4XF3A

Cysteine dioxygenase variant - y157f at ph 8.0 with cysteine and dithionite
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 54
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xf3A00
4GULA 4QM9A 3I7DA 3IDBB 3VHRA 4HSJA 4L11A 3DL3A 5CU1A 1X7NA 2GC0A 3EBRA 1RC6A 3H3ZA 1YFYA 3KGZA 4IESA 4Q29A 3RNSA 1FT9A 1CX4A 1QXRA 2QJVA 1WA4A 2F4PA 1ZNPA 1ZZBA 1ZZ6A 1UW8A 3S7IA 1J58A 1ZZCA 3NW4A 1EYBA 1IPKA 2H6BA 3H50A 3DKWA 5E16A 3O14A 4MGIE 4HSLA 5I93A 3H1WA 3OF1A 2PYTA 3E5QA 3LA3A 4YNIA 1YFXA 3SCGA 1ZREA 2QVSB 2MHFA 4Q0PA 3E6BA 2D5FA 2GZWA 1X82A 4MUVA 3USSA 4XF1A 5I8TA 1ZRFA 1J3RA 3PNAA 2ATFA 4JTNA 4KU8A 2MNGA 1L3JA 5FQ0B 3PLQA 1H1MA 1PMIA 3WW1A 4O9EA 4KWKA 4LULA 1O3TA 3WW4A 3CLPA 2IXIA 4NVPA 2GU9A 5I8SA 4QGLA 3UKVA 4KU7A 4N9IA 3ZDSA 2C0ZA 3H1MA 1DGRA 3D0JA 2IXHA 3ST7A 5KHJA 1OD5A 4KWJA 1ZZ8A 3SCHA 4BIFA 1RUNA 2BEOA 4LEJA 4XFIA 3HQXA 3R6SA 5BPXA 4MH0E 3OTFA 3KSCA 2CAVA 3FZ3A 5LEJA 1Q5OA 4YARA 3HIFA 2EA7A 4FT8A 2O8QA 1YWKA 3LA7A 4UXAA 3KMHA 3RYPA 4E2SA 4I2OA 1PM7A 4LUKA 3ACLA 4BH9A 1J3QA 5FPZA 4DINB 2UY9A 4MV2A 3BALA 1QWRA 4AQ2A 4HVOA 5D1IA 3H1YA 2OZJA 4J1XA 4XFBA 1OI6A 5JCTA 2IXLA 2XLFA 4JV4A 3ES4A 3C3VA 1NYWA 4AVAA 3UKTA 1X8MA 1LKNA 3N4MA 2P17A 2H0VA 4Q0QA 1H1IA 3NL1A 2GAUA 4PIXA 2BNOA 3OGJA 3MYXA 4KWLA 4QMAA 4XFHA 4I0AA 2UYAA 1IPJA 4MGYE 2XGXA 3FJSA 3ELNA 1EPZA 5I91A 1GQGA 1NZCA 4B29A 4E2QA 2OYZA 5FLIA 3CJXA 4I09A 5J3UA 5KHGA 2DCTA 5CADA 2N7GA 4XF9A 3WW2A 4HVQA 1DGWA 2D5HA 3DV8A 5I0TA 4QXKA 3E5UA 3E6CC 3FFQA 1I6XA 4K8FA 2XKPA 4HN1A 1RTVA 3FE5A 5FDBA 4HMZA 3MPBA 5JSRA 4IETA 2WC2A 2BGCA 4XFAA 2HJIA 1YFWA 2QDRA 2GH2A 1UIKA 3I59A 2PAKA 2UY8A 5KHIA 4IEUA 2XKOA 4JTOA 1JUHA 4HVRA 1YUDA 4WZCA 2ZCWA 2GC2A 5J48A 1XRUA 1O5UA 3OCPA 1J1LA 1VP6A 4I3PA 4ZU4A 5EZWA 2PTMA 1FXZA 2D93A 2XL7A 5JAXA 1O3SA 3D82A 4RD7A 2VECA 4QM8A 1XE8A 5KBFA 2OZ6A 3NVCA 4YSFA 4XETA 4QGMA 3PVBB 1ZVFA 3E5XA 2QCSB 2GC3A 2D40A 2PQQA 3TNPB 1SFNA 4EROA 3EHKA 4LTAA 4MGZE 2IC1A 3H9AA 1V70A 2EAAA 4Z07A 3KCCA 3U0ZA 4CYDA 1ZZ9A 1XE7A 1EP0A 2CAUA 3B02A 5LRSA 1QY4A 4L2NA 4EV0A 4I02A 3RDIA 5AVPA 2IXKA 3FHIB 4HZFA 1CAVA 3D0SA 5FLHA 3BPZA 2XL9A 2BNNA 4F8AA 3H7JA 3I59B 4HN0A 3RZZA 4ORFA 3L2HA 1Y9QA 3LZZA 4JVAA 3SCFA 2ETEA 4EWAA 4FAGA 2OA2A 2O1QA 5K8SA 4F7ZA 2IXCA 1RUOA 1CAWA 1LB2A 3LA2A 1J59A 3QACA 3BB6A 4AVCA 2B5HA 1O3RA 4QGNA 5I8YA 4PIYA 3WW3A 2HKXA 4AXOA 4P9GA 2FMYA 2I45A 3M70A 1U12A 3LWCA 5FCCA 4R8HA 4PIZA 2H6CA 4YRDA 2PHLA 4UBHA 4UBGA 2ZKLA 4OFGA 2WFPA 3TNQA 1CAXA 3EJKA 5I0RA 1VR3A 3LOIA 5LRRA 5KHHA 4WVZA 3EQEA 5JR7B 1VJ2A 5J7MA 4QX5A 4J1WA 1CGPA 4X6QB 2ET7A 4PJYA 4Q0SA 3ROUA 2Z69A 1YHFA 3CO2A 3EO6A 5E1RA 5F1RA 1ZX5A 4TLFA 1I5ZA 4Q0UA 4IERA 3BCWA 1CAVB 1SEFA 2BYVE 3SMHA 1GQHA 3FWEA 1ZZ7A 2VPVA 3NJZA 4YYOA 1Q3EA 5BXXA 2PHDA 1TQ5A 2XLAA 3S7EA 4D7SA 1WLTA 2V09A 5LEKA 1RL3A 1HW5A 3OD0A 4XF0A 1CAUA 3GYDA 1CAWB 4A2UA 4LA3A 5EFUA 1Q43A 2K0GA 1X8EA 2Q0AA 1NXMA 1UPIA 3MDPA 2IXJA 3DN7A 4ZU5A 1ZRDA 4WBBA 1UCXA 3G7DA 3I54A 3LAGA 4FAHA 4E2GA 4KL1A 1LRHA 1OFNA 4EWDA 5FPXA 4XFFA 4Z82A 3GBFA 3M3IA 4IEYA 4IEZA 4IEQA 4N9HA 1CAXB 2PA7A 3IIAA 1OMIA 2PFWA 4ZU7A 2QNKA 4ONUA 3E97A 1UD1A 5T3NA 2Q4SA 4XFCA 5CVRA 1O5LA 4LUMA 1DZTA 5C8WA 1SQ4A 3CL1A 5JSPA 3RPQA 4X6RB 3H8UA 2KXLA 3HT2A 4I01A 4IEXA 2GC1A 2VQAA 3QOPA 4LLOA 3NSTA 4R52A 5HI0A 4Q0VA 2MPFA 4AQ6A 4BHPA 3BU7A 1WGPA 2Q1ZB 1ZRCA 1YLLA 1CAUB 4IEPA 5KHKA 1NE4A 4HLTA 2E9QA 4FBFA 3MZHA 3H3UA 2UYBA 3FX3A 5FLJA 3RYKA 3UKNA 1O3QA 3E6DA 4IEVA 2PAMA 2ET1A 3IWZA 1O7FA 3U11A 4XFGA 4MZUA 2PAEA 3U10A 3SXWA 1ZRRA 4OLLA 2XLGA 2B8MA 3HT1A 2B9UA 1DZRA 5BUVA 3JZVA 4XF4A 2EVXA 1FI2A 2XHKA 4MGKE 3IDCB 4HBNA 5I0SA 1QXJA 1UIJA 4BYYA 4MX3A 1RGSA 2BNMA 3IBMA 5BY5A 1O4TA 1G6NA 5I0UA 3SHRA 2K9ZA 2FQPA 3ETQA 5BV6A 3H7YA 3CF6E 3KGLA 5FQ0A 1J3PA 4O9GA 4H7LA 2Q30A 1NE6A 4LA2A 2CGPA 4IEOA 4I0BA 5C6CA 4D7TA 1EY2A 2CV6A 4XEZA 3CEWA 2OPKA 2Y0OA 1Y3TA 4EWEA 4XF3A 4META 1YFUA 4IEWA 3S0MA 3NKTA 4AVBA 1LR5A 5JSOA 2Z2SB 3ES1A 3RYRA
chains in the Genus database with same CATH superfamily
3OYWB 4QM9A 3I2KA 5A32A 2ZEZA 1W2OA 1X7NA 2GC0A 4AE2A 1NCQA 3PHMA 3FFZA 4CCNA 1DG6A 5FIXA 2Q8OA 3H3ZA 4Q4Y1 1RUH3 1FT9A 2AYHA 1QXRA 3NKGA 2ZGSA 1XYOA 3O1SA 4GH4A 4A44A 1L7RA 1YIPA 3J7MA 1H4HA 1WA4A 5G05L 3HBZA 5F37A 2JIJA 1LJ7A 2BQPA 1ZZCA 2E51A 2CY6A 2XJSA 1Q56A 4EZHA 1NA1C 3WHUA 1PGW1 2E53A 4ZY9A 4FQ4A 2WNOA 4GH4C 5FOJB 1C3HA 1CONA 4AEJA 2VCBA 4XMIA 1RUI3 2PYTA 2VMCA 2VBPA 3E5QA 3TBDA 2WJSA 1YFXA 1MQTB 3SCGA 1DF0A 2W3JA 2GSYA 3POYA 5LA9A 4DNYA 1W06A 2ORXA 2D5FA 1LHUA 4I0WB 3VBUA 1W6NA 3AYEA 5I8TA 1CD3G 1AX1A 1ZRFA 3BOWA 4NHKA 4Q4W1 4LOTA 4XAAA 4OCTA 5JPMB 3WCRA 2MNGA 2YUEA 1HB1A 1RIRA 3AXEA 3A7QA 4LMFA 5IFTA 1PMIA 3VBUC 3WW1A 3VKNA 2V72A 4FPHA 1O3TA 1RUE2 5EYXA 5BNNB 2IXIA 2XJPA 4OHXA 2QE3A 4C0BA 2CWMA 2RG4A 4QGLA 3UKVA 4E9KA 1PIV1 1U0AA 3WP3A 5FOBB 4KU7A 3HBKA 3ZDSA 1KXGA 5A70A 5JMCA 5DN2A 2IWGB 1DGRA 2VUCA 2KA3A 4R9AA 4QQOA 2D44A 2LM3A 4CPBA 4QPIB 1QF3A 1MVQA 4AFBA 2C24A 2DTYA 2ZX4A 1ND3B 1FATA 4LOSA 4Q4V1 3ST7A 2WWJA 5KXCA 2GNMA 1XE0A 2VMHA 1CZVA 3QLQA 3I49A 