4XFDA

Crystal structure of a nh(3)-dependent nad(+) synthetase from pseudomonas aeruginosa
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
280
structure length
262
Chain Sequence
HHHHHMQQIQRDIAQALQVQPPFQSEADVQAQIARRIAFIQQCLKDSGLKTLVLGISGGVDSLTAGLLAQRAVEQLREQTGDQAYRFIAVRLPYQVQQDEADAQASLATIRADEEQTVNIGPSVKALAEQLEALEGLEPAKSDFVIGNIKARIRMVAQYAIAGARGGLVIGTDHAAEAVMGFFTKFGDGACDLAPLSGLAKHQVRALARALGAPENLVEKHGVTYAEIDAFLHGQPLREEAARVIVDTYHKTQHKRELPKAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a NH(3)-dependent NAD(+) synthetase from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
molecule keywords NH(3)-dependent NAD(+) synthetase
total genus 108
structure length 262
sequence length 280
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4xfdA00
2CSXA 3KFLA 2NZ2A 1O0BA 3C8ZA 3ZJVA 1ZUNA 3ND6A 4K03A 1N2JA 3AG5A 1NUPA 1QTQA 3A04A 3A2KA 4MVCA 4MAFA 1T6YA 1F7VA 2V0CA 4MW4A 4NAHA 1R6TA 1MJHA 3CR8A 3ND5A 1V47A 2CT8A 4X0EA 1KP3A 2A1TS 4F4HA 2HZ7A 4R2LA 1JEEA 1PFWA 3MLAA 3P0IA 1WZ2A 1WXGA 1Q77A 3COWA 1H3NA 4DDHA 4MUKA 4MUNA 1X8XA 1I6KA 2CYCA 3X1KA 4PY2A 2PZAA 1HYBA 4PBSA 2QJTA 2ZUFA 1M8JA 1QRUA 1BS2A 4G6ZA 2C5SA 1O95C 4U8HA 1J21A 2EJCA 3CVVA 1IQ0A 2PFSA 1N78A 1O96B 3ZJUA 1NUQA 1NZJA 1T6XA 2E18A 1O94C 3AKZA 2ZUEA 4EG7A 1K92A 1EFPA 2A1UA 4EF6A 4DLPA 4CDNA 1ZJWA 4PBTA 1DNPA 3HZRA 2DEUA 1WKBA 1COZA 1OBHA 3Q4GA 4ZT4A 1J20A 4E1AA 3AL0C 1O97C 1YUNA 1NUUA 3INNA 2CUZA 5DB4A 3IMCA 2IELA 1F9AA 1N1DA 4MVYA 2QTNA 5TEWA 4A91A 3UOWA 3KT6A 3ZUGA 3ELBA 3P0JA 1FYDA 2CV2A 4TS1A 4KR7A 2PIDA 2A84A 4EG8A 2DXIA 5K0SA 3A4IA 3FDXA 3CVWA 4YBRA 3H9CA 3SEZA 3IOBA 4KPUB 4CQNA 5K0TA 1T6ZA 2J08A 1G8GA 1KH1A 1YIDA 4MW1A 1G59A 3ZGZA 3SEQA 3FIUA 1KH2A 4EG4A 1N2IA 1N2BA 1JIIA 3N9IA 3U1VA 3RBAA 1EUYA 4MUIA 2E89A 2PXHA 2H29A 1VBKA 1WXFA 2I1LA 3HFJA 2GM3A 5J5AA 1ZH6A 2PZ8A 1IVSA 4HPWA 1EFPB 3KT3A 1TYBE 1WJGA 2J07A 5HG0A 1IFXA 3MXTA 4ZCRA 1WY5A 2R5WA 1YULA 3IUBA 1QNFA 1K4KA 3CVUA 3NBKA 1KH3A 1T9GR 4K0RA 4XFJA 1FFYA 1IRXA 1KQPA 2DPLA 3N05A 4MW7A 2AKEA 3FH0A 2QUIA 4ARCA 3COVA 2X0KA 1GN8A 3H99A 2TS1A 3D6VA 1MOPA 5FO1A 1KKUA 3P0HA 4U63A 3IMGA 5TEVA 1M8FA 1PFUA 3PNBA 2D13A 2QUHA 2HGZA 4MWEA 3TQIA 4MWBA 4MW2A 1N2GA 2X3FA 1TEZA 1O0CA 4MUFA 4EGAA 2WQ7A 1NYLA 4RPIA 4EG3A 3L92A 4OUDA 2E0IA 2GOYA 1NP7A 3IMEA 3TS1A 1IHOA 3ND7A 1GZUA 1GLNA 4ZT7A 5KWVA 1WOYA 1WQ4A 2VTBB 4MUJA 3AFHA 2IP1A 2QTMA 4G5YA 1I6MA 1XNGA 2JANA 2Z08A 1U7DA 1X6VA 2CYBA 1JIKA 4NDAA 1U3DA 4RUKA 3AIIA 1QU2A 3CLRD 5TGTA 2G36A 1F7UA 2NSYA 1P7PA 3GUZA 3SYTA 4MQ6A 2WQ6A 1OWMA 2RE8A 1QQTA 1IH8A 3E27A 3K32A 4DE5A 1QRSA 2JA2A 1B6TA 3VGJA 4MVXA 4FZJA 5LM3A 1JILA 3CLTD 3RFFA 5FNZA 4Q16A 4P2BA 4ZT2A 4AQ7A 1EJ2A 1KP2A 1SURA 4NATA 5H16A 2DR2A 3IODA 4CT0A 4ZT3A 4OJMX 1V8FA 2PZBA 3TZEA 4ZT5A 3FI0A 3NBAA 1NURA 2EL7A 3M5WA 2DUMA 3LCJA 2O5RA 4DDKA 2JAXA 5DASA 3UY4A 4WSOA 3BL5A 3RK0A 4BWVA 3COYA 1RQGA 3K9WA 4ZCPA 1JZQA 4MUHA 2VXOA 4YP5A 1M1ZA 1MAUA 1MAWA 1J1ZA 2AZXA 5DK4A 2D54A 3IDFA 3H97A 1MRZA 1TQ8A 4I6EA 3ZXIA 1NUTA 1U7XA 4EFKA 1H1TA 1N2EA 4S1OA 4KR9A 4HK4A 4XSVA 2YWCA 3RK1A 1TYAE 4I6JA 4DDMA 1O96A 1KQOA 1EFVA 3FG9A 5AHWA 1N2OA 3KT0A 4MWDA 2BYTA 1J1UA 1I6LA 3IOCA 4QRDA 1KR2A 2AG6A 3G5AA 2ZP1A 3MUEA 4MLPA 1JIJA 1WXEA 1XNJA 4PBRA 3Q10A 1M8KA 2QJFA 2YXNA 5J58A 1KAQA 2CV0A 2Z3VA 1I2DA 3HL4A 1K97A 5FO0A 3SZGA 3X1JA 1KAMA 5HUJA 5LFAA 2XRZA 4H3SA 1NI5A 4ND7A 1GPMA 2A88A 1J70A 4JZYA 5IHXA 1JZSA 2QUJA 3H9BA 2IJGX 4MWCA 2J4DA 4NX2A 1EUQA 1H3EA 4MUEA 3PXUA 3H05A 3AG6A 1OBCA 5TS2A 3PNYA 3FNRA 1EE1A 5IJXA 4G5FA 3DO8A 5H7XA 3DPIA 1GTSA 1PG0A 4YMIA 5KHAA 4JXXA 1F4LA 1XJQA 4MVWA 4EG6A 2QJOA 1JGTA 1TYDE 1T9GS 3GMIA 3X1MA 1GAXA 4JXZA 1XNHA 1EFVB 4F3RA 1M8GA 3IH5A 4XFDA 3CVYA 1GTRA 2CV1A 1R6XA 2X1LA 3CVXA 3N2YA 1N75A 1PFYA 2CYAA 4I6GA 2A1UB 3CLRC 4QBTA 1OWPA 2O8VA 2HMAA 4ZCSA 3N8HA 5LLTA 3RJZA 1K4MA 1Q19A 1G8HA 3MMXA 4CDMA 3UC5A 2A86A 3A05A 4MW6A 2D5BA 1YI8A 4L2IA 4NZPA 3CLUD 1ULHA 1N77A 4WNYA 1NSYA 3CLSD 1O6BA 4DJAA 4EG1A 3DV2A 1JHDA 3F3MA 4KR6A 1O97D 1OWLA 2A4MA 2J09A 1QJCA 1A8HA 1TYCA 5F23A 2H2AA 1N2HA 2OQ2A 3VRHA 4R0NA 1U3CA 4KKVA 1IQUA 3QTTA 3IVCA 3QTBA 4UZEA 4ZT6A 4JYZA 3HV0A 3UK2A 3FOCA 1M8PA 1Y42X 1O94D 2WSIA 3ZJTA 2DLCX 3FETA 1J09A 2X1MA 4JFAA 3COZA 1N3LA 3TQOA 1VBMA 3SP1A 3CLSC 1Q11A 3FY4A 1ILEA 4MULA 4YP6A 1O95D 1JMVA 3IUEA 1O5TA 1EXDA 1D2RA 1NUSA 2VTBA 5KCMA 3S3TA 3ZXSA 3JXEA 1ZH0A 3IVGA 1WQ3A 3PRHA 1Q15A 1MB2A 3MLBA 1CT9A 4MW5A 4MW0A 3RHSA 3DLAA 4J75A 1LI7A 2DETA 2B7LA 4AS1A 5J59A 3I05A 1R6UA 1LI5A 1MBZA 2PG3A 1MC1A 3SDBA 3FHJA 1VBNA 3HGMA 3Q12A 3IOEA 3ISJA 5EKDA 2YY5A 4EG5A 1TFUA 3CA8A 3OP1A 4KPUA 3ZIUA 4U7JA 1JECA 4MUGA 4ARIA 5BNZA 2E21A 2BTEA 3TNJA 4Q93A 4DNXA 1QU3A 2QTRA 3GLVA 5JBNA 3OTWA 1YUMA 3CLTC 3TZLA 1KQNA 4ND6A 4R2MA 2CFOA 2J5BA 4HJRA 3UMVA 2A1TR 5HUHA 4GU5A 4QREA 1PG2A 3ILVA 2V0GA 2WB2A 4YP7A 1LW7A 2YWBA 1H3FA 4MW9A 1MB9A 1M83A 2OV4A 3FWKA 4OUDB 3LOQA 3NV7A 1YIAA 1VLHA 3LE8A 3PNVA 2QUKA 3KT8A 5DEOA 4GRIA 1VL2A 2A7XA 1KORA 1QRTA 2GKSA 1OWNA 2RD2A 1G8FA 4NAUA 3G59A 1IQRA 3QE4A 3G6KA 4J76A 1UFVA 2DERA 3D6UA 3SZ3A 3HMQA 1PFVA 4UZFA 3P52A 3CLUC 4ZCQA 1OD6A 1U0BB 1WXIA 1WXHA 1S4MA 4L2IB 1JEDA 4ZCTA 4HJXA 1OWOA 3L93A 3IVXA 2Z09A 2XRYA 3VU8A
