1UIJA 1WGPA 4XFFA 3I59A 2BGCA 5FCCA 2Q4SA 2IXLA 3H9AA 4KWJA 1X8MA 1I6XA 1NE6A 4BYYA 5I0RA 5I8SA 3UKVA 3MZHA 5J48A 3NJZA 3OTFA 1QWRA 1YFYA 2C0ZA 4QGNA 4XFIA 4MGZE 2IXKA 2XLAA 5JR7B 4CYDA 1EY2A 3SXWA 4UXAA 1QXJA 2PAMA 1CAXB 4PIXA 4Q0PA 4IESA 5KHKA 5I0TA 1FT9A 5BPXA 5EZWA 5I8YA 3DN7A 5AVPA 4OFGA 3L2HA 1ZZ7A 3ZDSA 4N9HA 4XF0A 3HQXA 5LRSA 3G7DA 2GC2A 3ELNA 1XRUA 3SCGA 3FJSA 1RGSA 3NVCA 3PLQA 2E9QA 3SHRA 1O3QA 1HW5A 3E6DA 5LRRA 4JV4A 4IERA 1OI6A 4X6RB 4HZFA 4XF9A 3D0JA 4HVQA 1GQGA 4XFBA 1H1IA 4MZUA 5JSPA 1ZREA 2H0VA 2B9UA 1XE8A 1CAUB 3LWCA 2XL9A 3ES4A 4TLFA 5E1RA 4BH9A 5FPXA 3IIAA 3KCCA 4K8FA 2MNGA 2GZWA 2H6CA 5FLJA 4XF3A 3BALA 2QDRA 4BHPA 2QCSB 3H3ZA 1CX4A 1SQ4A 3M70A 4JTOA 3B02A 2BEOA 2EAAA 1UPIA 2IXHA 3NL1A 4XETA 2HJIA 5FLIA 5FDBA 3WW1A 3HT1A 3CJXA 2MHFA 1NYWA 3KMHA 3U11A 3UKTA 4I3PA 3MPBA 3BU7A 1YHFA 1DZRA 4PIYA 3GYDA 1FXZA 3GBFA 4N9IA 5T3NA 4A2UA 3NSTA 1VJ2A 4WVZA 3N4MA 2GAUA 3D82A 1J3PA 2Z69A 5JSRA 2Y0OA 5C6CA 4X6QB 4IEUA 1Q43A 4FBFA 2K0GA 1X8EA 2PHLA 3I59B 4QMAA 1OD5A 4ZU4A 1NE4A 3PVBB 4IETA 2P17A 3ETQA 3KGZA 3U0ZA 2HKXA 4QGLA 1CAUA 2PQQA 3H1MA 3MYXA 4HLTA 4HVRA 2PFWA 2ZKLA 4XFGA 1IPJA 2B5HA 3WW4A 4Q0SA 1J3QA 3S7EA 1V70A 1YUDA 3EQEA 5BXXA 4IEXA 4IEVA 1X82A 2O8QA 4Q0UA 4XF4A 2GC1A 1H1MA 5J3UA 5K8SA 3I54A 3OGJA 3UKNA 5JSOA 2XGXA 4Z07A 4AVBA 1Q5OA 4PIZA 1OMIA 3USSA 3S0MA 2QNKA 4O9EA 2O1QA 3LOIA 3R6SA 1DGRA 1G6NA 2Q1ZB 1J1LA 3RZZA 4YNIA 2N7GA 4MX3A 4L2NA 4D7SA 5CADA 3H50A 3FZ3A 4IEQA 3IDCB 2EA7A 4LULA 3E5UA 3CEWA 4LA3A 1UW8A 1Y3TA 4GULA 4RD7A 4E2GA 1U12A 1XE7A 2CAUA 4IEOA 3E6CC 4ONUA 3OCPA 4UBHA 5EFUA 1JUHA 5F1RA 5KBFA 4KU8A 2DCTA 3TNQA 2CGPA 3I7DA 3EJKA 3LA3A 2XKOA 3E6BA 1O3SA 5I91A 3ROUA 2BNNA 3DKWA 4QM8A 4KU7A 3RYKA 4XEZA 2F4PA 1O5LA 5KHHA 4MGKE 2PAEA 3QOPA 2VPVA 3H8UA 1VP6A 1NZCA 3SMHA 1EPZA 1RL3A 3OF1A 2GH2A 1YFXA 4HN1A 5FPZA 2UYBA 2UY9A 3MDPA 3BCWA 4ZU5A 4MV2A 3RYPA 3LA7A 3HT2A 1J58A 3CL1A 2GU9A 4F7ZA 5LEKA 3FFQA 1QXRA 4D7TA 4F8AA 1QY4A 3IWZA 3LZZA 1LB2A 1CAWB 5BY5A 1RC6A 4KWKA 4MUVA 4XFCA 1Y9QA 4E2QA 5J7MA 3U10A 2XLFA 1CAXA 4MGYE 4YYOA 2XKPA 3RYRA 1O3RA 2D5HA 4XFHA 4FAGA 2OZ6A 3H7JA 4LTAA 3S7IA 2XL7A 1ZRRA 5FQ0A 4H7LA 4O9GA 4LUMA 4AXOA 5KHJA 2CV6A 1DGWA 4HN0A 2WC2A 2UYAA 3CLPA 4YARA 4I2OA 4LEJA 2D40A 4YRDA 2CAVA 1VR3A 3RPQA 4FT8A 2PAKA 3ACLA 3RDIA 4QXKA 4MGIE 3KSCA 2IXJA
chains in the Genus database with same CATH superfamily
3B69A 3J7LA 2Z79A 5LA2A 3GM8A 5GLWA 2NPIA 1WMEA 1O3TA 1ZBE2 1LU2A 2W08A 1IQAA 2UWBA 4IV3A 3O1MA 4BIFA 4E2SA 1YXWA 3NNGA 4Q26A 4E8CA 3KGLA 5D1IA 1IPKA 5SV8A 4OHZA 2K2SA 2CTVA 3WNMA 3TEZA 5FV3A 4AQSA 1LOFA 1V6JA 1JZ3A 2D93A 4QDRA 2HBUA 1KGYA 2JE7A 3ZXAC 2VD7A 1W3XA 3ZSJA 2VZUA 3I3MA 1CIYA 4FP2A 2C1FA 4WM7B 3ZR6A 5LY1A 4WVWA 3T0DA 1IOAA 2X5IC 3KV5A 3VBFB 1QJY3 1LOBA 1UOJA 4JVAA 5HCAA 1JZ7A 1BEV1 2O0OA 2ETEA 1WW7A 1F5FA 4RGKA 3AL6A 3VKOA 2YC2A 2E7AA 1IKQA 1CJPA 3HMYA 2OUJA 3KV4A 2VQAA 1W9TA 4X8NA 1ZBE1 3VZKA 5FOBB 2LUWA 2PHDA 3H1YA 2GNTA 4NOTA 3LGRA 4I0AA 3C8XA 4KQ7A 3JXSA 4XHBA 2WFF1 4XQWA 3U4SA 5IAXA 4YG3A 2PHWA 4GH4C 5F5QA 3H3UA 4RS5A 3DPRA 4ZY9A 5FUNA 1REFA 1RUNA 3E5QA 3UGGA 1BLZA 4AGGA 1CAVB 1W39A 4NMIA 2Q0AA 1OLQA 2ZGLA 4P9XA 4H14A 5D2AA 3ZIWA 4GA9A 3N35A 1R092 2MEV2 4UFMA 4W6XA 1REDA 4ZHNA 4UAPA 2FDJA 3ORJA 1RXGA 2A3YA 3ZYGA 1EYBA 2IXIA 2D6NA 2Y60A 3P3NA 4ZU7A 3WCSA 2GC3A 3ZR5A 3P5BA 5KC6A 5LK5A 5B2GB 4Q2FA 4JHZA 4FTEA 2QQKA 2VXJA 4CDXA 5EIYB 5C4WB 1V6OA 1S0FA 3GZTB 1LOFC 3MIBA 4AAPA 2R041 2ILMA 2VUCA 3D5OA 2JE9A 3N7LA 5FY4A 4CDXB 1NA1A 2GP5A 4NIHA 1YQ6A 1KQRA 2VULA 4O7XA 5CFCC 3VD7A 2WDBA 4HSLA 4M4RA 4W65A 4F3JA 2JDYA 2WQZC 3IPVA 3RMYA 1PGL1 2PHRA 1PO22 3MW4A 3POEA 1GMMA 2K46A 1VRH1 1IG0A 1LRHA 5DG2A 1PM7A 1VALA 2YDEA 1AR93 4A41A 5A32A 5LWBA 3V0AA 1O8SA 5A3NA 1Y9GA 5IHRA 4XURA 5EJ1B 3AX4A 1ZRDA 4Y3OA 5C9AB 2VTXA 1D0HA 1J84A 4AZZA 4LLFA 4NR1A 3ZSMA 2XG3A 2FBEA 2ZJCA 4OCTA 3UJQA 1DZTA 4D6SA 1S0DA 2P3JA 1RVF3 5FZKA 1UX7A 4BDVB 2BYVE 3ACGA 5BV6A 4ZS3A 5KWRA 1GP6A 4A42A 2OXBA 2VZPA 4XFAA 2RMU3 1H9WA 5LBCA 5CFDC 4OLLA 1WMDA 3VD4A 4SLIA 4R9BA 1X9TA 2B4KA 1ODMA 4Y5Z0 3QACA 3CIHA 3FX3A 4K1YA 4L11A 5HI0A 1C8NA 4CEWA 4LBQA 2UWCA 2YHJA 5FK8A 1JU3A 1SZBA 3PTYA 3CO2A 2VU9A 3AMHA 3ON7A 5L9VA 5G05L 1X33A 3NNFA 4FAHA 1NA1C 3PURA 1RJ7A 4QGMA 3JU9A 1C1FA 1VBA1 2WFPA 4IEYA 5F3GA 5C33A 3RI9A 1RUG3 3NRUA 1XNBA 2RR12 2VMGA 2WKKA 1OC1A 5LEJA 2I07B 4XTMA 3T08A 4CXXA 4CDWB 1DIWA 1OUSA 3MW3A 4ZXKA 2WNVC 2HWF1 2X8KA 1ZA7A 1B35B 4Q0QA 5L73A 1F9KA 1ULFA 2CWSA 3APBA 5KXDA 3R05A 4DOUA 5A3LA 2GP3A 2PYTA 2EICA 1UMHA 5FY8A 2XHKA 4AOCA 2YC4A 3GZAA 2GNDA 5H9QA 2VQ0A 4MG2A 4D7YA 3OG2A 4XJZA 3ZYPA 2XLGA 2Y33A 5JXGA 3OOXA 3WDYA 2Y0IA 5K7PA 4I01A 4AGVA 4GAZA 3I2JA 5JZGC 1ULPA 1ZZ8A 3RGBA 3VD3A 1LJ7A 1AF9A 2DTYA 2VUAA 2GSYA 1UY1A 2ZX3A 3ZMNA 1AUYA 1WLCA 1OPOA 4CPBA 1WLWA 3VHRA 4EWEA 4HSJA 2TBVA 1C8M2 5FZOA 2Z2SB 1COV1 