4XFHA

Cysteine dioxygenase variant - y157f at ph 6.2 with cysteine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfhA00
3LA7A 2B9UA 2WC2A 4H7LA 4F7ZA 5FPXA 4I3PA 5KHHA 4ONUA 4ORFA 5FLIA 1CAWA 3LA2A 2D40A 1WGPA 4O9GA 4Q0PA 4R52A 3H1YA 1RUNA 3O14A 5JAXA 3JZVA 1OI6A 2OZJA 1FT9A 4Q0QA 4IEPA 4JTOA 3E97A 4IEYA 2Z69A 3RYPA 2ATFA 4EROA 1L3JA 2XL7A 5D1IA 5E1RA 4QM9A 3KGLA 4HBNA 5BV6A 3N4MA 1TQ5A 4XFIA 2Z2SB 4P9GA 3OGJA 1ZX5A 4PJYA 4WZCA 1G6NA 3S0MA 4TLFA 3R6SA 2B8MA 2PA7A 3WW2A 5I8SA 4AQ6A 3TNPB 4B29A 1JUHA 1CAVB 1O5LA 2PAMA 3WW3A 2IXHA 2IXIA 5FLHA 3E6BA 4I0BA 1O7FA 3EQEA 1Y9QA 5BXXA 1X8EA 3ES1A 3S7IA 3D0SA 5K8SA 2CAVA 2O8QA 1UW8A 1O3RA 4EWAA 3H8UA 2PAKA 4HMZA 4WBBA 2XLFA 4JTNA 5AVPA 1I5ZA 3E6DA 3IWZA 4XEZA 3NW4A 3DKWA 3LAGA 3CEWA 1ZZBA 4N9IA 1J1LA 4HZFA 5BUVA 4KWJA 3EO6A 1GQHA 4X6RB 5JR7B 4MUVA 1XRUA 5FPZA 3H50A 5I91A 3KMHA 2IC1A 1ZREA 1WLTA 2XL9A 4MGKE 1YWKA 5FQ0B 3HQXA 1VR3A 2D5HA 4IEZA 1ZZCA 4YRDA 2PYTA 1YFYA 3H3ZA 3IBMA 3LOIA 4KL1A 2GC3A 4QGNA 3FWEA 3B02A 1SEFA 4AXOA 2XLGA 3QACA 5I8TA 5JCTA 3NKTA 4IEQA 4MGZE 2V09A 2BGCA 2QCSB 4META 4YSFA 3SHRA 4F8AA 4IETA 5KHKA 1RGSA 2QNKA 4I01A 2VQAA 3OTFA 2GU9A 4BHPA 3RNSA 5BY5A 5CVRA 2ET1A 2CGPA 2CAUA 1PM7A 2WFPA 2PHDA 4LTAA 3DN7A 4GULA 2OZ6A 4KWLA 4MGIE 1UIJA 1EYBA 4IEOA 3RYKA 1ZVFA 3RYRA 1EY2A 4XFCA 5FLJA 1XE7A 2PTMA 2UY8A 3E5UA 2D93A 1ZRRA 2GC1A 1X8MA 1O3QA 2DCTA 4JVAA 4XF3A 1VP6A 4J1WA 1PMIA 3C3VA 4XFBA 3H1MA 4IEUA 5CADA 4L2NA 1OD5A 3FX3A 1Q43A 3DL3A 5FCCA 4MH0E 4FAHA 2BNMA 1YUDA 4IERA 4IESA 1CAUB 3FJSA 1DZRA 2Y0OA 3G7DA 4X6QB 1Y3TA 5KHIA 1UCXA 1UIKA 3HT1A 3PNAA 3CJXA 1ZRDA 4Q29A 2GAUA 1DZTA 5JSOA 2GZWA 3CO2A 4IEVA 1NE4A 3LZZA 