4XFHA

Cysteine dioxygenase variant - y157f at ph 6.2 with cysteine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfhA00
1QXRA 1V70A 2PHDA 4XFIA 1QY4A 4I02A 4IEXA 3S0MA 1LKNA 2QNKA 2XHKA 3H9AA 3UKNA 1EY2A 1XRUA 2N7GA 3IIAA 4PIZA 5JAXA 4AVAA 3CF6E 1EYBA 2UYBA 3U0ZA 4A2UA 2DCTA 3FFQA 1I5ZA 5FQ0A 3D82A 1SEFA 1LR5A 2ATFA 1G6NA 2GU9A 4Q0PA 2IXKA 4AVBA 2EVXA 2CGPA 1H1MA 5I8TA 3OGJA 5CADA 5LEKA 5FDBA 3GYDA 4F8AA 1J58A 1YFWA 3SMHA 4Q0VA 1IPJA 3LOIA 2MPFA 3L2HA 5LRSA 2FQPA 2H0VA 4HSLA 3RPQA 2V09A 4MGKE 3SXWA 2PAMA 3N4MA 3LA3A 4XF9A 4PJYA 3OD0A 1ZX5A 3MDPA 5FLHA 2O8QA 3I59A 1NXMA 1ZREA 4N9HA 5I8YA 1WLTA 5LRRA 1YWKA 3BCWA 3EJKA 4UBGA 3B02A 3CJXA 3EQEA 5KBFA 5KHJA 4XF0A 3C3VA 1X8EA 2UY8A 5J3UA 4Q0UA 4QMAA 2GC0A 3SCHA 4BHPA 2F4PA 3ELNA 3PNAA 2EAAA 3KSCA 1LB2A 3KGZA 1PM7A 2MHFA 4EV0A 1J1LA 1CAWB 1XE7A 5D1IA 5EFUA 2BYVE 4E2GA 1RUNA 5JSRA 3OF1A 4Z82A 2OZJA 3NJZA 3FWEA 3E6DA 4K8FA 3U10A 3QOPA 4XFGA 4YYOA 3MYXA 3WW2A 4KU8A 4LUKA 4HMZA 3FX3A 1O4TA 1ZNPA 4WZCA 3M70A 1WA4A 3HIFA 4IERA 4XF4A 3KGLA 4HVRA 4MGIE 2ET7A 2XLAA 4ZU7A 3M3IA 1YFUA 4Z07A 1YUDA 4YARA 4ZU4A 4FT8A 5KHHA 2XKOA 4XFAA 1HW5A 1TQ5A 2MNGA 4MV2A 3TNQA 1NZCA 2IXLA 4I09A 2OA2A 2PA7A 3H50A 4FAGA 5I91A 1ZZ6A 4I3PA 3H1WA 5K8SA 2IXCA 4Q0SA 1YFXA 3MPBA 2UY9A 3RNSA 4IESA 4EWEA 1ZRCA 2D40A 2D5FA 4FBFA 2XL7A 3CO2A 1RL3A 4AQ6A 5I8SA 2PAEA 3USSA 3WW4A 2HJIA 3H7JA 5AVPA 1UW8A 5F1RA 1O7FA 4KWLA 3KMHA 1UCXA 1CAWA 4XFCA 5BUVA 4EWDA 4KL1A 2VQAA 1DGRA 4YRDA 5FQ0B 4BIFA 4OLLA 3E5UA 3HT2A 3DKWA 2BNNA 4QM9A 1CAUB 4WVZA 2CAUA 2IXIA 2H6CA 4J1WA 1CAXB 1O3TA 2CV6A 5LEJA 4MH0E 4HLTA 4TLFA 4META 2GZWA 2QVSB 1CAUA 4XEZA 4Q0QA 3H3UA 4ZU5A 3HQXA 5J48A 1CAVB 2OPKA 3FE5A 4H7LA 2D5HA 1RC6A 2ET1A 4I2OA 1ZZ8A 3SHRA 3CEWA 5I0SA 4OFGA 4UBHA 3EBRA 2EA7A 2HKXA 3NL1A 3ZDSA 2PFWA 1ZZCA 3I59B 3RYRA 4JV4A 1VP6A 3WW1A 1VR3A 3R6SA 2Z69A 2IXJA 1ZRRA 4KWJA 1ZZ7A 4IEVA 5I0UA 3UKVA 4YSFA 1O3RA 4BH9A 1SFNA 1FI2A 2BEOA 2QCSB 3IBMA 3NKTA 3FZ3A 1FT9A 3ROUA 3LA7A 4MZUA 4HVQA 4QGLA 5FCCA 3NVCA 4EROA 1U12A 4QGMA 5FLJA 5CU1A 2H6BA 1QXJA 3KCCA 3BALA 1XE8A 4QM8A 2GC3A 1IPKA 3IDCB 1J59A 1UIJA 3D0JA 3FHIB 4XF3A 1Y3TA 1UPIA 4KU7A 2Y0OA 1CGPA 4HZFA 3CL1A 5KHKA 2GC2A 2IC1A 3IWZA 4IETA 5JR7B 4NVPA 4HN1A 1EPZA 3RDIA 4YNIA 2K0GA 4QGNA 3OTFA 3QACA 1RGSA 1YLLA 5CVRA 4LA2A 2P17A 4IEQA 5FPZA 1EP0A 4AVCA 1J3QA 3LWCA 4LUMA 1ZZ9A 2B9UA 5EZWA 2E9QA 3DN7A 2QDRA 4IEZA 2ZCWA 4X6QB 5BPXA 1GQHA 1OD5A 1QWRA 3ES1A 1OFNA 4IEUA 5BXXA 4IEOA 4LLOA 3NW4A 3DV8A 5E16A 4LULA 4ONUA 1RTVA 3ACLA 1NE6A 2FMYA 1O3QA 5T3NA 1Y9QA 1ZVFA 4KWKA 1UIKA 3E97A 5E1RA 1NYWA 5BV6A 1Q5OA 4PIYA 2XKPA 4DINB 4LTAA 4O9GA 4GULA 3H7YA 2IXHA 1L3JA 4B29A 2Q30A 3ETQA 2QJVA 4LA3A 4MGYE 3OCPA 3G7DA 3EO6A 1UD1A 2OYZA 3H8UA 5KHGA 4L2NA 5FPXA 1NE4A 3GBFA 2Q0AA 4X6RB 3HT1A 1J3RA 3EHKA 4N9IA 2B8MA 3E5XA 4J1XA 4P9GA 2PQQA 1GQGA 4EWAA 4O9EA 4D7SA 1CAXA 5JCTA 2I45A 4L11A 4IEWA 1ZRFA 3H1YA 4XFBA 3RYPA 2XL9A 4R8HA 2UYAA 2WFPA 4AQ2A 2PHLA 1O3SA 3IDBB 1O5UA 3VHRA 5J7MA 3O14A 3WW3A 4F7ZA 1YFYA 5BY5A 1X7NA 1H1IA 3I7DA 4RD7A 3PVBB 4QXKA 3LA2A 1Q43A 4HSJA 2K9ZA 1X82A 3H3ZA 4XF1A 4I0AA 4FAHA 1OI6A 1SQ4A 2OZ6A 2CAVA 4Q29A 4AXOA 5FLIA 3U11A 1LRHA 5JSOA 1Q3EA 2Q4SA 5KHIA 4I0BA 4JVAA 1CX4A 3BPZA 3I54A 4ORFA 5HI0A 1OMIA 2GAUA 4XFFA 2Q1ZB 4XETA 4QX5A 1JUHA 3H1MA 4LEJA 1CAVA 3E6CC 4BYYA 2BNMA 1O5LA 4MGZE 4D7TA 2XLFA 4E2SA 2PYTA 5C6CA 3S7EA 2D93A 2KXLA 1DZRA 1ZZBA 2VPVA 3MZHA 2WC2A 2B5HA 2GC1A 2Z2SB 4I01A 3LAGA 1X8MA 3FJSA 4R52A 1DZTA 1ZRDA 3RZZA 4HBNA 3ST7A 1YHFA 3E5QA 3RYKA 2C0ZA 3ES4A 5I93A 4E2QA 3PLQA 1PMIA 2XGXA 4JTOA 1I6XA 3S7IA 3E6BA 5JSPA 4PIXA 1DGWA 2ZKLA 4MUVA 2BGCA 5C8WA 4CYDA 5I0RA 3D0SA 3BB6A 3TNPB 1FXZA 4HVOA 3NSTA 4XFHA 4IEYA 2XLGA 1VJ2A 3JZVA 4MX3A 4UXAA 2O1QA 2PTMA 4WBBA 3BU7A 3DL3A 2BNOA 5I0TA 2PAKA 3LZZA 3SCFA 2VECA 1RUOA 2ETEA 3CLPA 3UKTA 4JTNA 1J3PA 4IEPA 1WGPA 4HN0A 3SCGA 2GH2A
chains in the Genus database with same CATH superfamily
2BUKA 1TME2 5FPBA 2QKDA 1RUE2 1GNYA 1RVF2 2BVVA 2P37A 1NY71 4KG0A 3AFGA 1HB3A 1WLCA 4Q2FA 4FFIA 4RR3B 5FYSA 5H9SA 1U0AA 2D6PA 4Q4X2 4A44A 1XC6A 4N7UA 4LORA 1XRUA 2N7GA 3OGGA 2Y6GA 3IIAA 4NUBA 1OPMA 2NN8A 4AVAA 2WBKA 3HN3A 1RUC1 5EV7A 4FP2A 3OG2A 5K7PA 4Q1RA 1KRIA 2WYFA 3JU9A 2QQIA 4YVWA 2G4IA 5FQ0A 1W9SA 2ATFA 3T0AA 5GZGA 4FPLA 3VBUC 5FBZA 4LBLA 2OW4A 3KV4A 2IXKA 4AWDA 1JMUB 5JMOA 2VXRA 4Q26A 1H1MA 5IUQA 1UY1A 2ZS6B 5I8TA 4ITCA 1JU4A 1PIV2 1UYXA 5A1AA 5LEKA 1ZBE1 3IB3A 1IQAA 3MW3A 2OVUA 1D0GA 5CYYA 5FO9B 1RHI1 4YZ3A 1RUG2 3SMHA 3ZXEA 1XJAA 3HVDA 4I30A 4MADA 4XIKA 2JJ6A 3ILRA 2H0VA 2FQPA 1S55A 2V09A 4GD4A 3IDEA 2OUJA 2D97A 5FO7B 3T4VA 2RR13 4LPLA 3C2UA 3WHUA 1BEV1 5LCWL 4GH4B 3H8OA 2HWF2 5CKQA 3P6BA 2AC1A 3IMNA 3KV6A 5FLHA 4NHMA 4IW3A 5AFBA 1Z0HA 5F2WA 5A6XA 3BYWA 4AVTA 4N43B 4DY5A 4ES8A 2P3KA 2E7QA 3MF6A 4EN0A 3PVOA 2FDJA 4PLNA 4UW3A 3P1IA 4Y22A 5DXDA 3ZSMA 5JIUA 3NV4A 4TWTA 4UBGA 3J7NA 3KT7A 5L9BA 3CJXA 1DU3D 3EQEA 5KBFA 4XJ8A 2J1TA 4XF0A 4YVWC 3FUOA 5KHJA 3GHMA 2AYHA 5F3GA 2UY8A 4QQPA 5J3UA 4Q0UA 2VUJA 1O8SA 4BHPA 1SMVA 3RVHA 