4CPBD 1Z7S1 3ZXFA 5CFDB 4XUTA 3RZHA 2DV9A 4EZ4A 3KV6A 4UWDA 3H8RA 4HT1T 3DYOA 2ET7A 1UIJA 1H4HA 3VBOC 4LR4A 2ZEXA 1OQDA 4JAAA 2BGCA 1BBT1 1QOOA 2A75A 2Q4SA 1OURA 3DPRB 4IE5A 2Y6LA 1YQ8A 4KWJA 1X8MA 1OXCA 2JE8A 1NE6A 2BVVA 1S2EA 4URTA 4NWVA 1QDCA 2BP6A 5FYMA 3MZHA 2IZWA 5A3MA 3C7OA 3VZJA 5ISLA 2C9AA 3WP5A 4XZUG 4QGNA 3QH6A 1SFYA 1R1A2 3FUOA 4YW5A 1C8M1 4UF0A 2WNVA 1X50A 5A70A 1GKBA 1CONA 1F8VA 3W5NA 1H6YA 1S0CA 2EIEA 3AZZA 4YW6A 1BVVA 1CAXB 3QH7A 2VBDA 4Q0PA 4IESA 4UT5A 5KHKA 5EZWA 1ULGA 5AVPA 4Q4V2 1TMF3 2PLV3 5ACA2 1ZZ7A 4YW3A 4GWMA 3ZDSA 4CP1A 5BNNC 4XF0A 4AL9A 1HV1A 5C3RA 1VB4A 2FCUA 3GCWA 1K5MB 1RUF2 1SLAA 3F2ZA 3NO8A 4OULA 3SCGA 1QQP2 3K4DA 2J7MA 1QU0A 2JDUA 1WW4A 3HNBM 2FHRA 3LFIA 1OH3A 2Z42A 3GALA 1O3QA 1HW5A 3TWIA 3VL8A 3IZOA 4X6RB 4XF9A 1W6NA 1NQDA 1GQGA 3GF6A 4QKFA 2D6MA 1GWLA 3VBOA 4D0QA 3B94A 1E5SA 5JSPA 5FBJA 3K77A 1UAIA 1HRI1 2AH2A 1XE8A 2W95A 2ZKNA 3CDZB 4R9CA 4XUOA 1NOVA 1ULOA 2XL9A 5BNPA 4LK6A 4DY3A 2F4LA 2R043 1MZEA 3ES4A 3VN4A 4TLFA 5FY5A 2CL2A 1UZYA 5FPXA 1FOD1 4QQPA 4K8FA 3POGA 1W6OB 2HWC1 2JD9A 4Q27A 4Q4V3 1IS4A 2H6CA 3PUAA 2EXJA 5JZGB 4XF3A 3WF2A 3H3ZA 4IE7A 1CX4A 2ZHNA 2BEOA 1UZVA 5FYIA 3OBAA 1GZCA 1PIV1 3NL1A 1H4GA 2W91A 2HJIA 5FLIA 1NAEA 4DUWA 4ASLA 1QH6A 5IW0A 5L9BA 3WG1A 3BODA 1SACA 2YZ4A 4TSVA 1RUE3 3ZYRA 1OA4A 3N9NA 1NYWA 4CCEA 5A33A 3ZXKA 5C5TA 1O91A 3B9CA 1O4ZA 4I3PA 1UZWA 3BU7A 2EIBA 2PMWB 4LHKA 1QJX2 2DDUA 4TYSA 4Y5TA 5GZDA 3T30A 4A2UA 1YIPA 1WZXA 1OOPB 1YQCA 3N7MA 3NSTA 1W04A 2VMEA 1RXFA 1VJ2A 5FKBA 4AI8A 2Z69A 2R061 5JXJA 4JHTA 2Y0OA 4QX0A 3R4UA 4P9LA 3H0OA 4X6QB 4EN6B 3PIGA 4FBFA 1PK6A 1EUUA 3O1SA 3NAPC 2FDIA 3PVOA 2XJUA 4QMAA 1KJRA 4DIQA 1OD5A 4OHYA 2DCKA 3H8OA 3WNLA 4Q4W2 1W9FA 3POSA 4M3CB 3KVAA 2P17A 3ETQA 2DCYA 3PMEA 3CMGA 1LHWA 1ALYA 3SKJE 3MYXA 4HLTA 1C1LA 5FZMA 2ZEYA 3ZYBA 1LODA 3THTA 5F6LB 4L8QA 1IPJA 2B5HA 1RUG1 3I2KA 5EQUA 5C3QA 4Q0SA 1J3QA 2R7EB 2V72A 2I2SA 4XE9A 3W5MA 2HWB2 1SBEA 4XUQA 1OQ1A 1V70A 4A4AA 3EQEA 1H0BA 4IEVA 2DVDA 2X5IB 4Q0UA 2OT7A 1Y43B 3N7KA 3RRDA 2FMDA 2JDAA 2VOXA 3VHOA 1RINA 2GC1A 1RUD3 3MIHA 3WLUA 4FPKA 1D0GA 3RZMA 3I54A 1OH4A 2D6OX 3M1HA 5F8PA 5F5AA 4QXCA 1C28A 1POV0 5FP4A 1SLTA 4DEQA 3LIGA 4JGZB 4NPLA 3USSA 1BK1A 4M3CA 5FWJA 3S0MA 1V9U1 2ARAA 2QNKA 3BGAA 1XYOA 4CE8A 4Q8LA 2WBKA 3LOIA 5FY0A 4LPLA 1JHNA 2BTVC 2I74A 4H7MA 2YC0A 4LO6B 3U1XA 3ZXGA 1G6NA 2Q1ZB 4QWNA 1KFUL 5FUPA 3LEMA 4ATFA 3OPTA 2DBIA 2WNUB 2XJTA 1RMU1 2E51A 3K46A 4HFSA 3POBA 4LULA 3NWKA 2CYFA 1ZYBA 3WR0A 1S55A 1XNDA 4FPHA 4DEVA 2WS91 3SEEA 3RVHA 5DZEA 2R0HA 1APNA 4GULA 4LO5B 4Y26A 5E88A 4E2GA 1U12A 2CAUA 4Q4V1 3RI8A 2A3WA 1YI9A 1LCLA 4HETA 1JUHA 2EIGA 2XR4A 5KBFA 1NCQA 1MVQA 4HG6B 4KU8A 4G3YC 2XVKA 3TNQA 2CGPA 3T09A 3A0KA 3KT4A 2YPDA 3J8F2 1MZ5A 3LA3A 1RUD1 5L7OA 3D3AA 1SBDA 2XKOA 3E6BA 2ES3A 3SC7X 1LESA 2XHNA 4NRQA 4QM8A 5G04L 5FZCA 3OD4A 5DABA 2BW8A 2RMU2 4JRLA 4LE4A 1ASJ2 5A7WA 2RS12 2EIDA 3KB5A 5F37A 5FO8B 1QJU3 2WINB 4LKFA 2PAEA 1OOPA 3K2OA 4O65A 2HYKA 1POV3 1HRV3 1VBC3 1W99A 1W0OA 3BVCA 4HK9A 1QGLA 4IUGA 1DQ4A 4L9BA 5BNPB 2Q5TA 3H8UA 3AMMA 4N8MA 2ZOEB 3SMHA 4XDPA 4M3CF 5FYYA 4FPEA 4E4ZA 3OF1A 1W6QA 1TZOA 2GH2A 4ARYA 3KCYA 2UY9A 4BQ2A 3ASIA 1W6MB 3AYCA 4M0NA 4MXWB 3R4DB 4RGGA 4RS5C 5FYCA 3BOWA 3KT1A 1SLCA 2W2IA 3CL1A 1J58A 3MV11 2GU9A 1I9RA 1E5HA 1LHOA 1UNBA 3TRSB 3AKSA 5T5LA 1LHNA 1QXRA 2VOKA 4MHRA 1OT5A 3IWZA 4L0PA 2Q8DA 3SITA 4DY5A 1CAWB 1EUTA 4JDMA 1AXKA 3TB0A 1NCRB 1W6PB 2Y34A 2XVGA 3HQUA 3USUA 2D6LX 3PVEA 4HKLA 4MUVA 3UESA 1XNAA 4IDZA 4D69A 1W90A 1QQP3 4NHYA 4MLOA 3O12A 5J7MA 4MO3M 3U10A 4A7YA 1CAXA 4MGYE 3RYRA 1A34A 2WAOA 2YG0A 3FBMA 3ZSLA 4LNVA 4BZ4A 4XFHA 3ZSKA 1IQDC 2WQ8A 4QU2A 4Y1XA 4I30A 5LATA 3ZDVA 1ZRRA 2W52A 1LOAA 1JYIA 3DEMA 1AR63 1W0NA 1CWPA 4QKNA 3ZFGB 1UZZA 2YGLA 1VBB1 3WT3A 4YRDA 3RPQA 4QXBA 4CUBA 3JD71 1DCSA 1R083 4BLIA 1IG3A 4NIAA 1H2MA 1I3HA 2JEMA 1AX2A 4V1PA 3VBFA 1JHJA 5EP9A 4LITA 1Q8PA 2E63A 1WD3A 2VQUA 2AZ5A 3HN1A 1AXYA 2ZAAA 4GB32 4MGIE 5DUVA 3C7GA 2ZGQA 4CXWA 1NKGA 4Q4Y1 2MEV1 4AI1A 5A80A 3L9JT 4K1ZA 3BPZA 3ZXJA 4J1XA 2F17A 4HVOA 4E27A 3LSEA 5FP7A 4KL1A 1J3RA 2ZCWA 3K4AA 5T5JA 1GNZA 3O0VA 1VBB2 4GMP0 3DXUA 4BU2A 4XCAA 3THPA 3O5SA 3FE5A 5DAXA 4CEWC 1LOEA 1UCXA 1JUIA 4W4ZA 4CEYB 1OSGA 2PN5A 3O14A 4J1WA 2PLV2 4GQ7A 2AEZA 4N43B 5I8TA 3T1LA 1NLQA 1BHGA 2KXLA 2RS32 4DB5A 1XNTA 4XJAA 4JZRA 4RR3A 1B35A 1XU1A 3OPZA 4GKYA 3T0BA 4TN7A 4AR2A 2VW2A 4FXKB 4Z2WA 1YQ2A 3C2UA 2QQOA 1H1AA 1LKNA 1RUC3 2VQTA 5GZFA 2NM1A 2OVUA 4PBOA 1R1A3 3T4VA 5IK8A 4RHV2 1NG0A 2W92A 5FMBA 2IC1A 2WO3A 1LHVA 4TZDA 1NXMA 1IPSA 4Q29A 4DO0A 5F6KA 4AI0A 5LBEA 1MS1A 1NCRC 4EN8B 1UY4A 1WCSA 4GXLA 3AJYA 5CZKA 4CP9A 2DCZA 5EWSA 4GH4B 1ZVFA 4LIUA 1PO11 3WF3A 3A4UA 1JS9A 3VHPA 1WA4A 5AC91 1XQNA 2W5FA 3DPRC 2VE1A 4QX3A 2ZHMA 1Z7S2 2V4AA 2UURA 4QX2A 5DN2A 3DL3A 4WZCA 3AYEA 2RR13 3KV9A 3ILRA 