3FHIB 1H1IA 2Q4SA 1O5UA 1Q3EA 2XGXA 4HN0A 4KU7A 2FQPA 3ETQA 3WW4A 4Q0VA 3PVBB 4LUKA 5I0SA 1O3TA 1SFNA 3CL1A 1IPJA 4XF4A 3OD0A 3OF1A 5LEJA 1H1MA 3UKNA 1ZRCA 3FE5A 3CF6E 3RDIA 4D7TA 4D7SA 4N9HA 3VHRA 3H7JA 4E2QA 2GC0A 2UY9A 3H7YA 2P17A 3LA3A 4ZU5A 3DV8A 4MV2A 5J7MA 1CAWB 2IXCA 4QMAA 4WVZA 4UBHA 5I0RA 3KCCA 3TNQA 3UKVA 2ET7A 4K8FA 3H3UA 3HT2A 1YHFA 4E2SA 2QDRA 1VJ2A 1RC6A 4LEJA 3SCHA 4OFGA 4XF1A 1QWRA 3ES4A 4FT8A 3IDCB 2PAEA 4I0AA 1RUOA 3HIFA 4BIFA 4BYYA 1RTVA 4Q0UA 3I7DA 2FMYA 2VECA 3KGZA 3BCWA 2MPFA 5T3NA 3MZHA 4MGYE 1ZZ9A 1CAXA 2MHFA 3M3IA 4Z07A 4PIXA 5EZWA 3RZZA 1ZNPA 1J3RA 4OLLA 2VPVA 1FI2A 3BPZA 4HSLA 1LB2A 3CLPA 1O4TA 3FZ3A 4XF0A 4QXKA 2HKXA 4FAGA 4CYDA 1XE8A 2PQQA 3LWCA 4HLTA 2Q1ZB 4XFAA 2K0GA 4XETA 3SCFA 5FQ0A 5LEKA 3NL1A 3I59A 3IDBB 3WW1A 4FBFA 2KXLA 5JSRA 3I54A 2ZKLA 5CU1A 1UPIA 5C6CA 2B5HA 4AVCA 3U10A 2EAAA 5J48A 2N7GA 1Q5OA 4DINB 1SQ4A 3SMHA 3I59B 1X82A 1LRHA 4LULA 1DGRA 5FDBA 1RL3A 2H6BA 2XKOA 1V70A 4NVPA 4IEXA 4ZU4A 5C8WA 5LRRA 3KSCA 1CAXB 3UKTA 4AVBA 1LR5A 4QM8A 5KHGA 4RD7A 4HVOA 1I6XA 1U12A 2EVXA 2XHKA 3SXWA 3BU7A 3FFQA 3D82A 1O3SA 2BNNA 2H6CA 4LLOA 3PLQA 4EWDA 2QVSB 3M70A 2PHLA 4BH9A 4ZU7A 3NSTA 1J58A 2GH2A 1IPKA 4YARA 3GYDA 2BEOA 3ROUA 5KBFA 3ELNA 2IXJA 3GBFA 2EA7A 4HVQA 1EPZA 2K9ZA 3E5QA 1ZRFA 4XFHA 1YLLA 3IIAA 3RPQA 5HI0A 4MZUA 5I0UA 2Q30A 4HN1A 4YYOA 1EP0A 3EJKA 2UYAA 3MYXA 4EV0A 1YFXA 1YFWA 4QGLA 1QXRA 2PFWA 2H0VA 4R8HA 2BYVE 2HJIA 5BPXA 1YFUA 3U11A 3EHKA 3ST7A 3USSA 2OPKA 4A2UA 4QX5A 4L11A 2F4PA 5J3UA 1NXMA 5I8YA 1LKNA 1NE6A 1WA4A 4LA3A 2BNOA 1CX4A 5EFUA 1QY4A 3S7EA 4MX3A 1ZZ6A 1CAUA 1CAVA 3BB6A 3H9AA 4LUMA 3E6CC 4KWKA 2MNGA 4PIZA 2IXKA 4I2OA 1CGPA 4O9EA 