4DY3A 1R093 3KT4A 1Q56A 4H3WA 3FFZA 4AFAA 1JYWA 5F5QA 3MI8A 3OYWA 3KGZA 2MHFA 3A22A 3ZO0B 3VL9A 5GZDA 1CAWB 5DN2A 2A6VA 3OGVA 4B7EA 5FUIA 5EFUA 3FMGA 2PLV3 4EZ4A 4FI9A 2C4XA 5T5PA 3AP5A 1VAVA 5IW0A 1ULFA 3W59A 3NNGA 5LBBA 4OHYA 1RUJ2 1ZA4A 5FZOA 4QX1A 3AJZA 5KR7A 2YYOA 1HRI1 3NJZA 4V2VA 3WF2A 3I2IA 1Y43B 3NWKA 3K4DA 3LF7A 3THDA 1RUD1 1KDKA 3MYXA 4NIDA 2X53S 3PVEA 4RR3A 1J84A 3TEXA 4HMZA 3WP6A 3V56A 5BNNB 1ND3C 2WZEA 3FX3A 2BBVA 2EIGA 4AQSA 1A78A 2D3PA 3ASIA 4CXWA 2HWB2 3WDUA 4EN7B 1WUVA 2LUWA 4CTEA 4J25A 2O0OA 1NLSA 4COZA 4AI3A 3U75A 1VBE2 2VD7A 2VTFA 3M70A 4ISQA 1WMXA 2YBKA 5C3SA 4RSUA 3T2QA 1HN1A 1VLNA 4PT6A 4BLJA 3PTRB 3I3MA 4ZU7A 5DDJ1 3X29B 3ZR5A 2WT0A 1B35B 1YFUA 1H2KA 1Q8PA 3RG0A 3RI9A 4IL7A 3V64A 4PDWC 4YARA 3TAYA 3ZX7A 2VMDA 4CEWB 3VBUB 1TQ5A 5A7PA 4MV2A 2EALA 1LODA 5FREA 3WDXA 4CU7A 1AR63 3TN93 1LOCA 3LGRA 1V9U2 3ZMNA 5F39A 1W9TA 2WWSA 4EN6B 1C28A 4JX0A 5T52A 4QDSA 3H8RA 2YXSA 3ZSJA 4KWUA 5ERLA 1DGLA 4P14A 1IHMA 2VW2A 3DECA 1COV2 2B9VA 3DEMA 4FPGA 3ZFFB 2BPA2 4P9LA 3KWVA 2ZGUA 5C8CB 2I2SA 5FZLA 2XH6A 4YW1A 1CX1A 1RHI3 2W87A 3ZFEA 1PO13 5F3CA 1ZRCA 5CB7A 4AYUA 1FPN2 1DQ1A 4IE4A 3V0AB 2RS53 5B4NA 3IM0A 4Q4Y1 4AW7A 1AL22 2WZR1 5CZKA 5I8SA 1ULEA 2DVDA 1AL0G 2ZAAA 4UT5A 4CEWC 2RHPA 2WS93 1VAKA 1I1EA 2PLV2 1K5MB 3WF3A 1UO9A 1LU2A 2ZEWA 2C24A 5B2GB 4IV1C 3KMHA 4B7KA 1UCXA 4PBPA 4YM0A 1CAWA 4QAWA 1K42A 1VMHA 5A1FA 2WNUC 3AKQA 5LATA 3TEZA 1H8TB 1TME1 4YRDA 2JG9C 2Z4FA 4FOQA 4IGQA 2JB4A 4GXLA 2W1WA 3P5BA 3SC7X 1QHDA 1W3XA 4FPKA 2VG9A 1IZ3A 5FZGA 3SNMA 2IXIA 4C0HA 2Y0IA 2H6CA 2ADEA 1CAXB 2PHTA 1R091 1S2KA 2CV6A 1KXGA 4HL0A 3VD7A 2QVSB 1QJY1 2VCCA 1E5SA 4R9BA 2JKXA 2DDUA 3VBOB 2NZ9A 1CIYA 3H3UA 3HJRA 2BU9A 2YZ4A 1GOHA 1GLHA 3HQXA 5J48A 2OPKA 5ABJC 4Z2AA 1PK6A 2ZHLA 5H9RA 5A3UA 3IT8A 2WINB 2WN2A 1RUH3 3CEWA 4LE3A 5I0SA 4UBHA 4W4ZA 3QD6A 2K2SA 1C4RA 1AXZA 5A33B 5I0DA 2EA7A 2PFWA 2R1DA 3RI8A 3RYRA 3O0WA 5J09A 1Y9GA 1XNCA 4AK3A 1BYHA 2VH9A 3K3NA 1VBD3 4IGPA 4JQTA 1HRV3 1W04A 3L9JT 4KG8A 4LITA 2OQ7A 4NMIA 1V6KA 2PHFA 2WZR3 3K3OA 4QKNA 4WM8B 4Y1UA 2Z69A 2IXJA 3WW1A 2JDHA 4KWJA 1NUKA 3WP5A 4IEVA 3FLTA 5K0UB 1S0EA 4EN8B 1RUE3 2WNUA 3FL7A 4XUOA 2QCSB 1QIQA 3VDDB 2JD9A 5FP4A 3SQOA 2W9XA 3FZ3A 1GP6A 3ETPA 3Q8AA 3K2OA 4YW7A 4Y33A 5FCCA 3I3BA 4H55A 4ASKA 1G9BA 4XACA 3ZYBA 4EROA 4QPYA 3IPVB 2FDKA 3VZNA 5BNQA 1HQWA 1WBLA 1IPSA 1QOSA 5FLJA 1FNZA 1PIV1 3AM2A 3HMYA 1VBE1 2VTXA 4YG6A 4UW6A 3GBGA 4QT6A 2WQZC 3OGSA 1JHJA 2AEYA 3ZN4A 1IPKA 3VDCA 3J8F2 4C0BA 1UIJA 1J59A 1NLRA 2DU0A 4GMP0 1JXNA 4NHYA 1JZ4A 1MACA 2QZ3A 3FHIB 3V0BB 4BK4A 3BTZA 5LWBA 4JZRA 1LOAA 2WT2A 3AYAA 5J96B 3A7QA 4QDQA 1NG0A 1N1VA 2UURA 1ODNA 4FVVA 2GSYA 2B7YA 4DXRA 4BQXA 4HZFA 3M4FA 3J4UH 4Q4W3 3O1PA 3MIDA 3WF4A 2MEV3 4RN5A 4XDQA 2R041 1POV0 1VMFA 3AYDA 3IWZA 5BNOA 5CA6A 2VZRA 1PO11 4NVPA 4RL7A 4HN1A 5J37A 2RJ2A 5JPMB 4XJZA 2K0GA 4E8DA 4MG2A 1UU4A 2YGLA 2ZBJA 2W94A 1WKYA 1R1A1 3OUIA 4OQ9A 4A4AA 1COV1 2OT7A 2WS91 2YG0A 2WNVA 4IEQA 4GQ7A 5FPZA 5A1LA 1S1AA 2HWB1 3TB0A 3N9QA 3M2MA 4GKYA 1UZ0A 2G9GA 3ACFA 5EZWA 5FKBA 4CDXC 4OYUA 4COVA 3UESA 3AP4A 1CQ9A 3LD8A 4CUGA 3ZPOA 2SLIA 3MLJA 4L97A 4LHNA 2A3WA 3D5OA 4DO0A 4LO4B 3PMSA 4YVSC 4IEOA 2JDNA 5DDJ2 1T6GC 2VBDA 4LLOA 4CDQC 5GLZA 4XHXA 2Y6KA 4W6XA 1FOD1 3N9LA 4JDNA 3VBOC 5EQUA 1ULPA 2BOIA 4LR4A 1W6MA 3ME2A 4HG6B 4BJ0A 2B45X 4UYBA 1L7LA 3PU3A 4Y20A 1ZVFA 1FMD1 1RUI3 2VL4A 3FLRA 3W9AA 4ZY9A 1OF4A 2RS31 3J8F1 4A42A 5BV6A 3AXEA 1POV3 1UOBA 2DVAA 2I74A 1LGBA 4IV3A 3VBFC 4URAA 2V5DA 2VUDA 1RUG1 2WNUB 5H9QA 1BVP1 2WFF2 3OB8A 5IT6A 4Q8KA 2BZDA 3AMHA 3WV6A 1NOVA 1D2SA 1VAMA 1UX6A 2VNGA 1TMF1 4L0PA 2WSUA 1PVC2 4Y4RA 3UT0A 1L3JA 1GR3A 1WLDA 2X5IA 4LA3A 2BBAA 1YI9A 5KXBA 5FMOS 1NT0A 1MQTA 4KH9A 3OUHA 2WRAA 4JHZA 3GNEA 5KHGA 3MHZA 2D7FA 2EIBA 2Y6JA 3WNNA 1AL21 2ZGSA 1AYN1 3GBFA 2ARCA 1E5IA 2XG3A 1QMJA 1H4GA 1SCSA 2VZOA 1YQ8A 3BPSA 2LTNA 3HT1A 3ILFA 4N9IA 2B8MA 3DCQA 2WT1A 5LK7B 1QH6A 1UZWA 4CDUC 4P9GA 2HWF3 2XVGA 2Z5WA 4CDQA 2VBBA 1PNFA 1NX9A 4AG4A 1APNA 1SHWB 4CEYA 4D7SA 5C7GA 3MFCA 5JCTA 4N7IA 3AFKA 4PLMA 1GQPA 1JU3A 4YW2A 3AZVA 1LHOA 4XFBA 3RYPA 4N43A 2XOMA 4R8HA 1H30A 2QQVA 1LNSA 2WFF3 3GALA 2PHLA 2E53A 3MO4A 2X05A 1ND2C 1W8FA 3IDBB 5D8AC 1D2QA 1R081 3WNPA 3P3PA 5DAVA 3JQWA 1YO8A 2QDNA 1RUC2 2VMIA 1W8TA 3MICA 1H2NA 3B69A 3J8F3 5FZ1A 1XYPA 1IS3A 4RA0A 5EYYA 3M3EA 2KR2A 4Y5SA 2OZ6A 5BNPC 4B4QA 1LRHA 1T6BX 3WP3A 4ZXEA 4QB2A 1JH5A 2Q4SA 5CFDB 2ZEYA 3RJ2X 3BPZA 2ADDA 3I54A 3LB9A 4NRQA 4ORFA 1MZFA 2GAUA 4XETA 4K40A 3MW2A 1SPPA 1AR81 4LOTA 2OX0A 4LEJA 5FZ6A 5FYMA 4XURA 1A8MA 4B8EA 2DYCA 1GMMA 2OXBA 1YC61 3WQ1A 5IYYA 5JMCA 3VDAA 2EICA 2NP0A 2TBVA 5C6CA 3ILNA 4Y1ZA 5FR3A 5IHRA 4XE9A 1G8WA 3S7EA 1S0GA 3BIEA 5CG9A 1CPMA 2KXLA 4GJZA 4LHKA 1DZRA 4QQOA 1US2A 4XAEA 2ZGOA 1HB2A 3EXUA 1M4WA 3RS6A 1M06G 1W3VA 4MGSA 1OQDA 4UFJA 5L73A 1JYIA 2GC1A 4PDWB 3LAGA 1AR62 2FD8A 4Q4W2 3MV01 3A23A 2VO5A 3LDRA 3S6PA 5LBCA 2TEPA 5C5TA 1RJ7A 3E5QA 1W39A 2QQKA 1XYOA 2E33A 1WCKA 2V4AA 3RYKA 3OOXA 5I93A 3VKNA 1PMIA 4CA9A 1SLAA 4ZPIA 4U2AA 