3TOJA 1UYYA 1PGSA 3MIDA 2FQPA 2RE9A 3NJYA 2UU8A 1LR5A 1MQTA 4GALA 1DYOA 1SEFA 4QQLA 2A70A 3PMSA 4XACA 2ZEZA 3WXPA 3ZM8A 3RZKA 3VBUA 1J1TA 1JU4A 1OPMA 3SH3A 1HQNA 1UOFA 1YFUA 1STMA 1NZIA 4QKDA 1PMIA 5FZ8A 3FHQA 3ZPYA 1Y9MA 1RUC2 1Z78A 1OFNA 4CDXC 1GWKA 4YG6A 2IXCA 1YYNA 1PGW2 2HWF2 2RJ2A 1B35C 2K9ZA 3AP7A 3SLIA 2BVBA 3UL2A 1TMF1 5FQ0B 1BEV2 1XYPA 4K20A 2P3KA 5AVAA 4AEDC 2KA3A 2D3SA 4XW3A 2WZEA 1K5JA 4M0HA 2WNVB 2W68A 5FPAA 3UK9A 3JQWA 1BCXA 1ZZCA 2ADEA 3WNKA 3MIFA 1J59A 4JQTA 3OYWA 4NVPA 3SCHA 1PZ9A 2XONA 5FZ4A 2JDKA 4Q4W3 5C5UA 4NIGA 2UY8A 2OUHA 1F5JA 2VY0A 4XAAA 4L92A 2VZ1A 2F6BA 2HWB3 1PMHX 3LAGA 2OZJA 5JIUA 2HLEA 5IYYA 1OLME 4PDWB 1HB4A 2QJVA 4LO4B 2WNUC 3OUHA 4PLNA 4RHV3 5E89A 4RYDA 5A32B 1VRBA 3V0AB 1QIQA 4JGZA 3ST7A 3VUOA 5IK7A 5CFDA 1JYVA 1ENRA 1GOHA 3B3QE 3LB9A 2WSVA 1CAWA 1QKQA 4AVTA 2UWAA 1MS9A 1W05A 2ZBJA 4YVSB 4AFBA 1WW5A 4YVWC 4EWAA 4IQPA 4YZ2A 1Z7S3 2VG9A 2OPKA 1V6MA 1A6CA 3IMNA 4GJYA 2BDRA 1N3PA 1RHI2 2PHUA 2R072 3NV2A 2GNBA 3BIWE 4W6WA 4CU9A 4DINB 5C3PA 4KWLA 2VAUA 4AQ2A 5D21A 3ACIA 1JTZX 3M4FA 4XHXA 4RSUA 1JMUB 2D3RA 5FYSA 1XB9A 2JG8A 2G19A 4JCKA 4AEDA 4V2WA 3PNAA 1VIWB 1I5ZA 2BERA 2HWD1 3HNMA 1M4WA 3PU3A 2B42B 3AJZA 3WW3A 2R063 4EV0A 3JUUA 1ZRCA 2HWF3 5C8WA 5L9RA 3CZUA 1W06A 2ORZA 2R32A 2WFF3 3EBRA 3LA2A 5FUIA 4RS5B 3WQ7A 2ZGSA 4CDQB 1YLLA 1K45A 2VM9A 1WCQA 4R52A 3OB8A 4COWA 1G8WA 4BXFA 3VDAA 1Y7BA 2DVGA 2VECA 2XB6C 4EN9B 2VCMA 2JIGA 1VAVA 4Y24A 1HB3A 1COV2 1NCQB 5DXDA 3U4XA 3ECQA 1WGPA 1TNFA 2LM3A 3MV01 3LF7A 1N47A 4RL7A 3W9AA 4CA9A 1F35A 1MS3A 3LPFA 3THCA 3I59A 5FXXA 4COVA 4P14A 2RM23 4MHUA 5FAXA 4K7JA 2GN3A 3ZYFA 1AR81 1OLRA 4BPZA 2VTFA 4XYXA 4BYYA 4YVWA 4OHWA 1GP5A 5I8SA 3UKVA 3D4KA 4UFLA 1GNHA 3KF3A 1LTEA 3ZMOA 3OTFA 1QWRA 3BIEA 3B01A 5ERLA 1YFYA 4XBLA 4AQTA 1G9BA 2P6HA 1V6IA 2RDQA 4FQ4A 2CHHA 4LKSA 1NQJA 1BBT2 2CDOA 1CN1A 1VBD1 2JG9A 4DXZA 1HRI3 1MZFA 1QXJA 1UY2A 1VRH2 2EAKA 2PAMA 3THDA 1VMHA 4JC1A 2VNRA 3ZN6A 4PIXA 3JBG1 3OUJA 2RG4A 1UN1A 4ET7A 1ZRIA 5DZFA 5E8AA 5J09A 1WD4A 2ZX1A 1SLBA 3KHBA 4YWAA 5IVYA 3ZFGC 3LDRA 3L2HA 3GGLA 4N43A 3ZLIA 4QPYA 3VBRC 3ZXLA 5ACA1 3WP3A 1RGSA 3NVCA 4CVUA 2E9QA 2OQ6A 2ZA9A 2RS52 3CU7A 4GKXA 4CDUB 1JYCA 1HXS1 3SHRA 1AZDA 1WCDJ 2NMNA 4QDQA 3VBSB 2R16A 3WNPA 3O1VA 1QJU2 4UOJA 1OI6A 1S0BA 1GOFA 5BNNA 2W87A 3I2OA 3UGHA 3D0JA 5HPOA 4HVQA 1TME1 1YQ5A 1YO8A 2GH8A 2GMEA 4XFBA 4AI3A 1U5XA 1BEV3 2JDPA 4FPGA 4MZUA 3O1UA 2VGDA 1K3IA 2C4XA 2YROA 2DURA 1ZREA 1OA3A 2AREA 3ZXEA 3BTYA 1JZ4A 4QD2A 2BGOA 3T3YA 5FK7A 3ZFFC 2ERFA 3I3BA 4FXGB 5JOXA 5DAQA 4U2AA 3BKZA 2CSGA 2DFCA 2R1BA 4TXWA 2QQUA 4ZZ5A 3WDVA 5AC93 2KM2A 3PU8A 2GZWA 1MVEA 3AM2A 3B7MA 3J7MA 1S0EA 5FLJA 3T2QA 3BALA 4AWDA 1H8VA 1RHI1 4MGTA 5HCBA 4JTOA 1G9CA 2EAAA 4IXLA 2IXHA 4GWJA 3KD4A 4XETA 4ES9A 4HK8A 4OI4A 3TYJA 4LXLA 2WWSA 4BQ4A 5FDBA 3PUQA 4PI2A 5GM0A 3RJ2X 3I3EA 3HT1A 2VUJA 4NWWA 3PL0A 5K9YA 3WX5A 4S2DA 3CJXA 3U11A 3RZLA 1HKDA 3UKTA 1H2NA 1JOBA 1CIWA 2NLRA 1E5RA 4CUCA 4XTPA 1UY3A 2JDNA 1YHFA 2KD7A 3Q8AA 2XWJB 1FNZA 3EMRA 3GBFA 4WM7A 1LAJA 1S2KA 1QH7A 1RUD2 4XABA 5C3OA 3MICA 1CESA 1T6GC 2QE3A 2TNFA 5JXHA 4LKDA 1M06G 1C5HA 1MEC3 3DKQA 4P9YA 3USUB 2ZGPA 4ASMB 5C6CA 3MF9A 3HN3A 4CU7A 1Q43A 2WN3A 2Q1FA 2VMDA 1JODA 1XU2A 5EXOA 2RS51 4YVSC 3VZLA 3ZYIB 1W6OA 5A3TA 1D2QA 1R082 4Y5SA 1YIFA 3WQ0A 4FTBA 2RS11 5JUVA 2RS33 1DLCA 2WS92 5EHDA 3PJYA 3U0ZA 2QTWB 4QGLA 2PQQA 3H1MA 4R4ZA 5L19A 3O1OA 4YM2A 2VCAA 4CU6A 1LHUA 1URXA 2XUMA 2ZKLA 3N36A 4XFGA 5JIAA 3UETA 4JX0A 4JGYB 4PQQA 2W47A 2OKXA 3WW4A 1LGCA 1GZWB 3LD8A 4OMDA 5IWFA 4AFAA 4BM8A 5KXEA 1RMU3 1HRV2 1VBC2 4IEXA 1X82A 1JOPA 2J1VA 2J42A 2ZX0A 4P00B 1ND2B 1VBB3 2WLQA 5A3OA 5C70A 5GZEA 2E32A 4XF4A 4RN5A 1L7RA 4A45A 4TTGA 1K5MA 3JCIA 4LKEA 3SNMA 4HPKB 3A23A 3UKNA 3Q8CA 3Q8BA 1AR83 5FJKA 1BMV2 4HKWA 4Z07A 2A6XA 1H2LA 3OSDA 4Q8KA 2HWD3 2RV9A 4PIZA 3T2TA 1OMIA 5F9TA 5FZFA 3IIIA 1QJFA 4WM8A 1AR61 1RITA 5FYBA 4D8MA 4O9EA 2O1QA 1HIXA 1PGW1 1RIRA 3ABZA 2FDHA 4JKMA 1WUVA 1DGRA 1NY71 1VMJA 2BZDA 2ZMLA 2HWE1 4QHBA 4UFIA 1ND3A 5JVVA 4YNIA 3DF0A 2N7GA 1QEXA 5C8CB 1D4M1 2LALA 4MX3A 4OI0A 4L2NA 4D7SA 5FRAA 5CADA 3OPWA 4IEQA 1POQA 3N7JA 4KWUA 1AHSA 4YG0A 2VOWA 5FMDA 5FXVA 4FP3A 2Q8OA 3CEWA 1LOCA 3VBFC 1DYKA 3QBQA 4LA3A 1DQ1A 1QHDA 2BOIA 4PLOA 2JKBA 1MEC2 1XE7A 4IEOA 1G86A 3E6CC 1CD3G 3KF5A 4ONUA 1G9FA 2AGSA 2VNGA 3NQHA 1VBA2 3HR9A 5EFUA 4MGSA 2DUPA 5F1RA 1QXPA 2HEVF 1W3VA 3I7DA 2XJPA 3OBTA 3GBGA 3AZXA 4CP2A 1YCIA 5IFPA 1O3SA 2CDPA 5FZOB 5FZAA 5A6XA 3C7EA 4A3ZA 2BNNA 5A3UA 2WZR2 3WHUA 2F4PA 1O5LA 5KHHA 4Q1RA 1YJKA 2ZABA 1OFSA 4BB3A 3ME2A 2BBAA 3HEIA 4AHZA 4XDQA 4RR3C 4IV1B 2VPVA 3A7QA 3KQ4B 1W0PA 5T52A 1VP6A 2XUEA 4BQ5A 4CCOA 3ZIXA 1BKZA 1OVSA 3GZUC 2W9XA 3AXDA 2CNAA 3CQOA 2WLPA 4FPOB 3TAYA 1BZWA 4CP0A 1JN2P 1ND3C 2E53A 1N1TA 2IWGB 2QQWA 3BCWA 1W9YA 3JD72 3K75B 1SHWB 3I97A 5KC5A 3LA7A 