chains in the Genus database with same CATH superfamily
3CNQS 3KJIA 1OX4A 4P7FA 4DLAA 4TLAA 3IRVA 3WLMA 1K89A 1RPAA 3AR9A 1DEXA 2QT0A 4Q0MA 5KDLA 3NOVA 1P2SA 2PR7A 3RYIA 2CXOA 4LECA 3QMPA 5EXTA 3KB1A 5HK9A 3O5AA 2ATXA 1OR8A 2J6BA 3Q2OA 3HU3A 4F71A 1XRSB 5CVVA 1QPBA 3GPBA 4K3UA 5CFOA 2VK4A 2FN9A 3QUCA 1SOWA 3T61A 4M87A 3EWAA 5K0NA 1VYHA 3WWZA 4G0VA 1WZ2A 4HATA 4NYMQ 3ND9A 1RHKA 3C3DA 5I9NA 3ST7A 1QGYA 1T4GA 1AF4A 4A6PA 4GYJA 4V0LA 4ZWNA 1DJQA 3NJ8A 1DIHA 4BO2A 3RVDA 2DVMA 1T0JB 4GUAA 1YQWA 5KINB 1A69A 2C5BA 4N5DA 4XWAA 2GHIA 4DMRA 4ZVMA 1FFSA 3U37A 2B4TO 4R7TA 1AKYA 4GRAA 5ES4B 1AHPA 2ZUFA 1GL7A 1WMDA 3HQ4O 4OGWA 1KEEB 4ZYWA 2FPRA 3ZV5A 5A5VA 1KO4A 4N0DA 4WBNB 4NXMB 1NUHA 3VI3B 3KK0A 4BO0A 4S05A 5C5CA 4KQIA 3QOWA 2JDIA 3AF5A 2BM0A 3KXIA 1OXKB 4NSNA 1AMNA 4ZK6A 5HCUA 3WMFA 1GL6A 2VT7A 5T8KA 3WQQA 2C5GA 4DUYB 1YR9A 1R8XA 1T1JA 2DBQA 3B85A 5NULA 3F6PA 4CDNA 2XWSA 2ZE8A 3AUXA 1DNPA 3HZRA 4ENSA 4LVCA 5EVCA 3VNAA 2XQFA 1DU4A 1U3WA 1DRUA 5JO0A 4B09A 1MVOA 2LCQA 2FEOA 2QTHA 5DCLA 3T7CA 1KR5A 4EY7A 1VPWA 4EHBA 1X13A 3QNUA 4R4JA 5BUSA 5K3FA 2B0JA 3PRJA 3IMCA 2IXDA 1GNQA 1NMSA 3EVEA 3H0KA 1F9AA 4WVFA 4E30A 2I4TA 5BQXA 1VL0A 2VA8A 5IK2D 2BMAA 2IHKA 4XWTA 2XCTB 1E6CA 1I3MA 4F21A 2MIIA 4RJTA 4I9FA 4PVCA 1WS6A 4H31A 2A84A 2B69A 2D0DA 1INLA 4DA4A 3U6BA 4I4CA 4KE9A 4YBRA 2OZLB 5A5DA 4XPZA 2JLVA 4TMWA 2VWPA 1TVMA 5HOEA 4LY9A 5KJ1A 1SH7A 4FEYA 2CVZA 3KYJB 3M8KA 2A57A 3RVRA 1CX9B 1L7RA 2YCBA 4DEYA 3ZDDA 8OHMA 1II0A 1QIJA 1ECGA 1QIGA 2FSIA 2NXNA 4FIZA 2POQX 1OLUB 2GX6A 3Q7SA 4KG7A 3T7IA 1M7BA 4AY3A 2PLNA 5CXQA 7GPBA 4LY3A 1JIIA 4QBKA 3LD9A 3OA0A 1Q7EA 3M6WA 3QUAA 4RHEA 1SQFA 2E89A 1VSBA 2GCOA 3GP8A 4TV8B 4F1WA 1TA9A 1GRNA 3JD0A 3QENA 3WQSB 3PKJA 1PYOA 5E6SB 2OHVA 2E48A 3L7DA 2Q8QA 3IO5A 4JHLA 4WXRA 1A1SA 4OHKA 3KYBA 2OBLA 1NDHA 3RVJA 2BVNA 3UGKA 5LL6P 1E2KA 4NH4A 1PR3A 1NF3A 5IMSA 3HEBA 3BHJA 1R74A 1AU9A 3WL8A 2BONA 4ZCRA 4XD2A 4C01A 3BGDA 1XPOA 3NBKA 3A1DA 3OZXA 4IH4A 2IWHA 1GZ3A 5FOWA 3HVRA 3Q7EA 4K0RA 4KZKA 4WK2B 3OEHA 3DULA 2ADOA 2B25A 2H1VA 1EU1A 3DHVA 3I3OA 4UD6A 3T94A 3ZE7A 2OOSA 5IVPA 3C3AA 3QVOA 3OMXA 1ZZEA 3AUFA 4FT2A 3ADBA 1Y9ZA 1K5HA 4TOIA 2OCPA 3KU1A 4D8XA 3OM1A 3D6VA 4WZ6A 3UNXA 4TZKA 1X15A 2XTAA 3CF4A 1SCUA 3K0BA 4E88A 2O2ZA 3CUUA 1TUBB 4B7CA 4HTFA 3O3NB 2FLWA 2WYIA 2AW5A 3EXIA 4R9SA 4JK3A 1GWNA 3C14C 1Z5ZA 2AE2A 1N2GA 4HS4A 1CUFA 1Y4DE 4JUBA 4TKMA 4MUFA 2G09A 4W7HA 3ROQA 3U16A 1NYLA 1P74A 1JDBC 3EEIA 3JQ7B 4RPIA 3QPCA 2BHRA 3JVVA 1FMLA 3IUPA 4N12A 1C0LA 4P0TA 2IHTA 3V80A 2XHEA 1B6GA 1JG2A 2DTEA 4QJIA 5KJEA 3D8HA 4BQEA 4FDAA 1G5RA 2FWIA 4RJLA 2QD5A 4ETIA 4FX5A 4TLMB 2PWBA 1OF1A 4GM4A 2AFHB 2D74A 2ZVQX 1GY8A 4WKPA 5K4GA 2PEYA 2VTBB 3LUCA 1DKNA 2Q9AA 5DM2A 1PQ4A 3DZCA 2VDPB 1P72A 3RNLA 1I9CA 3OSZA 4NJMA 1U98A 4HB0A 4NDAA 4W1QA 2HSGA 3F71A 5TGTA 3CZ9A 4ESVA 1A50B 4ZREA 4XGQA 2LXNA 5DNEA 3G7NA 3WGTA 1KMIY 1RADA 3MMSA 2HTEA 2ZWMA 1ZD8A 2X58A 1QK5A 2Q2WA 1TF5A 5IDWA 4MS1B 2NZJA 1MORA 3QXXA 2DP4E 4XWKA 2Z2JA 4J2TA 3X0DA 1PJRA 4CT5A 5BV8A 2WOJA 2G63A 2J7PD 1E9DA 3SC6A 2OT3B 3FMIA 4QUAA 3VKGA 5C8YB 4G23A 4KFSA 5HR5A 2EJVA 2PX5A 2C84A 4FONA 3DKKA 5FNZA 1VHTA 3S44A 2C9BA 3U13A 3SF8A 4IIHA 4JXJA 4KQCA 5H16A 2DR2A 4YJFA 1UK8A 3G9XA 3PDWA 5F2EA 4DXDA 2OZVA 1EB9A 3I45A 2HGSA 3BTOA 3PD1A 4BNJA 3C3EA 4NECA 4OJMX 2B61A 2NPOA 3WAGA 2O8DB 3GEHA 1K5PA 1R0WA 3FAZA 3MXOA 1V8FA 4OAPA 3PJEA 3CZ4A 3OPYI 4DQUA 2Z4SA 4OBXA 1P62B 4KQMA 1QGOA 3JARA 5JISA 3IO3A 2NSJA 2VHEA 4IF4A 4JC0A 4NCAA 2JFYA 2M6SA 4OHBA 3TW0A 1QHNA 2HK7A 4LYFA 4BZXA 4Y2TA 4FINA 3S7ZA 4ZO7A 4LG1A 3OOHA 5LQDA 5M29A 3DOUA 3V7FA 3K4HA 4JS0A 3ER8A 3RC2A 3WRXC 5JCOC 4Q4LA 3RK0A 5B4TA 1XQ6A 4B3MB 4G0OA 4M0EA 5HGJA 1T2CA 2HRBA 3DR3A 3LDHA 2KM1A 4JR2A 4LZLA 1LRKA 1KC1A 4IIGA 1E9SA 2ETXA 5FUQA 2NVWA 4HQKA 2C1ZA 2IHUA 4ZDWA 4PO9A 1L4MA 4RKEA 5FFNA 2D54A 5IVHA 3G9TA 4BEWA 2YN4A 4RK6A 3S2YA 1LH0A 1T36B 3X3HA 2I2DA 5KX5B 4F9TA 1EX6A 4CG0A 4LOAA 3W2EA 4PPGA 4F3NA 3GRYA 5DM70 1R4NB 1GQ2A 4RNCA 1PTKA 2O59A 4V39A 3VNUA 2EP7A 1ICIA 2CW5A 2WM8A 3KT0A 5F7JA 2R1VB 1MLDA 4MWDA 1YHYA 3KVNA 3NHPA 1IN7A 1VIDA 4P6VF 4FNGA 4QRDA 3VR6H 3M5PA 1MVLA 1QONA 2JG3A 1E9EA 4MLPA 4WVLA 3M6IA 4B6JA 2P3OA 1P9RA 4B3RB 4I08A 5G40A 2R6JA 2PSJA 2PT5A 3ZK7A 4P82A 3RTGA 3HDVA 2QU8A 3Q10A 2Q2VA 4EUSA 5J58A 3NM4A 4B84A 4IEFB 2Z30A 4BP3A 1R0LA 1GZ7A 4A16A 1WF6A 4HMQA 4IOLA 5A5FA 2Q5EA 2VZ8A 3L49A 521PA 2D2EA 4D25A 5A4IS 1QB7A 3QM1A 4QFMA 4P5PA 5KPDA 4G24A 5DX8A 2VC2B 1IBKB 3PUYA 1KDPA 4Q4DA 3U0BA 3RHFA 4HQRA 5L8VA 5IVKA 1XMOB 4Q1FA 1ZPDA 4TKUB 3B60A 5DTJA 5GP1A 4IG9A 1G55A 2Z8YA 1TX4B 1YRQA 4DG9A 2OECA 3BXHA 1NHWA 2C3MA 2II6A 3G2QA 3A06A 4Q1EA 4D9NA 4YT4A 5TQ0A 2BCJQ 3WP0A 4C7MA 1TJYA 2FJUA 1HY3A 4E0BA 3EZYA 1N2CB 2C77A 2W2TA 4EUEA 3QYPA 4DT1B 4ISBA 3GLRA 4JB3A 4YPOA 1E5DA 3R2JA 3MTAA 5IDYA 4DFDA 4F96A 1JGTA 4KDFA 5LOVB 4PR0A 4LX0A 2P9EA 2FGKA 5HFAA 2JFFA 2IKQA 3QE3A 2Z5VA 4O4HF 3CVXA 3S5UA 1D03A 1V11A 2GN4A 2QD3A 5D00A 4UBJA 4URHA 3N2KB 3ZE6A 3Q9NA 2B2NA 1UXJA 3QFHA 4PICA 1NDUA 1FEZA 