1XNKA 2WN3A 4JRAA 5GZFA 4P9XA 3N7MA 2ZKLA 2ZGKA 3RFRA 2BGCA 4LKSA 1K45A 2ZGLA 1J1TA 3CKHA 2DTWA 4CE8A 4DOUA 3TYJA 3AKPA 3T2TA 1FXZA 2A6WA 4HVOA 4NWVA 1BEV2 4R9DA 3NSTA 4HT1T 1W90A 2PLV1 4MX3A 4UXAA 4ZXKA 1TNFA 2O1QA 2Y64A 3F95A 3OBRA 3WCSA 1F8VA 3DL3A 2BNOA 2CDOA 2W47A 1REDA 4NR1A 2NPIA 5I0TA 3WQBA 3LZZA 5J36A 1CPNA 3FC0A 5DABA 3T1LA 1YQ5A 2ES3A 2KM2A 2WQ8A 4JKMA 1ASJ3 1OLME 3B94A 2AGSA 3SCGA 1UU5A 1C1FA 1ULGA 5KXDA 3UGFA 5AFEA 3VKFC 2YB7A 4KMQA 4WM8C 1QQP3 4XFIA 1S4CA 4I02A 4BMEA 5SV8A 5A3PA 3S0MA 1GICA 1DCSA 1ULCA 3M7AA 4GZ9A 4RR3C 2QQMA 2XHKA 1JZ6A 3H9AA 3J7MA 4YFWA 4NO4A 2ZX0A 4YW4A 1UAIA 4PIZA 4DZGA 4V1PA 2ILMA 4QPGC 1QEXA 1XB9A 3CF6E 5DQ0A 1DZQA 1EYBA 2UYBA 1WD4A 4YM2A 3V65A 4A2UA 5LZ6A 2RS32 1I5ZA 3FFQA 2ZAHA 5FY9A 5FXVA 5ABJB 2XWBB 1K12A 3APBA 1ZBE3 3MLKA 2CYFA 4Z8BA 3LPGA 1YCIA 1WMEA 2EVXA 1CESA 3OUJA 5CADA 2DV9A 4XQ4A 2QQOA 3WEZA 5GM0A 3TN91 1UY4A 4Q4V2 2DVFA 3NV2A 4NPLA 4MXWA 1S0IA 2VZSA 4LKEA 1W0NA 4AI1A 5EXOA 2JG9B 1PZ9A 1WLWA 2DU1A 3IN9A 4AI9A 4YFZA 5LRSA 2FMDA 4URTA 1AZDA 1F2NA 3S5QA 4CSWA 4XF9A 1BVVA 3DUIA 2ZX3A 4Y22B 1FMD3 1RUI1 4Y26A 4Q4Y2 1RXGA 2W1UA 1LEDA 2O8QA 1ZREA 1JTZX 2JDKA 4LBQA 5EPAA 5A70A 1ASJ1 1YJKA 1WLTA 2ZOEB 5LRRA 1LHWA 1W0PA 1JN2P 2P6HA 2ZGTA 3DYPA 1NCRA 4BCUA 1DDLA 3IKWA 1RUF3 5IVYA 1W8OA 3MUY1 3B02A 3RSJA 3ZFGA 3C3VA 5FFOC 4KI5M 5JI7A 1OURA 2XHNA 2WQ4A 3AK0A 1IKPA 3U1XA 4BA6A 4QMAA 4AAPA 5J98B 2GC0A 5HCFA 1RB8G 2BWAA 2XJVA 2ZHKA 1AYN3 4KBZA 5DG2A 5A6YA 4PQ9A 2CU5A 4YLZA 1LB2A 1OT5A 4FPHA 1ST8A 3ZDVA 3O1SA 3ALQA 1J1LA 1TME3 5D1IA 4CCMA 4UI9L 4PHZA 4P9JA 1VBC2 3AL6A 2D6MA 1HRV1 1AR61 1FV2A 1REEA 5C71A 2JDPA 3PURA 4CP1A 4NHLA 2J1VA 4XCAA 1OKOA 2NQYA 3FWEA 2AUYA 4CXXA 2NMNA 3VDBA 5KC5A 3CJIC 4KNCA 4W65A 4CP0A 4KBBA 4XFGA 3CMGA 3WW2A 1JZ3A 2B4KA 2ZABA 3O1UA 1QOOA 3LEGA 1VMJA 1AJKA 4OI1A 3ZFEC 4XYXA 4WZCA 4XILA 1LEMA 2QTWB 4NHKA 5HV4A 2YBPA 1MS8A 2YY1A 5ABJA 2DUQA 1PK6C 1XNDA 3HIFA 4IERA 4QKBA 4XF4A 5GZEA 5C4WC 3ZYGA 4CEWA 1S0BA 2RDSA 2XLAA 3AKRA 5JVVA 3SLIA 1H0BA 1OLMA 3AKSA 2VNRA 3F2ZA 4OI4A 1GNZA 1FOD2 2H0BA 3GHNA 1G9FA 1YUDA 1EV11 1IS6A 1Z7S2 4FT8A 4W6WA 5KHHA 3HQUA 3PHMA 4WVMA 1ENQA 4WVVA 1FMD2 1AR72 2DTYA 4P00B 3B9CA 5LBFA 2JG9A 1WW5A 3I3DA 1UY0A 2IXLA 4I09A 3GM8A 4UWDA 4F3JA 1GZ9A 5C3QA 1OH3A 1OA3A 4XMIA 1JZ7A 4YGCA 2CHHA 1AVBA 4I3PA 4QHBA 5C33A 1JOBA 2R062 3MBWA 1YI7A 4BISA 4ARYA 2R071 1ND2B 4YGEA 1R1A3 5K8SA 1PVC1 1OFSA 1OHFA 1TMF2 3NNJA 3MPBA 4Y20B 2ZGRA 4OHXA 4P9YA 1LESA 1SBEA 2YHJA 2ZA9A 1MVQA 3RNSA 1HXS2 3ZXLA 4EWEA 3RQ0A 4FBFA 3HPNA 3VBSB 2C26A 2DCYA 3C7FA 4AHWA 2IZWA 3C7EA 3U14A 4XDOA 1N3OA 1R64A 3LEKA 4K1YA 3ZFFA 3UJOA 3OPWA 5DUUA 1V00A 3USSA 1DYOA 1LENA 3WW4A 4YZ1A 4AEMA 4HK8A 2EF6A 1N47A 1VBA2 1W2NA 5F1RA 2D98A 2X5IB 2ZX2A 4ISRA 4CZSA 3HEIA 2ZHNA 4IUGA 3ZIWA 4AEDC 1VRH3 2X8KA 1I3HA 4HPKB 4XW3A 2RS12 5FZIA 5JDBA 1UY3A 1G9CA 2XB6C 5HXVA 4Q4X3 5C9AC 1UMIA 1W2TA 2VQAA 4XABA 5ANQA 1DGRA 4MXVA 1DYPA 1C1LA 2HWE1 4KGGA 3E5UA 4RYDA 5GLTA 5FOBB 1PGL2 2ORZA 1W6OB 1HV1A 4MOAA 4FPOB 2CAUA 2EIDA 4WVZA 4CDWC 3POIA 2D3RA 2WWJA 2ZEXA 2W1SA 1Q8QA 1WW4A 5LEJA 4MH0E 1QU0A 4YW3A 4HLTA 5A3WA 2W2IA 4E4DX 1W8HA 4AVVA 4LOSA 2PMWB 4WV8A 4ZU5A 1QJZA 4YVSA 1VB4A 2ARAA 2ET1A 1QOTA 4PQQA 4H7MA 3U37A 3ZFFC 4NOTA 2VZUA 4AFDA 4K7JA 4QX8A 1OSGA 4OULA 4FQ4A 2GP5A 2YV8A 5LASA 5T5JA 3ZDSA 1AX0A 1ZZCA 3GZTB 3I59B 4COYA 4WZFA 1HB4A 1RINA 5JI9A 5BNOC 4JV4A 5DUWA 4AHYA 1ZM1A 3LOBA 3C7OA 1JUIA 3FBYA 1DHKB 3R6SA 5JUVA 3KCXA 1FX5A 1IGOA 3BUCA 2R16A 1A3KA 1OF3A 4OQ8A 5CFDA 1PO23 3JQXA 4HKLA 1SFNA 3VBHB 4BH9A 3SH5A 1OQEA 1RUD3 2RDRA 2WNVC 1FT9A 4ATFA 3MFAA 1ZRIA 3LA7A 2RJLA 3UK9A 4LIVA 1VBE3 2XWJB 5CG8A 3VBSC 2VC9A 1FAYA 3T30A 3T3YA 3NV1A 1C5HA 4H2AA 5KXCA 3W20A 1JYCA 2PHRA 4QGMA 4RQPB 1QJY3 3BOWA 4HXCA 4OMDA 5DZGA 2VVEA 4DUXA 1QXJA 2JECA 3KCCA 3VB9A 5AC93 3EYPA 2R6QA 3GJAA 2XJUA 2WLPA 1XE8A 3WNMA 4ARXA 5IVVA 3IDCB 1CR7A 5FZOB 4BPZA 3D0JA 3NJXA 4QXBA 1B09A 2EAKA 3U78A 4CDUA 2VGDA 4AGVA 1QJU2 2ZMKA 4NIAA 5FYCA 1GU3A 2XJPA 1BLZA 2ZGMA 5A7SA 2W91A 4AAXA 1JBCA 2LRPA 2QQUA 2VZ3A 5FMOL 5FY8A 4KU7A 5EJZB 1CGPA 3WF0A 4CCKA 4GWJA 1O59A 1S0FA 3CL1A 4N43C 5KHKA 3DYOA 1RUD2 1VE0A 3VHOA 5JR7B 2XBO1 2WNOA 3J7HA 3BODA 3RDIA 4LKDA 3AVSA 4JGYA 3NAPC 3EB7A 1TEIA 2VOTA 4SLIA 4XZPA 3WXPA 4ZZ5A 1RUG3 4L9BA 4XTPA 2JWPA 4N8MA 1VIWB 1RGSA 5FP7A 3WNLA 4BQ1A 3KQRA 4LA2A 1SDDB 3LEMA 2K46A 5FY1A 2FDHA 1VRBA 2UU8A 2VY0A 1ZZ9A 4YM3A 1IG3A 1V6OA 2ZMNA 1IQDC 2VMEA 4QB6A 2QDRA 3TWIA 1NY72 1GNHA 2ZCWA 4FPEA 5F3EA 2LM3A 5A80A 1S2EA 4M3CA 3SH3A 4IEUA 5BXXA 3B9IA 5JWPA 4ZS3A 1UMHA 3SITA 4EJRA 3DV8A 3NNLA 3HD8B 4XXPA 4N53A 5E16A 1HRV2 3MLLA 2VR4A 2EXJA 1F15A 3ACLA 5E89A 1AF9A 5HV0A 1KGYA 2WYSA 2J1SA 2RVAA 1UIKA 3E97A 3P3NA 4KWKA 4TSVA 2WZPP 4COWA 1MZ5A 2G9FA 3S57A 1NYWA 2GN7A 3WCRA 3CIHA 4PIYA 2XKPA 4DINB 1RHI2 1MEC3 2CTVA 5IVFA 3VD5A 2R063 5HXMA 2IXHA 4LHLA 4YGDA 4LBQB 1SLCA 4YWAA 1VALA 2DUPA 3ZYHA 4CU8A 5AC92 2FZ2A 2P3YA 4B29A 1BMV1 3JCIA 3WDVA 2QJVA 1QDCA 5E6HA 2WSVA 4GMP3 2BGOA 4FO9A 2ID4A 2YU2A 1TZOA 1PNGA 3BN6A 1QJU3 