5HXVA 3VZNA 5LA1A 3HT2A 2IUWA 1V6KA 3INAA 1W8NA 1DBNA 1W8ZA 4NRPA 5M0TA 4O61A 4F7ZA 4COUA 3V65A 5ANNA 4CCDA 2WR9A 2JG9B 4Y4YA 4D7TA 4F8AA 3VKFC 3DUIA 5GJ6A 1CPNA 4CCKA 3QLQA 3IAQA 2R062 4DS0A 4KWKA 4XFCA 2ZGTA 2FD8A 1RJ8A 1O59A 4FPYA 5H9RA 3MW2A 4GWNA 1OKOA 2HWC2 5DDJ1 3GXUA 1H9PA 2XLFA 2P2KA 4GWIA 3TEWA 5FR3A 4P5HA 4LIVA 4YZ4A 5JPMB 3VDDB 1TME3 3FUQA 2DCJA 2OZ6A 3H7JA 2W1UA 4QPGB 2NZ9A 3VBUC 2A6ZA 1LGNA 2XL7A 3LFMA 5FQ0A 2P3IA 4H7LA 1GNYA 2WWUA 1VBE1 1BQPA 2X53S 2YV8A 3KM5A 4LUMA 4O9GA 4RFRB 5CIRA 5F2WA 4AXOA 1DGWA 1UQXA 5C8CC 4KG8A 4DXTA 5H9PA 1UYXA 2ZGOA 3AB0A 1DU3D 2WC2A 4INDA 2D40A 4LEJA 2CAVA 1QJY1 2EXKA 4NE9A 3I4IA 3ACLA 4IV3B 5FFOC 4DRRA 5JWPA 5FJHA 2JB8A 4RA0A 4QDSA 1PHMA 1VLNA 3MO4A 4IGQA 3IT8A 3NMBA 4PLMA 4QXKA 3KS7A 3VBUB 3I49A 1ND2A 4BWOA 1S0GA 3J8F3 1LNSA 2C24A 2IXJA 1KS5A 3T2PA 1Q8VA 4TWTA 4COZA 1LENA 1NY72 1P8JA 3CBNA 3M3CA 3K3OA 2WZPP 3K4ZA 1YJLA 4GZ9A 1VBE2 4JTNA 3VBSC 2DTWA 4XILA 1A3KA 1TG7A 3FFZA 5FP8A 4ZS2A 4GH4A 1NA1B 5GKAC 4RHV1 5CVRA 4QT6A 4Q5OA 1JI6A 3HOBA 1AL21 3MIGA 1MS4A 5BNOC 1WA6X 2ZHKA 2O8OA 1DF0A 3JB8A 3BTXA 5KR7A 5EYYA 4P9JA 1MEC1 3RS6A 3H1WA 1EPWA 2MEV3 2J1SA 1DP0A 4Q0VA 2ZAHA 2MPFA 2YBKA 5FPVA 1ULEA 4OYUA 5CBLA 3POFA 4Y22A 4KBBA 3I2HA 2R071 2DVAA 1ZZBA 1JYXA 3CF6E 4XJWA 1CGPA 2ARCA 2G9FA 4LE3A 4COYA 4BOWA 1D4M2 4S2GA 5A1LA 2AC1A 4KH9A 5I93A 4E8DA 4YFWA 5IVCA 1CZVA 2ZX4A 5T55A 4LBMA 1UU5A 2QZ3A 1ZX5A 2VUDA 2JDMA 2JDHA 1GU3A 1VRH3 1L3JA 2DU1A 2X5IA 2YPJA 3AZWA 1PVC2 4AW7A 4M01A 4AF9A 1Q56A 4EQVA 2VCBA 5FY9A 4OVEA 1ND2C 5IVBA 3ILFA 2E33A 1ZZ9A 2VNOA 2ZGNA 3U07A 4FFIA 4N90A 2OPWA 2P1BA 5J1XA 1YFWA 3DCQA 4YM0A 2ET1A 5A7NA 1Q8QA 4BJ0A 1GYKA 1BK0A 1SCRA 3ZX7A 1PO12 5FYVA 1DQ5A 2V4VA 5FZ0A 3NNLA 5GLUA 3WCRA 3ZPOA 2Y64A 2J22A 4ARXA 3F95A 3LDKA 1NLRA 4R9DA 1FI2A 1X7NA 1YEWA 4I09A 1V0AA 4OHXA 2Q30A 4R4XA 4CDQC 5HXMA 2VVDA 5BNOA 4PF5A 4FOVA 2E7TA 4SBVA 4EWDA 2WWJA 2W1SA 2RR11 3P3PA 1W2UA 4HMZA 4RQPB 4NROA 5FZIA 2J1TA 1ZBA1 4XUNA 2SBAA 3VHNA 3WG4A 5FZ3A 1SDDB 3OY8A 4MGQA 5AFEA 2YU2A 3CHXA 2R042 1RUOA 3ES1A 1O7FA 1GFF2 4N53B 1UIKA 3IAPA 3M3IA 2V09A 3ZYJB 4QB6A 1ZZ6A 1PVXA 4NHXA 3ACHA 4PF1A 3A22A 3UT0A 1V00A 2D6PA 3VKNA 2OW4A 4IL7A 2OA2A 1Q3EA 4HOOA 4A44A 5I0SA 2JG9C 5E16A 3RNSA 5L36A 3OD0A 1JOJA 2G1MA 3VBRB 4UFJA 5F7UA 3M3QA 3EXUA 4AVAA 2D97A 4B8EA 1C57A 1GQPA 1E57A 2Y6KA 1AJKA 1PMJX 4CXYA 1HJFA 4ORFA 4P5YA 3AXEA 4G4FA 3TN91 1EP0A 2C6SA 4LMFA 4NHMA 3WNXA 2Q8EA 2GMMA 4C8DA 4N43C 2PHXA 3J4UH 2JJ6A 4QQ2A 3AKPA 1F4AA 3FHIB 3VBRA 1ST8A 5CFCB 1QJX3 4XF1A 4B7KA 5FPUA 5LASA 4RR3B 1BBT3 3HIFA 5JAXA 4Q4W1 4Q4Y3 4C90A 2BQPA 4S2FA 5CEHA 5DAPA 4WBBA 4META 5F3CA 1U0AA 2W39A 4P9WA 1PNFA 5KHGA 3BYWA 1REEA 2BU9A 3SH5A 1H6XA 4LK7A 4AHXA 4EZHA 1RUI3 4LT5A 4AHWA 4AEJA 4AG4A 4YGBA 4AGRA 3SQOA 3D0SA 1A78A 3OJBA 4AE2A 1CZSA 3V0BA 1U5ZA 5CKQA 4AFMA 5FTTC 3OGVA 1XOYA 4ISQA 4FPJA 2R1DA 1YWKA 4LBNA 4XDOA 5JI7A 4E9KA 4EN0A 1UF2C 4NAMA 1LEDA 5CKNA 2GN7A 2L9LA 1VBE3 2A1XA 1N3OA 2XJRA 1AXZA 2RVAA 5DAWA 3J26N 4QX5A 4JKKA 2BNMA 1KDMA 3CKHA 5DDJ3 4Z92B 1AL0G 5BNQA 5FOJB 5LCWL 2X09A 5HV0A 1DQ6A 2QVSB 3CJIC 4Z82A 4TLGA 2JG8B 1WLTA 4NJ4A 2VOVA 3WP6A 1S0JA 3RZGA 3GJBA 3SISA 2DWRA 1PVC1 2TEPA 3LE0A 2WZR1 1RUF1 2JDZA 4I3GA 2AR6A 5JCTA 5GZCA 4MH0E 5K4LA 1HB2A 3TEYA 4BMBA 1FV3A 3GCXA 3NAPB 3R0RA 1K12A 3DECA 4XFFA 1YC61 3IDEA 2ID4A 4WM7C 2CY6A 2BWAA 3MHZA 2WRAA 1GOGA 4YW2A 1QOTA 1DLLA 1UOGA 2IXLA 3ZFFB 1FNYA 2XXZA 4EN7B 5ACA3 4B7EA 1AYN1 4Q4X2 5CG9A 3R4SA 1W9WA 2ZZJA 5I0RA 1ZBA3 4NAOA 3WF1A 2WQ4A 2ZXQA 3M8LA 3GZEA 5J48A 5A1FA 4XMIA 3KT7A 5T5PA 2QQPA 3J7HA 5DQ0A 1AR72 1AX1A 1HLCA 1RUJ1 3ILNA 2YY1A 4FQZA 4XFIA 3VL9A 4CUGA 5FKCA 2XLAA 5DUWA 5JR7B 2GDFA 4CYDA 2VZRA 4KMQA 3I8TA 4UXAA 2R6QA 3ZFEA 1IS3A 1R093 1LU1A 1RUH2 2YGMA 1PX3A 5I0TA 1FT9A 3BTZA 5BPXA 3WNOA 1VMFA 2QQMA 3ETPA 3DN7A 3B5LB 3MEPA 4CRQA 1GLHA 1JZ5A 5CYYA 3B93A 1ACCA 1W6QB 3G7DA 3ELNA 1CPMA 1RHI3 1XRUA 3FJSA 4IE4A 2HH9A 3I3QA 4XCBA 3PLQA 1FX5A 5HCHA 2ZTNA 4XPVA 3ZVXA 3E6DA 4E4SA 1QQP1 4UFKA 4FFFA 4IERA 4JV4A 1ZA4A 4GB31 4HZFA 5FMOL 1S1AA 3FC0A 3PUSA 2NYYA 1HQWA 5HV4A 4D94A 1D4VB 2XJVA 4KNCA 4BE3A 1X9PA 3AKTA 4ITCA 5CAZA 3U14A 2B9UA 1TME2 4FOYA 3ZOIA 1JH5A 2A71A 3BU0A 1IGOA 1GP4A 2XMLA 3LWCA 3VKMA 3AP6A 4BQXA 1TNRA 3DXTA 3SKVA 4YZ1A 2VH9A 5E1RA 5BYNA 4YVWB 4BH9A 3IIAA 3PJQA 5FYUA 1ULDA 3WV6A 3W59A 3WZ1A 2ZGKA 1AR82 2MNGA 1R1A1 5JI9A 1KXGA 2A6WA 2VMFA 4IE0A 2QDRA 2QQNA 1B09A 4CTEA 4WVMB 1SQ4A 3M70A 2Y26A 1PK6C 5LK7B 2XQXA 4MSVA 3CNAA 4IV1C 2BJSA 1PZ7A 1AYM3 1GICA 2W1WA 2BV4A 3ZFEB 3KQRA 2ZMKA 2ZHLA 2GMPA 3LCPA 3O0WA 1PO23 2ENRA 3VV1A 2DVFA 4Z2AA 1AR73 3O0XA 3ZO0B 1T6BX 1DGRN 2W94A 4W8JA 5FP3A 5J98B 1G7YA 2ZGRA 3A0NA 3MPBA 5GLTA 5FMCA 5T3NA 4FPLA 5FY7A 2XDVA 5K0UB 4WVZA 2VL4A 2GAUA 3D82A 1J3PA 3BN6A 3N3HA 5FY1A 5JSRA 2JB4A 2ZZQA 3A21A 5ABJC 4EE2A 4FCAA 4AEDB 4G9SB 1JW6A 