4Q3BA 4ZCSA 5KBYA 5DGXA 3V7YA 4S12A 3DNPA 2GNOA 1U4NA 2MSKA 3FYUA 4JB8A 2ZUSA 4PG7A 4NZPA 3HCPA 4WK6A 2RAUA 5E3HA 1SQ6A 4P98A 4E5MA 1NXSA 2UVPB 2D1YA 1PR0A 1N2SA 3QNWA 1RHJA 5FUWA 3RTAA 3WB9A 3L8MA 1GZDA 2I4RA 3U62A 4EBBA 3LX5A 3U61B 4FFMA 4NCBA 1Z6YA 4EHIA 4P4SB 1Y1SA 3H8SA 2PUBA 4BVAA 3DO6A 1IN6A 1H0HA 1A4RA 4DC0A 1S7GA 1E0JA 2VLBA 4X1IB 4OXKA 5KS2A 1U0RA 4W9RA 4ZAXA 1RQPA 2ECQA 1XDBA 4G4JA 4HNAA 1NPDA 3BJZA 1L7PA 3E81A 3TZQA 3HABA 4FFPA 4YDHB 3ZX5A 2ZSHA 2C4KA 1U4SA 4M1OA 1AKEA 2O8EB 2RIPA 3NNSA 2IYOA 3PXAA 1N4AA 2JKZA 3FMOB 1HNZB 4FE7A 3X43A 1U1GA 4NH0A 1NJGA 2C95A 5DGHA 1IHDA 3FW1A 1J8FA 3HBAA 3U4DA 3WYBA 4EMTA 5AJZA 1EHCA 3ENVA 4ZALA 2Q2OA 2IPXA 4N5NA 2PJUA 3TMAA 1VBMA 1UEXC 4GOLD 5FWXB 2IHVA 3OLXA 3OQJA 3QIAA 1YK1A 1Q11A 3FRIA 3FNBA 4FGKA 4KE7A 2PSSA 4NE2A 4YP6A 4WN3A 4IZOA 4XLLA 2BRUA 1PVDA 1Z88A 2L42A 3I1JA 3WLTA 5ERGB 2EKQA 1P2BA 2FMUA 1ZUHA 3DEZA 2GYYA 4YAIA 5D01A 1C7FA 3ZWWA 2BMFA 1B41A 2UUOA 2QYTA 5JVDF 4KAAA 4X90A 5GM1A 4NVRA 3O8QB 5FL3A 1QHYA 5A1JA 3P27A 4NMWA 3IVGA 2ZS7A 4JJ8A 3MRVA 1RC8A 1YBHA 3EQ9A 5IM4A 4IIYA 2E4YA 4L7VA 3SI7A 2ZYHA 3QE2A 4KE8A 2FPGA 2OAQ1 1X87A 5JH7A 2OP0A 4PZ0A 3WGYA 5LQNA 3ZQ4A 4PLFA 2D00A 1JEQA 3AXTA 3I05A 3KSMA 2CXHA 1LI5A 1YJBA 2D5CA 4KFCA 4ZJYA 3FHJA 1Y7HA 1FOEB 5A5EA 2AR0A 1HE8B 2E5WA 2VF4X 2X8BA 5I9SA 2YHIA 4RS4A 5J2TF 4QNNA 2GK4A 3I1FA 4ZP1A 1DQYA 1QS0A 5FB3A 4W8HA 13PKA 4FIDA 5BT9A 2EFJA 2DTXA 4IS2A 5PNTA 3WYFA 1VL6A 4E6PA 2BCGY 4QPCA 3ECAA 2NTEA 3EGXA 1TMGE 2J3EA 5KQSA 4CMBA 3W77A 4RTNA 5BORA 2GPYA 3ICQB 1TVKB 4YT5A 1ULUA 3PGLA 2IOFK 1LDGA 3UF0A 3AB3A 2NXJA 5H3CA 2Y1DA 3HMKA 3N7UA 4REQB 4YO7A 5CRIA 4JVNA 4UM9B 2Z5LA 3E8MA 3VXKA 2OTCA 4DJTA 5KB3A 1GPH1 2EARA 1MB9A 3CY6A 4XRGA 4FD3A 1ORRA 4MJXA 2OV4A 1E32A 2IXTA 4A2QA 2JCVA 5A0VA 2TMDA 3NOQA 3GFTA 4MSUA 1L5GB 3S29A 4RIIA 3H9GA 2VYVD 3I0ZA 3QITA 3LE8A 4IUCS 2GJ8A 1QIIA 2F4VB 1GRQA 3KT8A 1YVDA 4MIKA 2A7XA 2J9XB 3L4BC 2GHTA 2YJNA 1NN5A 3B51X 3GJ4A 3II6X 2CKDA 3WX0A 4E51A 2E3JA 4G5HA 3CURA 5AM2A 3WIBA 3JYQA 3D0QA 1CFJA 1Z2PX 4OJKA 4FMDF 5L3QA 3NVDA 2YJ6A 1C50A 2VDNB 4NRDA 5EZ6B 1EWYA 3D6UA 2XVYA 4S24A 4QU8A 1G9TA 4HH0A 5JG7A 1BE0A 1OFUX 1WP9A 4ZCQA 1AMUA 3SY8A 3M9XA 1D9XA 4QBHA 4QBGB 1C4XA 2O4CA 2Q46A 5I7HA 1SVUA 5ENDA 3C4JA 1JR4A 3DMPA 2ZJ2A 1E6UA 1SR8A 4RENA 5B1YA 2J3DA 5E3JA 4B45A 4TMZA 2XNCA 3PQEA 3PQDA 3PT5A 4JYBA 5KWJA 1Z4KA 3CVJA 4J0HA 2PN1A 4IJUA 2I7VA 2J6CA 3IBYA 3JPWA 1ZUNA 2JH8A 3EULA 4K03A 2X8WA 1KO7A 3JYNA 4MIYA 1V5WA 1E5VA 3K30A 4IRMA 4KO2S 1TRHA 3KDAA 2AKYA 3L79A 2CNWD 4LOHA 4QQ8A 4YALA 4BWYA 3RK4A 5JY1A 4BVGA 3D1VA 3K53A 1NXWA 3R3VA 2B5OA 1EAYA 4BO1A 2UZ1B 4UM8B 5KIAA 3U09A 3NZEA 1NMQA 2J0VA 2H06A 2ZI4A 4XWYA 3P0IA 3MLAA 1FMTA 5FFMA 2ZAMA 1RM0A 5LB2A 4DQLA 2AG1A 2QE6A 5HUQA 4YLEA 2I1QA 3UAWA 3QEMA 1VCOA 4FHGA 4KHPB 1DFIA 1Z26A 4CLRA 1R0YA 1YONA 4NZZA 4LDAA 3X1KA 1CJVC 1AUPA 2I6SA 5AK3A 5FWYB 3VZBA 3K7EA 1C7RA 3SYKA 4KQEA 4PYKA 1UK6A 1P0CA 2NU9B 1VB5A 5DLPA 5TXGA 3HC7A 1QHHA 5IZCC 1BS2A 1E20A 2C5SA 3RQIA 3HB1A 5YASA 5A3VA 4CIVA 1KVQA 3BL8A 4ZJPA 5K0ZA 2XWBF 2PEZA 2PS1A 4ZYLA 1FTNA 2ZUTA 3JASA 4IIEA 1O94C 1U04A 1WU8A 5CVDA 5FI5A 3JAMA 1XF1A 4Z53A 2FQWA 2WBLC 3ONEA 4MR7A 3JD4A 2FDRA 1WCV1 3HWSA 1JH9A 4PU0A 4QDJA 4K1XA 5HM6A 2NUTB 3SR4A 2EWMA 2ZPAA 3IEIA 1FIUA 4GMHA 1E1YA 1ZJWA 1DAPA 2BIFA 2CXSA 2XDYA 2YMMA 4GXRA 4CM6A 4M8NE 2Z1MA 3FRHA 1RNLA 3TD6A 4OVKA 3AL0C 3D4BA 4PN7A 2XMPA 1NTRA 1TU3A 1QPGA 5T3UA 1BW9A 2IK8A 5CDSA 2HPZA 1Q0ZA 5IUKC 3TKLA 1MOSA 3TUJC 2VWGA 1KI8A 2QDXA 3B78A 2WWVD 4EI8A 1EKXA 3BYZA 1EQAA 2PA3A 1V5FA 2CXXA 4G5OA 1UWVA 3KJQA 5DRTA 1FDRA 3JQRA 3KT6A 2J5QA 2ORED 1NWHA 2ERXA 3BQNB 1DLIA 3VHLB 1BMFD 1Z47A 2CV2A 3MIZA 3DOOA 1VE7A 2G82A 2O6LA 1HQCA 3DBRA 1YS7A 4N3CA 3AIMA 3W34A 3RW9A 4J0FA 4EG8A 4JROA 3IBFA 3W5DA 4K87A 4OK5A 4OTZA 3WJ2A 3OZGA 3BGWA 3JVEA 4H3KB 3TJRA 4JUAA 2IH4A 3NTQA 3X2SA 5ISMA 2OG1A 2VZLA 1QVZA 1UMDB 2X2EA 3FLAA 2JIPA 1WBDA 1Y6GA 4MUMA 1NPYA 2I6QA 4NBVA 4AJHA 4QJ3A 5A9RA 2NW6A 4WQMA 4M7RA 1BCRB 2AQ8A 2RGUA 2K5UA 1L3BA 3G8CA 4L16A 2VYND 3MTIA 4HN4B 4LSGA 3R7DA 4JEIA 4ARAA 1R0RE 4MUIA 4O4HA 1LNZA 5EFZA 1QUFA 5FULA 2DHEA 2RMKA 2AVNA 3C87A 2VI5A 3VKWA 3ZCXA 3ZWXA 6NULA 2BH9A 2M6LA 3TECE 1XTJA 2VH5R 3HXQA 4QEDA 2PZMA 2CVOA 4G3XA 5ENZA 4FBGA 2QN8A 4QT4A 4YRIA 4HAOA 3F7MA 2AEJA 3C5VA 1IJFA 2HBYA 2JJ2A 1G66A 2XA2A 3VJRA 1Z5UA 4IQ8A 4IVNA 4X1KB 5ITSA 4UDNA 3HWX1 2RAFA 4ZOAA 4LDQA 1KH3A 1V1JA 1EG7A 2JGIA 1EGAA 4GECA 5A6SA 1T9GR 2QRNA 4Q18A 4ZJZA 1OC4A 3D4PA 4PYOA 4D9KA 5EE1A 3VDXA 2VF7A 1SG9A 4ZI2A 2DWPA 5EIBC 3V1TC 2QPLA 3COVA 5T64A 2I34A 3PE3A 4J29A 4BNDB 3M3PA 4BHTA 1JI3A 3DMYA 4XLTA 2HADA 2X1HA 3EXEA 2X0EA 3FHCB 3WV4A 3IS3A 1MQSA 2H1RA 5TEVA 1VBFA 2Q2NA 5DYNA 3TSOA 4I1VA 2O3SA 2H2DA 1DC6A 3V8MA 2ZM5A 2UYGA 4MWBA 5BV7A 4JVSB 1CUYA 1HG0A 1CUWA 1ZSYA 1TUEA 3S8EA 3FSRA 3FWPA 1RQ2A 1TM2A 4M88A 1LLUA 4Y9DA 3W78A 2E0IA 2R86A 3CINA 3R74A 3V33A 5KX5A 1VYTA 5I8PA 4FZRA 3JQAB 5LP6C 3RREA 1WZIA 4XVHA 4Q15A 1QCZA 4X85A 2B5VA 3MAGA 5CT9A 3K0SA 5FUYA 2O05A 5ALRA 3E53A 1PR5A 4UM9D 4ZRNA 4LPSA 2BGRA 2ZKIA 3DR5A 4ZT7A 1N6IA 5EJAA 1DKPA 4FFRA 4OL9A 4CMHA 