1REFA 1S0FA 4YM1A 2E63A 2L9LA 5ACA2 1QQP2 4HOOA 1UAIA 1W28A 3NMBA 3O7OA 2VOTA 3KF3A 4MH0E 2CAVA 4XQ4A 3B9CA 1HQLA 1X33A 4YARA 5FWJA 2BP6A 3ENRA 2IZWA 2WKKA 3HIFA 1W9SA 1A3KA 1MR5A 2Z42A 1ULGA 1A8DA 4GWJA 1RUE3 3KMHA 3WNMA 1SLBA 4ZZ8A 1RUH1 2R32A 4FOWA 3RYPA 4E2SA 3DCQA 3VD9A 4TLGA 4XE9A 4KGQA 3VZLA 2RMU3 1OUSA 2OX0A 5LA0A 1WZXA 2WNUB 4URTA 4DINB 4QB2A 1QWRA 4OQ9A 5LB6A 4HVOA 3H8XA 2WT1A 2OZJA 3H1YA 1UPSA 4J1XA 4Y1XA 3VDAA 4NIIA 1C28A 1H9PA 1O59A 5DG1A 5JCTA 5KXBA 4AVTA 5FZ7A 4YGEA 5ACA3 2JDMA 2VQ0A 1JH5A 1G86A 3ES4A 5FFOC 3UKTA 5LZ6A 3KVBA 1S0DA 3RSJA 1PK6A 1H6YA 2NMNA 2P17A 3RZGA 4WM8B 4XC9A 3W59A 3ZVXA 3VD4A 1H1IA 3HVDA 1T2XA 1NZIA 2VOXA 4P5YA 1W9TA 3PJQA 4WVMA 3OG2A 3Q8CA 1QJX2 4KWLA 4UF0A 1MQTC 4V2WA 3U4XA 3BIEA 2JDAA 3TWIA 5ABJB 2JE7A 2JECA 4XFHA 4DXRA 4EYUA 1PK6C 4OHWA 5CFCB 1S0BA 1RUG1 1RUC1 2XGXA 2Y6FA 2ZZJA 2RM22 3ELNA 4GA9A 4HANA 4MGYE 4RGKA 4SBVA 3WQ7A 4E2QA 2QQMA 1ULDA 4I09A 1WW5A 5J3UA 3DXUA 1LENA 3A23A 5DUWA 2DCTA 4RFRB 3WF0A 5A80A 3VDDA 5CADA 2HWD2 3PUIA 3I2HA 5BNNC 3B7MA 4LT5A 2Q5TA 3WW2A 2EIBA 4HVQA 4CDXB 1C4RA 1WW7A 3AFKA 4XABA 4AVSA 3DV8A 1F4AA 2P6HA 3VHNA 3AL6A 3CHXA 3VDDC 4GD4A 3K4DA 5EPAA 4BWOA 3KT1A 4HN1A 3THTA 2LROA 4FQZA 2VR4A 2G9GA 1LGCA 4BZ4A 4HMZA 1Q8OA 3HN3A 4QQHA 2VTXJ 4JHZA 3LPGA 2GALA 2ZGRA 3B69A 1BZWA 1YJKA 2CDOA 2WA4A 1H6XA 3DKQA 4FOVA 1SFPA 1LGBA 3P5BA 1SPPA 2LRPA 5DQ0A 4CXYA 4KG0A 2AEZA 2XKOA 1DHKB 2JG9A 2P37A 1JUHA 1UYZA 3GXUA 3B5LB 1XYNA 1YUDA 3ILFA 1GOHA 2ZCWA 1GWMA 2HWD3 3F2ZA 5FRAA 2H0BA 2FDIA 4QX2A 2PHUA 1O5UA 3OCPA 3LSDA 2VGDA 4QQLA 3AJZA 1XJAA 4IE5A 3UNPA 4B7KA 1OPMA 3AB0A 1X9TA 2JG8A 4K6BA 2YPDA 1FXZA 1W0NA 5JAXA 4P9JA 1QQP1 2MEV2 2WO7A 3D82A 5IVVA 1OLME 1W8TA 1E5RA 3T4HB 5T50A 4K20A 4CXWA 1GOGA 3EB7A 5FZ0A 2JG8C 4NO4A 3TAYA 4LR4A 3KF5A 5FV3A 3WDXA 1XNTA 4YSFA 2JDHA 5J98B 4QGMA 2RS53 3OBAA 3S30A 1QJU2 3PU3A 5CBLA 2GC3A 2PQQA 4XIKA 2XJRA 4CU9A 3RFRA 4EROA 2W46A 3VUOA 5ABJC 2X29A 1V70A 2DVBA 2JKXA 2WT0A 3KCCA 4HONA 2OVUA 1LOBA 3U0ZA 4NUBA 2FMDA 2V5DA 1UO9A 2QQNA 4XAEA 4N7IA 2QQIA 2XG3A 4P5HA 1O4YA 5IVCA 4OQ8A 2VBBA 3WDYA 3AZXA 4HPKA 4U36A 1YQ2A 5GLTA 3MI8A 1UQXA 2MEV3 2R072 1QY4A 4L2NA 1JYTA 4EV0A 4KNCA 3VZMA 5I0DA 3RDIA 3HJRA 5F2SA 5LA1A 1QJX1 4YFWA 2BNNA 4F8AA 1QOOA 2A71A 4HN0A 3N9OA 3IDAA 1HQNA 3ZXKA 4AOCA 4ORFA 1Z78A 3MF9A 2RM21 1XNCA 1LEMA 5CEHA 3L2HA 2D3PA 3WHTA 1Y9QA 5A3LA 3LZZA 4YVSA 2A1XA 3THDA 4Y20A 1AX0A 4JVAA 1FMD3 2ETEA 4FAGA 1ODMA 5F7UA 2OKXA 3K75B 3KD4A 2RVAA 1S0CA 2P2KA 2IXCA 3ILRA 4Q27A 5FY8A 4D94A 4F7ZA 2HWD1 3MW4A 1H8TB 1I5PA 2ZZQA 4D69A 2A5ZA 4XACA 3N3HA 4CEWB 2YBSA 5CFCA 2R073 4RGAA 1IOAA 1TEIA 5GLWA 1PMHX 2R0FA 1HRV3 1LEDA 3WDTA 3LF7A 4R4XA 1GZ9A 5FZEA 5CFCC 4UFKA 3OD4A 4JGYB 3CMGA 4Q26A 2JEMA 4R8HA 5C3OA 2DBNA 1VBB2 3BODA 4LJHA 3ZXAC 1JYVA 4COUA 4NE9A 4YRDA 2PHLA 1HV1A 2Y34A 3VV1A 1BCXA 4BQ3A 2RS11 2WFPA 5I0RA 3RZHA 1BVP1 2VY0A 3LOIA 4OZOA 2XXZA 5IVJA 3D3AA 3HNBM 1D4VB 1DLLA 2WS92 2D6OX 3IPVA 3D8CA 4ASMB 4AHZA 3ROUA 4XPVA 2XBO2 3CDZB 4TLFA 4NPLA 1PVC3 3IB3A 4IE6A 3CJIA 3OUHA 4FOYA 5E88A 1JYIA 1SBEA 1EUUA 4IV3B 1I5ZA 1KQRA 2TEPA 5BNQA 1FOD2 4TTGA 1S0IA 2VL4A 1LOFA 4XMAA 2WUHA 3SMHA 1K5JA 2X10A 1GQHA 5FKBA 3FWEA 1ZZ7A 3CJIC 2VPVA 2YV8A 4YYOA 1Q3EA 4GWIA 1AR82 1GNYA 2HEWF 2PHDA 4MXWB 4A7KA 1N3PA 1OA4A 1KEXA 1B09A 3VBOA 1NCRA 4D7SA 1QOTA 1LHNA 2YBPA 1DU3D 2WO3A 1LHOA 1SBDA 1EAH2 1X36A 2B9VA 4PLNA 4LE3A 5CIRA 2ZEXA 1XSQA 3ZSEA 1QJU1 1W8HA 3OD0A 3WX5A 5C8CA 4FCAA 4XHXA 1CAUA 1D4M2 1W6OA 2WS93 1BMV2 1NCRC 1SACA 1Q43A 1GOFA 2K0GA 4XUTA 3RG0A 1X8EA 3IN9A 4AZZA 1ZBA2 2WZR1 1MVEA 5JUVA 5C8CC 2E33A 4J6GA 4LO4B 3MDPA 5FZ3A 1IG0A 2QUOA 3ZYRA 1YQCA 2HWB2 2YXSA 5FPBA 4ZU5A 1ZRDA 2W92A 4FOQA 1UCXA 3G7DA 3N36A 2VJXA 3SQOA 2ZS6B 4MO3M 5DZFA 3I8TA 4NWWA 5L7OA 1OKOA 1AF9A 2QTWB 1H8TC 2HWF3 3WF2A 1AR83 1H0BA 4IE7A 2EXKA 1OLRA 2Q8DA 1AL0G 3ZR5A 4Z82A 3VZNA 3ZYPA 3M3IA 4P08A 4IEYA 4N9HA 3PURA 1VBC2 1EAH3 2PFWA 1JZ5A 3T1MA 4ZU7A 1E5SA 1N3QA 3AX4A 3LGRA 4XURA 1Y43B 3E97A 1UD1A 4B1MA 1W6PA 4JGYC 5T3NA 1FAYA 3LDRA 1OBNA 3POJA 4LUMA 2E6VA 3VBHA 1BBT3 3FUQA 5JXIA 3APBA 3GZTB 3UETA 5JSPA 3PUQA 2RR12 4JC1A 3RPQA 3U1XA 5FP7A 4QB1A 5IWFA 4YM2A 3CU7A 1JHJA 1XOYA 4B4RA 2HWB3 4QDRA 4LXLA 4Z8BA 3VBHC 3QOPA 5T5OA 4URAA 5FJKA 2R1BA 2B42B 2ZACA 3AJYA 4FFGA 1UU5A 4Q0VA 1CX1A 4QWNA 1IS4A 1BHGA 1X9PA 4K8RB 3MICA 4XXPA 4MG2A 3AKRA 1VBC3 5IATA 1DDLA 3GZEA 1VBB1 4OULA 5JOZA 3T08A 3VKFC 5KHKA 3BKZA 4HXCA 3NNFA 3R4DB 2E9QA 2YC4A 3POIA 3SH3A 3VKLA 4FBFA 4YG3A 4OI4A 5GM0A 3MZHA 3INAA 5C4WA 3RYKA 3SNMA 5IFPA 1O3QA 4WM7B 4RL7A 1UZVA 2KR2A 2RR13 3POFA 4IEVA 1O8PA 1UMIA 3IWZA 4HETA 3BTZA 4ZHNA 5IK8A 1O7FA 1UZZA 4FPGA 2XBO1 1COV2 4MZUA 3U10A 1HJGA 5C4WC 4QB6A 2B8MA 2F4LA 3HT1A 4FI9A 1YIFA 2XHNA 1GQPA 4FPFA 1FOD1 1ASJ2 1E5HA 2VZRA 3JZVA 4QPGB 2EVXA 2XHKA 4JQRA 5BUVA 2GN3A 3IDCB 2ZBJA 1W6MA 1GNHA 2JJ6A 5EYYA 4LHKA 1RMU1 4CUGA 4MX3A 1CIYA 1S0GA 4A45A 2BNMA 1AR81 1ZRIA 4W6XA 1YNAA 4OVEA 5FZ8A 3SHRA 5HXMA 5BYNA 3DGTA 5FK7A 2E7AA 4CCKA 3SLIA 3H7YA 5DPNA 3VD3A 3RVHA 4DXZA 5C33A 2ZGLA 3CF6E 