1FXZA 4XFFA 2QJVA 3L2HA 1J3QA 4XF9A 2ETEA 1OFNA 3U0ZA 3NVCA 4QGMA 3SCGA 2ZCWA 1J59A 4J1XA 4XFGA 1UD1A 2OA2A 5KHJA 1OMIA 1ZZ7A 3NJZA 4I09A 3ACLA 4UXAA 1HW5A 5I93A 2I45A 3BALA 2C0ZA 2IXLA 1QXJA 4YNIA 1ZZ8A 4I02A 4IEWA 1NZCA 2O1QA 2E9QA 4LA2A 5I0TA 2GC2A 3MDPA 3OCPA 1NYWA 4HVRA 1X7NA 4E2GA 1DGWA 2Q0AA 4AVAA 1J3PA 5JSPA 3E5XA 5LRSA 3EBRA 4KU8A 4Z82A 4EWEA 2CV6A 2UYBA 4Q0SA 2XKPA 2OYZA 5E16A 4AQ2A 3D0JA 4PIYA 3MPBA 3QOPA 3H1WA 2D5FA 4UBGA 4HSJA 1GQGA 3ZDSA 4JV4A 5F1RA 2XLAA
chains in the Genus database with same CATH superfamily
1S2KA 1B35B 2JX9A 1HQLA 1S0CA 4M4PA 1UU6A 3WQ1A 3ZDVA 3T4VA 4H7LA 4AI1A 2Q8CA 2UWBA 5FPXA 3GZUC 5FLIA 4GH4B 2XJVA 3WNKA 3BODA 1RUNA 1DQ5A 3JZVA 5FY1A 3AL5A 4IV1C 3VB9A 1WBFA 3ZPYA 3WG4A 3LFIA 4NR1A 1BBT1 4W6YA 3CJIA 5EJ1B 5JOWA 1VRH1 3UYJA 1YQ5A 2IVJA 3J26N 4IUGA 4IEYA 2Z69A 2E6VA 1TNRA 1D7PM 2JJ6A 1WMEA 4PQQA 1H6XA 5C3RA 3B9CA 1Z78A 4A44A 3KGLA 1BVP1 3BOPA 1FPN3 1DU3D 2XBO1 4DY5A 3JB4C 1V6IA 4AI3A 1LOEA 2ID4A 4LE3A 4UW5A 1WLCA 3C8XA 3ABZA 1ZX5A 1XOYA 3VN4A 4QHZA 4PBOA 2DU1A 1G6NA 2KR2A 4TLFA 3PUAA 2B8MA 4Y1ZA 3R6SA 4D8MA 3TNPB 4B29A 5AFEA 2RM23 5LCWL 4NIHA 3ZOIA 4CP0A 1KD7A 2VXRA 3WXPA 4AEJA 5A3UA 2EIBA 2A6ZA 2Y64A 1N1VA 2OW4A 5JI9A 3EMRA 5L7OC 1IHMA 4JKKA 2Z42A 3U75A 1O7FA 4QXHA 2PQSA 1W6PB 2C26A 1VBC1 5BXXA 4QDSA 4L0PA 5KC6A 2ERFA 2P5BA 2VOXA 4QKFA 4GH4C 3ILNA 4XIOA 4W4ZA 1JUIA 1CPNA 2HWD1 2XVKA 5FMCA 1CJDA 1NLQA 3ZN4A 3LE0A 3K3OA 5F3IA 2WS91 4TTGA 2HWF3 1XB9A 3J7NA 2CAVA 3D5OA 3DXUA 3VGIA 3ZYGA 2OUJA 4HOOA 5A3WA 1HRI2 1E57A 2VMIA 1UW8A 1LOGA 1EUUA 4UFHA 1RHI2 4QPGB 1S0IA 1RUD1 3K48A 1BLZA 4M0NA 4Y5TA 5AVAA 3VKLA 4C1XA 4MGTA 4AR2A 3NAPB 1O8SA 5AVPA 