4Y1YA 4L2NA 1NQDA 3RZMA 4NJ4A 1V6IA 4M4PA 1WZXA 3WNKA 4H14A 3ZXGA 2XQRA 3VDDC 4FSJA 3K4AA 1PZ7A 1J3RA 4Z1VA 5L19A 2ZPXA 5CISA 2EXKA 2P3IA 3URFA 2PQQA 2GP3A 4HKOA 1REFA 3ZFEB 2HWE2 4NRPA 4EWAA 2DCZA 4O9EA 2I45A 1LHNA 5JZGA 3RZGA 2GNMA 4IEWA 4BB3A 5F9TA 2OIIA 4CP9A 3B93A 4DXZA 2C1FA 1PZ8A 4B1LA 4JKKA 4LIUA 1O3SA 3TRSB 1NCQB 1OUXA 5CFCA 1WW7A 1FATA 1H4HA 2QFEA 3QH6A 4GALA 1FNYA 5DMYA 1QJY2 1YFYA 4UW4A 1NCRB 1X9TA 4FPJA 1H1IA 1S0DA 3UETA 1AYM2 3N36A 3PVBB 3Q8CA 2W46A 1S2BA 2B42B 4GIQA 2DCJA 4NWWA 3OBAA 2ERFA 3POEA 5FTTC 2P3JA 4D6RA 1UZVA 3EMRA 5FY7A 1CJPA 5JSOA 1DGWX 2JDMA 1SPPB 2A3XA 1Q3EA 1JZ5A 4UFLA 4BOWA 3OGRA 4QQLA 3GZEA 5L9RA 3AKTA 5KHIA 1D4M1 1HQLA 4YW5A 1CX4A 5HI0A 5JOXA 3VDDA 1XU1A 2ARXA 1OD3A 3R0RA 4QX5A 4WVMB 1HDKA 1JUHA 2ZGQA 1NXD1 4K8RB 2A70A 1JYTA 5GLWA 3WZ1A 1GUIA 1CAVA 3NKGA 3E6CC 3RZJA 2WZR2 1RMU1 5FMBA 4JKLA 4A3XA 4RFT0 4E2SA 2PYTA 1DFQA 5FO8B 1FV3A 2DVBA 2CGNA 5A32B 3VGIA 1EV12 2D93A 4BXSV 3AMPA 2E51A 1ZZBA 3CNAA 3KQ4B 5AVAA 3PUSA 4FQZA 5FAXA 4PLOA 3T2OA 2Y8KA 2HWB3 2VQUA 2B5HA 5FYVA 3WLUA 4I01A 2YC0A 4WM8A 2RS51 4X8NA 1VBA1 1HB1A 4FXKB 4WVWA 5D21A 3O1RA 2FZ1A 1ULOA 1BK0A 3ZXDA 1YNAA 4OVEA 4QD2A 3ZYJB 3K46A 5FZ0A 2CDPA 2V73A 4QPGA 2ZX4A 2CWMA 5A3OA 3VN4A 1RUF1 4JTOA 4HFSA 5F6KA 1ZA7A 1KITA 3B3QE 1JS9A 1MVEA 3AMQA 1CIWA 2XUMA 3GXUA 3JBG3 3LSDA 4HPKA 4MUVA 2Q1FA 3T4HB 3VZLA 1QGLA 3POYA 4OMCA 1VBC1 5I0RA 3D0SA 4CCLA 2RG4A 1PVXA 1OXCA 3TNPB 3T0BA 3HN1A 2FCVA 1N1YA 3MPPG 2VU9A 1KEXA 4IEYA 3BKZA 3N7LA 1QXPA 3JZVA 4TXWA 3THPA 1EUTA 3BU7A 1AR91 3O12A 1ENXA 4MGTA 4XBLA 4LO7A 3H8XA 3SCFA 3B00A 1OKQA 4E4HA 3LFIA 1V6JA 3CLPA 4JTNA 2L9LA 1J3PA 1W28A 4IEPA 1WGPA 4HN0A 5B4XA 1W6MB 1ENRA 5FY0A 4JDOA 1V70A 2PHDA 1PGSA 3I2GA 4LHSA 5FYIA 5FUPA 3SEEA 3OPZA 5DUVA 4XZUG 4AI8A 4DUWA 1AL23 3MUZ1 1HLCA 5C4WB 1KDMA 4D0QA 2XBO3 2C9AA 2CSGA 3UKNA 1EY2A 4AQTA 3VZMA 4OHVA 5JAXA 3ZSKA 4BE3A 2JXAA 1LHVA 1JW6A 1MS0A 3O1TA 4MYEA 3NJVA 4MHRA 5DPNA 1VBD1 2PN5A 3CDZB 3D3AA 4WM7B 1JZ8A 4HOOA 1RITA 3ZFGC 3D82A 1SEFA 1QJEA 1UL9A 2Z79A 4Y1XA 1AR71 2CL2A 2GU9A 4Q0PA 2RJKA 4MXWB 1C8M3 1D4VB 3WHTA 2CGPA 4XUPA 3GGLA 2VW0A 4XUTA 4IDZA 3N7KA 3HAGA 1UPSA 5FZEA 4F8AA 5FDBA 1BMV2 3MEPA 2P1BA 4YG3A 4O65A 1IPJA 3POGA 4CCOA 3MIHA 3NV3A 2IVIB 4HSLA 4HONA 3RPQA 3SXWA 3N4MA 4C90A 5CKNA 1CZTA 3LA3A 4JDMA 3AZYA 2VOWA 1ODMA 3CJIA 3LIHA 3CU7A 3I49A 3Q8BA 3SKJE 1YRZA 3UJQA 5FZ8A 2Q8CA 3I59A 2HYXA 1NA1A 4YGBA 1RXFA 3SEPA 1XSRA 4FXGB 2Y6HA 4XVHA 5E88A 2XJRA 4FCAA 2BV4A 1Y9MA 1LHUA 2JX9A 4QKFA 5FV3A 1YWKA 1W6NA 1WMFA 2BVBA 3EJKA 1A6CA 4L8QA 3ZSEA 3I2OA 2DFBA 3RWKX 3VL8A 2LROA 4AE2A 1X8EA 2ZTNA 1OLRA 4JGZC 1EAH2 2DUOA 4RS5A 2VOKA 1RMU2 4LBMA 4PI2A 4XJ9A 3USUB 3IDAA 2P6CA 3SCHA 2F4PA 3LE0A 2WA4A 5SV5A 3ELNA 3PNAA 4AEDA 5FPAA 5FOJB 3PJYA 2IUWA 3JB4C 3U4SA 1G9AA 1CZSA 1BK1A 1MS1A 3KF3A 1RUH2 4ATEA 5JIAA 3UNPA 3O1VA 4CPBD 1OLQA 3E1F1 4QX7A 1SLLA 1WMDA 3POWA 4M3CF 1OOPA 3RJRA 2BYVE 1W8ZA 3ACGA 5JSRA 2RMU2 4Z82A 3C7HA 4NE9A 4BXFA 1QJX3 1PHMA 4GB32 3JUUA 4BIOA 1K3IA 3N7JA 4K8FA 5FJKA 3U10A 3AMMA 2R32A 3LSEA 1DLLA 3QOPA 4Y5TA 4YYOA 1H8VA 4KU8A 3VKLA 2VTXJ 1ND3B 1O4TA 2G19A 3AP7A 5JOYA 2HWC3 5T5OA 3VZJA 4YM1A 2XJTA 3VBFB 4FOYA 2BDRA 1H9WA 1DYKA 3ZN6B 4LO8A 1WA4A 3GJBA 4MGIE 2ET7A 2RV9A 1BBT1 3RWNA 4TN7A 1UY2A 2VMCA 1D0HA 4UFKA 4YG0A 3T1MA 2YFZA 4RS5C 5FJHA 4Z07A 2WNEA 4ZU4A 3ZOIA 3OEBA 1AR92 2XKOA 2D6OX 2E26A 1D4M3 1WBFA 4RGGA 5GLUA 1D7PM 5H9PA 3ZIXA 1HKDA 3TNQA 3BU0A 2WA3A 4RHV2 3KHBA 1R1ZA 5K0UA 1U5IA 2OA2A 5GLVA 1W99A 5CFDC 4P5HA 1SBFA 1GWLA 4A7YA 2YFUA 4FAGA 4CDWA 3DYMA 1C5IA 4FOVA 2RDNA 4UFHA 1XNBA 2VUAA 2Q8EA 3VBSA 1E5RA 5DAXA 5HPOA 1DQ6A 5IFPA 2VZQA 5EYXA 2IXCA 3R05A 5TSWA 4IE7A 5LA9A 4V2WA 4DEQA 5AC91 4C8DA 4N90A 4A41A 5CBLA 2R043 4P02B 2UY9A 4W8JA 4IESA 4QX0A 2D5FA 2XL7A 3CO2A 2DBIA 1QQP2 1RL3A 3VD4A 3WD5A 4DB5A 1AYN2 3DPRA 3ZSLA 3KV5A 2W0XA 4PCRA 3VZOA 2PAEA 2AR6A 4D69A 1E5HA 4UFIA 3ZM8A 2HJIA 1WCQA 5CFCB 3H7JA 1UW8A 4FPFA 2WO3A 4MSVA 1F4HA 2D6LX 1O7FA 1Q8OA 3TN92 1QDOA 5DG1A 4D6SA 3VD9A 1AYM3 4Y3OA 2JEMA 2VULA 2R0HA 3C8XA 4R9CA 1NLQA 2A6ZA 2V4VA 3WQ0A 4XFCA 5BUVA 4KL1A 5IFTA 4OLLA 5EJ1B 2VNVA 3ZR6A 3D8CA 1LTEA 2ZZJA 2GNDA 1UMZA 3GF6A 2MEV2 2BNNA 4QM9A 4JHTA 1CAUB 2VVFA 5FMCA 1HQNA 1NCQC 1HJFA 3I2HA 2QBXA 1E57A 1SLTA 4GAZA 1BJQA 2ZJCA 5BNNA 1AR83 1WW6A 1ND3A 2XQXA 4TLFA 3VUOA 2OPWA 4META 3KD4A 3SKVA 1W6OA 4CVUA 2GMEA 1UZYA 1YEWA 4XEZA 4I0WB 4Q0QA 2XDVA 4QPWA 1POV1 1JHNA 1CAVB 3PIGA 2QZ2A 3K51A 4BQWA 4H7LA 3TOJA 2YDEA 1SFYA 2GH8A 2XBO2 1ZZ8A 5FYBA 4Q4V1 3GDBA 3VBRB 5BNPB 4I2OA 1UOJA 3EBRA 2ZX1A 2BFUL 1O91A 2WZ8A 2XJQA 4D3WA 1F4AA 1PO21 4K3UA 1RUC3 3I4IA 1RUF2 2HYKA 4Y4YA 1VP6A 4AHXA 2VCMA 3N3HA 1YXWA 5CKMA 5C3RA 5I0UA 3UKVA 4LBJA 2VVDA 2HWE3 3R4UA 2HEVF 2FCTA 1O3RA 4RGKA 5JOZA 1QH7A 2VUCA 3T2PA 5FIXA 4XBQA 3RMXA 4FPCA 4QPGB 5JXIA 3ROUA 4A3ZA 2VOXA 1CWPA 5L7OC 5T5LA 4HVQA 4XUNA 2HWD2 4QGLA 4AI2A 5LA0A 1A34A 2X5IC 4Q4W1 4YZ5A 3BTXA 1S0CA 4NIHA 4CDUB 2BRTA 4YZ4A 1H6XA 5JXHA 4AEJA 4LK6A 2RR12 4A7ZA 3LKJA 2H6BA 3OJBA 2X10A 4QQ2A 4AHZA 