3G6JB 4ZONA 3ZMOA 1W03A 2Q30A 5DAWA 1KDKA 5FREA 1D4M1 4IEOA 4I0BA 5HV0A 2VNVA 1BMV1 1OF4A 4OMDA 4ZS2A 1COV3 1LU1A 2XONA 3ZFFA 1ZBA1 2Y6LA 3VBRB 4Z92B 2R061 4EWEA 2P1BA 2WDBA 4YZ4A 4DEQA 4F3JA 1QH6A 4F83A 4L92A 1RITA 3J26N 2D97A 3M2MA 1OUXA 1MZ6A 1YFUA 3AP9A 3R0RA 4IEWA 1ASJ3 3PUHA 4META 4P00B 3S0MA 3ZIWA 5JMOA 2V4AA 3OUIA 4CP9A 4MXVA 1RUJ1 1ONAA 3ZFFC 2VO5A 2JDNA 2W1WA 3ES1A 3SCHA 4UW4A 1QGLA 3NAPA 4HG6B 2XUEA 4W50A 3NQHA 4LE4A 4ZS3A 5BNPC 3ZFEB 3DL3A 4AG4A 1HV0A 1W39A 1C8M2 1DGLA 1NT0A 1Y4WA 2J1UA 1ND2A 3B00A 3BTAA 4XUQA 4FTBA 2YY1A 4BXFA 2ARXA 5GZDA 3WSOA 4XBLA 4IESA 1T6BX 3TN92 3WEZA 4W6YA 2D6MA 1XU2A 2ARAA 2QZ2A 3HD8B 1NXD1 4IE4A 1R081 2ORZA 2ZPXA 2XB6C 4R9DA 1KFXL 3M7AA 1RB8G 1ZZBA 2QQJA 1UW8A 4N53B 4E4HA 2VMGA 1J58A 1EYBA 3KS7A 1AUYA 1IPKA 4CDWA 5J96B 5J37A 1MS0A 1TMF2 3H50A 4ISQA 4K40A 4A7YA 3FLTA 2XJQA 4K21A 1WLCA 3O14A 4HSLA 3Q8AA 4P9YA 4WM7C 1Z7S3 3ZYFA 1HB4A 1F2NA 3WOGA 1AR73 4YNIA 3HEIA 3TOJA 4BQYA 3WG1A 1Y9MA 2QVSB 5FZ4A 4CDWC 2BBAA 2BOIA 1E5IA 1X82A 2GZWA 4L8QA 3WG4A 2P4EA 5FR3A 3RJRA 2NPIA 1MS9A 4PT6A 5FYTA 4Y5Z0 4JTNA 3SH5A 4ES9A 3SISA 2HEVF 1L3JA 5FQ0B 1AR92 4FFFA 4QQ2A 4V2VA 5K9YA 3ACGA 4INDA 4L0PA 4O9EA 4QHBA 1TME2 4KWKA 4QAWA 5F5AA 1J1TA 1FX5A 1SDDB 1XNAA 4GIQA 3IKWA 5FZ1A 3WV6A 1PGW2 4NVPA 4OYUA 1WW6A 3V0BA 2IVIB 2VXJA 3K3NA 1DYPA 3AMQA 2R0HA 1NLSA 5FY7A 4JDOA 4N9IA 4FXKB 4D3WA 1YQ6A 1BXHA 1UYXA 3DECA 1TMF3 2AEYA 5K7PA 3O1RA 5FMDA 4RGGA 3AZZA 5FZDA 3D0JA 2WFF3 4A7ZA 3V0AA 2IXHA 5HBAA 2BFUS 1RJ7A 1OD5A 4KWJA 1POQA 3WDVA 4XDPA 5A32B 2ARCA 4Q1PA 4Q4W2 1KJRA 4B1LA 1HN0A 1ASJ1 4IDZA 2W87A 3VZKA 1NCQB 2O8OA 4Q4Y3 5FXXA 4LBMA 5BPXA 3OPWA 2C1FA 3KSCA 5LEJA 1MS4A 2QBXA 3I3EA 4CCLA 1IG3A 4GH4B 3WG3A 4XYXA 1OVSA 3GCWA 4FT8A 1YWKA 4OUSA 4Y26A 1UN1A 5CG9A 1L7LA 5L19A 4BPZA 4M3CA 3TEYA 1DQ6A 5FYVA 3H42B 1QJEA 4LUKA 1HB2A 3ACLA 3J9SA 2CL2A 4NOTA 4C8DA 1KJLA 3ATGA 4Q4V2 2UY9A 4MV2A 5ANNA 5T54A 2ZEYA 3FUOA 3WP6A 1QIQA 3PDQA 4DRRA 2XDVA 1MPXA 1S2BA 1UF2C 4IGOA 4OHZA 3THCA 2VZ1A 1PO21 5H9SA 3VBUB 4AEDA 4YW1A 3TRSB 3MIHA 2A75A 1W6NB 4N53C 3DPRA 3JQXA 4Q4W3 2EIGA 2O14A 4I30A 1VB2A 1GR3A 1YCIA 2H0VA 4M4PA 4Q0QA 3K51A 3ZXJA 1HXS1 4R9BA 3DPRC 2GAUA 1WMEA 3OGJA 1WCSA 3MYXA 1C8M1 2PN5A 1W9YA 2DFCA 4AVVA 4QMAA 1PIV3 1C5IA 4I0AA 2XH6A 4WVVA 2AUYA 5T5LA 3MIFA 2EALA 5LBCA 1EPZA 3TN91 1JU4A 1OF3A 2BFUL 4B29A 3KQ4B 4BDVB 4GB31 1BQPA 4Q4V3 3BI3A 1JZ3A 4CDQA 2PHRA 3AKPA 5HCFA 4A6OA 3Q8EA 2QFEA 2CHHA 3W58A 2ZMNA 3N7KA 4YM0A 2N7GA 4MVTA 1JOBA 2W39A 1G9CA 5FJHA 1UY4A 4QU2A 1JZ6A 3N9MA 3MIBA 2XR4A 1W2NA 3RWKX 4FTSA 4LIVA 5I0TA 5J36A 2JE8A 4CU7A 2FBEA 5GLZA 3E5UA 3NJYA 3E6CC 4Q8LA 5HPOA 2FCVA 2XKPA 1RUG2 1UZYA 1RUC2 3C7OA 1OXCA 3W5NA 5C3RA 3J7NA 2JD4A 3FE5A 5FDBA 1AR91 3RI8A 1DGRN 1NCQC 1V6OA 1VRH2 2BGPA 3MPBA 4ASKA 2WC2A 1GU3A 1TME1 1KDMA 2VD7A 3JCIA 3KV5A 2BGCA 2A3XA 3DYMA 3OJBA 3X29B 4XFAA 3AKQA 1WKYA 2UWAA 2QDRA 4RS5A 3PVNA 3I59A 2PAKA 2UY8A 2WO2A 5GALA 2YHJA 1QJY2 3ZXEA 5KHIA 1BK1A 5DG2A 4DQAA 2HWC2 2FCTA 2PHWA 4HVRA 4UFLA 4IXLA 5F5QA 4O7XA 4WZCA 4AF9A 1MEC1 5F39A 1IKQA 1ZBE1 5J48A 1XRUA 3LD8A 1CIWA 4RS5C 3N9LA 1PK6B 5EQUA 5B4XA 5FYCA 1UY0A 4YW3A 3J7HA 3MF6A 3WG2A 4OHVA 4UW3A 4GKXA 4WVMB 4AEKA 4A3XA 2D93A 2EICA 2XL7A 3B9IA 4UF0B 5EP9A 1V00A 1U5ZA 5HCBA 2VW1A 1RUG3 4H7MA 1RUC3 1SLAA 4GWNA 4RD7A 1LTEA 3MIEA 5FYUA 4GAZA 5C3PA 1NLQA 1VRH3 2A6YA 3Q9OA 5FPVA 1ENXA 1A78A 1PVXA 2OZ6A 3NVCA 4N8MA 1JI6A 2J1RA 3H8RA 1WD3A 4XETA 2JENA 5FYMA 1PMJX 3OGGA 3E5XA 4XF3A 4GMP1 4JCKA 1QJY3 4CP0A 3VDDB 3FL7A 4XJZA 3AMHA 4ZPIA 4MGZE 5AVAA 1AL22 2IC1A 1W2AX 1PGSA 2V73A 3T4VA 2EAAA 2YU2A 1OOPA 3C8XA 3TEXA 4Y4RA 2OQ7A 4QX8A 2PELA 2GNBA 4EZ4A 2VZQA 3IIIA 4P14A 2VUDA 3CBNA 4QKBA 5GZCA 4A4AA 1JZ2A 2Y8KA 3FLPA 1BKZA 3U4SA 3JXSA 3USUA 1VBA2 5EHDA 4JKLA 1GZTA 1A34A 5CNAA 5LWBA 3ZXDA 5DAQA 4W65A 5LRSA 2A3YA 5A6YA 2BWAA 4MLOA 3K4ZA 4QX0A 1WCDJ 4FPEA 5AVPA 1IS5A 1DLCA 2IXKA 4ASLA 4HZFA 3ZSMA 1AR61 2G19A 4XOGA 4BQ5A 3PUSA 3D0SA 3I2OA 2R49A 2I2SA 2IVJA 3MBWA 3RZZA 1SPPB 4OZXA 2JG9B 2EXHA 5KC5A 5FZHA 3VD5A 5FWEA 4LHNA 3WQ0A 2BZDA 2HWE2 4LBOA 4XJ9A 4Y5SA 2OA2A 4TXWA 4C1XA 4NIGA 1UOBA 2O1QA 2JDYA 1I3HA 4DFSA 5K8SA 2E26A 5M0TA 3A0NA 2VBDA 3D5OA 1RUOA 3M3OA 5J09A 1QQP3 1CAWA 1ZA4A 2JG8B 3LA2A 2NN8A 5C7GA 2P6CA 5KWRA 3H0OA 1J59A 2BERA 4AVCA 2Y6JA 5A6XA 4NN0A 1QMJA 5CZKA 4SLIA 4QGNA 4JQTA 2CGNA 2HKXA 5KXDA 4XDOA 4QX3A 4NRQA 2UWCA 1VRBA 4IV1A 4DIQA 1V6MA 4XUPA 4HFSA 4TSVA 2AR6A 1BYHA 4Y5TA 4NWVA 3TEWA 5LW9A 1VRH1 2VZPA 2QQKA 2VE1A 4IV1C 4UBHA 4S2FA 2WZ8A 1GKBA 1GSLA 2ZKLA 5CKNA 2RDQA 2BUKA 3EJKA 1H2LA 2J1VA 5LRRA 2AACA 5KHHA 4CE8A 4LNVA 2TNFA 3HR9A 1QJY1 4UAPA 4QX5A 4D6RA 4J1WA 5FY9A 2HWC1 2D6NA 3ECQA 4Y22A 2C9KA 2QQPA 3OGRA 1LOCA 2GH8A 2VULA 4HPKB 5T5JA 5TSWA 1JUIA 4AI0A 2P5BA 4N43A 3HN1A 4AWDA 5FXVA 1PX4A 3NV1A 1VBD2 2JKBA 3ZYJB 4BQ4A 1HN1A 1QJX3 2LS6A 2ZX0A 1SEFA 4HK8A 1N1SA 1JODA 4H2AA 1YJLA 2A70A 2ZGOA 2ADEA 3AMNA 3H3LA 2FDJA 4Y1UA 1HJFA 3T2PA 3VL8A 5C9AA 3O1TA 2RM23 2FDGA 3SC7X 3AMMA 4PDWA 5BXXA 3FN9A 4W8JA 1G9AA 1CQ9A 1R091 2RS12 1TQ5A 3LDKA 