3RWNA 3T1MA 1DG6A 2ZS6B 2WIIB 5A3TA 3WQ7A 1OF4A 4XEZA 4YPJA 1Q8SA 2IVIB 4V2WA 2QKDA 2OVUA 5F2SA 5CFCC 1S0EA 4HFSA 1OLRA 1SLLA 2Y6LA 2W08A 1QOOA 2WLQA 5JR7B 4MUVA 2A3WA 1LGNA 3H50A 2GALA 3J9SA 4EN7B 2YMZA 5IHRA 2RR11 1LGBA 3ZYIB 3OBTA 2XL9A 2RDRA 4WVMB 2J1SA 1OKQA 4KH9A 3KF5A 4YRDA 5BNPB 1YCIA 3KVAA 4CU6A 4H7MA 4FPEA 1SLCA 3LOIA 1NG0A 5FY4A 3DEMA 3ZFEA 5F3EA 4LBQD 1SEFA 2RR12 3A0KA 3QACA 5JCTA 3J8F3 3NKTA 1HXS1 3MBWA 3MEPA 4MGZE 5L73A 2BGCA 3UETA 3WSOA 4META 1G9DA 4JGYC 1VLNA 4SBVA 1FMD1 4B7KA 3WR0A 1POV1 4IETA 1RGSA 3RMXA 4A7YA 4I01A 1ULGA 4FPYA 5FRAA 3SH5A 3RNSA 3K46A 1ONAA 2BTVC 2Y6GA 4AHZA 1YIPA 2IFRA 2V4AA 4N53C 5A80A 3WG1A 3PL0A 4L9BA 1KXGA 4GULA 1A8DA 1PZ8A 4BQ4A 3MIGA 4PCRA 2QDNA 3HBKA 4QPIB 3OG2A 3WEZA 3ZYRA 4JHTA 4MGIE 4QPWA 1EYBA 2ZGMA 4IEOA 5GLZA 1B35C 3RYKA 4LOTA 1QH7A 5DQ0A 3ME2A 4BE3A 5C7GA 1ULDA 4MYEA 1WW7A 3WCSA 1POQA 1UOBA 2AEYA 3Q9OA 5C3OA 3WF4A 2RMU1 3IB3A 4ZY9A 1JYWA 4NRPA 2DFBA 4XF3A 5A7WB 3ZR5A 4FFFA 3F2ZA 2XBO2 2W39A 4YVWA 4FPJA 1BEV2 5KR7A 1PMIA 1Y9GA 2VZ3A 1L7RA 4Z1VA 1DYKA 1IKQA 4IEUA 3PURA 3L2YA 1OD5A 2R32A 5FCCA 4MH0E 1ULCA 2W1WA 4WM7C 2R043 3VBSA 3ZFGA 4L97A 3ILRA 3ZYFA 1WWYA 4Q4X2 4BISA 4DB5A 5L36A 4RSUA 3FJSA 3I49A 4KGQA 3G7DA 2DYCA 4FP2A 1NAEA 4YG6A 4CP1A 1D0GA 1UIKA 1UL9A 1DF0A 1NCRB 1ULEA 3N7JA 5IK4A 3CJXA 4OUMA 4CUCA 5FYHA 5I0DA 2WN3A 1FATA 1DZTA 3OGRA 2GZWA 1UZZA 5FZDA 5IVBA 2BQPA 3VBOC 1H1IA 3PUIA 2X29A 3POWA 3BUCA 3SEEA 1ENSA 2WT1A 4K8RB 4KU7A 4XURA 4AAPA 4LO7A 2FQPA 3OBAA 4OCTA 1JH5A 1G8WA 1OFSA 3LDKA 4LBNA 3I3DA 1NY71 4NRMA 3CZUA 4JGZC 2VZPA 3CL1A 3R4SA 4CCDA 4Y24A 4OMDA 4IE0A 5LBBA 4NIIA 3SISA 4AYUA 2F6BA 3BYWA 5A3MA 3AC0A 3OY8B 