3BALA 1W6QA 1R083 1S0JA 2E7TA 4QM8A 5DAPA 3V0AA 3M3QA 1GFF2 1LGCA 3BTAA 4IXLA 1YYNA 1BEV3 3DPRB 2G9ZA 4DRRA 3GCWA 2NMOA 1CZVA 1POQA 4XF3A 2O14A 2XJSA 3PL0A 4LMFA 2ORXA 5FK7A 5JXJA 2W5FA 3R4DB 2PELA 2Q5TA 2EXHA 3AMNA 1Z7S1 2HBTA 4IQPA 4NAOA 5IJRA 5IVBA 4RGAA 3H3LA 2F17A 4IV1A 2A71A 2GC2A 2IC1A 3ORJA 1LCLA 4IETA 5IAVA 2HH9A 1RMU3 5LB6A 5IVCA 2GMMA 5CFCC 1KFUL 5A3LA 2HWC2 4WM7C 2RE9A 1FOD3 3UYJA 1JODA 1YIPA 4QGNA 4CRQA 3QACA 4CXYA 1XSQA 2WO1A 2J1RA 1GYKA 3KT1A 1PM4A 1YLLA 2VXJA 3WG4A 5CVRA 1V6MA 3LIGA 5FXWA 3KF5A 5FP8A 4AVCA 2A1XA 2TNFA 1Y7BA 1J3QA 2C6SA 3LWCA 5L7OA 2YU1A 2J1AA 4AGRA 2B9UA 5A7NA 5C70A 1ACCA 1HXS1 2VZ1A 3DN7A 3NMBA 1JYNA 1DQ0A 5FYZA 1PMJX 4FP3A 1DGRN 4CUAA 4GWIA 1QWRA 1X9PA 4QB1A 5ACA2 1RIRA 1TE1B 2VOVA 3HBZA 1W8UA 4QU1A 4ZKTB 3HNYM 2NM1A 3NW4A 2AH2A 1ENSA 3K75B 3K48A 2XVLA 2GNBA 1RVF3 4S2GA 4CU9A 5FPUA 4LULA 3CQOA 1IKQA 1UF2C 1RTVA 4ONUA 3RMYA 3AP9A 1O3QA 5T3NA 3I2DA 4M3CB 3SH4A 1OVSA 5F5CA 1MEC1 1FPN3 1QKQA 2VZTA 2ZMLA 1Y9QA 2BFUS 1SDWA 2R061 5E1RA 2W3JA 4DFSA 4JRLA 5L9VA 3I2KA 1MZ6A 1V9U3 1PMHX 3AC0A 5IK4A 1IOAA 3IIIA 4O9GA 4UF0B 3TBDA 4TZDA 1SLBA 2RM23 2TUNA 4YVWB 2IVJA 1CN1A 3POBA 3ENRA 1CD3G 5GKAC 1STMA 1F5FA 4OZOA 1ZBA2 2Q30A 3WY6A 3ETQA 4GKXA 4MGYE 3IPVA 5ACA3 1B35C 3O0XA 2D3SA 4G9SB 3EO6A 1UD1A 4MHUA 2ZEZA 1C8M2 2Q1MA 3OD4A 1F5JA 2Q0AA 3KS7A 5A7WA 4OI2A 3NAPB 1T2XA 4XIOA 3S30A 5LA1A 3KVBA 3EHKA 3JD73 3NRUA 4RHV1 3PDQA 1W9FA 4TYSA 2VE1A 4J1XA 2Y6LA 4BZ4A 1QJFA 2Z42A 4XXAA 5FPLA 1GQGA 1Q8VA 2IFWA 5FWJA 2CGOA 3BOPA 4BK5A 4GH4A 4QQHA 4RQPC 1XNTA 4FFHA 1CONA 3LEIA 2D6NA 4QPIC 1YJLA 3VKOA 4DXSA 5CIRA 3WOGA 5F37A 5A3NA 3WNOA 1V6NA 3H1YA 1ZRFA 1NA1B 2VMHA 2XL9A 5A6ZA 2XMLA 2UYAA 5ACA1 2WFPA 4QXCA 3W5MA 1CVNA 3GZUC 4Q4Y3 1TVGA 1IG0A 1SCRA 4JQRA 5K9YA 3KM5A 4YPJA 2LALA 3ZYIB 3AB0A 4CCDA 3O14A 4F7ZA 3TEYA 1W6NB 4C91A 2WLQA 4DUVA 1F9KA 4NPMA 4XC9A 5EWSA 2VJXA 2YROA 5JLVA 1XYNA 1VBD2 4QXKA 3WUCA 1Q43A 1R092 2X29A 3ZYPA 2R042 4OHZA 4HSJA 1V9U1 1W2UA 1X82A 4I0AA 4FAHA 3W58A 5D2AA 1SQ4A 4O61A 3LCPA 2CAVA 2YBSA 4G4FA 2ARBA 2HLEA 2AREA 4Q29A 5FLIA 3U11A 4AEDB 4AXOA 3W5NA 1W03A 2EIEA 3W21A 4UOJA 3B5LB 2O8OA 4LBQD 3OY8A 3WG3A 4ASMB 2JG8B 4DIQA 2Q8DA 1JOPA 2W39A 2KA3A 3CHXA 3A0NA 4BYYA 5FZBA 3JBG2 5F5IA 1JOJA 4MGZE 4RQPA 1BXHA 3NNMA 2XLFA 2VW1A 3RZHA 2HWD1 1C8NA 2JDAA 2WIIB 4MVTA 5IK8A 1DP0A 1PVC3 2JDZA 2QQWA 1W6PA 1VBA3 4FOWA 3MGUA 4LBOA 4PF5A 5LY2A 3VBFA 1AR93 4M4RA 2RR11 2BWCA 2YC4A 4FFGA 4JCKA 2AENA 3KLSA 4P08A 3SISA 4AFBA 2WABA 3UGHA 3VBRC 2WWUA 2PQSA 4DQAA 2WAAA 4YW6A 3FJSA 1MS3A 2WDBA 3DXUA 4BQ3A 4GA9A 1ZRDA 2Y26A 2JDYA 1PX3A 1WCUA 4HBNA 3ST7A 1YHFA 1HRI3 3MW4A 4AF9A 1NA1C 5DAWA 5FXXA 4ES9A 1EAH1 4A7KA 2W95A 4JGZB 4Y24A 4LO5B 1YQCA 1JYVA 2VMGA 2XGXA 3OBZA 1K5MA 1SZBA 5FY5A 3E6BA 1NCRC 3S7IA 5FBJA 3WDTA 2YPJA 1BCXA 2I07B 4PIXA 1DQ5A 5C8CC 3LDBA 1QQP1 3OBTA 5L36A 3Q8EA 2WUHA 4LJHA 4CYDA 4Z92B 3NJYA 4CEYB 3I2JA 3I97A 2ZXQA 4NAMA 3J26N 4XFHA 5DDJ3 3T08A 3ZXFA 2GN3A 4NIGA 1H6YA 1EAH3 5FMDA 1J83A 3LDKA 1UKGA 1OOPC 1UXZA 4OI0A 1GKBA 2WS92 3UKTA 5IVJA 4N53B 2D43A 3AZZA 1W8NA 4Z2WA 1VPHA 4DEVA 4ZZ8A 1XU2A 3MF9A 4QPIB 5JOWA 1QXRA 3ECQA 4S2HA 1QY4A 1PO22 1DQ2A 2MEV1 4IEXA 3INAA 5LW9A 1LKNA 2QNKA 3D6EA 2XR4A 1KD7A 5EP9A 5BNPA 2E7AA 2A75A 2XONA 4OUEA 5J1XA 2Q8OA 4XOGA 1QF3A 3N9OA 3FUQA 2HBUA 4P9WA 3POJA 3U0ZA 3M1HA 1ONAA 5FZAA 2DBNA 5GALA 2DCTA 3JXSA 1CJDA 1H8TA 4HK9A 4AEKA 4ET7A 2R1BA 5C4WA 1LR5A 4I3GA 4S2DA 3QH7A 1MEC2 5IVEA 1G6NA 1V0AA 2C5DA 5C3OA 1XBFA 4AVBA 2WL1A 4W6YA 4BQYA 1PO12 3OGJA 2A5ZA 2BOJA 3THTA 2BTVC 1NKGA 2V5YA 3GYDA 4XUQA 4E4SA 4X8PA 1J58A 4M0HA 1PGW2 3CJIB 4BQ4A 1YFWA 1GWMA 4Q0VA 5A3TA 5A6QA 2FDGA 3LOIA 3GBWA 3PUAA 2DF7A 3I2FA 5DZFA 2MPFA 3GZAA 1TG7A 3L2HA 4P5YA 1AR82 1LOEA 5FYUA 1WWYA 1DQ4A 1JZ2A 5HCHA 4MGKE 1XQNA 2PAMA 2X09A 3VD3A 3S5AA 2P5BA 3ZMOA 1MS5A 3O1MA 4PJYA 3AZWA 3OD0A 4TLGA 5KC6A 1ZX5A 5F7UA 1W6QB 5LK5A 3MDPA 2R0FA 1W0OA 5M0TA 5FYTA 3ZXKA 1KQRA 1RUJ3 1NXMA 1UOGA 1VRH1 2NYYA 4N9HA 1K5JA 1MS9A 4LQRA 1Q8SA 5CEHA 1SG3A 2HWC1 4EN9B 1H2LA 1XXNA 5FY4A 4AVSA 1A8DA 4XQDA 5I8YA 1GP4A 3THCA 4QX2A 3IAPA 1US3A 3BCWA 2W92A 3R4SA 5LY1A 2F4LA 2ZGPA 3NNFA 4R4ZA 4KGQA 5FZ4A 2DFCA 3OSDA 5FZKA 3JBG1 5C3PA 5F2SA 3WINE 5IK5A 1AYM1 2E32A 5K4LA 5T50A 4BWOA 2EAAA 3ACHA 3KSCA 3KHCA 3VLBB 3TEWA 5IK7A 4CCCA 1PM7A 4D94A 4O7XA 2UWCA 4CCNA 3U4XA 3POSA 4EV0A 1XE7A 5K0UC 2ZKNA 5G05L 2CNAA 3O5SA 5L7OB 3MV11 4L99A 2QQJA 4E2GA 1X50A 1RUNA 1SFPA 3OF1A 3OEAA 5HCAA 2OZJA 4ZS2A 2E6VA 4R9AA 1LJ7A 3E6DA 5FP3A 1GOGA 1DG6A 3HNBM 1X36A 1NCQA 2VQ0A 2GDFA 4FTEA 2WFF1 3BVCA 4BLIA 4GJYA 4LUKA 1WCDJ 4IV1B 4QHOA 4EZHA 3MIGA 1ZNPA 1KJLA 2UWAA 3POFA 3PU8A 3ZKUA 1R1A2 3J9SA 3QCWA 3AVRA 1WD3A 2ZZQA 3DPRC 4YVSB 3M3OA 4XQWA 3KGLA 1RJ8A 4HVRA 4NROA 1DIWA 1L7RA 4DPNA 2DWRA 3K4ZA 3T09A 1OC1A 4Q4X1 3VBUA 3B7MA 3FN9A 2Y34A 5HCBA 3IAQA 2F6BA 1SACA 1XNAA 4NIIA 3RRDA 3ZXAC 3M3IA 4UF0A 3BTYA 4ZHNA 1LOGA 3L2YA 3LPFA 4XFAA 2W52A 1HW5A 1U5ZA 2RMU3 1G86A 3C7GA 2MNGA 4GMP1 4BQ2A 4CUBA 3Q9OA 2BERA 4QHZA 2BJSA 1UYPA 2AACA 1NZCA 1G9DA 