1ZUIA 2HC9A 1PJLA 4G5YA 4NICA 1RCUA 1LSJA 3CKYA 2HNBA 3U9LA 1P8JA 1J5PA 5BN3A 1IXZA 2A0XA 4Z8XA 4HEJA 1F7UA 3N2GB 3D3NA 1U5CA 1JJAA 1QF9A 3A6FA 3FE2A 3H5NA 5AIAA 5JYCA 4D3SA 1LC0A 4MQ6A 1CCWA 4KACA 3ILXA 2HBRA 2K87A 4AW9A 4KREA 3B1WA 3CF2A 3E5RA 5K3SA 1Q1ZA 3QBVA 3AHHA 4PZPA 1QTRA 5B1IA 5J2UF 1L3CA 1VKNA 2UZ4A 5DJ5A 4AJ9A 1QE3A 5HCIA 4Z7NB 3G0CA 4PPQA 2X76A 1EGVB 3QI7A 2B83A 4JOCA 1Y3DE 4K05A 3REQA 4FD2A 1ST3A 3V1NA 4YJ2F 1ZJJA 4R0MA 5GZ6A 5ICGA 1VL8A 4QGBA 4LDPA 5LBTA 4YONB 3ONVA 5JJCA 4OI2A 5TT1A 1T35A 1KP2A 2HWYA 3FHLA 3LUAA 3E18A 2AOWA 2ET6A 1Z83A 3NPAA 1NIJA 3IA7A 1X80A 4PTZA 1D8AA 4RELA 2KS6A 2RGEA 3CB4A 3GV0A 5CT4A 3TL3A 2DUUA 1PZHA 1C7IA 4MVJG 1URPA 1BYIA 1XLTC 1EAMA 1E1CA 2Q3HA 2GBPA 3KC2A 5DBOA 2ZJZA 1V7QA 2B4QA 2PXCA 3HKCA 4AX4A 1MJNA 1NQWA 2XQVA 2YZGA 1FFDA 2XT6A 4DSTA 2B35A 5CEJA 1S2OA 2ZLBA 2DUMA 5G0VA 4DDKA 4IHAA 3SVTA 3IDSA 4MX8A 3R1IA 2WWRA 1WMAA 3GIWA 3QF4B 4HEHA 1GG2A 5LQCA 2QLTA 4AJ4A 4YYZA 3DVRX 2G9UA 3R0IA 3BH0A 1T4DA 3C45A 1FVOA 2XDQA 5CM9C 1WNFA 2CHVA 4U6QA 3UHJA 4J2HA 1Z63A 1TQ6A 1OSNA 1YJ5A 1ZLYA 1EWKA 1X39A 4U7DA 3U7RA 4IQGA 4FR0A 2F55A 4EYSA 5FPSA 3L40A 3DHWC 3NOXA 5B2ZA 4OQEA 4K6OA 3TW6A 2PV7A 4P4UA 1TT5A 1PJ8A 4FDLA 4AU1A 4G1BA 4FKMA 4QECA 2A0KA 2VQEB 2Q1YA 3QWHA 4BFVA 3DKIA 3DVSX 4Y7CA 2HY7A 4ACAA 4MVJA 4II7A 4C4AA 1F5NA 5AVXA 1IOVA 1XV5A 4Q5IA 5C8XA 3NGLA 2EQAA 5KREA 3CTMA 2BFEA 5B6JA 2BR5A 3IUQA 1HMYA 3WOHA 1J1UA 1QMPA 4UCFA 2VBCA 1HDYA 3KQKA 1T36A 3IV9A 1KR2A 3WZLA 4MUAA 3U2QA 4LXTA 2V7EA 4CL0A 5BYAA 1Z3IX 4AB1A 1WXEA 1FXWF 1XNJA 3W5AA 4J4BA 1N6LA 3ICCA 2P40A 1NKVA 5FQOA 2W71A 5B30A 2CZGA 3NTRA 4FU0A 2QEQA 2I4OA 4AYWA 4QIHA 1JDSA 3AOEA 1P4GA 5HQ3B 3B5EA 2PMBA 4M3NA 4MV9A 2ZRBA 4JSTA 4LHYA 5G3YA 3SJAA 4NMHA 4ZAFA 2CXRA 3GT4A 2Z2XA 4JA2A 4OB8A 3OTIA 2FRVA 3M49A 2OD7A 5F1OA 2Q3EA 2OESA 3IAXA 4LF6B 4JJGA 5CJPA 3A6KA 3M5CA 3ORYA 3Q3IA 3A6EA 3JQ7A 3RE1A 3GARA 3KKEA 4EM6A 1ND5A 2GNPA 5EHIA 3T5CA 4RGQA 1SXJA 2Z56A 4AK9A 5HKOA 1WEHA 3H5LA 3R76A 4BGEA 1MUUA 1IG0A 1AGNA 2W4IA 5TQJA 3IQXA 3OZVA 4UD2A 2Q5CA 5ALNA 3MCWA 4DF3A 5KHAA 1QYXA 3TBKA 4N7RA 5KTSA 1YB4A 5LYJA 1P3DA 1F0YA 4RYDA 4DLTA 1EVEA 2PD6A 5A04A 1EZZA 1IE3A 2WDZA 2PMKA 2YYYA 3BSFA 2G5GX 3M1AA 2D59A 1U8TA 2PGIA 3MINA 4L0CA 3I73A 1XE3A 4QUHA 2E9SA 3AO0B 4W1RA 3NCTA 3CLRC 5AOVA 3EEOA 3AXSA 2NAFA 2HMAA 2JI6A 4HTAA 3RC1A 1Z8HA 1CZNA 1KMHB 1GTJ1 3DP9A 3GUUA 4NZNA 3PENA 2Q9BA 4L74A 1RW4A 2YWJA 3S2SA 3U81A 4GKVA 1IB6A 4U6SA 1GN9A 3PL1A 1TC2A 4L2IA 1EK2A 1KTVA 1ZITA 5DNVA 3VAZA 4P4NA 3AHFA 4YMLA 1ZD4A 1R64A 3SF8B 4AVYA 2QRVB 1XTVA 1O95A 4XM0A 1UUFA 1AKMA 2PD3A 3PQ2A 2I6UA 3KJNA 1VTKA 5AFSA 4RA6A 2JLWA 4H7PA 5FNVB 1E2FA 3C41J 4EVQA 4UZEA 3OFND 1DBQA 2I4MA 2ZIFA 4G63A 3DE5X 5IKOA 4QG3A 3G17A 4XM1A 2FWPA 3HB5X 1G4HA 2VJDA 4PONA 5COBA 4LF7B 2WJPA 2DLCX 3VC7A 1WA5A 2COEA 2CB9A 1BRTA 1PT9A 1NM5A 1TMYA 1ZESA 2MINA 2ZJ1A 3DBHB 4AZSA 2BP7B 3W4KA 2VJLA 2GA9A 4C2BA 1MHTA 4X8MA 1C9JA 5CVTA 4BIMA 2EWWA 2WWGA 1ILEA 3CX3A 4XVUA 1O95D 5EJ7A 1W36D 2VQ3A 3TIVA 3E9RA 3FPFA 1OXUA 2VTBA 3O2SB 3T1NA 3HVKA 4BVFA 3R41A 2RBKA 3DXYA 3W8FA 1ZH0A 3QA3E 3MWGA 2XV1A 1WSAA 1TM5E 4XSGA 5EXXA 1F0NA 2WF5A 3QW4B 3T8YA 4KQ9A 1VIVA 3E84A 4RZXA 4DYDA 1AB5A 4UU7A 2FR8C 3EGDB 2WTBA 3TRFA 3ZY2A 5J4HA 2LUOA 4W9NA 1GPAA 3KEQA 5FQNA 1XJCA 5KTPA 2NM0A 1ESCA 2QRVA 2EF0A 2BOVA 1N7HA 1RXUA 2Y1CA 3CH7A 3TQCA 1VMIA 1XD2A 3IOEA 3ISJA 2HU8A 4RHFA 4HB2A 4EG5A 5L3SB 2YXEA 1TFUA 3CMMA 2YN2A 3LG2A 3WYNA 2Z8ZA 5AKEA 1XXLA 3GFBA 4HQFA 1YL6A 3MGKA 2MMCA 1SXJD 3UKJA 2PKEA 4TUYB 1DG9A 3IBSA 1SUPA 2XMGA 3VO2A 3R4VA 4UUPA 5AW0A 1A04A 3A9CA 3WLPA 3NKVA 4YCAA 1YAHA 4QYWA 3WL5A 4CMGA 5FBVB 1AUVA 2V9ZA 1XP8A 1VHLA 3H11A 1O4WA 3I8OA 3KIPA 2WTEA 1UC4B 4MQFB 1OGYA 1H0SA 1OOEA 1UOQA 3L0DA 4XCQA 3UICA 2VTEA 2X9NA 3LCVB 2A6PA 4A8HA 1LW7A 1VP3A 3OJLA 4IMIB 1S3SA 2OLJA 1Y1PA 1FUIA 4Z0NA 5KJFA 3LY7A 2VDQB 5KWIA 2IOFA 2M2IA 3K2BA 3ZBPA 4PSUA 3K9HA 1Z2EA 1TW2A 3EG9A 1LX7A 3M6UA 2ZZKA 4ZXPA 1A72A 2FDXA 4L5CA 3V8VA 1IBMB 4MR8B 4KHZA 5C37A 1BRMA 1CR2A 4ZVKA 5A4JA 2VK1A 3VTFA 3WKAA 2GAJA 3EXEB 4QUBA 2I29A 4YJGA 3G59A 1N5KA 2AZTA 3IAEA 1BC5A 1UXOA 2Y1FA 2BMEA 3PRKE 1H2WA 5EXPA 3RIGA 2BZ1A 3H7IA 2AMJA 4YHHB 3QLTA 2FN3A 2QRKA 2DWCA 2PH5A 5E4YA 1M2WA 3GMDA 1QGUA 3CLUC 2NU7A 1ZONA 1M34B 3WLOA 2VDWB 4J16C 4GL4A 3NW9A 2W90A 3K6SA 4XOUA 5FFFA 4EJ6A 4QWMA 1JU3A 3MPOA 3SX0A 1A2QA 1UT8A 4CEJA 4DR4B 1YIOA 2LRHA 4B6PA 1OWOA 2FUNB 2NVOA 3GT3A 2XGJA 4D57A 4H6PA 4WNCA 1RI5A 1CKEA 1W44A 1UZUA 2WU0A 3C8ZA 1Y1LA 2DULA 5H3HA 4EEZA 3TLMA 3GWGA 4R1PA 3F4KA 5KVQA 2FVXA 1PD1A 2OP1A 1JFVA 3BTVA 4X5OA 5E8JA 1KARA 3C8MA 3PC2A 1QR2A 1V5GA 2R1UA 4MV7A 3SQDA 4DCOA 3D31A 1IZ9A 5DYGA 1EDOA 2PX4A 2GZ2A 2B5WA 3H2HA 2XUAA 3PDCA 1KOLA 1R6TA 4KO3S 2YHIB 3DOFA 3EDMA 4NFSA 3U40A 3W6PA 3U5ZB 1EJ6A 4F4HA 3EG9B 1IOLA 5HQTA 1YFLA 4V0SA 3HDYA 4IWXA 1QRRA 3R3YA 1AV6A 4R81A 3OI7A 1H6CA 5AW5A 2CYCA 2A4KA 4AECA 1KI6B 2OBBA 1LLQA 5BSRA 2O1WA 3I6MA 1ZD5A 4OV6B 4Z4FA 3PFHA 1WBJB 3DP7A 2PCJA 3KOYA 3SEAA 4OQYA 3HBMA 3G88A 3WO0A 5IJ9B 3J80A 1NX6A 3AUSA 1HDRA 5EZSA 3RKUA 3WHPA 4AY5A 3H5AA 4EDFA 1W59A 4LHEA 5AW1A 3K1YA 