2VW0A 4P9IA 3SH4A 3C7FA 2HWD2 1KJLA 1X8EA 4XJUA 2DBNA 5JOWA 2Z4FA 4PCRA 1O6UA 3AL5A 2FDGA 4LHLA 4YLZA 2ZMNA 3ZXDA 2WNEA 1W03A 4ZU4A 4ATEA 4D3WA 1H8TB 2WO2A 4IETA 3UJOA 2V5DA 4C91A 3KGZA 5FZ7A 2HKXA 4K8RB 1CAUA 2NN8A 3OGGA 3VDDC 4HVRA 4RQPA 3VGIA 3ZN5A 2PFWA 3AZYA 4YVSA 2NP0A 5ANQA 4Y33A 3O7OA 1A8DA 4X8PA 2RS53 4LO8A 2WL1A 2HEWF 5HBAA 1PIV2 1DZQA 4FVVA 4NHLA 4A7KA 1R091 1PGL2 3U75A 4BK5A 5FXWA 2WYFA 2RS31 4JKLA 2BPA2 2E6VA 1RUJ2 3NV1A 4UI9L 3ZSEA 4DXSA 4AAXA 1PO13 1FPN2 1H1MA 2B9VA 4QAWA 5JMOA 2VMHA 5C9AC 5K8SA 5A3PA 1VBA3 1XPWA 4XJ9A 1ENXA 1JZ2A 1RYYA 4NPMA 1JBCA 1CR7A 3WEZA 5A6QA 5IK5A 3NJXA 3WQBA 4CSWA 3VZMA 4LBJA 1GV9A 5JPNB 3P1IA 1HRV1 1VBC1 5A7OA 1ZBA2 2D6KA 5FBZA 1ENSA 1K5MC 5DPNA 5CA6A 1NCQC 3R6SA 3WDTA 4QHOA 3EB7A 5CNAA 2IFRA 4YW7A 1DYPA 1ND3B 1SG3A 5ABJA 2FDFA 5JOYA 1HB1A 2YU1A 4PDWC 1DQ2A 3RZZA 4DMIA 1H8TC 2P37A 5IATA 1S0IA 3H50A 3FZ3A 4OHVA 5IFTA 3IDCB 5D8AC 4JDNA 3MIEA 1PIV3 5FZ1A 3AVRA 3J8F1 4RGAA 1V9U2 1R64A 1VAMA 5IVJA 5JOZA 1FYUA 4CEYC 4CCCA 4ZXEA 1Y3TA 4RD7A 4FPCA 1WCUA 2Y38A 1R081 3AMQA 3PHMA 4P02B 4UW5A 4ES8A 3B9IA 1Q8SA 3NV4A 3OCPA 1ASJ1 4UBHA 1SMVA 1MS8A 2QQVA 3FHAA 5DZGA 3WNNA 2P4EA 2WO7A 5FREA 3ZYHA 4QB2A 5J96B 3D8CA 1W2OA 3VBHB 1C3HA 1XXNA 2VBPA 1CX1A 3EJKA 4BXSV 3DYMA 4LBOA 1VE0A 3S5QA 5LBFA 5FMOS 3T1MA 2WYSA 1OHFA 4XEZA 1NUKA 1RVF1 2EXHA 2WABA 5EV7A 5FYHA 1K42A 2WAAA 4KGGA 2YYOA 1WWYA 2RDNA 2QUOA 1UU6A 5KHJA 1UX6A 3AKRA 3OY8B 3QOPA 3OUIA 3M2MA 3MPPG 3V64A 3AP4A 3CJIB 1KD7A 1IKPA 1RL3A 1SPPA 3BPSA 1RUJ3 4MYEA 4AFCA 4BISA 3WDXA 2BBVA 4HN1A 2JENA 1WW6A 3JB4C 3DGTA 4QX1A 3VDBA 1F4HA 4WZFA 1FMD2 2G4IA 3RYPA 2CGOA 3PUIA 1RUI2 2XJQA 3BOPA 3HD8B 2Y6JA 5FZ9A 1MACA 5D8AA 5LEKA 3Q9OA 1CQ9A 3FFQA 4OMCA 1RB8G 3MUY1 1GR3A 3AYDA 1IS5A 1QY4A 3LZZA 4CEYA 4QPGA 5ABJB 5I0DA 1LB2A 4K9SA 5EJ3A 1UOBA 1UXXX 4LHNA 4GMP3 2R49A 4FSJA 1BJQA 5FP9A 5A6YA 1EAH1 1Y9QA 3BUCA 3MFAA 2VR4A 4M4PA 2ZGMA 1UYPA 2DVBA 2J1RA 4JGYC 4B4PA 2Q8CA 3POJA 5T50A 3H8XA 5IUQA 2RDRA 1O8PA 3MLJA 4GB33 5FYTA 2D5HA 3FMGA 4FAGA 4MVTA 5JMCA 5DDJ2 5C71A 4LO7A 3VKLA 4CDQA 4E4DX 1OD3A 4J25A 1DG6A 5A7PA 2A6YA 3P6BA 5C4WC 2VBBA 2JKXA 2J1EA 2BGPA 1TEIA 4QPWA 2PXJA 4Q4X1 1AL23 3N9QA 3VDCA 2CV6A 3EYPA 5F39A 1S4CA 4H2AA 2WS93 3JBG2 2R30A 2UYAA 3CLPA 2P34A 4A6OA 5A6ZA 5LBBA 4YARA 4I2OA 2G9ZA 1UY0A 1VR3A 1UMZA 3PTRB 2A6VA 2PAKA 4IGPA 2BOJA 1US2A 2B7YA 2AACA 3ACFA 1H30A 4HONA 1DDLA 5JDBA 5GZGA 1N1VA 3BI3A 2GALA 2EF6A 1LGBA 3KSCA 4LQRA 1OF4A 2FZ2A 5IT6A 3K3NA 1HV0A 3GHNA 1RUE2 3WDWA 4YW1A 2QBXA 1W6MA 3UNPA 4R8HA 5DAVA 5IK4A 3KHCA 2VZSA 1HDKA 3AZVA 4BMEA 4QU1A 3BB6A 3NKTA 2BFUL 1SCSA 2P6CA 3ENRA 4QQHA 3NNJA 5GLVA 1RUH3 3D6EA 1G9AA 1ZRFA 2D7FA 1JZ8A 1CVNA 4PJYA 4QXHA 5IJRA 5K0UA 5HCFA 1VPHA 2RHPA 5F5IA 5T5OA 1NLSA 3ZN6B 2HEYF 4DXRA 3LEKA 1NCRA 3W20A 1ZNPA 3TN92 1O5UA 2PA7A 5EPAA 2ORXA 3RJRA 2NMOA 2VMCA 5TSWA 5KHIA 1DHKB 2RM22 1NXD1 4XJ8A 1VAKA 3EO6A 3I2FA 2LS6A 1IHMA 3AKQA 1RUI1 4KG0A 4Q4X3 5IVEA 3WG3A 3K48A 5FZEA 4NN0A 4CEWB 2RDSA 1SLIA 4XMAA 4LUKA 1UMIA 2A7AA 1W28A 2FCTA 2D5FA 2PHTA 3WY6A 1QDOA 1KITA 1KFXL 1DGLA 3W58A 4ISRA 3DYPA 5LY2A 4OUSA 3IDBB 3SCFA 1QMJA 3IMMA 3J7NA 4YSFA 1GANA 1OKQA 2QFEA 2WJSA 4YPJA 2LW8A 1WCKA 1XC6A 5A7WB 3IDAA 4LA2A 5FO9B 3MLKA 4PHZA 3S57A 4XVHA 4H55A 5FZBA 5FZ6A 4QM9A 3GHMA 4LOSA 4BIOA 1C4RA 5AFBA 3EHKA 5B4NA 3CJIA 5L7OB 2E7QA 1BMV1 4PI0A 1D4M3 3N9PA 3WF4A 4BQ3A 2VO5A 4XUPA 4AVSA 2B8MA 5LA0A 1TMF2 2W46A 4I02A 4NPRA 1O4TA 5F32A 4B29A 3MLLA 2WT2A 1UZ0A 4IEZA 4IW3A 4J6GA 1MR5A 3IPVB 1RTVA 1UO9A 4XXPA 3WP4A 1UU4A 3VLBB 4BQYA 5H9SA 3FBYA 4N53A 1KS4A 1W8FA 5E6HA 4UW3A 1GZTA 3C3VA 3WW2A 4EROA 3VBHA 1DGWX 4FO9A 3H7YA 2FMYA 2PTMA 2ZEWA 1O4YA 2I45A 2WNUA 1FMD3 4A3XA 4IEWA 3DV8A 4AI9A 2RMU1 4I0WB 3H3LA 4JGZC 1RUE1 4GD4A 3QCWA 3GJAA 3RWKX 2YBPA 3PUHA 1BVP1 4CDWC 1MQTC 1SFPA 3HBKA 3WINE 2EXIA 1QF3A 4BQ1A 3N9OA 5F3EA 4CCMA 3NNMA 3OGRA 5A1AA 1L7LA 3LPGA 4IGOA 4IV3C 4L97A 3ZFEC 1CAVA 2E31A 2EVXA 2OIIA 4YM3A 2HWE2 4I0BA 2W3JA 4UFHA 3N9MA 2Y6FA 3IN9A 2JX9A 3OEBA 5I0UA 1SDWA 2YFZA 2XVLA 1RUH1 4LOTA 2RJKA 5IVFA 3K51A 3N9LA 3RMXA 2JG8C 2YB7A 5FO7B 2P3YA 2Q1MA 1SFNA 2VZQA 1XSQA 3I2IA 4W50A 4DPNA 1RMU2 4Y1UA 4UBGA 1FOD3 1WBFA 3IBMA 3I3DA 4HBNA 1RUC1 5CU1A 2XH6A 2XOMA 2DFBA 4EYUA 5FZGA 3AFKA 4UW6A 2A5ZA 2OYZA 2GC0A 2WFF2 5BNOB 3E97A 4KBZA 1OUXA 2AENA 3RFRA 1PVC3 2D44A 1CZTA 4KI5M 1EAH3 4QKBA 3AFGA 3TNPB 1TQ5A 1AYN2 1HXS3 4N53C 4LLOA 4B1MA 4AVVA 1F2NA 2ZACA 4B3NA 1AYM1 3VBHC 2WIIB 4P9GA 4JQRA 1XJAA 4CZSA 3RQ0A 5FLHA 1GWMA 2ATFA 3GNEA 4AQ6A 4QHZA 3NW4A 1U5YA 4BK4A 5JZGA 2Y6GA 1JYNA 1QNYA 1KEXA 1PM4A 2E26A 2ZPXA 4JDOA 2XBO2 3O1PA 1UKGA 2AUYA 4AVCA 3E5XA 1XYNA 3V0BB 3FLPA 4WVVA 2WSUA 1IZ3A 4A6SA 2VOTA 4YZ5A 4IEPA 5FZHA 2QQIA 3WUDA 2VJXA 1UD1A 2B39A 3KVBA 5BUVA 3HWJA 5F2SA 2W0XA 4RFT0 1V6LA 1GQHA 2H6BA 1US3A 5A7SA 3FLRA 2HBTA 1XE0A 3FN9A 2JD4A 3I2GA 