2J1EA 3QLQA 2PA7A 1HV0A 3H50A 5I91A 1MZEA 3AYEA 1ZZ6A 2R30A 2YC2A 5A32A 2WR9A 5A7OA 2YPDA 3I8TA 4FFFA 1AXKA 3MIEA 5DAQA 3H1WA 4BU2A 1UZZA 5BNNC 2DCKA 2LS6A 2EXIA 3RGBA 3A4UA 4Q0SA 1NQJA 1YFXA 1ZBA1 3DXTA 2A6YA 3KB5A 4CDWB 3N9NA 2JIJA 1W8WA 4JC1A 2ENRA 4AGGA 2KD7A 2D40A 4DXTA 2A3YA 5FP9A 4IV3B 1RUI2 5F8PA 1BZWA 4C1WA 2JDUA 1C8M1 2OUHA 4AQ6A 4GWNA 3FLPA 5IWFA 3ON7A 1GSLA 2WO7A 1AJOA 4OHWA 3GCXA 3PUHA 2OKXA 3HWJA 2BW8A 4M00A 4P9IA 3PUIA 4Q8LA 5AVPA 4NRMA 4XJAA 2B46X 2CY6A 4PBOA 3VKMA 2BGPA 2QQLA 3WP4A 4CUCA 1O4YA 4KWLA 5DZEA 1XE0A 1ZBA3 1LECA 1O8PA 1UNBA 3JD72 4OZXA 3HOBA 1P8JA 4R4XA 3PIJA 3UL2A 4EWDA 4IE6A 5FZCA 2FBEA 3WQ7A 4WM7A 2JG8C 5A7WB 4OUSA 3NAPA 3U07A 5FQ0B 3ABZA 4BIFA 2PXJA 5A3MA 3HT2A 3DKWA 2G1MA 4Q1PA 4GWMA 4BM8A 5ANNA 3A0KA 1LAJA 5D8AB 1HX6A 3AZXA 4IGOA 1U5XA 1GANA 4J1WA 3VHPA 3WDWA 2NLRA 4K1ZA 1O3TA 1KFXL 4LE4A 3PJQA 4CDXB 3WG2A 1VB2A 3ZYFA 2GZWA 2RM22 3M8LA 3O7OA 2P34A 5T55A 1CAUA 3OPTA 1HN0A 1NZIA 5FPVA 5A33A 4A45A 3ZXJA 5FZ9A 3FE5A 3AYCA 1DBNA 2D5HA 1RC6A 2LW8A 4INDA 2R073 4LT5A 4N53C 3FBMA 5DUXA 3SHRA 5FYYA 4M0NA 4OFGA 5CAZA 5F5AA 1D4M2 2IFRA 3WR0A 4A6SA 2R7EB 4XJWA 1W6PB 1W9WA 3H42B 2Y6FA 1UN1A 4K9SA 1BBT3 3NL1A 2HKXA 1GOFA 1RUE1 1YQ6A 1UOFA 1F35A 4PDWA 4QKDA 4Y1VA 5JXGA 3ZYRA 5FWEA 1VR3A 2VM9A 1UU6A 2D44A 4XCBA 1ZRRA 4EE2A 2BP6A 4E27A 4E4ZA 1ZZ7A 4LNVA 4YSFA 2BQPA 3QBQA 1FI2A 1UQXA 1TMF3 3OY8B 2BEOA 2JG8A 4LBNA 2XUEA 3IBMA 2JICA 4UW5A 5FZMA 1UXXX 3NKTA 1GP5A 1I9RA 1H2MA 4XMAA 5GZCA 3PMEA 4RS5B 4LBKA 4MZUA 4BQ5A 3NVCA 1V6LA 2RS52 4KQ7A 1U12A 3N9PA 1YIFA 1AHSA 1GZWA 1OPOA 5FUNA 1EV13 1ASJ2 4CPBA 5T54A 4B4RA 4OCTA 1RYYA 1WA6X 5CU1A 4AI0A 1ZBE2 3PVNA 4QXHA 3Q8FA 5F32A 5FZFA 2VAUA 2QUOA 3CZJA 3I3EA 1BHGA 1GWKA 2JIGA 3M3CA 2AEZA 2RDQA 4HKWA 2GC3A 1ZYBA 1BBT2 1Z7S3 1F31A 1KJRA 1RUH1 4NN0A 2W08A 1MPXA 2J42A 5KXEA 1PIV3 3WSOA 2QQNA 2B39A 5A7QA 3PTYA 1Y3TA 1H9PA 5E8AA 2CWSA 2PHUA 4GH4C 1UPIA 1OVPA 5IATA 2E63A 1GV9A 1LU1A 5JZGC 2Y0OA 4B3NA 1LGNA 4FTSA 1VBB1 4XTMA 1OA2A 2WNVB 2VZVA 3KVAA 2JE8A 5FZ7A 3ZN6A 2QQPA 3USUA 2P2KA 2UWBA 1EPZA 2ZACA 3VBHC 5C9AA 1GBGA 4YNIA 3CBNA 3OTFA 4JAAA 2VZPA 1AUYA 2ZHMA 3A21A 2Y38A 3OYWB 3WX5A 5KWRA 3O1OA 2P17A 3NO8A 1AX2A 1EP0A 3ATGA 5BNOB 4ZONA 1B35A 4HANA 4LUMA 1AR73 1YQ2A 4AR2A 3NQHA 1AX1A 1OBNA 2E9QA 4IEZA 4J6GA 1RVF1 1W2OA 4IE0A 4UAPA 1PGL1 4X6QB 5BPXA 1GQHA 2AZ5A 1OD5A 1VBB3 3ZKYA 3ES1A 2XPJA 1OFNA 2GNTA 4PI0A 3AXDA 1HJGA 1UYYA 2E31A 4XHBA 4K21A 5EHDA 1DLCA 3AL5A 1MS4A 3J7LA 3ZN5A 2HWF1 1OA4A 2GALA 4QPIA 2JE7A 5APAA 1I5PA 4Q4V3 1NE6A 2FMYA 4B1MA 2SBAA 2JENA 3HBKA 1LOFA 1N1TA 3WDYA 4AOCA 4LK7A 4LLFA 4D8MA 4GB31 1QNWA 1Q5OA 3LFMA 3PUQA 4A6OA 4LTAA 3ACIA 1O4ZA 3VBHA 4GULA 1SBDA 1WCSA 3H7YA 4NPRA 2FDIA 1IS5A 4XDPA 2PHWA 1N3QA 1VBC3 4E8CA 2WAOA 3IMMA 1BQPA 1UYZA 2D6KA 5LBEA 2RMU1 1VBB2 2W68A 1GZWB 4EYUA 5FZ3A 3OCPA 2RM21 4W50A 1L7QA 4IE5A 2J7MA 1W2AX 3G7DA 3UV9A 5JR2A 3BI3A 3ZFGB 3WF1A 2VNOA 3IZOA 3H8UA 2OYZA 4DS0A 1KS4A 1LOBA 5FPXA 3RZLA 1NE4A 2A73B 4XAAA 4X6RB 3ZLIA 1TNRA 1GZTA 4CP2A 4D6QA 5EIYB 1W05A 1HRI2 4UFMA 3MIBA 1Z78A 5C8CA 3AP6A 4G3YC 1MQTB 2GMPA 3E5XA 4MLOA 4QDRA 3DGTA 4F83A 5C5UA 3BGAA 3KCYA 2RS13 1URXA 1CAXA 3RZKA 4DMIA 3JD71 4RHV3 4L11A 2VMFA 1IS4A 1LULA 2RS33 1LOFC 4CDQB 4AQ2A 2HWD3 5FXZA 3AJYA 4DRVA 1QJU1 1HIXA 3CZUA 1O5UA 3HQRA 1UKRA 3O0VA 3VHRA 5C9AB 5FRAA 3ZPYA 5BYNA 2XVKA 5J7MA 4JGYB 2VQTA 4JGYC 1PK6B 3WW3A 4BDVB 2J1UA 2JKBA 4IV3C 3VBRA 5BY5A 4M3CE 4TTGA 4BMBA 1X7NA 3I7DA 4DNYA 4RD7A 1NAEA 4AL9A 4MGQA 4EQVA 1C57A 3LA2A 1GZCA 4FTBA 2W1QA 3K77A 2QE3A 4CCJA 4XF1A 2K9ZA 1U5YA 3H3ZA 1PX4A 1QJX2 4GB33 4S2FA 3ITQA 4CDXA 4COUA 3JB8A 1OI6A 2HEYF 4NHXA 4XBNA 1C3HA 1W06A 1XOYA 2Y60A 4AZZA 4CU6A 1K5MC 2R072 1RUJ1 3DF0A 3HR9A 4U36A 1N1SA 5IAXA 4I0BA 4JVAA 4SBVA 5EJ3A 5FKCA 1PGW1 1JI6A 1OMIA 2R49A 1UX7A 4XFFA 2Q1ZB 5LA2A 3VZKA 3VBOA 4L92A 4CCEA 2YUEA 3H1MA 2FDFA 3UGGA 4AFMA 2YGMA 3WUDA 2JD4A 1XPWA 3KZ4C 2FCUA 2BNMA 1O5LA 2WJSA 4Q27A 4D7TA 4C1XA 2VBPA 3HNMA 3FHQA 5FZDA 3BIWE 2JE9A 4K20A 2WO2A 5ISLA 2VPVA 4Q5OA 1COV3 1ND2A 4QX3A 3MZHA 1G7YA 2RS11 2WC2A 4D7YA 2VCBA 1O6UA 3AX4A 2Z2SB 1MR5A 1X33A 5G04L 3ZVXA 1X8MA 5FK8A 4XPVA 1HXS3 4R52A 2YMZA 4HETA 3H0OA 1FYUA 1OUSA 2FHRA 4LO6B 1DZTA 3VHNA 3WT3A 5HBAA 3DKQA 5FZHA 1W9YA 3RZZA 2HEWF 5F3IA 4PF1A 1MQTC 2ZGNA 3WVJA 1R082 3LQCA 2C0ZA 4XJUA 3ES4A 1JYXA 4E2QA 3PLQA 4LKFA 5FYHA 3N9MA 1KS5A 1ALYA 4YZ2A 1I6XA 1H8TC 4AFCA 2VCAA 4RFRB 5JSPA 3MIFA 4QWNA 4Y5Z0 4OUMA 1DGWA 2IWGB 4E9KA 4K6BA 1UWWA 3B01A 3I3QA 5CNAA 3FHAA 5GJ6A 1FPN1 1QJX1 5F6LB 5C8WA 4JGZA 2C9KA 3N35A 1QNYA 2XXZA 3BB6A 4CEYC 1N3PA 2A6XA 5JPNB 2P4EA 5JZGB 1ULDA 2OQ6A 2OS2A 1DF0A 2PHXA 1BKZA 4CP9B 4B4PA 4FPYA 2Y33A 3V0BA 2XLGA 1VJ2A 3G6JB 1EUUA 2PTMA 4WBBA 3WG1A 1OH4A 4MO3M 1VRH2 5D8AA 2A7AA 2DURA 2PAKA 2V72A 1AXYA 1OQ1A 2DVGA 4M01A 2JB8A 3VV1A 1OOPB 2VECA 3D4KA 3KV9A 2ETEA 1RUOA 4QU2A 4ASLA 3T0DA 2WKKA 1H1AA 2J22A 4LXLA 1EPWA 3WNXA 1SLIA 2GH2A 1Y4WA
chains in the Genus database with same CATH topology