3O8CA 4DIUA 4LHVA 3GJ7A 2NX2A 4AP9A 2VQDA 3U3JA 4FOLA 5T4FA 4AN1A 4HGRA 4OYRA 1D2CA 3VJLA 3FOEC 3E5MA 2H4XA 4DR6B 1V8PA 2MSNA 5KDDA 2FLKA 4RLFA 5EJMA 4DJFC 4UVGA 3K2EA 4S1VA 3V2IA 3PWSA 4GXNA 1LBQA 2E6UX 3LC2O 1FTWA 4F8EA 2O2SA 1CIPA 3FCXA 3KYCB 5SY9A 1JE1A 4HO1X 3L7AA 1M9NA 1EI9A 1XWFA 4UUMA 4ARVA 3Q4GA 1COZA 3ICOA 1RHQA 3ZY5A 4P7GA 1Z35A 1N5DA 2VF5X 4TL6A 1JBEA 4KZPA 3ZJYA 3E5NA 3FYTA 5ITWA 1CNMA 4H7HA 2FFRA 3HCRA 4IOKA 3UMYA 3KE8A 3CJTA 3A4LA 2NN3C 3BK2A 1SU6A 4IHJB 2V6IA 1AM4D 4KUHA 1H2ZA 1RDFA 5G1NA 4C3OB 3UK0A 2IZ6A 2BFFA 4MQEA 4Y2VA 3OZRA 4A0SA 1AKVA 3ZUGA 1G42A 3BM5A 4DSUA 2YIMA 3EQ7A 4UPEA 4K86A 3VO9A 3QJYA 5E4JA 3DA8A 2DXIA 5I7WA 4QU0A 1B6RA 4JCOA 3HL0A 4YCCA 4ZICA 2HLPA 3AFOA 4I2VA 1SOUA 5CT6A 2G71A 1CIVA 1IHYA 1ISFA 1ZMBA 1C3OA 2O2DA 3C3XA 3NFYA 1S8FA 3QYFA 4M54A 1L5ZA 4LTMA 2BTQA 1YIDA 1H9CA 1DOHA 1GQQA 4GWLA 1U8ZA 1WCXA 3TK1A 1RE0A 1Z2AA 2GKGA 3ZCQA 4WFQA 1MF7A 2P6MA 1M0TA 2UZ1A 1RPZA 4YECA 3REFA 1UDCA 4XDHA 2ZI3A 1SOMA 3QLVA 4YFVA 5LZ5A 1ILWA 5JWHA 3UZUA 2I4LA 1SO8A 1Q0SA 2EWVA 1Z5VA 2XUDA 3PICA 1VFPA 4F2PA 2DYKA 1FJGB 3C3YA 5IJAA 4TM7A 5CPBA 4Q3DA 4O4IB 3WGUA 4O0LA 5KTKA 4KQXA 3CR7A 1Z4MA 1KJZA 2WD8A 1NE7A 2W93A 1LJUA 1P0IA 1EFPB 3D7KA 3KT3A 3NRBA 1OLXA 2W6JA 3H8VA 1GAJA 3IR6A 5AXCA 4TZTA 2MYNA 3PYMA 2RGDA 3V4OA 3SJBA 1NVMB 1KFCB 1GR1A 1WY5A 2PBFA 2J1LA 3FYDA 1ZKDA 3FHOA 5DLYA 1QNFA 5JFOA 3NHUA 9LDTA 3PXGA 4ZOQI 4YHBA 2FZCA 1WDLA 2CLHB 4WZBA 3BWBA 2D1TA 5I9IA 1LGYA 1ZAYA 4FEGA 1YDEA 1P9LA 1OQAA 4GDMA 4BUZA 1KYXA 1SC3A 2IYVA 2HUPA 3RTDA 1IY2A 1LCIA 2NPIA 4UNRA 3IPCA 4N49A 5F2KA 3H99A 4Q4HB 3DQZA 3H1TA 3TVTA 3VNRA 3E7PA 3ZZNA 4HQOA 1GXSA 1HR0B 2H8GA 4OJYA 1EUZA 2JB9A 2VOEA 4AP5A 2HK9A 1UWCA 1GFZA 2O0LA 5JOQA 3OZFA 1RYDA 2ZDHA 3ANSA 5BOVA 3ZVRA 1FDUA 4Y0AA 3PC3A 2A3RA 4N8EA 2VHWA 1B3RA 3B7WA 1M0SA 1VSQA 2XOEA 3F9CA 2BFBB 4BAZA 5AUOB 3JAKA 1ZM4A 1I80A 4QYIA 1KDTA 2ZRPA 4BV2A 2OHOA 4A73A 3IMEA 3SQMA 3RSSA 2JFVA 2XQJA 1CUHA 1CW2B 5TARA 5K03A 1A8IA 2IPAB 3U4CA 1E1RD 1FS5A 4RSMA 1E3DA 5JDCA 5JS6A 3HB0A 3ZLUA 3HTXA 4YAWA 2W2OA 2AFIB 3GXOA 3QP9A 3P2IA 1I6MA 1Z0AA 1T5IA 3KR1A 2REOA 2B3TA 2RSLA 1R66A 2QRHA 2FCRA 1YVEI 3HU1A 4KR3A 5JEDA 5K05A 1YTUA 3TLBA 4KSYA 1DKRA 3Q8MA 2H3HA 2BFDB 4UU8A 2YASA 1M2JA 1RMQA 5HKKA 4DUPA 3GPLA 3WL3A 2FZWA 1M1YE 1XLVA 4F1JA 1KMNA 4UUOA 1EUCB 4JL8A 1MO2A 3Q5GA 5KYVA 5T4HA 2GZAA 4FW9A 4UAVA 4YRGA 3HJCA 4US2R 4K9QA 3MILA 3S0JA 4CKEB 2IOQA 3TTSA 4WINA 4FN5A 5C32A 5ALHA 4MPJA 4MWTA 1JTFA 1CVLA 1JILA 1WCIB 3T3DA 4GP6A 4RCYA 1N5IA 4OAQA 4BJ6A 2G1UA 3A9RA 2ZVDA 3V8RA 3UA4A 3OM9A 4BX2A 3I2KA 1TQ4A 2GHRA 3ET5A 1GVHA 1ZYUA 1JS1X 3RAJA 4EBFA 3WB1A 5JZMA 5K6RA 5B1HA 3A0RB 4CT0A 2PS9A 1U3GA 4B8ZA 1C0KA 3FZGA 4H1TA 3TOXA 4M7PA 1EGHA 5G1OA 4GI3A 1JF8A 1RQLA 3VHXA 5CNJA 1LVGA 2FJPA 4MP8A 4M0FA 1IPFA 3N2LA 2NQTA 4G1VA 5TJ9A 2OO5A 2IFTA 3L9WA 4L5AA 4M8LA 3HVUA 4K9MA 3RUAA 2FVYA 3RHZA 1Z0UA 2VDKB 1Y4ZA 5E4TA 3QXGA 4FUQA 2A78A 3IUYA 2DFPA 4CM9A 5L53A 1T1GA 2DUNA 2XZTA 3C1TA 1C0IA 4WSOA 3S2UA 3NDJA 5DV9A 3VR0A 3D6JA 2GLXA 3NHZA 2AC2A 2FMTA 4V2IA 1XCPA 3EN0A 2VP3A 1U9IA 4D9GA 1YI1A 4B5KA 3Q6MA 3FFXA 5ARDA 4RKFA 7MHTA 2JRLA 5JW6A 1N0VC 5M34A 2XADA 3VV3A 2CF5A 3ZBQA 4DV2B 1K6XA 3FCCA 3KP1A 4EKDA 2OXEA 3ZD7A 3TZBA 1JDBB 3ZIAD 1ADJA 1QQAA 1G1MA 3VR4H 1WV0A 2X0RA 1U81A 3BE6A 3W4IA 4AWXA 4HAWA 3AF4A 2HRRA 1D4FA 1ZGBA 1SAYA 4OQQA 2GO7A 4HLNA 4EB0A 3L0YA 4G5RA 5E9QA 3C8UA 4EPWA 2D2IA 3ILSA 3PK0A 4I55B 1UJBA 3FZYA 4L3VA 1LQTA 1T4CA 9GPBA 3SE0A 3Q9LA 3TW8B 3N8KA 3WMWA 1R9MA 3S2FA 2IXGA 2PGXA 2VP9A 3I5XA 2DU8A 2MYTA 3AKEA 3W8EA 3A4VA 2AXQA 3N0XA 3OZIA 3N2GA 3PVCA 4OXRA 3WKBA 3ASZA 1WG8A 3CZMA 3OOEA 2WIDA 3VR6A 5A0FA 1EFAA 3PDIA 4LY0A 1GPLA 1QDUA 3E7WA 4KGVA 1CUXA 1OJLA 2HMVA 1FFAA 4JJKA 4EZIA 1OIWA 2GZDA 1J8MF 1RAAA 3QWBA 3UJ3X 5DBEX 1TZMA 1GPBA 1N5RA 3D0OA 3HL4A 1A8QA 3IC5A 3M4ZA 4NARA 2BGUA 5HIIA 4A1OA 4BCBA 4DW8A 1HKUA 3IE1A 1EK6A 2XKBA 5B3KA 5DNWA 2Q5QA 3VOAA 4C4SA 3MWEB 2WJ6A 5F3RA 1PUJA 2OGZA 4RVGA 4G0WA 2B37A 2ZSAA 1O9HA 2P2NA 3FUUA 2IVFA 3LLUA 5TNXA 4M76B 3H05A 5U9CA 1OLOA 2FPWA 2H92A 4B76A 4HUTA 1WABA 1KI2A 3D5EA 2KQUA 4OQ4A 3JQAA 3O47A 4I8IA 4IHKA 4HYTA 5EHQA 4CMJA 4F9EA 1O0CA 2WM3A 4JOSA 2IBTA 3BMQA 3VOSA 4MVWA 1U8FO 3NVKI 2SBTA 2WUGA 3FNIA 4DA7A 1JU4A 4IUDS 5FBRB 3U7IA 4R2JA 4TMTA 1G38A 3VR6D 1E9CA 1OJ7A 3L1JA 1A27A 2GZ3A 3U3OA 4POOA 1FS6A 4Z51A 5EIXA 3KYDB 4BRZA 2R5FA 4BU1A 1ZUNB 2H4HA 2W22A 3JSXA 3KM0A 4MV0A 3FYUB 4JQOA 4RE5A 1LI4A 1U28C 1NG1A 3SSNA 3NIGB 1DO2A 1X1TA 1J9EA 1HC7A 4FHZA 4IKOA 1E79A 4MW6A 4NU5A 1O2DA 2IIBA 5C8ZA 2CWWA 2I3DA 4X1KA 4QODA 1D1TA 4XCXA 3T3EA 4AG6A 3G7UA 1JIVA 3NHAA 1K8XB 3A8TA 3GHHA 5LUBA 4JI3B 5BSTA 1L5FA 4A0HA 3P9SA 4M1QA 2FR1A 2GYUA 2R66A 1EP3B 1D5CA 4GICA 2JAHA 5EUQB 4RTKA 1PQPA 2DFLA 2OQ2A 2YCLA 3ITEA 1Y8AA 3K72B 2B9VA 4JD5A 4KKVA 4LJ7A 5CP8A 5BWMA 3NT2A 1CR4A 3VNVA 4JVMA 4PZDA 2O9JA 4DLVA 2WB4A 3E58A 4MJLA 1IUNA 2GAFA 4BFXA 1ZW1A 4AWBA 3AUUA 2FPIA 5FR2A 5FPYA 1XHLA 3DVLA 3MS2A 5HCNA 1XU4A 5C8YF 3TQQA 2WSIA 4DM7A 4MDEA 4RD3A 3P4XA 4HUQB 2GF2A 3LMKA 5HMLA 4U9IS 2OFFA 3D6TB 3PFCA 1AY0A 4R8MA 5HJ2A 5BT8A 3AI1A 1T3SA 