5AC92 2YFUA 2YUEA 2ZX2A 3Q8EA 1ONAA 3GBWA 3Q8FA 1LOGA 4N7IA 4W6YA 1QJU1 1FPN1 4M3CE 4EJRA 5CFCA 2BNOA 1MS5A 3JZVA 2VVFA 3FWEA 4FTSA 3QD6A 1W8UA 1JYWA 1TVGA 2YMZA 4K6BA 3IKWA 4ZKTB 5FCCA 1X36A 3LEGA 4Y20B 4Y22B 4OZOA 4XZPA 2XQRA 5F3IA 3WF0A 4DRVA 3H9AA 2X10A 1Q8OA 1I6XA 1QJEA 2TUNA 4QQOA 5CISA 2WO1A 3T2OA 1UL9A 3LIHA 1ODNA 2B45X 3LKJA 3KLSA 5FWEA 3TEXA 1RUF3 2J1AA 2DUOA 2VTXJ 4LBQB 4CCLA 4BA6A 3NJZA 3HPNA 3M7AA 4XBQA 4C1XA 1T2XA 3OEAA 3M3OA 2PLV1 2C0ZA 3ALQA 4MGZE 5DUXA 2IXKA 4XOGA 2VVEA 1N3QA 2Y6HA 5EYXA 3POIA 3VBOB 1EY2A 3SXWA 3OBRA 4C0BA 2A73B 2ARXA 4URAA 5A7QA 3VDDA 4RQPC 5FZDA 3ZKYA 3BTAA 1COV3 4NO4A 4YGDA 2BFUS 4K3UA 3ZN4A 4HANA 1AR91 1W8OA 4Q4Y2 3VD9A 2VZOA 5I8YA 1XBFA 4YZ3A 2PELA 4NHKA 1L7QA 4OFGA 5JXIA 3ITQA 4MADA 3HVDA 4QX7A 4N9HA 1LECA 3O1TA 1MS0A 3NKGA 3HQXA 4HKOA 5LRSA 5CB7A 2EALA 3RSJA 2VCCA 3WOGA 2GC2A 1OVPA 2AYHA 4FFHA 1F15A 5FYZA 3AP9A 4E4HA 4NRMA 1QJZA 4S2HA 5C9AA 4DUXA 1I5PA 3TBDA 1AYM2 1D2SA 1ENQA 3POYA 1D7PM 3E1F1 5KXBA 5LRRA 4LBLA 4F83A 2XPJA 1W2NA 4FOWA 3IM0A 4QPIB 1HRI2 3FLTA 4A7ZA 2HWC3 2CGNA 2ADDA 1DQ0A 1H1IA 5IAVA 5FPLA 2LRPA 3WD5A 2QDNA 5IVVA 5FPBA 1ASJ3 2H0VA 1OQEA 3MFCA 4Z1VA 2WN2A 1CAUB 1AR92 4Y1VA 3ZKUA 5LW9A 1YI7A 3C7HA 1GSLA 3ZFGA 2VNVA 2W1QA 3JBG3 2FZ1A 4PQ9A 1H8TA 4OUEA 2VXRA 4ZZ8A 3AVSA 1OA2A 3NV3A 1AL22 1VB2A 1VBD2 3KCCA 5DG1A 4DFSA 3HAGA 3AK0A 2VZ3A 1AX0A 1WKYA 5FZLA 3U37A 4DNYA 4FPFA 4BHPA 2QCSB 1W9SA 2VMIA 3B02A 2ZS6B 5F5CA 4CCNA 2DU0A 4XQ4A 1AVBA 5DMYA 1UPIA 1XNCA 1POV1 4ZONA 4CUAA 5C7GA 2VC9A 2OQ7A 3KCXA 5EJZB 5B4XA 1W6PA 3WW1A 5JR2A 4GJZA 1OF3A 4OQ9A 3MI8A 2SLIA 2X05A 2MHFA 3KMHA 3ZFFA 2VW1A 3X29B 1HN0A 3S6PA 3WUCA 1DFQA 4OUMA 4IV1A 3S30A 1DZRA 4M00A 2FDKA 2C26A 3GYDA 1FXZA 4PIYA 3NAPA 4N9IA 3RG0A 3OYWB 1FPN3 1NT0A 2JXAA 3HJRA 4NUBA 4OI1A 3LEIA 4MXWA 3N4MA 1W8HA 2GNMA 3KZ4C 5J36A 4OQ8A 1R1ZA 2BUKA 4WVMA 1SBFA 4LORA 1TE1B 4IE6A 4IEUA 4LHSA 4LBKA 2K0GA 2PHLA 1UXZA 1RVF2 2DYCA 3IB3A 1KDKA 3TN93 4C0HA 3I59B 1JZ6A 4YM1A 5D8AB 2WZR3 1W8TA 3O1RA 4B4RA 1NE4A 3PVBB 1MZ6A 3UV9A 2XBO1 1OLMA 4ZPIA 3HQRA 3PDQA 4OZXA 1HJGA 4CU8A 3URFA 4ASKA 1GUIA 2JICA 2HWB1 1PK6B 1IS6A 1PNGA 3MBWA 1S2BA 3RWNA 2HWE3 3B00A 3LSDA 4AEKA 3I2DA 1EV13 2PQSA 4GMP1 3S7EA 4WV8A 1YUDA 4QPGC 5BXXA 1FATA 3CZJA 4MOAA 5J37A 2O8QA 4XIOA 1JXNA 3AMPA 1ZBE3 4PBPA 4V2VA 2G9GA 1HN1A 2X29A 5LZ6A 2ARBA 5J3UA 2IVIB 5KXCA 1HQLA 2D98A 1C8M3 4JGYA 2XJSA 3OGJA 4QPIC 1I1EA 2C9KA 2WA3A 2D3PA 2XGXA 5JSOA 1W2AX 4XBNA 3SEPA 4AVBA 3T4HB 1V6NA 3WDUA 5LB6A 1Q5OA 2OS2A 3GDBA 4P08A 3AYAA 2B46X 1KRIA 2QKDA 5C4WA 1Z0HA 1QJY2 4JRAA 4FI9A 2QQJA 4KGQA 1LULA 1UKRA 5FIXA 4Y4RA 1HX6A 1QOSA 2DF7A 4Z8BA 4BLJA 4U36A 2LTNA 2KR2A 4GIQA 3WVJA 5JLVA 5BNPC 1UYZA 1J1LA 4PT6A 2BWCA 3NJVA 1N1YA 4Y20A 4YGCA 5DUUA 4B4QA 4C1WA 4NIDA 3MUZ1 1W8WA 1UWWA 2WUHA 1WMFA 4AI2A 3OGSA 5FXZA 2EA7A 1ZM1A 2XBO3 3AP5A 3E5UA 3UGFA 2RS13 4B1LA 4D6RA 4DZGA 1AR62 2FCVA 2QZ2A 1GZWA 2CWMA 4K40A 4AHYA 1JYTA 1UW8A 2J1UA 1FV2A 2XWBB 1PX4A 1YNAA 4PDWA 3LDBA 1WBLA 1E5IA 4H3WA 5L7OC 2LROA 4OI2A 4QB1A 2JECA 5CKMA 4WM8C 1W6NB 3LOBA 3H42B 2VZTA 3L2YA 4K21A 4L99A 3RZJA 2JIJA 1Y4WA 2QQLA 3POWA 3UYJA 4XC9A 2DCTA 4HXCA 2YXSA 1J83A 2RJLA 2IFWA 4XAEA 4DQAA 1OOPC 3WSOA 2D43A 3M3EA 3PIJA 2R0FA 4Q1PA 4XIKA 5K0UC 2AEYA 1FAYA 2RM21 5I91A 1SLLA 1H2KA 1N1SA 5GLZA 3ROUA 3DKWA 3HBZA 4KU7A 3RYKA 4QX8A 1C5IA 4QPIA 1XSRA 3FL7A 4YGEA 1ULCA 4MGKE 4CDUC 2WT0A 3V56A 4CCJA 1EV12 1GZ9A 1U5IA 1QJX1 4DUVA 2DUQA 1NZCA 3KWVA 4LBQD 1EPZA 1PO21 4LJHA 5T54A 1RUG2 2NQYA 1AJOA 1FOD2 3PVNA 4XQDA 2V5YA 1AYN3 1HXS2 1YFXA 4HL0A 4UF0B 1LEMA 1A8MA 2UYBA 3MDPA 5FPZA 4MXVA 1UPSA 4ZU5A 4UYBA 3MF6A 4MV2A 1PZ8A 5SV5A 2A3XA 2PHFA 4AEMA 2JWPA 4R9AA 4FFGA 2Z5WA 1MQTB 2YBSA 3T0AA 5C8CA 2OX0A 1GBGA 5A33B 3U78A 1QNWA 5LA9A 2WNOA 1YRZA 2WT1A 3J9SA 5BY5A 1RC6A 1WMXA 2O14A 4AFDA 4BQWA 3S5AA 3VZOA 1OBNA 3JQXA 4WM8B 5APAA 3WQ1A 4E2QA 4CP9B 1FMD1 4FOQA 4Y1ZA 1WLDA 1W2TA 1MPXA 2HYXA 4D6QA 3HNYM 4XXAA 4YYOA 1CJDA 2XKPA 1O3RA 3WHTA 2C5DA 3W21A 3JD73 3MGUA 2V73A 4HPKA 4LTAA 4AK3A 3WG2A 1SPPB 3S7IA 3VD5A 2WA4A 4YFZA 5BNNB 3G6JB 1BXHA 3VB9A 2ZGUA 3LQCA 3VBSA 1V9U3 2IVJA 4UW4A 1EAH2 2VZVA 5A3WA 1BYHA 4HN0A 4CDUA 3AC0A 5C3SA 3ATGA 4Y1YA 3AMNA 2H0BA 2WZ8A 2BRTA 5CG8A 4YW4A 2Y8KA 2CU5A 4FT8A 3OBZA 1AR71 4BCUA 1VBD3 3RDIA 2P5BA 1XNKA 1G9DA 1NX9A 2R073 4N7UA 4AYUA 1EV11 4CDWA 5GALA 4NIIA 1F31A
chains in the Genus database with same CATH topology