2BUKA 1TME2 2QKDA 1RUE2 2BVVA 1RVF2 2P37A 4KG0A 1NY71 4Q2FA 3AFGA 4CDXB 1WLCA 4ES9A 4EN6B 4RR3B 5H9SA 1U0AA 2D6PA 4Q4X2 4N7UA 1XRUA 2N7GA 3OGGA 3IIAA 1OPMA 2NN8A 4AVAA 1RUC1 5EV7A 4FP2A 5K7PA 4Q1RA 1KRIA 3JU9A 4YVWA 2G4IA 5FQ0A 5GZGA 2ATFA 4FPLA 3VBUC 5FBZA 4LBLA 2OW4A 2IXKA 4AWDA 2VXRA 4Q26A 1H1MA 5IUQA 5I8TA 2ZS6B 4ITCA 1PIV2 5LEKA 1ZBE1 1IQAA 3MW3A 2OVUA 1D0GA 5FO9B 1RHI1 4YZ3A 1RUG2 3SMHA 3ZXEA 4I30A 4XIKA 2JJ6A 3ILRA 2FQPA 2H0VA 1S55A 2V09A 3IDEA 2OUJA 2D97A 5FO7B 2RR13 3C2UA 3WHUA 1BEV1 4GH4B 2HWF2 5FLHA 3IMNA 5AFBA 4NHMA 1Z0HA 4AVTA 4N43B 4DY5A 4ES8A 2P3KA 2E7QA 3MF6A 4EN0A 3PVOA 4PLNA 4UW3A 5DXDA 4Y22A 3ZSMA 5JIUA 3NV4A 4TWTA 4UBGA 3KT7A 3CJXA 1DU3D 3EQEA 5KBFA 4XJ8A 4XF0A 4YVWC 5KHJA 3FUOA 3GHMA 2AYHA 2UY8A 4QQPA 5J3UA 4Q0UA 2VUJA 4BHPA 1SMVA 4DY3A 1R093 3KT4A 1Q56A 4H3WA 3FFZA 4AFAA 5F5QA 3MI8A 3OYWA 3KGZA 2MHFA 3ZO0B 3VL9A 5GZDA 1CAWB 2A6VA 4B7EA 5EFUA 3FMGA 2PLV3 5T5PA 3AP5A 1VAVA 1ULFA 3W59A 4OHYA 1RUJ2 1ZA4A 3AJZA 2YYOA 1HRI1 3NJZA 1Y43B 3NWKA 1RUD1 1KDKA 3MYXA 2X53S 3PVEA 4RR3A 3WP6A 4HMZA 3V56A 5BNNB 1ND3C 3FX3A 2BBVA 2EIGA 4AQSA 1A78A 2D3PA 3ASIA 2HWB2 3WDUA 4EN7B 1WUVA 2LUWA 4CTEA 2O0OA 1NLSA 4COZA 4AI3A 1VBE2 3M70A 4ISQA 4RSUA 1VLNA 4BLJA 4ZU7A 5DDJ1 3X29B 2WT0A 1B35B 1YFUA 1H2KA 1Q8PA 3RG0A 3RI9A 4IL7A 3V64A 4PDWC 4YARA 3TAYA 3ZX7A 4CEWB 3VBUB 1TQ5A 4MV2A 2EALA 1LODA 5FREA 3WDXA 1AR63 3TN93 1LOCA 3LGRA 1V9U2 3ZMNA 2WWSA 1C28A 5T52A 2YXSA 3ZSJA 1DGLA 4P14A 1IHMA 2VW2A 1COV2 4FPGA 3ZFFB 2BPA2 4P9LA 5C8CB 2ZGUA 2I2SA 2XH6A 4YW1A 1RHI3 3ZFEA 1PO13 1ZRCA 5CB7A 4AYUA 1FPN2 1DQ1A 3V0AB 2RS53 3IM0A 4Q4Y1 4AW7A 1AL22 2WZR1 5I8SA 1ULEA 2DVDA 1AL0G 2ZAAA 4CEWC 2RHPA 2WS93 1VAKA 1I1EA 2PLV2 1K5MB 1LU2A 5B2GB 4IV1C 3KMHA 4B7KA 1UCXA 4PBPA 4YM0A 1CAWA 2WNUC 3AKQA 1H8TB 1TME1 4YRDA 2JG9C 4FOQA 4GXLA 1QHDA 4FPKA 2VG9A 1IZ3A 3SNMA 2IXIA 4C0HA 2Y0IA 2H6CA 1CAXB 2PHTA 1R091 1S2KA 2CV6A 1KXGA 4HL0A 2QVSB 1QJY1 4R9BA 3VBOB 2NZ9A 3H3UA 2YZ4A 3HQXA 1GLHA 5J48A 2OPKA 5ABJC 1PK6A 2ZHLA 5H9RA 3IT8A 2WINB 4LE3A 1RUH3 3CEWA 5I0SA 4UBHA 3QD6A 2K2SA 1C4RA 1AXZA 5A33B 2EA7A 2PFWA 2R1DA 3RI8A 3RYRA 3O0WA 5J09A 4AK3A 1XNCA 1BYHA 2VH9A 4KG8A 1VBD3 5KXBA 1HRV3 3L9JT 4WM8B 4EN8B 1V6KA 2PHFA 2WZR3 3WW1A 5GZCA 4Y1UA 2Z69A 2IXJA 4KWJA 3WP5A 4IEVA 3FLTA 5K0UB 1S0EA 1RUE3 2WNUA 2QCSB 3VDDB 3FZ3A 5FCCA 1G9BA 4H55A 4EROA 4QPYA 3IPVB 3VZNA 5BNQA 1HQWA 1WBLA 1QOSA 5FLJA 1FNZA 1PIV1 3AM2A 3HMYA 1VBE1 4YG6A 4UW6A 3GBGA 4QT6A 2WQZC 3ZN4A 1IPKA 3J8F2 4C0BA 1UIJA 1J59A 1NLRA 2DU0A 4GMP0 1JXNA 1MACA 2QZ3A 3FHIB 3V0BB 1LOAA 2WT2A 3AYAA 5J96B 1NG0A 1N1VA 2UURA 4FVVA 2GSYA 2B7YA 4HZFA 3M4FA 3J4UH 4Q4W3 3MIDA 2MEV3 4XDQA 2R041 1POV0 3AYDA 3IWZA 5BNOA 5CA6A 1PO11 4NVPA 4RL7A 4HN1A 5J37A 5JPMB 4XJZA 2K0GA 1UU4A 2YGLA 2ZBJA 1R1A1 1COV1 2WS91 4IEQA 2WNVA 5FPZA 4GQ7A 1S1AA 2HWB1 3TB0A 3M2MA 4GKYA 2G9GA 4CDXC 5EZWA 4COVA 3AP4A 1CQ9A 2SLIA 3MLJA 4L97A 4LHNA 2A3WA 3D5OA 4LO4B 3PMSA 4YVSC 4IEOA 5DDJ2 1T6GC 4LLOA 4CDQC 5GLZA 4XHXA 4W6XA 1FOD1 4JDNA 3VBOC 4LR4A 1W6MA 3ME2A 2B45X 4Y20A 3W9AA 1ZVFA 1FMD1 1RUI3 3FLRA 2RS31 3J8F1 5BV6A 3AXEA 1POV3 2DVAA 2I74A 4IV3A 1LGBA 3VBFC 1RUG1 2WNUB 5H9QA 1BVP1 2WFF2 5IT6A 4Q8KA 3AMHA 3WV6A 1NOVA 1D2SA 2VNGA 1UX6A 1VAMA 1TMF1 2WSUA 1PVC2 1L3JA 1GR3A 1WLDA 2X5IA 4LA3A 1YI9A 5FMOS 1MQTA 4KH9A 3GNEA 5KHGA 2D7FA 1AL21 2ZGSA 1AYN1 3GBFA 2XG3A 1QMJA 1H4GA 1SCSA 5CBLA 3HT1A 2LTNA 3ILFA 4N9IA 2B8MA 5LK7B 2WT1A 1QH6A 4CDUC 4P9GA 2HWF3 2XVGA 2Z5WA 4CDQA 1PNFA 4AG4A 1APNA 4CEYA 4D7SA 3MFCA 5JCTA 4N7IA 3AFKA 4PLMA 4YW2A 3AZVA 1LHOA 4XFBA 3RYPA 4N43A 4R8HA 1H30A 2WFF3 3GALA 2PHLA 2E53A 1ND2C 3IDBB 5D8AC 1D2QA 1R081 3P3PA 3JQWA 1YO8A 2QDNA 1RUC2 2VMIA 3MICA 1H2NA 3B69A 3J8F3 1XYPA 1IS3A 4RA0A 5EYYA 3M3EA 2OZ6A 5BNPC 4B4QA 1LRHA 3WP3A 1JH5A 2Q4SA 5CFDB 3RJ2X 3BPZA 3I54A 4ORFA 3LB9A 1MZFA 2GAUA 4XETA 4K40A 3MW2A 1AR81 4LEJA 1A8MA 4B8EA 2DYCA 3WQ1A 5JMCA 2TBVA 5C6CA 3ILNA 4Y1ZA 4XE9A 1G8WA 3S7EA 1S0GA 5CG9A 1CPMA 2KXLA 4LHKA 4QQOA 1DZRA 1M06G 2ZGOA 3EXUA 1M4WA 3RS6A 1OQDA 5L73A 1JYIA 2GC1A 4PDWB 3LAGA 1AR62 4Q4W2 3S6PA 2TEPA 1RJ7A 3E5QA 1W39A 1XYOA 1WCKA 3RYKA 5I93A 3VKNA 1PMIA 1SLAA 4U2AA 1XNKA 4JRAA 5GZFA 4P9XA 3N7MA 2ZKLA 2ZGKA 2BGCA 2ZGLA 1J1TA 2DTWA 4DOUA 3TYJA 3AKPA 3T2TA 1FXZA 2A6WA 4HVOA 4NWVA 1BEV2 4R9DA 3NSTA 4HT1T 2PLV1 4MX3A 4UXAA 4ZXKA 1TNFA 2O1QA 3OBRA 3WCSA 1F8VA 3DL3A 2BNOA 4NR1A 1REDA 5I0TA 2NPIA 3LZZA 5J36A 1CPNA 3FC0A 3T1LA 2ES3A 2KM2A 1ASJ3 3SCGA 3B94A 2AGSA 1UU5A 1C1FA 1ULGA 5KXDA 5AFEA 3VKFC 4WM8C 4BMEA 1QQP3 4XFIA 4I02A 5SV8A 3S0MA 1GICA 1ULCA 3M7AA 4RR3C 2XHKA 3H9AA 4YFWA 4NO4A 2ZX0A 4YW4A 1UAIA 4PIZA 4DZGA 4V1PA 2ILMA 4QPGC 3CF6E 1DZQA 1EYBA 2UYBA 1WD4A 4YM2A 3V65A 4A2UA 2RS32 1I5ZA 3FFQA 2ZAHA 5ABJB 2XWBB 3APBA 1ZBE3 3MLKA 2CYFA 4Z8BA 1YCIA 1WMEA 2EVXA 1CESA 5CADA 2DV9A 4XQ4A 5GM0A 3TN91 4Q4V2 2DVFA 3NV2A 4AI1A 4MXWA 1S0IA 4YFZA 5EXOA 2JG9B 1PZ9A 1WLWA 2DU1A 3IN9A 5LRSA 2FMDA 4URTA 1AZDA 1F2NA 4XF9A 1BVVA 3DUIA 2ZX3A 4Y22B 1FMD3 1RUI1 4Y26A 4Q4Y2 1LEDA 2O8QA 1ZREA 1JTZX 4LBQA 1ASJ1 1YJKA 1WLTA 2ZOEB 5LRRA 1LHWA 1W0PA 1JN2P 