4MB6A 4HFJA 4KLNA 1T3ZA 4YCDA 3K31A 4C5AA 5CB4B 1Z45A 3IE0A 4C7KA 4V38A 4QZVA 1YQGA 4U39A 3DG9A 5B12A 1MO4A 4W4TA 4WZBB 3K6SB 1DFGA 4YR9A 2V5VA 1UMCA 2QE7A 4UEKA 2J9FA 4PFKA 3QKUA 2GJAA 1I2CA 1E9FA 4B87A 4DLYA 3PHBE 2ZSDA 1BW9B 1GTL1 4CHTA 1E2DA 4RS3A 5COAA 2F9LA 2IX9A 3QLUC 4L4YA 1CT9A 1G8MA 2HHLA 3F8SA 5IDVA 5DCYA 3C2QA 3M6FA 1T4BA 2JLQA 1CQXA 3Q87B 5SYAA 3DLAA 3MJFA 4EFMA 3TN7A 2DETA 4L4RA 1H5QA 5F78A 1QTNA 3MMZA 3VH2A 4X62B 4RKWA 2HIMA 2ACVA 4RZSA 1QCYA 4ZYZA 1KPIA 4GYWA 2QDKA 3JQFC 3PSHA 1MCZA 2BTQB 2BMJA 3ACDA 3R6GA 5I8ZA 3SKVA 4I4LA 1M1YA 5HXAA 3ET4A 1N5LA 1J90A 4WDQA 4BX0A 1U8AA 3NEPX 1MB0A 3RIHA 4DZTA 2OO3A 3EH2A 4L9WA 2V3CC 2XEXA 4QFCA 3RAPR 4YV1A 3BZUA 4ENQA 4GPZA 1A4UA 1HT1E 2CUTA 3OTWA 5FLKA 3P19A 1X9IA 4Y30A 2O8NA 3U26A 5A4MS 1HDGO 2JEYA 2GVDC 2GDZA 1EBUA 3ONNA 5HUHA 2QG6A 2NU9A 1J2RA 4EW1A 4QLAA 2ONKA 2EFYA 2D5LA 4JP1A 1OW3B 3F6YA 4QREA 4TXHA 7YASA 1Z12A 5EUCA 4RJKA 1HZZC 1RYMA 2B1IA 2NYRA 3QHQA 2YJZA 4EPVA 1VKHA 2UVQA 5JCXA 1Q1EA 1ECPA 1CPYA 1ZGZA 1FMJA 2CFRA 2QTGA 2UUCB 4ZOEA 2YBDA 3H5VA 2ZS8A 5E9AA 3LO5A 4BLPA 5JSHA 2ZU6A 1XB2A 1EEXB 3L0ZA 3ZHYA 2HT6A 1F4PA 5G0WA 2ZVPX 3P71T 1A3CA 1M2KA 2QUKA 2O7NA 3TXAA 1TKCA 2EF1A 1XDWA 1YS1X 1Z7YA 1FUKA 5KSZA 3D54D 4O4JF 4Q47A 4RLSA 3P2JA 4M98A 2O0HA 1G8FA 2PSFA 1NR1A 1VHWA 1XQYA 2IUSA 1KO1A 2ID4A 4J76A 3LC7O 2C9OA 3AEZA 1CY1A 1QH8A 2CFTA 1W5FA 1ZEJA 1M6YA 2Q1UA 2ZULA 4R1OA 2AG8A 4WZBE 1EYZA 2CF6A 5ESWA 4EUKA 3GLIB 1OD6A 1AK9A 1YR2A 3PD0A 1WXIA 5E4FA 1V9LA 5I5EA 2PWPA 3AIKA 5AK0A 4D4GA 1YCFA 2P5YA 1ZMOA 1E0DA 2JIRA 2JK1A 2BEVB 3MOIA 4H1VA 1ADYA 4J0GA 1JLLA 3MJ4A 3KDPA 3PC8A 2XUOA 4ZVSA 3I76A 3RVNA 3WBBA 3EC7A 4YCBA 2B4YA 4BQRA 3W5VA 4JI1B 4CN8A 4DLSA 4MRMA 3PA8A 4L6CA 4ZCMA 3ND6A 4HDNA 4HDAA 5LR6A 4TTJA 4LJKA 1SIUA 1RP1A 4KXXA 1DARA 2C3OA 3G5LA 3JD3A 1LS6A 1YHZA 2ONCA 1WIWA 4MAFA 4ZTBA 3M6AA 4MGEA 4R71A 2MDTA 3RRJA 1FP6A 4JFRA 5B5SA 5EKTA 2IYZA 2WU4A 1BD4A 4C5BA 1BIFA 2JIDA 1CU1A 2GBLC 4TWIA 3QEKA 4RIHA 1FFXA 3VX3A 4KAJA 3ZV4A 2PKXA 2I2WA 4IFBA 1W0KD 4RVSA 2A35A 2BHSA 1T5BA 1GU0A 1P7CA 2XF8A 4MYRA 4JQSA 4RBNA 4KODA 2JIOA 4HBZA 5LBIA 3RT9A 1ATZA 3ZCSA 4P7BA 4TRRA 3SC4A 1GYRA 1Y3CE 1ZU5A 2Q07A 4OGFA 1TXGA 4JKYA 4GDFA 1AZSC 4UBMA 2TECE 2I1WA 3LW7A 3TOCA 1CDEA 2P9TA 4PBSA 4Y6SA 1PHPA 4BKMA 4R1QA 2ONYA 1QHSA 2LVBA 4Y9SA 1FU7A 1QRUA 4MV4A 1ZNZA 2ZBRA 1RWMA 3E9EA 4NI5A 2JGEA 3VR5A 4LDJA 4Q7QA 1J21A 4FDTA 4DM3A 2EJCA 5AUPB 5EIEA 1ZVVA 4BL5A 2FX2A 5B4UA 1K7FB 2CCGA 1OROA 1ULSA 3ZJUA 1U5BB 1MEEA 3JVDA 5J2UA 1P1BA 3IAS1 1GUYA 4G8DA 2ODQA 5CURA 5IAAA 3QYJA 1P7YA 1MENA 3E22A 1ADBA 4EP1A 1SQ0A 1PGNA 1K92A 5C5EA 1M2VB 4NYIQ 3ESZA 1ZGJA 2HHAA 5B6IA 5HX7A 1YZLA 2YJ5A 2Q49A 1W5EA 1G5QA 4NBUA 4TMKA 3SOZA 4IR7A 4TWJA 2WTMA 1K6JA 2JHFA 2W7TA 1JHAA 2QROA 3F5FA 3KYCA 2GCPA 4EL5A 4YK7A 1GEEA 2VDOB 4ABYA 1UM8A 5E1DA 3TRJA 2DCMA 1E77A 3D2CA 4LXUA 1E2LA 1B0AA 4QXAA 2AIRA 5EIOA 2Q1TA 4JYMA 1M2FA 1YOVB 2GJ4A 5FOSA 3UOWA 3VTKA 1GA6A 3P0JA 2GD1O 5SZIA 1YSCA 3GFQA 1X92A 2HQOA 2FUG6 4EABA 2XUPA 4FFSA 5D8DA 2NOAA 4LNUB 4YCLA 1XR3A 4G9EA 1G64A 3QPUA 1T24A 5M3BA 4F2DA 2EXXA 2A9QA 3QXSA 1OYVA 5ELMA 4IGKA 3N86A 3EXG1 2VH1A 3FB4A 4J3JA 3OOJA 4MRPA 3TDNA 1ZO8A 2PUCA 2JJMA 2ZE7A 1GRVA 2O2IA 1GD1O 3VPGA 1Z4IA 2BDEA 4S2UA 1FB5A 5KSPA 5BRAA 3NX4A 2IXBA 3SGLA 3P9IA 2HK6A 4JJIA 3QHPA 5JAZA 3DE4X 4RHXA 3P4YA 3B1YA 2AZDA 1Z4JA 4RSHA 2VQFB 4OGLA 4BBJA 4QVIA 3T0FA 1X8KA 2FOXA 3FPCA 2VHCA 1GAQA 1T8RA 2WZBA 1NY6A 2RHLA 4FFWA 2C42A 1DJLA 2O0KA 1SB8A 2F8MA 1M2HA 2DH5A 1SVKA 2WHQA 3Q6NA 4HS9A 1ZH6A 5LXTA 1YI0A 2DY1A 4A15A 2Q3LA 3BK7A 3DAPA 3ZY3A 5A6VA 1W0KA 1VDZA 2RHMA 2GJ9A 5C4IA 1WF3A 2HHJA 5BQFA 3MUNA 1KAOA 5F1YA 2UZ0A 1JLRA 3HY3A 3NHFA 5LA6F 4ND5A 2H52A 2RHRA 3W0LB 2V7TA 3EMDA 2IL1A 3G6WA 3EVNA 4G2TA 4QO7A 3C48A 1ES9A 5KSOA 4G2NA 5IM4F 5EEHA 4HF7A 1JH8A 5JAOA 2DHCA 2O50A 4XGRA 5MN4A 3BRQA 1YJAA 3GEMA 1RYNA 4X64B 2EZ9A 1E4YA 3I3SR 4ZDJA 2FDCA 1P6XA 2JBAA 4F5EA 1HFKA 3BMNB 1XEXA 2A58A 1ZJ5A 4L5JA 2F2TA 1KRWA 4NS4A 2I78A 1O87A 2X9VA 4PIMA 4BLRA 3QVMA 3AM3A 3ROEA 4CF3A 2G5TA 1MABB 1WY7A 2ZGVA 4FDVA 5EG5A 3TE6A 1MOZA 3O7MA 4M99A 1B2LA 2D13A 2ZYSA 4I7EA 1JDVA 3PB3A 3P7MA 2AFHA 3SLGA 2PZEA 4DR7B 4J1SA 3ESAA 5B55A 1QFJA 1R88A 4I4TB 4X3CA 2Y1OA 4DPKA 3DDOA 2BGJA 4EHNA 2YYSA 2PKYX 3TZCA 4DJDC 1YC2A 2BHNA 4ZARA 4OOEA 4XTCS 3UOAB 3EZXA 1JXMA 3LBYA 1YZNA 3GMSA 4GKAA 4UBNA 1XVVA 1YRYE 4JN6B 4XRRA 2E6KA 2JLSA 3OT1A 5ADHA 4GKJB 1UAAA 3ND7A 3LOPA 5FLYA 2WMOB 4EUNA 1VJDA 1Y7IA 2ZRNA 4B48A 2AJCA 1DRJA 1EB8A 2IHJA 3MJTA 2C8VA 2I6XA 2YY6A 1GFSA 3I9JA 3NHBA 1FXWA 2VJCA 3G0DA 3I9NA 5MN5A 4MUJA 5HFJA 2XCOA 3VSBA 1T0IA 4HDRA 1DRVA 3A10A 1CJBA 3ODPA 4PGHA 4YUAA 1XL1A 3CSDA 2OXRA 2QLMA 3DL2A 3RS5A 2E87A 3O8BA 4YMHA 4MQUA 1C9YA 1JNYA 2PO5A 3JPYA 4YMTA 4JJFA 4D4LA 1EZ4A 1SBYA 5JAUA 4IV8A 1CV2A 3WGOA 1XTSA 2FYTA 3FDFA 3ZV7A 1TLTA 5JQWA 1CJUC 5IRCD 3IEMA 4B34A 4NU0A 5E2BA 2CL7X 5G02A 3VDNB 2GO1A 3GCDA 3PR3A 4DG5A 1SCDA 1PL7A 2NG1A 4CLRB 4KPEC 2PSHA 1VGVA 1E3WB 1PK8A 1H8EA 4WH0A 5MGBA 3DBLB 1SUCA 4P4GA 3JTEA 3WB2A 3NH9A 4ZT2A 4HEA6 1IATA 2GXQA 1T8YA 2QUAA 4BO5A 2REBA 5B3AA 4P84A 3GFGA 