3B69A 2Z79A 5GLWA 1O3TA 2NPIA 1WMEA 1ZBE2 1LU2A 2W08A 1IQAA 2UWBA 4IV3A 4BIFA 4E2SA 1YXWA 4Q26A 3KGLA 5D1IA 1IPKA 5SV8A 4OHZA 2K2SA 2CTVA 4AQSA 1LOFA 1V6JA 2D93A 2JE7A 3ZXAC 3ZSJA 4FP2A 4WM7B 2C1FA 4WVWA 1IOAA 2X5IC 3VBFB 1QJY3 1LOBA 4JVAA 5HCAA 1BEV1 2O0OA 2ETEA 1WW7A 1F5FA 3VKOA 2E7AA 1IKQA 1CJPA 3HMYA 2OUJA 2VQAA 4X8NA 1ZBE1 3VZKA 5FOBB 2LUWA 2PHDA 3H1YA 2GNTA 4NOTA 3LGRA 4I0AA 4XHBA 4KQ7A 2WFF1 4XQWA 4YG3A 2PHWA 4GH4C 5F5QA 3H3UA 4RS5A 3DPRA 1REFA 1RUNA 3E5QA 4AGGA 1CAVB 1W39A 2Q0AA 1OLQA 2ZGLA 4P9XA 4H14A 3ZIWA 4GA9A 3N35A 1R092 2MEV2 4W6XA 1REDA 2A3YA 3ZYGA 1EYBA 2IXIA 2D6NA 3P3NA 4ZU7A 3WCSA 2GC3A 5KC6A 5LK5A 5B2GB 4Q2FA 4FTEA 4CDXA 5C4WB 1V6OA 1S0FA 3GZTB 1LOFC 3MIBA 4CDXB 2R041 2ILMA 3D5OA 3N7LA 2JE9A 1NA1A 1KQRA 2VULA 5CFCC 4HSLA 4W65A 4F3JA 2WQZC 3IPVA 3RMYA 1PGL1 2PHRA 1PO22 3MW4A 1VRH1 1LRHA 5DG2A 1PM7A 1VALA 2YDEA 1AR93 5A32A 3V0AA 1ZRDA 3AX4A 5C9AB 1D0HA 4LLFA 4NR1A 3ZSMA 2XG3A 2FBEA 2ZJCA 3UJQA 1DZTA 1S0DA 2P3JA 1RVF3 2BYVE 5BV6A 5KWRA 4XFAA 2RMU3 1H9WA 5CFDC 4OLLA 1WMDA 4SLIA 4R9BA 4Y5Z0 3QACA 4K1YA 3FX3A 4L11A 5HI0A 1C8NA 4CEWA 4LBQA 2UWCA 2YHJA 3PTYA 3CO2A 2VU9A 3AMHA 1X33A 4FAHA 1NA1C 1RJ7A 4QGMA 3JU9A 1C1FA 1VBA1 2WFPA 4IEYA 5C33A 3RI9A 1RUG3 1XNBA 2RR12 2VMGA 2WKKA 5LEJA 2I07B 4XTMA 4CDWB 1DIWA 3MW3A 4ZXKA 2WNVC 2HWF1 2X8KA 4Q0QA 1B35B 5L73A 1F9KA 1ULFA 2CWSA 3APBA 5KXDA 3R05A 4DOUA 5A3LA 2PYTA 2XHKA 3GZAA 2GNDA 5H9QA 2VQ0A 4D7YA 4XJZA 3ZYPA 2XLGA 3WDYA 2Y0IA 5K7PA 4I01A 4AGVA 5JZGC 1ZZ8A 1LJ7A 1AF9A 2DTYA 2VUAA 2GSYA 2ZX3A 3ZMNA 4EWEA 1AUYA 1WLCA 1OPOA 1WLWA 3VHRA 4HSJA 2TBVA 1C8M2 2Z2SB 1COV1 1Z7S1 3ZXFA 5CFDB 2DV9A 4HT1T 2ET7A 1UIJA 1H4HA 3VBOC 4LR4A 1OQDA 4JAAA 2BGCA 1BBT1 1QOOA 2A75A 2Q4SA 3DPRB 4KWJA 1X8MA 1NE6A 2BVVA 4URTA 4NWVA 1QDCA 3MZHA 2IZWA 5A3MA 3VZJA 2C9AA 3WP5A 4QGNA 3QH6A 1SFYA 1R1A2 3FUOA 4YW5A 1C8M1 2WNVA 1X50A 1GKBA 1CONA 1F8VA 1S0CA 3AZZA 1BVVA 1CAXB 3QH7A 4Q0PA 4IESA 5KHKA 5EZWA 1ULGA 5AVPA 4Q4V2 1TMF3 2PLV3 5ACA2 1ZZ7A 4YW3A 4GWMA 3ZDSA 4CP1A 5BNNC 4XF0A 1HV1A 1VB4A 4OULA 1K5MB 1RUF2 1SLAA 3NO8A 3SCGA 1QQP2 1QU0A 1WW4A 2FHRA 2Z42A 3GALA 1O3QA 1HW5A 3TWIA 3VL8A 4X6RB 4XF9A 1W6NA 1NQDA 1GQGA 3GF6A 2D6MA 3VBOA 3B94A 5JSPA 1UAIA 1HRI1 2AH2A 1XE8A 4R9CA 2ZKNA 1NOVA 2XL9A 5BNPA 4DY3A 2R043 3ES4A 1MZEA 3VN4A 4TLFA 2CL2A 1UZYA 5FPXA 1FOD1 4QQPA 4K8FA 1W6OB 2HWC1 4Q27A 4Q4V3 1IS4A 2H6CA 5JZGB 2EXJA 4XF3A 3H3ZA 1CX4A 2ZHNA 2BEOA 1GZCA 1PIV1 3NL1A 1H4GA 2HJIA 5FLIA 4ASLA 1QH6A 3WG1A 3BODA 1SACA 2YZ4A 4TSVA 1RUE3 3ZYRA 1OA4A 1NYWA 5A33A 3ZXKA 1O91A 3B9CA 1O4ZA 4I3PA 3BU7A 4LHKA 1QJX2 5GZDA 4TYSA 4A2UA 1YIPA 1OOPB 3N7MA 3NSTA 4AI8A 1VJ2A 2Z69A 2R061 2Y0OA 3R4UA 4P9LA 3H0OA 4X6QB 4EN6B 4FBFA 1PK6A 3NAPC 3PVOA 2XJUA 4QMAA 1KJRA 1OD5A 4OHYA 2DCKA 4Q4W2 3POSA 4M3CB 2P17A 3ETQA 2DCYA 3PMEA 1LHWA 1ALYA 3MYXA 4HLTA 1C1LA 1LODA 3THTA 5F6LB 4L8QA 1IPJA 2B5HA 1RUG1 4Q0SA 1J3QA 2I2SA 4XE9A 2HWB2 1SBEA 1OQ1A 1V70A 3EQEA 1H0BA 4IEVA 2DVDA 2X5IB 4Q0UA 1Y43B 3N7KA 3RRDA 2FMDA 2VOXA 3VHOA 1RINA 2GC1A 1RUD3 3MIHA 3WLUA 4FPKA 1D0GA 3I54A 2D6OX 3M1HA 1C28A 1POV0 1SLTA 4JGZB 3USSA 1BK1A 4M3CA 3S0MA 1V9U1 2QNKA 1XYOA 4Q8LA 3LOIA 1JHNA 2BTVC 2I74A 4H7MA 2YC0A 4LO6B 3ZXGA 1G6NA 2Q1ZB 1KFUL 4ATFA 2WNUB 2XJTA 1RMU1 2E51A 4HFSA 4LULA 3NWKA 2CYFA 1ZYBA 3WR0A 1S55A 1XNDA 4FPHA 2WS91 5DZEA 2R0HA 1APNA 4GULA 4LO5B 4Y26A 5E88A 4E2GA 1U12A 2CAUA 4Q4V1 3RI8A 2A3WA 1YI9A 1LCLA 4HETA 1JUHA 2EIGA 5KBFA 1NCQA 1MVQA 4KU8A 4G3YC 2XVKA 3TNQA 2CGPA 3A0KA 3KT4A 3J8F2 1MZ5A 3LA3A 1RUD1 5L7OA 1SBDA 2XKOA 3E6BA 2ES3A 1LESA 4QM8A 3OD4A 2BW8A 2RMU2 4JRLA 4LE4A 1ASJ2 2RS12 3KB5A 5FO8B 1QJU3 2WINB 2PAEA 1OOPA 2HYKA 1POV3 1HRV3 1VBC3 4HK9A 1W0OA 4L9BA 1QGLA 1DQ4A 5BNPB 2Q5TA 3H8UA 3AMMA 3SMHA 2ZOEB 4M3CF 4FPEA 4E4ZA 3OF1A 1W6QA 2GH2A 3KCYA 2UY9A 3ASIA 1W6MB 3AYCA 4M0NA 4MXWB 3R4DB 4RGGA 4RS5C 3BOWA 3KT1A 1SLCA 3CL1A 1J58A 2GU9A 1I9RA 1LHOA 3TRSB 3AKSA 5T5LA 1LHNA 1QXRA 2VOKA 3SITA 3IWZA 4DY5A 1CAWB 4JDMA 1AXKA 3TB0A 1NCRB 1W6PB 3USUA 2XVGA 2D6LX 3PVEA 4HKLA 4MUVA 4D69A 1QQP3 4MLOA 3O12A 5J7MA 3U10A 4A7YA 1CAXA 4MGYE 3RYRA 3FBMA 3ZSLA 4LNVA 4BZ4A 4XFHA 3ZSKA 4QU2A 4Y1XA 4I30A 1ZRRA 2W52A 1LOAA 1JYIA 1AR63 3ZFGB 1UZZA 2YGLA 1VBB1 3WT3A 4YRDA 3RPQA 3JD71 1R083 4BLIA 1H2MA 1I3HA 2JEMA 1AX2A 4V1PA 3VBFA 1Q8PA 2E63A 1WD3A 3HN1A 2AZ5A 2ZAAA 1AXYA 4GB32 4MGIE 5DUVA 2ZGQA 4Q4Y1 2MEV1 4AI1A 3L9JT 4K1ZA 3BPZA 3ZXJA 4J1XA 4HVOA 4E27A 3LSEA 4KL1A 1J3RA 2ZCWA 5T5JA 1GNZA 3O0VA 1VBB2 4GMP0 3THPA 3O5SA 3FE5A 4CEWC 1LOEA 1UCXA 1JUIA 4CEYB 1OSGA 2PN5A 3O14A 4J1WA 2PLV2 4GQ7A 4N43B 5I8TA 3T1LA 2KXLA 2RS32 4DB5A 4XJAA 4RR3A 1B35A 1XU1A 3OPZA 4GKYA 2VW2A 4FXKB 4Z2WA 3C2UA 1H1AA 1LKNA 1RUC3 5GZFA 2NM1A 2OVUA 4PBOA 1R1A3 5IK8A 4RHV2 1NG0A 2IC1A 1LHVA 4TZDA 1NXMA 4Q29A 5F6KA 4AI0A 4EN8B 1MS1A 1NCRC 1WCSA 4GXLA 3AJYA 2DCZA 5EWSA 4GH4B 1ZVFA 1PO11 3A4UA 3VHPA 1WA4A 5AC91 1XQNA 3DPRC 2ZHMA 1Z7S2 2UURA 3DL3A 4WZCA 3AYEA 2RR13 3ILRA 3TOJA 1PGSA 3MIDA 2FQPA 2RE9A 2UU8A 1LR5A 1MQTA 4GALA 1SEFA 4QQLA 2A70A 3PMSA 3WXPA 3VBUA 1J1TA 1OPMA 3SH3A 1HQNA 1YFUA 1PMIA 3ZPYA 1RUC2 1Z78A 1OFNA 4CDXC 4YG6A 2IXCA 1YYNA 1PGW2 2HWF2 3AP7A 1B35C 2K9ZA 3SLIA 2BVBA 3UL2A 1TMF1 5FQ0B 1BEV2 1XYPA 4K20A 2P3KA 5AVAA 4AEDC 2KA3A 2D3SA 4XW3A 4M0HA 2WNVB 2W68A 3UK9A 3JQWA 1BCXA 