4BCUA 2ZGTA 1NCRA 1DDLA 3IKWA 1RUF3 3B02A 3RSJA 3ZFGA 3C3VA 5FFOC 5JI7A 2WQ4A 3AK0A 1IKPA 4BA6A 4QMAA 5J98B 2GC0A 5HCFA 1RB8G 2BWAA 2XJVA 2ZHKA 1AYN3 5DG2A 4PQ9A 4YLZA 1LB2A 4FPHA 3ALQA 1J1LA 1TME3 5D1IA 4P9JA 1VBC2 2D6MA 1HRV1 1AR61 1FV2A 1REEA 4CP1A 4NHLA 2NQYA 3FWEA 2AUYA 2NMNA 5KC5A 3CJIC 4KNCA 4W65A 4CP0A 4KBBA 4XFGA 3WW2A 2ZABA 1QOOA 4OI1A 1AJKA 3ZFEC 4XYXA 4WZCA 4XILA 1LEMA 4NHKA 1MS8A 2YY1A 5ABJA 2DUQA 1PK6C 1XNDA 3HIFA 4IERA 4XF4A 5GZEA 5C4WC 3ZYGA 4CEWA 1S0BA 2XLAA 3AKRA 5JVVA 3SLIA 1H0BA 3AKSA 2VNRA 4OI4A 1GNZA 1FOD2 2H0BA 3GHNA 1G9FA 1YUDA 1EV11 1IS6A 1Z7S2 4FT8A 4W6WA 5KHHA 3PHMA 4WVMA 1ENQA 4WVVA 1FMD2 1AR72 2DTYA 3B9CA 2JG9A 1WW5A 2IXLA 4I09A 4F3JA 1GZ9A 1OA3A 4XMIA 4YGCA 1AVBA 4I3PA 4QHBA 5C33A 2R062 1YI7A 2R071 1ND2B 4YGEA 1R1A3 5K8SA 1PVC1 1OFSA 1OHFA 1TMF2 4Y20B 3MPBA 2ZGRA 4OHXA 4P9YA 1LESA 1SBEA 2YHJA 2ZA9A 1MVQA 3RNSA 1HXS2 3ZXLA 4EWEA 3RQ0A 4FBFA 3VBSB 4AHWA 2DCYA 2IZWA 1N3OA 4K1YA 3ZFFA 3UJOA 5DUUA 1V00A 3USSA 1LENA 3WW4A 4YZ1A 4AEMA 4HK8A 2EF6A 1N47A 1VBA2 5F1RA 2D98A 2X5IB 2ZX2A 4ISRA 4CZSA 2ZHNA 3ZIWA 4AEDC 1VRH3 2X8KA 1I3HA 4HPKB 4XW3A 2RS12 5JDBA 1G9CA 2XB6C 5HXVA 4Q4X3 5C9AC 2VQAA 1DGRA 4MXVA 1DYPA 1C1LA 2HWE1 4KGGA 3E5UA 5GLTA 5FOBB 1PGL2 1W6OB 1HV1A 4WVZA 4FPOB 2CAUA 4CDWC 2D3RA 1Q8QA 1WW4A 5LEJA 4MH0E 1QU0A 4YW3A 4HLTA 4E4DX 4AVVA 4WV8A 4ZU5A 1QJZA 4YVSA 1VB4A 2ET1A 1QOTA 4H7MA 3ZFFC 4NOTA 4AFDA 4K7JA 1OSGA 4OULA 4FQ4A 2YV8A 3ZDSA 5T5JA 1AX0A 1ZZCA 3GZTB 3I59B 4COYA 4WZFA 1RINA 5JI9A 5BNOC 4JV4A 5DUWA 4AHYA 1ZM1A 3LOBA 1JUIA 3FBYA 1DHKB 3R6SA 3KCXA 1FX5A 1IGOA 2R16A 1A3KA 5CFDA 1PO23 3JQXA 4HKLA 1SFNA 3VBHB 4BH9A 3SH5A 1OQEA 1RUD3 2WNVC 1FT9A 4ATFA 3MFAA 3LA7A 2RJLA 3UK9A 5CG8A 1VBE3 2XWJB 3VBSC 1FAYA 3NV1A 1C5HA 5KXCA 1JYCA 2PHRA 4QGMA 4RQPB 1QJY3 3BOWA 5DZGA 2VVEA 1QXJA 2JECA 3KCCA 5AC93 2R6QA 2XJUA 2WLPA 1XE8A 3IDCB 1CR7A 4BPZA 3D0JA 4CDUA 1B09A 2EAKA 2VGDA 4AGVA 1QJU2 2ZMKA 2XJPA 2ZGMA 1JBCA 5FMOL 4KU7A 1CGPA 4N43C 1S0FA 3CL1A 5KHKA 1RUD2 3VHOA 5JR7B 2XBO1 3BODA 3RDIA 4JGYA 3NAPC 4XZPA 1TEIA 4SLIA 3WXPA 1RUG3 4L9BA 4XTPA 1VIWB 1RGSA 4BQ1A 3KQRA 4LA2A 2UU8A 2VY0A 1ZZ9A 4YM3A 1V6OA 2ZMNA 3TWIA 2QDRA 1NY72 1GNHA 2ZCWA 4FPEA 2LM3A 4M3CA 3SH3A 4IEUA 5BXXA 3B9IA 5JWPA 3SITA 4EJRA 3DV8A 3HD8B 4XXPA 4N53A 5E16A 1HRV2 3MLLA 2EXJA 3ACLA 5E89A 1AF9A 3P3NA 1UIKA 3E97A 4KWKA 4TSVA 2WZPP 4COWA 1MZ5A 2G9FA 1NYWA 2GN7A 3WCRA 4PIYA 2XKPA 4DINB 1RHI2 1MEC3 2CTVA 2R063 2IXHA 4LHLA 4YGDA 4LBQB 1SLCA 2FZ2A 1VALA 2DUPA 5AC92 4B29A 1BMV1 3JCIA 3WDVA 2QJVA 1QDCA 2WSVA 4GMP3 4FO9A 1PNGA 1QJU3 4Y1YA 4L2NA 1NQDA 1V6IA 4H14A 3ZXGA 3VDDC 4FSJA 1PZ7A 1J3RA 4Z1VA 5L19A 2ZPXA 2EXKA 2P3IA 3URFA 2PQQA 4HKOA 1REFA 3ZFEB 2HWE2 4EWAA 2DCZA 4O9EA 2I45A 1LHNA 5JZGA 2GNMA 4IEWA 5F9TA 2OIIA 3B93A 4DXZA 2C1FA 1PZ8A 1O3SA 3TRSB 1NCQB 5CFCA 1WW7A 1FATA 1H4HA 2QFEA 3QH6A 4GALA 1FNYA 1QJY2 1YFYA 4UW4A 1NCRB 4FPJA 1H1IA 1S0DA 1AYM2 3N36A 3PVBB 1S2BA 2B42B 4GIQA 2DCJA 4NWWA 2ERFA 5FTTC 2P3JA 1CJPA 5JSOA 1DGWX 2A3XA 1Q3EA 4BOWA 4QQLA 3AKTA 5KHIA 1D4M1 1HQLA 4YW5A 1CX4A 5HI0A 5JOXA 3VDDA 1XU1A 2ARXA 3R0RA 4QX5A 4WVMB 1HDKA 1JUHA 2ZGQA 1NXD1 2A70A 5GLWA 3WZ1A 1CAVA 3NKGA 3E6CC 2WZR2 1RMU1 4A3XA 4RFT0 4E2SA 2PYTA 1DFQA 5FO8B 1FV3A 2DVBA 2CGNA 5A32B 3VGIA 1EV12 2D93A 3AMPA 2E51A 3CNAA 1ZZBA 5AVAA 4FQZA 5FAXA 4PLOA 2HWB3 3WLUA 2B5HA 4I01A 2YC0A 4WM8A 2RS51 4X8NA 1VBA1 4FXKB 4WVWA 2FZ1A 3ZXDA 1YNAA 4OVEA 4QD2A 3ZYJB 2V73A 4QPGA 2ZX4A 2CWMA 3VN4A 1RUF1 4JTOA 4HFSA 5F6KA 1KITA 3B3QE 3AMQA 1MVEA 3LSDA 1CIWA 2XUMA 3JBG3 4HPKA 4MUVA 3VZLA 1QGLA 3POYA 1VBC1 5I0RA 3D0SA 1PVXA 3TNPB 3HN1A 1N1YA 3MPPG 2VU9A 4IEYA 3N7LA 1QXPA 3JZVA 3THPA 3BU7A 1AR91 3O12A 1ENXA 4XBLA 4LO7A 3SCFA 3B00A 1OKQA 1V6JA 3CLPA 4JTNA 1J3PA 4IEPA 1WGPA 4HN0A 1W6MB 1ENRA 4JDOA 1V70A 2PHDA 1PGSA 3OPZA 5DUVA 4AI8A 1AL23 1HLCA 5C4WB 1KDMA 2XBO3 2C9AA 3UKNA 4AQTA 1EY2A 3VZMA 4OHVA 5JAXA 3ZSKA 4BE3A 2JXAA 1LHVA 1JW6A 1MS0A 4MYEA 1VBD1 2PN5A 4WM7B 3ZFGC 1RITA 3D82A 1SEFA 1UL9A 2Z79A 4Y1XA 1AR71 2CL2A 2GU9A 4Q0PA 2RJKA 4MXWB 1C8M3 1D4VB 3WHTA 2CGPA 2VW0A 3N7KA 3HAGA 1UPSA 4F8AA 5FDBA 1BMV2 3MEPA 4YG3A 1IPJA 3MIHA 3NV3A 4HSLA 3RPQA 3SXWA 3N4MA 4C90A 3LA3A 4JDMA 3AZYA 2VOWA 3CJIA 3CU7A 1YRZA 3UJQA 3I59A 1NA1A 4YGBA 4FXGB 5E88A 2XJRA 4FCAA 1LHUA 2JX9A 1YWKA 1W6NA 1WMFA 2BVBA 3EJKA 1A6CA 4L8QA 3ZSEA 2DFBA 3VL8A 4AE2A 1X8EA 2ZTNA 1OLRA 4JGZC 1EAH2 2DUOA 4RS5A 2VOKA 1RMU2 4LBMA 4XJ9A 3USUB 3SCHA 2F4PA 2WA4A 5SV5A 3ELNA 3PNAA 4AEDA 5FOJB 3PJYA 3JB4C 1G9AA 1MS1A 1BK1A 4ATEA 1RUH2 5JIAA 1OLQA 1SLLA 1WMDA 3POWA 4M3CF 1OOPA 3RJRA 2BYVE 5JSRA 2RMU2 4Z82A 1QJX3 1PHMA 4GB32 3JUUA 4BIOA 3N7JA 4K8FA 3U10A 3AMMA 2R32A 3LSEA 1DLLA 3QOPA 4YYOA 1H8VA 4KU8A 3VKLA 1ND3B 1O4TA 3AP7A 5JOYA 2HWC3 5T5OA 3VZJA 4YM1A 2XJTA 3VBFB 4FOYA 3ZN6B 1H9WA 1DYKA 4LO8A 1WA4A 4MGIE 2ET7A 1BBT1 3RWNA 1D0HA 4YG0A 3T1MA 4RS5C 4Z07A 2WNEA 4ZU4A 1AR92 2XKOA 2D6OX 4RGGA 1D4M3 1WBFA 5GLUA 5H9PA 3ZIXA 1HKDA 3TNQA 2WA3A 4RHV2 1R1ZA 5K0UA 1U5IA 2OA2A 5GLVA 5CFDC 4P5HA 1SBFA 4A7YA 4FAGA 4CDWA 1C5IA