2PHFA 2XLAA 4FFIA 2RE9A 4UFJA 5EXOA 4YVSB 5FZKA 5IVFA 1WLTA 4Y20B 4QX1A 1UX7A 4EN6B 5C9AC 1RL3A 5LY2A 2B46X 5FP9A 4XVHA 2YMZA 1PZ8A 4PDWC 4CRQA 3F95A 1VAMA 3ILNA 4A2UA 4ISRA 3B3QE 5LBEA 1AL21 1GFF2 2VNGA 2YYOA 2BWCA 2JG9C 4QKFA 1TNRA 4NAOA 2DYCA 5FY1A 5GLUA 3B93A 1VBE2 3WUDA 4CA9A 4ET7A 2F6BA 1NXMA 1JYXA 5GJ6A 3IM0A 4Y3OA 4NR1A 1MS1A 3VBSA 1VBA1 3FBMA 5CFDA 1MZ5A 1WMDA 4RR3A 4QT6A 5L9RA 1W8NA 4E2GA 4CUCA 3NJVA 4KL1A 2R16A 1OFNA 3UGFA 5FPXA 1JOJA 2RS13 3VBSC 1H9WA 4XFFA 4Q4X2 2RV9A 1S2KA 1JYCA 5CFDC 3M3EA 1AYN2 2YC2A 1MS5A 4RR3C 4QDSA 2PA7A 1ZA7A 2Y64A 4O61A 4ONUA 3IPVB 1YI9A 4QU1A 2WQ4A 4FP2A 2KD7A 2WZR2 1N3OA 4BU2A 3K2OA 5FZLA 4CCMA 5CVRA 2I07B 2HWE1 2DCKA 4XUNA 3CJIB 4MOAA 2RDRA 3AVSA 3V65A 2VW2A 2LTNA 3H8UA 3HT2A 3MEPA 4I01A 1D7PM 1VPHA 1R1A1 2XJUA 2Q8EA 4CU6A 5GZEA 5A7OA 2RHPA 1S4CA 2DBIA 4M3CE 4PBPA 1W04A 4Q5OA 5FTTC 2VCMA 3KV9A 1BK0A 4COYA 3IAPA 4G9SB 3VBOB 1NCRB 2VUJA 3VHOA 4HKLA 1EV11 1QJU3 1WLDA 3A22A 4AFCA 3BU7A 2VXRA 1MS3A 3LFIA 4K3UA 2WYSA 2JICA 2OPWA 5C8CB 1WGPA 2P34A 3RMYA 4FPCA 5JOYA 1CAUB 4CCJA 1W6OB 2FZ1A 4HLTA 1XYPA 2WZR3 5DAPA 4LLFA 5CKMA 3RZKA 4OHYA 1GBGA 1UOFA 1FYUA 3OY8A 1JOPA 1AVBA 2RJKA 2OS2A 4YVSC 5IUQA 1F35A 2C26A 5LA2A 5HCAA 2PAMA 2ET1A 4Y1ZA 1IS3A 1DGWX 5F6KA 4M0HA 1UY1A 2DCJA 4NHXA 3J4UH 3U11A 2TUNA 2VZTA 4CUAA 3KT4A 2JDZA 3ZDVA 2XMLA 1JN2P 3SXWA 5L7OB 2XLGA 1OLQA 2VW0A 4LBQA 2BU9A 1ULCA 3O1VA 1VBD1 1KFUL 3K46A 4XW3A 3KV6A 4OMCA 5T52A 5FYYA 4MGKE 4Z1VA 4HBNA 2P3YA 3C7HA 3MIGA 3EMRA 1UMZA 1QXJA 1UIJA 4BYYA 1UU6A 1S0EA 3P3PA 4R4ZA 3ZKYA 3RZMA 5E8AA 4W6WA 5EJ3A 3N9NA 2RS32 5LCWL 4KBZA 5EWSA 5FZGA 5BY5A 1W6PB 4MHRA 3N35A 3ZXGA 4JGZA 3ETQA 3DUIA 4P9WA 3VBHB 1J83A 4CPBD 2HYXA 5IAVA 1J3PA 3N9PA 4O9GA 4XJ8A 4KMQA 4YVWA 3U07A 1SBFA 2C5DA 3LEKA 3ME2A 2J1SA 1EY2A 1H2MA 2CV6A 1GV9A 1WBLA 2Y0OA 4DRVA 3LB9A 5B2GB 3I2IA 1VBE1 1LECA 4XXAA 2A7AA 1CJPA 4YVWC 3ZR6A 1VALA 4KQ7A 4L9BA 4Y33A 5IYYA 4H55A 1MACA 1RMU2 2ZJCA 2VMDA 3ZSKA 4FPJA 5AC92 5A6QA 1VBB3 1ZZ6A 2Z2SB 4ZXKA 1K42A 3ZOIA 4RHV1 3ZPYA 5IK4A 1LOFC 2W5FA 4HSJA 4L11A 1XNKA 3AP7A 2BDRA 2YZ4A 3AKSA 5CU1A 4Q4X1 4RA0A 4YGBA 1AYN1 4XZUG 5FYZA 3EBRA 2EAKA 2O0OA 5FZFA 1SLIA 3RRDA 1NOVA 3B94A 4GXLA 5C4WB 1YFYA 2EF6A 2FZ2A 3KGZA 3RNSA 3RMXA 1O4ZA 1N1YA 3VBOC 4COWA 1CZSA 2PHXA 2XBO3 5L9VA 3ZYIB 1UXZA 1WCUA 2R062 4TWTA 4WVWA 1XPWA 2E7QA 4QKDA 4UW5A 4U2AA 5FZIA 4CZSA 1OH3A 1LESA 1WW4A 4A42A 1FOD3 5FMBA 2YGMA 3O0XA 5T5PA 4CEYA 1AYM2 5JPNB 2Y6GA 2H6BA 5LASA 2BOJA 2VTXA 1RUJ2 2ZGUA 2VM9A 4E8CA 2DVGA 3DKWA 5I93A 4GMP0 2HBUA 3AC0A 1RMU3 4MGIE 1W6MB 1GLHA 4P9IA 1QDOA 5DMYA 5C5TA 3NWKA 3LA3A 1DBNA 4X8PA 4FXGB 5CG8A 1KRIA 1RJ8A 1GANA 2K2SA 2MHFA 1OFSA 3E6BA 4Q0PA 3WNPA 3DEMA 4BMEA 1RUF2 5DZGA 4E27A 4XF1A 5L7OC 1J3RA 4TN7A 4M3CF 3PNAA 2ATFA 4IGPA 5F3EA 1J84A 2WNEA 3N7JA 4WV8A 1Z0HA 3WNNA 1FV3A 1R082 1Y9GA 3SITA 1MS8A 1D4M3 3SEPA 1VAKA 1H1MA 4LIUA 1PNGA 4CUBA 5FY5A 1JU3A 1KS4A 3O5SA 1ZBA3 3WW4A 5IK5A 2R063 2XPJA 3ZFFB 1UWWA 1IPSA 1RUD1 1W90A 3CZUA 2FCUA 5I8SA 5A33A 3VL9A 4LBNA 1H4GA 5JLVA 4LBKA 2C0ZA 4C1WA 5BNPB 4LKFA 2P3KA 1EUTA 2SBAA 1RUJ3 4K1ZA 4CCDA 3K77A 4V1PA 2C9AA 4CP9B 1FPN2 3AYAA 1V6NA 4D6QA 1AHSA 1TZOA 5J1XA 5KHJA 1IS6A 3WNOA 1AJOA 1GZWA 3NAPB 1GP6A 3FHQA 1NQJA 1QNYA 5FMOS 1RUNA 2BEOA 3HNMA 3JUUA 3BGAA 4LEJA 1RUF3 2PLV1 3KHBA 4XFIA 1K45A 1ND2B 1VMFA 2WO1A 3POGA 2EXJA 4EN9B 3OTFA 3FZ3A 1LU2A 1Q5OA 1R083 5A7PA 4PI0A 2ES3A 2RS31 2VVFA 3IDEA 4AAPA 4K1YA 2VZ3A 4QXCA 2O8QA 2ZGTA 2V5YA 3VZJA 3TYJA 1OQDA 2W1SA 3JB4C 5DDJ2 2CNAA 3I3QA 3D4KA 4CDWB 1PM7A 2EIDA 3T2TA 4ZZ5A 3OSDA 1OH4A 3AVRA 3ZM8A 3KV4A 2C6SA 1LULA 4JKKA 1IQAA 5E6HA 5FPZA 5FZOA 2WSVA 3GHMA 3R4UA 5K0UA 2X05A 5DAXA 2XQXA 5AFBA 3O12A 2E31A 4JX0A 3C7FA 4Z2AA 1PZ9A 2XLFA 2G1MA 4JV4A 4NMIA 3C3VA 3NV2A 1KITA 3T1LA 1XU1A 5AC91 5F5IA 4JRLA 1LKNA 3N4MA 5JI9A 4DXTA 2HLEA 1H2KA 3NL1A 4AQTA 5A3PA 3ZN6A 4MGTA 5IVYA 2I74A 1C8NA 2R7EB 3LE0A 3LIHA 4DOUA 4EN7B 3MFCA 2DU0A 1HRI1 3OUJA 5F32A 5A7NA 4AAXA 4BLIA 3V0BB 1G7YA 2OXBA 2UYAA 3VD7A 1IPJA 1SCRA 1W8UA 3FJSA 1V6JA 2CGOA 3ORJA 2KM2A 4BIOA 4C0HA 1NZCA 1VIWB 5FMOL 2OYZA 5FLIA 1PO22 5FK8A 3V0AB 2Y6HA 4XILA 2ZHLA 1BEV1 4CCEA 1W99A 1AYM1 3N7MA 4M4RA 5C71A 5F9TA 5CA6A 2X09A 4JDMA 1DGWA 2A6XA 5JI7A 3ZIXA 1HXS2 3QH7A 5FYHA 5CB7A 3VGIA 4KGGA 2QDNA 5HCHA 4NIHA 2AGSA 4QXKA 3LCPA 1DCSA 2Y60A 3ZN5A 3NNMA 1NKGA 1RUF1 3KCXA 2VCCA 2X5IA 3KQRA 4RFT0 4BK5A 4BK4A 4K8FA 4AR2A 5C3QA 5FZMA 3NAPC 3L9JT 5JZGA 3LSEA 4M3CB 3QH6A 3BN6A 2A6WA 2A73B 1W6QA 3I2JA 1CPNA 4GB32 5BNOA 5JSRA 1ND2C 3AYCA 3ZX7A 1AX2A 2X5IC 1FNZA 1US2A 4DUWA 4N90A 4M00A 2HJIA 2J1EA 4YZ2A 5C70A 2GH2A 1UIKA 2ZX1A 1PO23 5JZGC 1RHI2 3GALA 1E57A 4XHBA 3WZ1A 4M01A 3M8LA 4JTOA 4AEDB 3M3QA 1DQ2A 3DPRB 2GC2A 1D2QA 2W2IA 3DF0A 4JDNA 5LK7B 1VB4A 1FPN1 3AM2A 2SLIA 4ES8A 1J1LA 1LCLA 1HXS3 3BUCA 2D6LX 5A6ZA 1F5FA 4PCRA 4D6SA 4I3PA 3GZAA 1OQ1A 5EZWA 4ZU4A 1C8M3 2PTMA 3O0WA 3OEBA 2NM1A 2LALA 4A41A 4BLJA 4BQWA 4EQVA 4YG6A 2DURA 5KR7A 3R05A 4RQPA 5JVVA 3LIGA 4W4ZA 1ST8A 1LHVA 3UL2A 1DZQA 3A21A 3FLRA 3TN93 2NLRA 3I97A 2VMIA 