1ZZCA 3MIFA 1J59A 3OYWA 4NVPA 3SCHA 1PZ9A 4Q4W3 2UY8A 2OUHA 1F5JA 2VY0A 4L92A 2F6BA 2HWB3 3LAGA 2OZJA 5JIUA 4PDWB 2QJVA 4LO4B 2WNUC 4RHV3 4PLNA 5E89A 5A32B 3V0AB 4JGZA 3ST7A 3VUOA 5IK7A 5CFDA 1ENRA 3LB9A 3B3QE 2WSVA 1CAWA 1QKQA 4AVTA 2UWAA 1MS9A 2ZBJA 4YVSB 4AFBA 4YZ2A 1WW5A 4YVWC 4EWAA 4IQPA 1Z7S3 2VG9A 2OPKA 1V6MA 1A6CA 3IMNA 1N3PA 1RHI2 2PHUA 2R072 3NV2A 2GNBA 3BIWE 4W6WA 4DINB 4KWLA 4AQ2A 1JTZX 3M4FA 4XHXA 4RSUA 2D3RA 2JG8A 4JCKA 4AEDA 3PNAA 1VIWB 1I5ZA 2HWD1 1M4WA 2B42B 3AJZA 3WW3A 2R063 4EV0A 3JUUA 1ZRCA 2HWF3 5C8WA 2R32A 2WFF3 3EBRA 3LA2A 3WQ7A 4RS5B 2ZGSA 4CDQB 1YLLA 4R52A 4COWA 1G8WA 1Y7BA 2DVGA 2VECA 2XB6C 4EN9B 1VAVA 4Y24A 1COV2 1NCQB 5DXDA 3U4XA 3ECQA 1WGPA 1TNFA 2LM3A 4RL7A 1N47A 3W9AA 1MS3A 3I59A 4COVA 4P14A 2RM23 5FAXA 4K7JA 2GN3A 1AR81 1OLRA 4BPZA 4XYXA 4BYYA 4YVWA 4OHWA 5I8SA 3UKVA 3D4KA 1GNHA 1LTEA 3ZMOA 3OTFA 1QWRA 3B01A 4AQTA 1YFYA 4XBLA 1G9BA 1V6IA 4FQ4A 1NQJA 1BBT2 1CN1A 1VBD1 2JG9A 4DXZA 1HRI3 1MZFA 1QXJA 1VRH2 2EAKA 2PAMA 4JC1A 2VNRA 3ZN6A 4PIXA 3JBG1 1UN1A 5DZFA 5E8AA 5J09A 1WD4A 2ZX1A 1SLBA 3ZFGC 3L2HA 4N43A 4QPYA 3VBRC 3ZXLA 5ACA1 3WP3A 1RGSA 3NVCA 2E9QA 2ZA9A 2RS52 3CU7A 4GKXA 4CDUB 1JYCA 1HXS1 3SHRA 1AZDA 1WCDJ 2NMNA 3VBSB 2R16A 1QJU2 5BNNA 1OI6A 1S0BA 3D0JA 4HVQA 1TME1 1YO8A 2GH8A 2GMEA 4XFBA 4AI3A 1U5XA 1BEV3 4FPGA 4MZUA 2VGDA 2YROA 2DURA 1ZREA 1OA3A 2AREA 3ZXEA 4QD2A 3ZFFC 2ERFA 5JOXA 4FXGB 4U2AA 2DFCA 2R1BA 5AC93 3WDVA 2KM2A 2GZWA 1MVEA 3AM2A 3B7MA 1S0EA 5FLJA 3BALA 4AWDA 1H8VA 1RHI1 5HCBA 4JTOA 1G9CA 2EAAA 4IXLA 2IXHA 4ES9A 3KD4A 4XETA 4HK8A 4OI4A 3TYJA 2WWSA 5FDBA 3RJ2X 5GM0A 3HT1A 2VUJA 4NWWA 5K9YA 3WX5A 4S2DA 3CJXA 3U11A 1HKDA 3UKTA 1H2NA 2NLRA 1CIWA 4XTPA 1YHFA 2XWJB 1FNZA 3GBFA 4WM7A 1S2KA 1QH7A 1RUD2 3MICA 1CESA 1T6GC 2QE3A 2TNFA 1M06G 1C5HA 1MEC3 4P9YA 3USUB 2ZGPA 4ASMB 5C6CA 3MF9A 1Q43A 3VZLA 1XU2A 5EXOA 2RS51 4YVSC 3ZYIB 1W6OA 1D2QA 1R082 3WQ0A 1YIFA 4FTBA 2RS11 2RS33 2WS92 3PJYA 3U0ZA 4QGLA 2PQQA 3H1MA 4R4ZA 5L19A 4YM2A 1LHUA 1URXA 2XUMA 2ZKLA 3N36A 4XFGA 5JIAA 4JGYB 3WW4A 1LGCA 1GZWB 4BM8A 5KXEA 4AFAA 1RMU3 1HRV2 1VBC2 4IEXA 1X82A 2ZX0A 1ND2B 1VBB3 2WLQA 5GZEA 4XF4A 1K5MA 3JCIA 3SNMA 4HPKB 3UKNA 1BMV2 1AR83 4HKWA 4Z07A 2A6XA 1H2LA 4Q8KA 2HWD3 4PIZA 3T2TA 1OMIA 5F9TA 4WM8A 1AR61 1RITA 4O9EA 2O1QA 1HIXA 1PGW1 1RIRA 1WUVA 1DGRA 1NY71 2ZMLA 2HWE1 4QHBA 1ND3A 5JVVA 4YNIA 3DF0A 2N7GA 5C8CB 1D4M1 2LALA 4MX3A 4OI0A 4L2NA 4D7SA 5FRAA 5CADA 4IEQA 3N7JA 1AHSA 4YG0A 2VOWA 4FP3A 2Q8OA 3CEWA 1LOCA 3VBFC 1DYKA 3QBQA 4LA3A 1DQ1A 1QHDA 4PLOA 2JKBA 1MEC2 1XE7A 4IEOA 1G86A 3E6CC 1CD3G 4ONUA 1G9FA 2AGSA 2VNGA 1VBA2 3HR9A 5EFUA 2DUPA 5F1RA 1QXPA 2HEVF 3I7DA 2XJPA 3OBTA 3GBGA 3AZXA 4CP2A 1YCIA 1O3SA 2BNNA 2WZR2 3WHUA 2F4PA 1O5LA 5KHHA 4Q1RA 1YJKA 2ZABA 1OFSA 3ME2A 4AHZA 4XDQA 4RR3C 4IV1B 2VPVA 1W0PA 5T52A 1VP6A 3ZIXA 1BKZA 3GZUC 4FPOB 3AXDA 2CNAA 3TAYA 2WLPA 1BZWA 4CP0A 1JN2P 1ND3C 2E53A 1N1TA 2IWGB 3BCWA 3JD72 5KC5A 3LA7A 5HXVA 3VZNA 3HT2A 3INAA 1V6KA 1DBNA 4F7ZA 4COUA 3V65A 2JG9B 4Y4YA 4D7TA 4F8AA 3VKFC 3DUIA 5GJ6A 1CPNA 3QLQA 2R062 4DS0A 4KWKA 4XFCA 2ZGTA 1RJ8A 4FPYA 5H9RA 3MW2A 4GWNA 2HWC2 5DDJ1 1H9PA 2XLFA 2P2KA 4P5HA 4YZ4A 5JPMB 3VDDB 1TME3 3FUQA 2DCJA 2OZ6A 3H7JA 4QPGB 2NZ9A 3VBUC 2A6ZA 1LGNA 2XL7A 5FQ0A 2P3IA 4H7LA 1VBE1 1BQPA 2X53S 2YV8A 3KM5A 4LUMA 4O9GA 5CIRA 4AXOA 5C8CC 5KHJA 1DGWA 4KG8A 5H9PA 2ZGOA 3AB0A 1DU3D 2WC2A 4INDA 2D40A 4LEJA 2CAVA 1QJY1 2EXKA 3I4IA 3ACLA 4IV3B 5FFOC 4DRRA 5JWPA 4RA0A 1PHMA 1VLNA 4QXKA 3IT8A 4PLMA 3VBUB 3KS7A 1ND2A 4BWOA 1S0GA 3J8F3 2IXJA 1KS5A 1Q8VA 4TWTA 4COZA 1LENA 1NY72 3M3CA 2WZPP 1YJLA 1VBE2 4JTNA 3VBSC 2DTWA 4XILA 1A3KA 3FFZA 4GH4A 1NA1B 5GKAC 4RHV1 5CVRA 4QT6A 1AL21 3MIGA 1MS4A 5BNOC 2ZHKA 2O8OA 1DF0A 3JB8A 5EYYA 4P9JA 1MEC1 3RS6A 3H1WA 1EPWA 2MEV3 5CBLA 4Q0VA 2ZAHA 2MPFA 1ULEA 4Y22A 4KBBA 2R071 2DVAA 1ZZBA 3CF6E 4XJWA 1CGPA 2G9FA 4LE3A 4COYA 4BOWA 1D4M2 4S2GA 4KH9A 5I93A 4YFWA 2ZX4A 5T55A 4LBMA 1UU5A 2QZ3A 1ZX5A 1VRH3 4AW7A 1L3JA 2DU1A 2X5IA 2YPJA 3AZWA 1PVC2 4M01A 4AF9A 1Q56A 4OVEA 1ND2C 3ILFA 2VNOA 1ZZ9A 2ZGNA 3U07A 4N90A 1YFWA 4YM0A 2ET1A 1Q8QA 1GYKA 1SCRA 3ZX7A 1PO12 1DQ5A 5GLUA 3WCRA 1NLRA 4R9DA 1FI2A 1X7NA 4OHXA 4I09A 4CDQC 2Q30A 4R4XA 2VVDA 5BNOA 4PF5A 4FOVA 2E7TA 4SBVA 4EWDA 4HMZA 2RR11 3P3PA 1W2UA 4RQPB 1ZBA1 3WG4A 2SBAA 3VHNA 3OY8A 5AFEA 2R042 1RUOA 3ES1A 1O7FA 1GFF2 4N53B 1UIKA 3M3IA 2V09A 3ZYJB 1ZZ6A 1PVXA 1V00A 2D6PA 3VKNA 2OW4A 4IL7A 2OA2A 1Q3EA 5I0SA 2JG9C 5E16A 3RNSA 5L36A 3OD0A 1JOJA 3VBRB 3M3QA 3EXUA 4AVAA 2D97A 4B8EA 1C57A 1E57A 1AJKA 4ORFA 3AXEA 4G4FA 3TN91 1EP0A 4NHMA 3WNXA 2GMMA 4N43C 2PHXA 3J4UH 2JJ6A 4QQ2A 3AKPA 3FHIB 3VBRA 5CFCB 1QJX3 4XF1A 4B7KA 4RR3B 1BBT3 3HIFA 5JAXA 4Q4W1 4Q4Y3 4C90A 2BQPA 4S2FA 4WBBA 4META 1U0AA 2W39A 4P9WA 1PNFA 5KHGA 1REEA 3SH5A 4AHXA 1RUI3 4LT5A 4AHWA 4AEJA 4AG4A 4YGBA 4AGRA 3D0SA 1A78A