4I4TA 4LKOA 3MSCA 3I58A 5KYXB 3GH1A 3I5UA 2WG2A 2ZRIA 4F8JA 1B4DA 2GK6A 1FU8A 1Y80A 2XD4A 1L4HA 1C5KA 2BSAA 2RH5A 4ZT5A 1W4AA 3ICVA 2R25B 2RGCA 1CDDA 3EIEA 4RH3A 1KWKA 4H77A 4NFYA 1SN7A 1FX1A 1U0SY 3FXAA 4U9HS 2ORWA 3LCJA 2L17A 4JOQA 3HVJA 2CLEB 1P80A 1FDVA 4G85A 3ZDAA 4DN6A 1JHXA 1JSLA 1RQGA 3MOGA 2RCYA 1JZQA 4IIXA 1T5HX 2P6OA 2JFQA 3ELYA 1KJYA 9LDBA 4TWRA 3RKSA 2YYZA 2M98A 2ZUBA 3L02A 4FWIB 5AHXA 2F9FA 1XD2B 1J1ZA 1WM1A 3WHKA 2AZXA 3QBDA 1JYSA 1AKTA 5K4AA 1XA0A 3OHSX 3RPEA 4C4YA 1UWLA 1W36C 1L4NA 1NN3A 2PMCA 2PPLA 1A4XA 4G4IA 4I6EA 4Y1FA 3PS9A 3U19A 4A92A 1THZA 1A9RA 1N2EA 3AIOA 4U2BA 3SHFA 3UV3A 4B8WA 1PLKA 2C00A 3L41A 3RFXA 3RYHB 4MZXA 1BQ3A 4P35A 4BX8A 4N4AA 4JI2B 1G2OA 1KJNA 2XNJA 3OF2A 1Y48E 1SHUX 3OOWA 4GSLA 2R1TA 3MCZA 4EW2A 5HP4A 4WLOA 2R48A 3I6ZA 3WGMA 3VR2D 3O75A 4YYEA 2H2GA 2WEKA 3BB1A 3TM4A 1T1EA 4AMZA 4D8WA 2PDAA 1OIXA 1SVIA 3DO5A 1GGVA 3IMFA 4A03A 4B32A 4E5KA 2FFQA 2NU6A 4JT2A 4RFLA 2V0NA 5JAPA 2Z2YA 5JXGA 1Q1AA 2H65A 4S1PA 4WBNA 2IS6A 1RAHA 3SZGA 2UUAB 2JRCA 4ZOCA 2OYRA 2WZCA 4J1TA 3EFHA 2OWDA 4YJGB 2ZYTX 3DJYA 5CA1B 2W83A 2Z6AA 5FJJA 4AD8A 3GRUA 1JZSA 4UDOA 5J1SB 3EEFA 4P83A 4REMA 1I7QB 4UUNA 2ZJBA 1T1RA 3DYVA 4ER3A 1CUEA 3CZAA 5KNDA 1QIFA 3I2HA 5ECDA 4QTUB 2QIOA 3AG6A 2J0UA 3C5HA 5F1KA 4UQPA 3ZGVA 5T3YA 1CUZA 3V42A 1YBMA 2RI1A 4ZQIA 1GPWB 3L2OB 4FHDA 4OYHA 3JCZA 4ZIRB 5H9WA 3NHMA 1VLJA 1P7ZA 4ZO6A 1OGIA 1AIPA 3SKYA 5AD1A 4IGFA 2YRXA 4LJ9A 3E03A 4EG6A 2NLOA 3ZCUA 4HGOA 3N3AC 2QPOA 1PNQA 3G68A 4ZYVA 1EXNA 4WAUA 3FTFA 3QEBZ 2J5XA 4NBRA 4JXZA 2IPMA 1QCDA 3K4QA 4PX9A 4Z86A 3DGEC 2CXQA 3AILA 1R2QA 4XYMA 2JBHA 2DY0A 1W85B 4G07A 2O8BA 1NVDA 3A0UA 1BZYA 2AN4A 1BFDA 2OUIA 2WI8A 2ZRFA 3O38A 5BSKA 4D3YA 5ALTA 4FMBB 3A4TA 4BMYA 3OPNA 1NU6A 2WFZA 1QF6A 3OWHA 3WBKA 1SVWA 3LP6A 5ED4A 4RHCA 2PRZA 2WJZB 1UFKA 3LZDA 3QTLA 4BECA 1FP7A 2IUFA 3M7IA 3A2MA 1Z2OX 4NWIA 4IDPA 3IB6A 3C6XA 1KPGA 3LWNA 2QVGA 2P9ZA 4DXHA 2WMYA 3LT1A 4QOGA 3QVGB 4MH0R 1M6VB 5ALKA 2V7UA 3B36A 4DZRA 5AHRA 1E7SA 2WSSD 3CNBA 3LFTA 4FB5A 2PFGA 5AVYA 2O8EA 2AXPA 2KB0A 1OV4A 3MMNA 6LDHA 1DBVO 1ZBDA 2XE6A 3AUKA 4KMSA 4ZT6A 5T8KC 4B1FA 1B0PA 4D44A 4MYUA 2DPXA 1N6PA 4K2AA 2PLWA 4YQYA 1W4CA 3B8HA 5JALA 5LN1A 3M6LA 1PZXA 2XXBA 5EEGA 3PFBA 3ZJTA 5EFOA 1HEUA 1SPXA 1IZ7A 4IZHA 3FETA 4N0EA 2VNKA 1IN4A 3RRXA 5KYUB 4C7OB 4BE9A 4CMAA 1NRWA 4IDCA 3UPTA 4FOTA 4B2LA 2BTOA 3OKFA 1HFEL 1N3LA 2R8RA 4P5DA 2PUJA 4HNTA 4BC1A 1M34E 4I4IA 4HXFB 3DJFA 3UJBA 3H7AA 3FPBA 4HLDA 3WNCA 4BNVA 3GLIA 1EDDA 3AW8A 3IKLA 3QKWA 5DXFA 3UWOA 4W1SA 3TOSA 2JJ8A 5IX8A 3GJ0A 5DSXA 1ZVQA 3CNNA 4HR7A 4YEDA 3LTEA 4WGGA 5DCUA 3KZOA 3BZBA 1IDN1 4GLLA 3WWDA 4CW7A 3HDQA 1KZHA 2ZUDA 3AVPA 1H2AS 4OD0A 4AMUA 3GAAA 4ITVA 2CLSA 4RD4A 3T35A 4WKNA 1U2TA 1UDWA 2BFFB 3VR4D 4NEQA 2NT3A 3GCGA 2WVHA 3HJFA 4DPLA 3ONDA 5HE9A 1UJMA 4AS1A 3I4CA 3RQSA 3SNHA 4BUJA 4XEUA 1JIUA 3DM5A 2QUBA 3I39X 4RXUA 5CVCA 3TMYA 4AKHA 1QO7A 3EAFA 3CCBA 3HGMA 3I23A 1MP0A 4O08A 2GERA 3KFVA 1GJRA 4XLZA 1P4JA 5MFPA 1EJ0A 1Y8RA 2CLKB 1P81A 4REQA 1E2UA 2LPMA 4BNMA 1UEJA 1Y0BA 1IMOA 1G19A 2VUSA 2X1VA 1KKLA 5DIFA 3VQTA 4B82A 4QLBA 3TOVA 1QU3A 5TQVA 2BJVA 3DFUA 9MHTA 2W5UA 4EF5A 3Q7RA 4H7FA 3MUOA 3WGHA 3DKPA 4C76A 2GF9A 1Z0SA 1A7AA 3R7AA 4PLCA 3WA7A 4CHGA 4H9GA 1R37A 1E18A 2E85A 1KVRA 2D7CA 2YV2A 3DYIA 4GXTA 2RGYA 5CAEB 2YWBA 2DSNA 2GKOA 1GGFA 1Q3HA 2HO4A 2IYQA 4MW9A 4LZAA 1DQNA 2FG7C 1C1HA 4PZUA 3FFBA 4IIFA 4ZZ2A 4EYQA 1N57A 5KKAA 2I2CA 4BMPB 5SYNA 4XIGS 1KZ7B 2Z83A 3FTPA 3BCUA 1HSOA 1BJTA 1HTTA 3NC1C 3A58B 1E3WA 2VLIA 3DZJA 2JGNA 2V1XA 2QV7A 4P81A 1DBIA 4A4DA 3LT5A 1CETA 2FPKA 4N7MA 1BHSA 1KORA 1WBBA 1UPBA 4C0AC 1W87A 2J48A 2EZ8A 2RBGA 4GE0A 1OB2A 3R9WA 3PF9A 4ENWA 5E1BA 2EGHA 4G8CA 4O1HA 1XFAA 1YRHA 1PFVA 2LTAA 3H5IA 3ABRB 3NHRA 2Q28A 1W96A 4TTIA 5H81A 5J40A 3BXZA 2REQA 1CY2A 4L5BA 4YDSA 2QT9A 2R87A 3L04A 3RLIA 1KEKA 2YWHA 2OCGA 2UYCA 3G2PA 2JD2A 2WJHA 1PJCA 1HYQA 3KKNA 3FR7A 2XA1A 4IJMA 2MR5A 5DGDA 4JI0B 2WWTA 1MC8A 3CNLA 5DBFA 4FYIA 2I99A 1Z8NA 2GBIA 4JUDX 1U9JA 1CR0A 4YS6A 4AO6A 4QYXA 5TT0A 3K5HA 4CMKA 4KMRA 5AT1A 5JS8A 2XBLA 3H6HA 2I33A 2HAEA 2R7MA 5A05A 2VPYA 1CYDA 4B33A 4AI6A 3C6ZA 2VATA 2FNAA 2FV8A 1E7MA 4NG5A 1R27A 1BCSB 3EGEA 4KFRA 1FRVA 2WFAA 1CDOA 2DPHA 2RB5A 3DT9A 1J7KA 1Z33A 1G98A 2OCBA 1P18A 1ZNXA 2FF7A 2PO7A 3BJEA 3HBNA 3PLNA 4FS8A 3AY3A 1NAIA 5DI3A 2OFPA 2C2XA 2JATA 3LW8A 2ZYDA 4X0EA 1Q1BA 2C5FA 1UBUS 2A1TS 1NC3A 2I62A 3KL4A 1RMYA 3LGSA 1MDFA 1DVRA 3IT2A 1KBOA 3K09A 2FJ0A 3BAZA 3OE4A 4TV9B 4X1YB 2QZJA 4ND4A 3BIFA 4Y18A 5D7BA 3VNBA 2YFKA 4C03A 4EA9A 2ZIEA 3KLNA 3TE7A 1EVQA 1X8XA 4ZVOA 4YV2A 1YS4A 4AYTA 1IU9A 3AC0A 3LPAA 2NACA 4LFBB 4BMCA 2QBYA 3COSA 4HZIA 4WUTA 4RTMA 3NGMA 1YRWA 1P61B 2P9CA 2PQ6A 3OFKA 3OKCA 1UJ6A 2P2ZA 2V5UA 1MJ5A 2WV9A 3G02A 3OE5A 4V0ME 3GYBA 4R6XA 5TR9A 2VRWA 2J41A 4LXIA 2QSZA 3PR1A 5ANRB 4B83A 1ZXXA 3G1TA 1XDDA 4E5PA 1T91A 2Y2UA 4TS4A 4HNRA 3UOGA 2G88A 3VHQA 5BR8B 2K6GA 4BNYA 2O8FB 3HP1A 2QX7A 2XOXA 3CONA 3I42A 2FG5A 3JD1A 1TVEA 3UW1A 1H0RA 1K9SA 4NJEB 1LLFA 3U7QB 3MT7A 4RIEA 1BNCA 1DAOA 3WRXA 5JCOA 1YT5A 1RBYA 2CL5A 3Q1KA 4HDSB 1O5OA 2VH2A 1JR6A 