1IKPA 4MADA 3VBFA 5SV8A 2XVLA 3LOBA 1AXZA 1QXPA 2DCYA 4GB33 1NUKA 5CKQA 5KBFA 4MGQA 2WYFA 4RQPC 5FYBA 4CSWA 4YPJA 4CDQB 1HX6A 2Q1FA 1WD4A 3C2UA 3PVBB 1ZVFA 3GM8A 5DDJ1 2QCSB 2BW8A 1MEC2 5GLVA 2HH9A 3VBFC 4BQ1A 1LODA 1SFNA 1ZBE2 1PGL2 3EHKA 3J8F2 4LTAA 3ZN4A 1PO11 4XJWA 4AYUA 4HK9A 3PTYA 3H9AA 2Y26A 4Z07A 3ZFGA 1CESA 1JYNA 1XSRA 5KXEA 4CYDA 4IUGA 3JD71 2DUPA 3HAGA 4E4ZA 1ZZ9A 1XE7A 4DZGA 2WNVA 1IQDC 3RZLA 1Q8SA 3O1UA 2BJSA 4ITCA 3I2FA 1QDCA 1BLZA 1EP0A 1UYPA 3W5MA 2CAUA 3B02A 1AR93 1RXGA 4Y1YA 3WD5A 5FMCA 4BQXA 3JBG2 1TME3 3WLUA 3FHIB 2VOKA 2WNVC 5A3TA 1CAVA 3POEA 4Y1VA 3LDBA 4HT1T 3BPZA 2PMWB 5FLHA 4D0QA 3KCYA 1OHFA 2LUWA 4LQRA 1JS9A 4RS5B 3I59B 4XTPA 5FPUA 2XVKA 5D8AA 5JWPA 1DYOA 1F5JA 1MEC3 5KC6A 2W94A 4AI2A 1Y7BA 1ZBE3 4NHLA 1W9FA 4KWUA 3ZMNA 3UV9A 1UKRA 4JKMA 1QJZA 2DF7A 2RDNA 4AI1A 1V6LA 5FY4A 1W05A 4YG0A 2UU8A 4QPYA 5D8AC 2JX9A 2VCAA 5A7WA 1AJKA 4BA6A 1M06G 4AL9A 5FZBA 4QHOA 1WBFA 2DDUA 1K5MA 2WLPA 4QX7A 3RWNA 3UGHA 5ANQA 3K4AA 4EJRA 2ZXQA 4C90A 3H8OA 2GDFA 3AZWA 4AFMA 1YO8A 3GBWA 4AEDC 3ZXLA 1AR62 1SCSA 5I8YA 4PIYA 3WW3A 1V9U1 2Q8CA 1A6CA 1F4HA 4AXOA 3WR0A 4P9GA 1GMMA 2FMYA 1K5MC 2I45A 1U12A 1JHNA 1GWLA 1N47A 1W2TA 3LWCA 3M4FA 5FCCA 4ARXA 3BOPA 3IT8A 4GQ7A 1PM4A 4GMP3 3LEIA 1NG0A 4H3WA 1CVNA 1WCKA 2ZKNA 3OPTA 5F3IA 2BRTA 3LEGA 4GZ9A 4E4DX 2VNRA 4UBGA 3EXUA 2VUAA 1MZFA 3TNQA 2XUMA 1CAXA 4FFHA 3B01A 1VR3A 1G8WA 1OOPB 3TEZA 1NAEA 1RHI1 4HKOA 5FPAA 1Q8VA 1V6IA 3ETPA 1CPMA 2Z5WA 2W1QA 2ID4A 4X6QB 4Q0SA 1UZ0A 3USUB 2Z69A 2ZHMA 4CDQC 2BBVA 3CO2A 1WA6X 4XQDA 2DUQA 3EO6A 5E1RA 1ZX5A 4S2HA 3WUCA 4DS0A 5T55A 4NJ4A 1GP4A 3PMEA 5HV4A 1AR63 1F31A 5EJZB 4CDUA 3URFA 1N1VA 5IHRA 5F8PA 3BCWA 4LHSA 2VC9A 4MYEA 5F3CA 2JIGA 2BYVE 4D7YA 2R041 1RUI2 4LKEA 3ZYBA 1XNBA 5DZEA 4CDUC 3AK0A 4L99A 3I3DA 1JBCA 1JW6A 1WWYA 3NNGA 5F2WA 4QD2A 2WL1A 1PHMA 4P9XA 2G4IA 3MW2A 5D21A 1KGYA 2WN2A 2OT7A 4XF0A 4AFAA 3KVAA 1OD3A 1XNDA 3AZYA 1PGL1 1CAWB 1DQ0A 2DUOA 2W0XA 2WBKA 3J8F1 4HKWA 1GYKA 1NA1A 1DFQA 2GMEA 5CYYA 1LGNA 1GWKA 4FPYA 1RVF2 3J7LA 4AI9A 4ATEA 2Q0AA 4AI8A 3WF4A 1B35A 1GUIA 5L73A 3DN7A 3IZOA 1POV1 4IV1B 2GMMA 4WBBA 4BISA 1QOSA 3PTRB 3LAGA 3SEEA 3UESA 1JZ7A 1CN1A 1R092 1ZM1A 4XUOA 1B35C 2YBKA 3GJAA 1LRHA 1S0JA 3LPFA 4EWDA 1Q8PA 1QH7A 3JBG1 2W95A 1YQ5A 3O1PA 2DWRA 3ZXFA 5FUPA 3GBFA 3JQWA 2VVEA 4UFHA 4MSVA 1H2NA 3IIAA 2VVDA 2HWC3 5LK5A 2PXJA 3VDBA 1SLTA 3FMGA 4BQ2A 4Y22B 3ACIA 5JXJA 1DIWA 1TE1B 2JE9A 4FP3A 4XJUA 5FKCA 3SKJE 3E1F1 1O5LA 3C7GA 4N43B 1IZ3A 1RVF3 3UGGA 1SQ4A 5IT6A 1US3A 1YEWA 2AC1A 1W8FA 2KXLA 4YW2A 3T2OA 1XXNA 4FPKA 4IEXA 1OOPC 3NNLA 2RMU2 5FO7B 5EJ1B 1H1AA 3S5QA 3AZVA 5C9AB 2EIEA 3MUZ1 3AYDA 1R093 4AI3A 4YGDA 1NY72 1GICA 1SLCA 2HBTA 2ERFA 4PDWB 3W20A 3U75A 4FTEA 1SZBA 1CJDA 2GNDA 3FBYA 1RXFA 2MPFA 3P6BA 3U78A 4COVA 3POSA 2VU9A 2J7MA 1OURA 3T0DA 3OYWA 2AH2A 1YLLA 3VZOA 1MZEA 1AL23 3S6PA 1I9RA 4AQSA 3JU9A 1G9BA 1D0GA 2P3JA 4RN5A 2ZEWA 3FX3A 2WABA 2WINB 5A3UA 1R1A2 3WXPA 3VLBB 1VBA3 2G9ZA 2TBVA 4I3GA 4AHYA 4YZ1A 3VBSB 5CFDB 4XFGA 2PAEA 3UK9A 1STMA 4RR3B 1ZRRA 2ADDA 3ABZA 2JXAA 1AZDA 2B9UA 1S55A 1EV12 1FV2A 1CZTA 2D6PA 4XQWA 5FY0A 2RJ2A 3NV4A 5FZCA 5I0SA 2E7TA 1SG3A 1QJFA 3NNJA 5FO8B 1RUI1 1M4WA 1MQTA 3BU0A 5A7SA 2DFBA 2OUHA 3IBMA 2YDEA 3MIDA 2HWE3 1C5HA 3CKHA 4OI0A 2IFRA 4MGSA 4XBQA 1DQ4A 1OA3A 4H7LA 1XBFA 1NE6A 4FVVA 1R1A3 1URXA 4LA2A 3WINE 5JOWA 2CGPA 2HEYF 3ALQA 3T0BA 1O91A 1QKQA 1UMHA 2VZSA 5BNNA 1T6GC 5JIAA 1Y3TA 1RVF1 3NV3A 4H14A 4COZA 2JWPA 2W68A 3WQBA 1D2SA 4FPOB 1EV13 2E32A 4N43C 2JDUA 2OUJA 2D6KA 3Q8FA 5IK7A 2D98A 4LHLA 1LR5A 4QPIA 3VKMA 5JSOA 1ND3A 1FNYA 3POWA 4PLMA 3RYRA 4GULA 4LO6B 4D8MA 5B4NA 3I7DA 3IDBB 2W08A 3VHRA 4IQPA 1TG7A 5C3SA 1JTZX 1F9KA 4LORA 1W2UA 3ZO0B 4QPIC 1RC6A 3S5AA 1ND3C 4OUMA 5IW0A 4Q29A 3OY8B 3QCWA 5F3GA 2WQ8A 1CX4A 3RI9A 1R64A 2QJVA 3UJQA 2F4PA 2K46A 1ZNPA 4CP1A 2ZTNA 4XZPA 3BPSA 3C7EA 1VBD3 2CYFA 3S7IA 3NW4A 1OT5A 4LBQB 3DXTA 1DP0A 5AFEA 1RUE1 2RS52 1NLRA 2DCZA 5CAZA 3GCXA 2RJLA 2ZA9A 2RMU1 5E16A 2WNUA 5BNPA 3H1WA 4LK6A 4OI2A 4RHV2 3ACHA 1OPOA 3OF1A 2D3SA 1ZREA 2VOWA 1YXWA 1NY71 2GMPA 1V6KA 5FP3A 4MUVA 2NYYA 5IVEA 3USSA 2WNUC 4JGZB 2VOVA 1UOJA 2WSUA 3WDUA 2ZMLA 4DEVA 3BVCA 4KU8A 5ACA1 3MHZA 2YROA 4K9SA 5FBJA 3HMYA 2YFZA 2BVBA 1KS5A 3K3OA 3PLQA 4WM8A 5DUVA 4YVWB 5FP8A 2ZGNA 3D6EA 2C4XA 3AP5A 2QKDA 4QPWA 3WF1A 4LULA 2WZPP 3CLPA 4G4FA 4YLZA 1VBE3 4ARYA 5ABJA 4LBJA 2JDPA 4N7UA 2Q1MA 2GU9A 1ODNA 2QQVA 3HNYM 4WM8C 2FDKA 3HWJA 4KBBA 3H1MA 1OQEA 1LNSA 4BB3A 4BOWA 2W9XA 3FHAA 2Y0IA 1VMJA 3GZUC 4RHV3 3T09A 1EPWA 2JDKA 5D2AA 2GNTA 1FMD2 4Q2FA 4DY3A 1YRZA 2Y33A 1GP5A 1W8ZA 1YC61 1ZZ8A 4Q4X3 4NPMA 4BIFA 3ITQA 1AYN3 4RSUA 2ZMKA 3HQXA 4EN0A 2UURA 5L9BA 1HDKA 4YW5A 3R6SA 4CDXA 2FHRA 3NRUA 3KWVA 4JRAA 2ZHNA 3RS6A 3PJYA 4YZ3A 3POBA 3MV01 3PVEA 2VG9A 4QHZA 4YM3A 2EA7A 4JZRA 1D0HA 3I2DA 1RUD2 4QDQA 1HRV2 1W0OA 4FPLA 3WNKA 2GP5A 3LA7A 4UXAA 4CDXC 2Y6KA 3SKVA 1DYKA 5GKAC 4I2OA 1VMHA 2B7YA 1ALYA 4CEYB 3AMPA 1W3VA 4S2DA 5FZAA 4BH9A 2BVVA 1XC6A 1J3QA 3WP5A 2FDFA 5IJRA 1F8VA 1HKDA 2VNOA 1QHDA 1SLLA 5FYSA 4QQPA 3BALA 4AQ2A 4BE3A 1S2EA 5D1IA 2PLV2 1N1TA 3MLKA 5HXVA 5CISA 1ENRA 1VAVA 4XFBA 1OI6A 1QNWA 1A8MA 1OVPA 2IXLA 4YW4A 3BTXA 2J1TA 4OUEA 5FXWA 2Y38A 4AVAA 1NYWA 2D43A 4B4PA 1X8MA 3SH4A 1PVC2 3KT7A 4IW3A 2ZGKA 4Q1RA 4YW7A 3DYPA 2AREA 2AZ5A 2ZGQA 4PIXA 2BNOA 4E8DA 4K7JA 4NRPA 3HQRA 4UOJA 1RUD3 1XQNA 3WP4A 3NJXA 1WMXA 5FZ9A 5A33B 3NO8A 1SMVA 2D3RA 3OGSA 4JGZC 3ZSLA 2ARBA 5I91A 1GQGA 5JOXA 4IL7A 4G3YC 5A1FA 3O0VA 1CWPA 2ZHKA 3CJXA 2J42A 5KHGA 2CU5A 3CIHA 3EYPA 1GZWB 2RS51 2FD8A 4CVUA 2PLV3 3HQUA 4O65A 3RJ2X 1U5XA 3CZJA 4XF9A 3UJOA 4QXHA 4B8EA 3BTYA 2VH9A 2XWBB 3CNAA 2ZOEB 2D5HA 3DYOA 2RS33 4AHXA 5ERLA 2IUWA 3MLLA 3VB9A 4DPNA 1LHWA 1HRI2 3FFQA 3GGLA 2YFUA 4GALA 1I6XA 1UYYA 3MPPG 1WMFA 4NROA 4UI9L 5APAA 4J25A 4CCCA 1POV0 2NZ9A 3HPNA 1RTVA 5A1LA 4CP2A 1LOGA 2MEV1 2NQYA 1L7QA 3OBTA 3OB8A 4IETA 3OBZA 2HWF2 2BTVC 4IE0A 2Z4FA 5FZOB 4S2GA 4Y24A 5K0UB 1GNZA 1YFWA 4LO5B 1BEV2 5H9RA 1UL9A 1OKQA 4IEUA 1AXYA 3T0AA 3MO4A 3OOXA 4E4SA 1YYNA 3M1HA 4UWDA 3PU8A 5A3NA 5AC93 5F5CA 4CEYC 4PLOA 1BBT2 1FMD1 3M3CA 5DXDA 1IGOA 4DXSA 3W21A 1VP6A 5A3WA 4LITA 3T30A 3ZN6B 1HRI3 5FUIA 1H8TA 3LEMA 4ATFA 1O3SA 1X50A 4CEWA 1UY2A 4UYBA 3OPZA 5E89A 1TVGA 2VECA 1PX3A 1W8OA 4QM8A 1GZCA 5K4LA 3RQ0A 1VE0A 2R071 1PZ7A 1PNFA 1REEA 3ON7A 1XE8A 4XBNA 3KB5A 2DTWA 1HRV1 2WLQA 5LY1A 5H9PA 5FUNA 4CEWC 4JGYA 2OQ6A 3UT0A 1BEV3 1HLCA 3ZKUA 1AYM3 2QQUA 1DQ5A 5IAXA 2D40A 3ZLIA 3TNPB 1OA2A 2OIIA 3TB0A 4A3ZA 3IMMA 1VLNA 3KM5A 3T3YA 2WN3A 3P3NA 4DUVA 3AFGA 2XQRA 3PVOA 5A7QA 4Q8KA 1ENQA 4AEMA 1TNFA 2X5IB 1K3IA 1R1ZA 3WQ1A 2CTVA 1ULPA 5JZGB 3LKJA 3WNLA 5FXZA 4I02A 1BJQA 1W6QB 2W91A 1PVC1 3I3BA 3BYWA 4PQ9A 4IV3A 4Y4YA 1UU4A 4AK3A 5BNOB 3ZYHA 2NP0A 2WRAA 4OI1A 4NPRA 1Q8QA 2XL9A 2ZGMA 4BM8A 3JB8A 3H7JA 2R30A 3MW3A 1PO12 2BV4A 1OC1A 3MLJA 1NX9A 2QZ3A 4IV3C 4MHUA 4MXWA 4NHYA 1WUVA 1IHMA 5A3OA 5LBBA 4CCOA 2CWSA 2X53S 1FPN3 1UXXX 2BPA2 3SCFA 5JDBA 3JD72 4EWAA 3R4SA 4TZDA 5IVBA 1AXKA 5JXHA 3WNXA 2V4VA 2ILMA 3A0KA 3RZJA 3MGUA 4IGQA 5K0UC 3LQCA 1APNA 4FO9A 4JAAA 5JR2A 1LB2A 2WR9A 1QEXA 2EXIA 2W47A 3MUY1 2WS91 3QACA 4RQPB 3BB6A 1O3RA 2B5HA 1HQWA 2CDPA 3AKTA 3UYJA 3VBFB 4NIDA 4XCBA 4YW6A 2AENA 3M70A 4PBOA 2CSGA 5H9QA 1RYYA 1W8WA 2W1UA 4CXXA 3N9QA 5DDJ3 3GNEA 4R9CA 2G9FA 1SHWB 2R6QA 3ZPOA 1PO13 2H6CA 2P3IA 4PIZA 2ZX2A 4YGCA 3U14A 3AXDA 4EN8B 5A3MA 2HWF1 4GWMA 2WAAA 5SV5A 2WIIB 1UX6A 4OFGA 5A1AA 3ZFGB 4LKSA 3JD73 2YC0A 3WCSA 4DUXA 4WVZA 3EQEA 2ZGPA 5JR7B 1VJ2A 4PF5A 4X8NA 3V64A 4DMIA 1C57A 1EAH1 5EIYB 5J7MA 4PF1A 4AGRA 1JZ8A 3S57A 4KH9A 1CGPA 2FDHA 2WNVB 2VZOA 2ET7A 4PJYA 1UNBA 2F17A 1YHFA 1V9U2 3PMSA 4HL0A 2VAUA 1W0PA 1ZYBA 3AP6A 4LO7A 4AHWA 5F1RA 2GP3A 3GHNA 1BBT1 2A6ZA 2QQLA 1HIXA 4Q0UA 4IERA 1CAVB 3K48A 4NAMA 3I3MA 1JMUB 3BIWE 2Z79A 2VZUA 3OEAA 2HWB1 1UZWA 3IAQA 2ZX3A 1Z7S2 3OGVA 2B39A 1H30A 2DV9A 2WAOA 2WWSA 2XWJB 3NJZA 2JB4A 3KLSA 5D8AB 1AR72 4RYDA 3U37A 2WWUA 3S7EA 2WQZC 2B45X 2YGLA 2WZEA 2V09A 5F6LB 5LEKA 3GDBA 1XB9A 5BNOC 1HW5A 4AGVA 3W9AA 1H8VA 1UY3A 3IMNA 4KG8A 4LBQD 3PL0A 5A7WB 4AGGA 2VMEA 2WA3A 1VBC1 3GYDA 1K5MB 1O8SA 5JXGA 4LA3A 5EFUA 4CU8A 2VQUA 2XOMA 1W9WA 4AFDA 5JIUA 4QKNA 1JXNA 5DAVA 1V9U3 1I1EA 5FPLA 4LO8A 3HOBA 1UPIA 3PIJA 4WM7A 2IXJA 2QQWA 2DU1A 2R042 3VHPA 2RR11 2XJTA 2DVDA 3I54A 3KZ4C 4B7EA 3AP4A 4XIOA 4FAHA 5LBFA 3A4UA 1ACCA 2J22A 2WFF2 2XVGA 2B4KA 2ZAHA 3N7LA 4QPGA 5FAXA 4GKYA 2YU1A 4YZ5A 3GJBA 4IEZA 4IEQA 5EV7A 1RHI3 1CAXB 1K12A 5DUUA 5ISLA 4Q4Y2 1OMIA 4DO0A 1G9FA 2QNKA 4QXBA 1S1AA 3WY6A 2X8KA 1KD7A 4QPGC 4BJ0A 2Q4SA 4LPLA 2UWBA 2VTFA 4XFCA 4C91A 1DZTA 5C8WA 3CL1A 1OLMA 2YPJA 3WF3A 4CDUB 2NMOA 4X6RB 2A6VA 1REDA 4WZFA 1LOAA 3I4IA 2GC1A 3ZFGC 4NRMA 4B4QA 2R043 1O6UA 5DUXA 4FSJA 1YQ8A 1F15A 3CQOA 1LAJA 2VQAA 4LLOA 3VBRA 4DB5A 3RGBA 4PQQA 2D7FA 2BGOA 1COV1 2RDSA 3NSTA 4R52A 3THPA 5HI0A 4M0NA 1G9DA 2GN7A 3VN4A 3WVJA 4ZKTB 1P8JA 1V0AA 2LW8A 4AQ6A 1W3XA 4BHPA 2HYKA 3Q8BA 4P02B 3VBRC 2Q1ZB 3J8F3 3ZSJA 4EE2A 3AL5A 3ASIA 1ZRCA 1JYWA 4ZXEA 1SDWA 4CTEA 4IEPA 1NQDA 1ULFA 1NE4A 4KI5M 2PHTA 3ZFEA 4L97A 1QU0A 1NA1B 1UOGA 5DABA 3PUAA 3H3UA 2UYBA 4UFMA 5FLJA 4DY5A 3UKNA 1B35B 1POV3 3MV11 4XCAA 1PIV2 3V56A 4YFZA 1U5YA 2YB7A 4Z2WA 4XTMA 2YG0A 3E6DA 5FZ6A 5LATA 3ZFEC 4LBLA 1HB3A 3FC0A 3PIGA 3MFAA 4NIAA 2WT2A 1ULEA 3LFMA 2VQTA 4N53A 4TYSA 5FYIA 5GZFA 4AW7A 3GF6A 3JBG3 4OLLA 5C5UA 3O1MA 2IFWA 5FP4A 3QD6A 3ZYGA 1DZRA 5L36A 1CR7A 3I2GA 3WT3A 3P1IA 2ENRA 4XF4A 1DQ1A 1FI2A 1ENSA 5FBZA 1RINA 2JB8A 3QBQA 4UW6A 1BVVA 4PHZA 4XJAA 2A3WA 4GJZA 4BMBA 3T2QA 1JZ4A 1UKGA 1Z7S1 3OBRA 1ULOA 4BCUA 3VKOA 1RGSA 4A6SA 1AR71 4NHMA 1O4TA 1G6NA 5I0UA 2R1DA 1LOEA 3ACFA 2K9ZA 4GJYA 4PI2A 3KHCA 2FQPA 2JD9A 2DVFA 3GBGA 5BV6A 2PQSA 4UFIA 1RUH2 2QQOA 4B3NA 3KGLA 5FQ0A 1YI7A 1SFYA 2VZVA 4UT5A 1C1FA 4BXSV 1WCQA 4YWAA 2ZAAA 2J1AA 4XDQA 5C6CA 4D7TA 1C1LA 2W52A 4XEZA 4P9LA 3CEWA 2OPKA 4JHTA 2ZABA 3L2YA 4LK7A 5FO9B 5G04L 3O1OA 1WLWA 1U5IA 2OW4A 4LKDA 2VMFA 2XJVA 3WDWA 1OSGA 3NKTA 3VDCA 1TMF1 4AVBA 5GZGA 2DVAA 2WFF1
chains in the Genus database with same CATH topology