2CHQA 2E49A 2O1EA 1IM5A 1Q17A 4O59O 4UTOA 1HDZA 4HDOB 2XTJA 3BSSA 2BUAA 1W2GA 2BEJA 3TM5A 1IJEA 4K9RA 4KW7A 3RYTC 4BMNA 3IFSA 3IESA 1J20A 1FA9A 3CRZA 4ZYUA 3L7NA 4Z9BA 1NFQA 4KRGA 4PW0A 1O97C 1U0EA 4PZZA 4QYIB 5CEFA 3P32A 3JAKB 1BFKA 3E8SA 3RG2A 3ZHQA 4LDRA 4DIFA 2IELA 4LIPD 2IWRA 4B81A 4U8GA 1PYDA 2QTNA 2IYYA 2XEDA 5FOXA 2P27A 3K9QO 5FBZA 4E03A 3FTNA 3KJEA 2WJWA 4DVGA 5FX2A 2FK7A 1XWIA 1FSSA 4D7AA 5CCDA 4KR7A 3A6DA 3K6KA 4PIPA 2QHXA 5LDGA 1GSHA 1NMYA 5B4VA 2YVLA 4NE7A 5CYPA 4C6SA 1EX9A 3AEYA 3LRPA 4MI9A 1OXTA 3BERA 3DAGA 4OA5A 4CTNA 1VHDA 4CQNA 1T5TA 3QEMB 4GEKA 1VLVA 3CUWA 3ZWCA 3K6JA 4QYSA 1BH6A 3EBLA 1SELA 3JTMA 5H59A 5BVGA 1DC3A 1R6AA 5BVHA 1N2IA 2IDMA 2XLBA 4RGBA 3FOFC 3HZOA 3IJ5A 1WSBA 1CP2A 4OJTA 2QLNA 1I1OA 5L3VA 5CB0A 2H29A 2C07A 1KFBB 4Y2HA 1HRDA 4B0OA 4JGIA 5EMMA 3EXHA 4LRWA 4JODA 1V5IA 4FHCA 3O31A 2VKTA 1DB3A 3Q3EA 1D1PA 5J4KA 3A3OA 3H2KA 1TNDA 2BFCB 2FOLA 1C8BA 2I3ZA 3E2MA 4PZAA 1XQ1A 3VSDA 1JYEA 1WJGA 4L4SA 2ZIXA 3IDAA 3MXTA 1JVSA 2PAFA 3DOEA 4L1KA 5C8YA 3DW3X 1B8VA 5DTMA 5E3IA 3PUIA 2H6EA 3RC9A 1YULA 4U2EA 5IYZF 3SOPA 4CG3A 4PINA 1PNVA 2DECA 4ALKA 1R0ZA 1YE5A 5DMXA 3ENNA 4BMSA 1Z73A 3URMA 3GLGB 3CPSA 3M1LA 1JKJA 2D1RA 2XB4A 1C30B 2XOKA 4UCXA 1HQYE 1YMQA 1G3UA 4RK7A 1RFLA 4UUBA 1VSTA 4UHFA 1XMSA 2QR5A 2M1XA 3TRKA 1SHLA 4B3FX 4YRAA 1SNYA 2O8BB 5JIBA 1M8FA 5CVEA 4J0KA 1M34A 1MA3A 1AC5A 2QUHA 1QDLB 2P67A 3FYUC 3HFSA 3TQIA 4ER0A 4UXIA 4EJ0A 2PMWB 1U3VA 2VHUA 1RWNA 3AVXA 5BSHA 1CF4A 1PR4A 2WYOA 4RVHA 4CEHB 2WF6A 1PLLA 1OXVA 3KD2A 2P2CA 4CM4A 5KJCA 1KDVA 2DUWA 3ZNQA 1GADO 3SQNA 4M1WA 4GM1A 4P93A 4D2IA 4DVJA 2E1RA 4DILA 2B1JA 5KWSA 3RWMB 1HL3A 3M82A 2UKDA 1QVWA 3UB3A 4EO4A 4IDDA 4JX8A 2XBMA 5LQSA 3FOAA 3UYLA 2EW1A 3CZPA 1YDHA 3WAJA 3O95A 3KB8A 4ASUA 3GZTB 4GE3A 2ZS9A 5GJWC 2EL9A 1MQ8B 2AH5A 4FNAA 3LFUA 4MHSA 4OLHA 3L07A 4PLVA 4RK1A 2ZRGA 3E3MA 4X94A 2Z08A 1KE1A 3DZ8A 3H6GA 3F4LA 1JIQA 2F3SA 1D2NA 5EL0A 3MIIA 3CLRD 3WIEA 1FYFA 2OFOA 2VFAA 3H0EA 3OZEA 1TTPB 2B8NA 3WKEA 2JKVA 3GUZA 4FFNA 4BWFB 5LYYA 5IWCA 3NONA 1O6CA 3PNMA 1K9VF 4EIWA 1M0WA 4HQ6A 4ENRA 5IYZB 3HKBB 5ESRA 3RWOA 2DLDA 2HN9A 2PL9A 3L6OO 4WCDA 1LWOA 2WMNB 1D1SA 4FSDA 4N7JA 1JJFA 3AR3A 3P9ZA 1U80A 1QRSA 2WY2D 1P9NA 1WMBA 1XSEA 3FDZA 4Y6RA 6YASA 1JEOA 2J9YB 2QB5A 4K9NA 5B36A 4QM6A 3SHOA 5KVSA 3UFXA 4TZ0A 4TXNA 4ER7A 2HFKA 2ZJ8A 4CF7A 1IK4A 5DP1A 3RFFA 3SG0A 4Q16A 2AJLI 1YGPA 3F74A 3MJEA 4JB0A 3EXIB 2QE7D 1NU8A 1A2BA 1WB5A 1XRMA 4B6SA 4YV7A 2Q5IA 5IEBA 3PJDA 4Z9FA 4BNUA 1O89A 1UPFA 2D4HA 3MWKA 4YNBA 1JA0A 2W11A 3B9PA 5DYYA 3G9QA 1AA6A 1NNEA 3I6IA 1I1HA 4P4SA 1EDBA 1UBMS 3I9FA 3PUHA 1E6WA 1NW9B 3CH4B 5AVJA 1S9HA 1WETA 4X1IA 1AMOA 3WYGA 2F8SA 3VU9A 4TVSA 2P77A 5AOBA 5CB4F 3DEYX 2O3TA 4XOIA 3GBSA 3UYKA 1FTYA 3FPKA 1IMJA 4IFEA 5DOVA 4RO0A 3JWJA 3V8NA 4G5QA 1QANA 4J1QA 3D6MA 5BUCA 1N2CE 1H69A 2BJWA 3NI2A 2VXOA 4HX5A 1F17A 3ZDZB 1L9XA 5JZOA 4RQBA 2IV7A 2Y4OA 3E8XA 5BN1A 3UT5A 7REQA 4L02A 3DNFA 5FI1B 2B2XA 4PQYA 2GM4A 8ABPA 3U60B 5DN6D 4BX3A 3NDPA 4HGPA 3SZMA 1K4YA 3LDUA 4MGIR 2GM9A 1KOJA 3LXMA 1IZYA 4JLMA 1X1QA 1M5RA 4LVNA 2QI9C 1A9SA 2D0IA 5FBQB 4PG5A 1U9ZA 2A92A 5AIBA 4H4CA 2C88A 4M1ZA 1HM5A 4ZZ1A 1C4OA 2OD2A 2QOEA 2BKLA 2OSBA 2C2YA 4EB6B 1HWYA 1MPTA 5CFMA 4LKRA 3DE6X 4ZCLA 1L6RA 5K5EA 3PE6A 3X1YA 4RCZA 3BDIA 1ZGHA 2OE2A 3OFNA 4QPNA 2BGIA 3VR1A 3AR6A 4GI1A 3L4BA 4IYRA 4CF5A 5AYVA 4XKJA 1JIJA 4C6RA 1E9VA 2KI5A 1XZLA 2D06A 1TUBA 1U6IA 3LUGA 5E1MA 3V8QA 5KNLA 2ZJ4A 1RI4A 4OGGA 3WAKA 5LD2B 5AICA 3R44A 5D3KA 1GKLA 3OY2A 5B7QA 1U65A 2X15A 4HDKB 3DZBA 2VXCA 3VR5D 3GYGA 3LUHA 5TGZA 1SU8A 1RMTA 1QKJA 3DWGA 3GLUA 4U0KA 1DIGA 4CTKA 3I2GA 1DI0A 2F3UA 2IEIA 3H3XA 3LCRA 1W30A 4ZOLF 2X2FA 3L6BA 3X2FA 4DY6A 1VIYA 5DTIA 2YC4C 1YOBA 2UV8A 3N53A 2G9NA 3NWEA 1OXXK 2GAAA 2PX3A 4XWGA 5KDOA 4R3WA 4M0LA 3L7LA 2CUNA 4L85A 2XR1A 2EZUA 1JG3A 4INZA 3S40A 1P4RA 3QU9A 4ECEA 3DPIA 5FA5A 1OASA 5FI0B 1SRRA 1QC5B 3VYRB 4M46A 5FCDA 2AMLA 3MJCA 4QGHA 2DM6A 3SS8A 2J3JA 2OV6A 3F8TA 1USUA 1Z22A 2ZRCA 3A32A 5CM8B 4NQRA 1XVIA 1G6HA 3UV6A 4XFDA 2RGGA 3DC7A 2YMPA 3QELB 5JFTA 2ILVA 4RKQA 3S7TA 1X2EA 2BUCA 2C9CA 2C4MA 4QPPA 3E3LA 1QWOA 4QBTA 4JJ4A 2W9XA 4RPHA 5ILGA 6ADHA 1RXCA 3W6ZA 4ZGWA 3RYIB 5KWEA 5LLTA 3N8HA 2YOGA 3ESXA 3R6WA 3RJZA 4TYNA 3ZOKA 1HA3A 4OX9Y 3H86A 5IU6A 1AQLA 3ILHA 3OT4A 3A1FA 1SCAA 1GZSA 5HW0A 1SQSA 2RFLA 2HIGA 4BZWA 3DDUA 1MJGA 1C0PA 1L5LA 2NMVA 3GJ8A 5IZCA 1NVTA 4KDCA 2GSDA 2G1PA 1YVPA 1ZOOA 2RONA 2IZZA 2QAIA 1O97D 2NIPA 1QE5A 2FETA 3L8CA 1ZM9A 4MWGA 4R7ZA 3TLJA 1W19A 2QN7A 1F38A 1MB3A 1HT3A 2NO1A 1JG6A 3JZMA 2O48X 3MS7A 4JUCA 2WAMA 4OQMA 5ALDA 5IEJA 4WLEA 4HADA 2KHZA 2G70A 2VYCA 3CNOA 1SGWA 5CNKA 5EC8A 4YJ2A 2PGNA 3O4HA 3O4RA 5TQ0B 3WG9A 4N01A 4BTLA 3ZWPA 4YA6A 3HV0A 1V3TA 5HDBB 3ZWKA 4CM9D 4YUYA 3RVSA 1Y6JA 4YRQA 3UUGA 1PNRA 3QU4A 1P91A 4R8VA 1P1JA 2J7KA 2R44A 3TLXA 2IY7A 1JE0A 2VZ9A 1I32A 1M7HA 4FYPA 1AF7A 3W2HA 1XTIA 3CGWA 4G0PA 1KNQA 2B1RA 2VZEA 1G16A 3EIQA 1MZVA 2AFHE 3LBFA 2BFPA 1U11A 3I53A 4WGFA 4GNKA 4KXWA 2FR0A 5EIWA 3TSZA 1XAIA 3RAGA 1OC2A 4CIAA 4P3OA 4RTSA 1NT4A 1JMVA 3LYLA 5SYMA 1EVYA 1Q84A 3IEKA 1D2RA 2QL5A