3OYWB 4QM9A 5A32A 1X7NA 2GC0A 4AE2A 1NCQA 3PHMA 3FFZA 1DG6A 2Q8OA 3H3ZA 4Q4Y1 1RUH3 1FT9A 2AYHA 1QXRA 3NKGA 2ZGSA 1XYOA 4GH4A 1YIPA 1H4HA 1WA4A 3HBZA 1LJ7A 2BQPA 1ZZCA 2E51A 2CY6A 2XJSA 1Q56A 1NA1C 3WHUA 1PGW1 2E53A 4FQ4A 4GH4C 5FOJB 1C3HA 1CONA 4AEJA 4XMIA 1RUI3 2PYTA 3E5QA 3TBDA 2WJSA 1YFXA 1MQTB 3SCGA 1DF0A 3POYA 2GSYA 5IK5A 4DNYA 3VBUA 4I0WB 2D5FA 1LHUA 1W6NA 3AYEA 5I8TA 1CD3G 1AX1A 1ZRFA 3BOWA 4NHKA 4Q4W1 5JPMB 3WCRA 2MNGA 2YUEA 1RIRA 3AXEA 1PMIA 3VBUC 3WW1A 3VKNA 4FPHA 1O3TA 1RUE2 5EYXA 5BNNB 2IXIA 2XJPA 4OHXA 2QE3A 4C0BA 2CWMA 4E9KA 4QGLA 3UKVA 1PIV1 1U0AA 3WP3A 5FOBB 4KU7A 3ZDSA 5JMCA 1KXGA 2IWGB 1DGRA 2KA3A 4R9AA 4QQOA 2D44A 2LM3A 4QPIB 1QF3A 1MVQA 4AFBA 2DTYA 2ZX4A 4Q4V1 1ND3B 1FATA 3ST7A 5KXCA 2GNMA 2VMHA 3QLQA 1REFA 1S0FA 4YM1A 2E63A 5ACA2 1QQP2 1UAIA 3O7OA 4MH0E 4XQ4A 2CAVA 3B9CA 1HQLA 1X33A 4YARA 3ENRA 2IZWA 2WKKA 3HIFA 1A3KA 1MR5A 2Z42A 1ULGA 1A8DA 1RUE3 3KMHA 1SLBA 1RUH1 2R32A 4FOWA 3RYPA 4E2SA 4XE9A 4KGQA 3VZLA 2RMU3 2WNUB 4URTA 4DINB 1QWRA 4HVOA 2WT1A 2OZJA 3H1YA 1UPSA 4J1XA 4Y1XA 1C28A 1H9PA 5DG1A 5JCTA 5KXBA 4AVTA 4YGEA 5ACA3 2VQ0A 1JH5A 1G86A 3ES4A 5FFOC 3UKTA 1S0DA 3RSJA 1PK6A 2NMNA 2P17A 4WM8B 3ZVXA 3W59A 1H1IA 2VOXA 4WVMA 5CA6A 3PJQA 1QJX2 4KWLA 1MQTC 3U4XA 3TWIA 5ABJB 2JE7A 2JECA 4XFHA 1PK6C 4OHWA 1S0BA 1RUG1 1RUC1 2XGXA 2ZZJA 4HANA 2RM22 3ELNA 4GA9A 4MGYE 4SBVA 3WQ7A 4E2QA 1ULDA 4I09A 1WW5A 5J3UA 1LENA 5DUWA 2DCTA 3VDDA 5CADA 2HWD2 5BNNC 3B7MA 4LT5A 2Q5TA 3WW2A 4HVQA 4CDXB 1C4RA 1WW7A 3AFKA 4AVSA 3DV8A 3VHNA 3VDDC 4BWOA 3KT1A 4HN1A 3THTA 4FQZA 2G9GA 1LGCA 4BZ4A 4HMZA 1Q8OA 4QQHA 2GALA 2ZGRA 3B69A 1BZWA 1YJKA 2WA4A 4FOVA 1LGBA 4KG0A 2XKOA 1DHKB 2JG9A 2P37A 1JUHA 3ILFA 3B5LB 1XYNA 1YUDA 2ZCWA 2HWD3 5FRAA 2H0BA 2PHUA 1O5UA 3OCPA 3LSDA 2VGDA 4QQLA 3AJZA 4B7KA 1OPMA 3AB0A 2JG8A 4K6BA 1FXZA 5JAXA 4P9JA 1QQP1 2MEV2 3D82A 5T50A 4K20A 2JG8C 4NO4A 3TAYA 4LR4A 3WDXA 4YSFA 5J98B 4QGMA 2RS53 3S30A 1QJU2 5CBLA 2GC3A 2PQQA 4XIKA 2XJRA 4EROA 3VUOA 5ABJC 2X29A 1V70A 2DVBA 2WT0A 3KCCA 2OVUA 1LOBA 3U0ZA 2FMDA 4N7IA 2XG3A 4P5HA 1O4YA 3WDYA 3AZXA 4HPKA 4U36A 5GLTA 3MI8A 2MEV3 2R072 1QY4A 4L2NA 4EV0A 4KNCA 3VZMA 3RDIA 1QJX1 4YFWA 2BNNA 4F8AA 1QOOA 2A71A 4HN0A 1HQNA 3ZXKA 4ORFA 1Z78A 3MF9A 2RM21 1XNCA 1LEMA 3L2HA 2D3PA 3WHTA 1Y9QA 5A3LA 3LZZA 4YVSA 4Y20A 1AX0A 4JVAA 1FMD3 2ETEA 4FAGA 3KD4A 1S0CA 2P2KA 2IXCA 3ILRA 4Q27A 4D94A 4F7ZA 2HWD1 3MW4A 1H8TB 2ZZQA 4D69A 2A5ZA 5CFCA 3N3HA 4CEWB 2R073 4RGAA 1IOAA 1TEIA 5GLWA 2R0FA 1HRV3 1LEDA 3WDTA 4R4XA 1GZ9A 5CFCC 3OD4A 4JGYB 4Q26A 2JEMA 4R8HA 1VBB2 3BODA 3ZXAC 4COUA 4YRDA 2PHLA 1HV1A 3VV1A 1BCXA 2RS11 2WFPA 5I0RA 1BVP1 2VY0A 3LOIA 1D4VB 1DLLA 2WS92 2D6OX 3IPVA 3D8CA 4ASMB 4AHZA 3ROUA 4XPVA 2XBO2 4TLFA 1PVC3 3CJIA 4FOYA 5E88A 1JYIA 1SBEA 4IV3B 1KQRA 1I5ZA 2TEPA 5BNQA 1FOD2 1S0IA 1LOFA 4XMAA 3SMHA 1GQHA 3FWEA 1ZZ7A 3CJIC 2VPVA 2YV8A 4YYOA 1Q3EA 1AR82 2HEWF 2PHDA 4MXWB 4A7KA 1N3PA 1OA4A 1B09A 3VBOA 1NCRA 4D7SA 1QOTA 1LHNA 1DU3D 1LHOA 1SBDA 1EAH2 1X36A 4PLNA 3ZSEA 4LE3A 5CIRA 1QJU1 3OD0A 3WX5A 5C8CA 4FCAA 4XHXA 1CAUA 1D4M2 1W6OA 2WS93 1BMV2 1NCRC 1SACA 1Q43A 2K0GA 3RG0A 1X8EA 3IN9A 1ZBA2 2WZR1 1MVEA 5C8CC 4J6GA 4LO4B 3MDPA 2QUOA 3ZYRA 2HWB2 2YXSA 4ZU5A 1ZRDA 4FOQA 1UCXA 3G7DA 3N36A 2ZS6B 5DZFA 3I8TA 4NWWA 5L7OA 1AF9A 1H8TC 2HWF3 1AR83 1H0BA 2EXKA 1OLRA 1AL0G 4Z82A 3VZNA 3ZYPA 3M3IA 4IEYA 4N9HA 1VBC2 1EAH3 2PFWA 3T1MA 4ZU7A 1N3QA 3AX4A 3LGRA 1Y43B 3E97A 1UD1A 1W6PA 4JGYC 5T3NA 1FAYA 4LUMA 2E6VA 3VBHA 1BBT3 3FUQA 3APBA 3GZTB 5JSPA 2RR12 4JC1A 3RPQA 4YM2A 3CU7A 4B4RA 2HWB3 4Z8BA 3VBHC 3QOPA 5T5OA 2R1BA 2B42B 2ZACA 3AJYA 4Q0VA 1UU5A 1IS4A 3MICA 4XXPA 3AKRA 1VBC3 1DDLA 4OULA 1VBB1 5JOZA 3VKFC 5KHKA 3R4DB 2E9QA 3SH3A 3VKLA 4FBFA 4YG3A 4OI4A 5GM0A 3MZHA 3INAA 5C4WA 3RYKA 3SNMA 1O3QA 4WM7B 4RL7A 2RR13 4IEVA 3IWZA 4HETA 5IK8A 1O7FA 1UZZA 4FPGA 2XBO1 1COV2 4MZUA 3U10A 5C4WC 2B8MA 3HT1A 1YIFA 4FPFA 1FOD1 1ASJ2 4QPGB 3JZVA 5BUVA 2EVXA 2XHKA 4JQRA 2GN3A 3IDCB 2ZBJA 1W6MA 1GNHA 2JJ6A 5EYYA 4LHKA 1RMU1 4MX3A 1S0GA 2BNMA 1AR81 4W6XA 1YNAA 4OVEA 3SHRA 5BYNA 3DGTA 2E7AA 3SLIA 3H7YA 4DXZA 5C33A 2ZGLA 3CF6E 3G6JB 3ZMOA 2Q30A 1KDKA 5FREA 1D4M1 4IEOA 4I0BA 1BMV1 1COV3 1LU1A 3ZFFA 4Z92B 1ZBA1 3VBRB 2R061 4EWEA 4YZ4A 4F83A 4F3JA 1QH6A 5BNPA 4L92A 1RITA 3J26N 2D97A 3M2MA 3R0RA 1MZ6A 1YFUA 3AP9A 4IEWA 4META 1ASJ3 4XF3A 3S0MA 3ZIWA 4MXVA 1RUJ1 1ONAA 3ZFFC 3ES1A 3SCHA 4UW4A 1QGLA 3NAPA 4LE4A 5BNPC 3ZFEB 3DL3A 4AG4A 1HV0A 1W39A 1C8M2 1DGLA 3B00A 3BTAA 1ND2A 4FTBA 2YY1A 2ARXA 5GZDA 4XBLA 4IESA 3TN92 4W6YA 2D6MA 1XU2A 2QZ2A 3HD8B 1NXD1 1R081 2ZPXA 2XB6C 4R9DA 1KFXL 3M7AA 1RB8G 1ZZBA 1UW8A 4N53B 2VMGA 1J58A 1EYBA 3KS7A 1AUYA 1IPKA 4CDWA 5J96B 5J37A 1MS0A 1TMF2 3H50A 4ISQA 4K40A 4A7YA 3FLTA 2XJQA 4K21A 1WLCA 3O14A 4HSLA 4P9YA 4WM7C 1Z7S3 1F2NA 3WOGA 1AR73 4YNIA 3WG1A 2QVSB 4CDWC 2GZWA 1X82A 4L8QA 3WG4A 3RJRA 2NPIA 1MS9A 4Y5Z0 4JTNA 3SH5A 4ES9A 3SISA 2HEVF 1L3JA 5FQ0B 1AR92 5K9YA 4QQ2A 4INDA 4QHBA 4O9EA 1TME2 4KWKA 1J1TA 1FX5A 4GIQA 3IKWA 3WV6A 1PGW2 4NVPA 1WW6A 3V0BA 1DYPA 3AMQA 2R0HA 1NLSA 4JDOA 4N9IA 4FXKB 4D3WA 1BXHA 1TMF3 5K7PA 4RGGA 3AZZA 3D0JA 2WFF3 4A7ZA 3V0AA 2IXHA 5HBAA 2BFUS 1RJ7A 1OD5A 4KWJA 3WDVA 5A32B 4Q1PA 4Q4W2 1KJRA 1ASJ1 3VZKA 1NCQB 2O8OA 4Q4Y3 4LBMA 5BPXA 2C1FA 3KSCA 5LEJA 1MS4A 4GH4B 3WG3A 4XYXA 4FT8A 1YWKA 4OUSA 4Y26A 1UN1A 5CG9A 5L19A 4BPZA 4M3CA 1DQ6A 4LUKA 4NOTA 3ACLA 3J9SA 2CL2A 1KJLA 3ATGA 4Q4V2 2UY9A 4MV2A 5T54A 3FUOA 3WP6A 4DRRA 1UF2C 1S2BA 4OHZA 1PO21 5H9SA 3VBUB 4AEDA 4YW1A 3TRSB 3MIHA 2A75A 1W6NB 4N53C 3DPRA 3JQXA 4Q4W3 2EIGA 4I30A 1VB2A 1GR3A 1YCIA 2H0VA 4Q0QA 3K51A 3ZXJA 1HXS1 4R9BA 3DPRC 2GAUA 1WMEA 3OGJA 1WCSA 3MYXA 1C8M1 2PN5A 2DFCA 4AVVA 4QMAA 1PIV3 1C5IA 4I0AA 2XH6A 4WVVA 2AUYA 5T5LA 3MIFA 2EALA 3TN91 1EPZA 2BFUL 4B29A 4GB31 1BQPA 4Q4V3 4CDQA 2PHRA 3AKPA 5HCFA 2QFEA 3W58A 2ZMNA 3N7KA 4YM0A 2N7GA 4MVTA 2W39A 1G9CA 4QU2A 3MIBA 4FTSA 5I0TA 5J36A 2FBEA 5GLZA 3E5UA 3E6CC 4Q8LA 2XKPA 1RUG2 1UZYA 1RUC2 2JD4A 3FE5A 5FDBA 1AR91 3RI8A 1DGRN 1NCQC 1V6OA 1VRH2 3MPBA 2WC2A 1TME1 3JCIA 1KDMA 3OJBA 3X29B 4COVA 2BGCA 2A3XA 4DRVA 4XFAA 3AKQA 2UWAA 2QDRA 4RS5A 3PVNA 3I59A 2PAKA 2UY8A 5GALA 3ZXEA 2YHJA 1QJY2 5KHIA 1BK1A 5DG2A 4DQAA 2HWC2 2PHWA 4HVRA 4IXLA 5F5QA 4WZCA 4AF9A 1MEC1 5J48A 1IKQA 1ZBE1 1XRUA 1CIWA 4RS5C 1PK6B 4YW3A 3MF6A 3WG2A 4OHVA 4UW3A 4GKXA 4WVMB 4AEKA 4A3XA 2D93A 2XL7A 3B9IA 1V00A 1U5ZA 5HCBA 2VW1A 1RUG3 4H7MA 1RUC3 1SLAA 4GWNA 4RD7A 1LTEA 3MIEA 1VRH3 2A6YA 3Q9OA 1ENXA 1A78A 1PVXA 2OZ6A 3NVCA 1WD3A 4XETA 2JENA 3OGGA 3E5XA 4GMP1 4JCKA 1QJY3 4CP0A 3VDDB 4XJZA 3AMHA 4MGZE 5AVAA 1AL22 2IC1A 1PGSA 2V73A 2EAAA 1OOPA 2PELA 2GNBA 5GZCA 4P14A 3FLPA 1BKZA 3USUA 1VBA2 5CNAA 3ZXDA 5LRSA 4W65A 2A3YA 2BWAA 4MLOA 1WCDJ 4FPEA 5AVPA 1IS5A 2IXKA 4ASLA 4HZFA 3ZSMA 1AR61 4XOGA 3D0SA 2R49A 2I2SA 3RZZA 4OZXA 2JG9B 2EXHA 5KC5A 4LHNA 3WQ0A 2HWE2 4LBOA 4XJ9A 2OA2A 4C1XA 2O1QA 1I3HA 4DFSA 5K8SA 3A0NA 3D5OA 1RUOA 3M3OA 5J09A 1QQP3 1CAWA 1ZA4A 2JG8B 3LA2A 2NN8A 5KWRA 3H0OA 1J59A 4AVCA 4NN0A 1QMJA 4SLIA 4QGNA 2CGNA 2HKXA 5KXDA 2UWCA 4IV1A 1V6MA 4HFSA 4TSVA 2AR6A 1BYHA 4NWVA 1VRH1 4IV1C 4UBHA 4S2FA 1GKBA 1GSLA 2ZKLA 2BUKA 3EJKA 1H2LA 5LRRA 5KHHA 4LNVA 2TNFA 3HR9A 1QJY1 4QX5A 4J1WA 2HWC1 2D6NA 3ECQA 4Y22A 2QQPA 1LOCA 2GH8A 2VULA 4HPKB 5T5JA 5TSWA 1JUIA 4AI0A 4N43A 3HN1A 4AWDA 3NV1A 1VBD2 2JKBA 3ZYJB 1QJX3 4HK8A 2ZX0A 1SEFA 1N1SA 1YJLA 2A70A 2ZGOA 3AMNA 4Y1UA 3VL8A 5C9AA 5JLVA 2RM23 3AMMA 4PDWA 5BXXA 1G9AA 1CQ9A 1R091 2RS12 1TQ5A 2PHFA 2XLAA 2RE9A 5EXOA 4YVSB 1WLTA 4Y20B 4EN6B 5C9AC 1RL3A 2B46X 2YMZA 1PZ8A 4PDWC 4CRQA 1VAMA 3ILNA 4A2UA 4ISRA 3B3QE 1AL21 1GFF2 2VNGA 2YYOA 2BWCA 2JG9C 5GLUA 1TNRA 3WUDA 2DYCA 5CFCB 3B93A 1VBE2 2F6BA 1NXMA 5GJ6A 3IM0A 4NR1A 1MS1A 3VBSA 1VBA1 3FBMA 5CFDA 1MZ5A 1WMDA 4RR3A 4QT6A 4E2GA 4KL1A 2R16A 1OFNA 5FPXA 1JOJA 2RS13 3VBSC 1H9WA 4XFFA 4Q4X2 1S2KA 1JYCA 5CFDC 3M3EA 1AYN2 1MS5A 4RR3C 2PA7A 4ONUA 3IPVB 1YI9A 2WQ4A 4FP2A 2WZR2 1N3OA 5CVRA 2I07B 2HWE1 2DCKA 3CJIB 3V65A 2VW2A 2LTNA 3H8UA 3HT2A 3MEPA 4I01A 1R1A1 2XJUA 5GZEA 2RHPA 4M3CE 4PBPA 5FTTC 4COYA 4G9SB 3VBOB 1NCRB 2VUJA 3VHOA 4HKLA 1EV11 1QJU3 1WLDA 4AFCA 3BU7A 2VXRA 1MS3A 4K3UA 2JICA 5C8CB 1WGPA 2P34A 3RMYA 4FPCA 5JOYA 1CAUB 1W6OB 2FZ1A 4HLTA 1XYPA 2WZR3 4OHYA 4LLFA 1GBGA 1FYUA 3OY8A 2RJKA 1AVBA 4YVSC 5IUQA 5HCAA 2PAMA 2ET1A 4Y1ZA 1IS3A 1DGWX 5F6KA 4M0HA 2DCJA 3U11A 3J4UH 2TUNA 3KT4A 2JDZA 1JN2P 3SXWA 5L7OB 2XLGA 1OLQA 2VW0A 4LBQA 1ULCA 1VBD1 1KFUL 4XW3A 5T52A 4MGKE 4Z1VA 4HBNA 3MIGA 1UMZA 1QXJA 1UIJA 4BYYA 1UU6A 1S0EA 3P3PA 4R4ZA 5E8AA 4W6WA 5EJ3A 2RS32 5EWSA 5BY5A 1W6PB 3ZXGA 3N35A 4JGZA 3ETQA 3DUIA 4P9WA 3VBHB 1J3PA 4O9GA 4XJ8A 4YVWA 3U07A 1SBFA 2C5DA 3ME2A 1EY2A 1H2MA 2CV6A 1GV9A 1WBLA 2Y0OA 3LB9A 5B2GB 1VBE1 1LECA 4XXAA 2A7AA 1CJPA 4YVWC 1VALA 4KQ7A 4L9BA 4H55A 1MACA 1RMU2 2ZJCA 3ZSKA 4FPJA 5AC92 1VBB3 1ZZ6A 2Z2SB 4ZXKA 4RHV1 3ZPYA 5IK4A 1LOFC 4HSJA 4L11A 1XNKA 3AP7A 2YZ4A 3AKSA 5CU1A 4Q4X1 4RA0A 4YGBA 1AYN1 3EBRA 2EAKA 2O0OA 3RRDA 1SLIA 2FZ2A 1NOVA 3B94A 4GXLA 5C4WB 1YFYA 2EF6A 3KGZA 3RNSA 3RMXA 1O4ZA 1N1YA 3VBOC 4COWA 2PHXA 2XBO3 3ZYIB 2R062 4TWTA 4WVWA 2E7QA 4UW5A 4U2AA 4CZSA 1LESA 1WW4A 1FOD3 5T5PA 2YGMA 3O0XA 4CEYA 5JPNB 1AYM2 2H6BA 1RUJ2 2ZGUA 2DVGA 3DKWA 5I93A 4GMP0 4MGIE 1RMU3 1W6MB 1GLHA 4P9IA 1QDOA 3NWKA 3LA3A 1DBNA 4X8PA 4FXGB 5CG8A 1KRIA 1RJ8A 1GANA 2K2SA 2MHFA 1OFSA 3E6BA 4Q0PA 4BMEA 1RUF2 5DZGA 4E27A 4XF1A 5L7OC 1J3RA 4M3CF 3PNAA 2ATFA 5AFEA 2WNEA 3N7JA 4WV8A 1Z0HA 1FV3A 1R082 3SITA 1MS8A 1D4M3 1VAKA 1H1MA 1PNGA 1KS4A 3O5SA 1ZBA3 3WW4A 2XPJA 2R063 3ZFFB 1RUD1 5A33A 5I8SA 3VL9A 4LBNA 1H4GA 4LBKA 2C0ZA 4C1WA 5BNPB 2P3KA 2SBAA 1RUJ3 4K1ZA 4V1PA 2C9AA 1FPN2 3AYAA 1V6NA 1AHSA 5KHJA 1IS6A 1AJOA 1GZWA 3NAPB 1NQJA 1QNYA 5FMOS 1RUNA 2BEOA 3JUUA 4LEJA 1RUF3 2PLV1 4XFIA 1ND2B 4EN9B 2EXJA 3OTFA 3FZ3A 1LU2A 1Q5OA 1R083 2ES3A 2RS31 2VVFA 3IDEA 4K1YA 2O8QA 2ZGTA 2V5YA 3VZJA 3TYJA 1OQDA 3JB4C 5DDJ2 2CNAA 3D4KA 4CDWB 1PM7A 3T2TA 1LULA 5FPZA 1IQAA 5K0UA 2WSVA 3GHMA 3R4UA 5AFBA 3O12A 1PZ9A 2XLFA 4JV4A 3C3VA 3NV2A 1KITA 3T1LA 1XU1A 5AC91 4JRLA 1LKNA 3N4MA 5JI9A 1H2KA 3NL1A 4AQTA 3ZN6A 4DOUA 2I74A 1C8NA 4EN7B 3MFCA