4Q4Y2 3CF6E 4D7TA 1OQDA 4DRVA 5DZEA 5IK5A 1C1FA 3VHRA 1Q8QA 5EXOA 3I2IA 4YG3A 4L8QA 2JKBA 2VVEA 5DZGA 3TN92 4ZKTB 1SLTA 3D8CA 1D0HA 2GC0A 5FP4A 4E2QA 4IGOA 1QJU1 5KXBA 1UZYA 2MEV3 3KQRA 4ZU5A 2Y38A 4R9AA 3ZSKA 4KMQA 4MV2A 1CAWB 4IV1A 5JZGA 2IXCA 5KXCA 1BYHA 4AEDA 1R1A3 3VZJA 5I0RA 2VG9A 3KCCA 3NAPC 3UKVA 1JTZX 1U0AA 3N36A 4K8FA 3SQOA 4NIGA 4YW5A 3MIEA 5IUQA 2AUYA 1QJX3 2P34A 4YLZA 5FMOL 2AZ5A 4P9WA 3HT2A 5F7UA 4CCJA 1ZM1A 1RC6A 2HYKA 4TXWA 5DUVA 4H3WA 1O91A 2VBBA 1ZA7A 2AC1A 4DEVA 3WDVA 1OPOA 2CSGA 3J7LA 2QQJA 1RINA 3CHXA 5JZGC 3TYJA 2OPWA 1OUXA 5J09A 3IDCB 1UU5A 3HN1A 3HIFA 4QX8A 2CDPA 4RFT0 4BYYA 4E9KA 2W5FA 4R9BA 3LPGA 2VECA 4XZPA 1PO22 5A33B 3BCWA 1PGL1 2MPFA 1I9RA 4JCKA 2W2IA 2VE1A 1V6JA 4QWNA 5EZWA 2IUWA 2R0HA 5BNNC 1OURA 4NOTA 3BPZA 1SFYA 1COV3 1H8TA 1W9FA 2WZR3 1J1TA 3ZMNA 3WINE 1YQ8A 2E7AA 4FQ4A 1QQP2 2JG9B 2VULA 4B8EA 4LKDA 4QXKA 1XE0A 2CGOA 1I5PA 2E26A 3N3HA 1XE8A 3ZIWA 5DDJ1 4S2GA 2YV8A 2Q1ZB 4Q4Y3 2Y34A 2RS33 5T5OA 4AL9A 4ZZ5A 1YQ2A 1H30A 2RJLA 4NPRA 4PF1A 1JBCA 1UX7A 4XETA 3SCFA 5J96B 5HPOA 5FYMA 2UU8A 1BK0A 2R1BA 4ISQA 3NL1A 5JIUA 2PLV1 3K77A 3KV5A 1D4M2 2LW8A 1GZ9A 2HEVF 1ULFA 1A6CA 4GAZA 1UPIA 3O7OA 2B5HA 1C8NA 3U10A 1AF9A 3SH4A 3ZXJA 5DMYA 5GJ6A 1SQ4A 3SMHA 2ES3A 3C7HA 3I59B 3NNLA 4LBMA 4P9IA 5LK5A 1F31A 3HN3A 3IN9A 1DGRA 2BW8A 4OHYA 4LORA 2ORZA 1GFF2 4QB1A 2QQIA 4PF5A 4QX7A 4AVSA 3CBNA 4ARYA 2C6SA 3H0OA 2ZHLA 4JC1A 2B7YA 3R4UA 2VUCA 5DAPA 2R7EB 2P4EA 4WVMA 2NP0A 1CAXB 4EZHA 2ZHNA 2WAAA 3BI3A 1LR5A 2YROA 1ODMA 3P3PA 1JYCA 1NUKA 2RVAA 1AVBA 1CJPA 1I6XA 1GMMA 1U12A 4BQ5A 3M3QA 1TME1 4XTMA 2EVXA 2OUHA 1UMHA 1RVF3 4Q4W3 3OYWB 4YM2A 1PK6C 4CDXC 5C33A 3T0DA 1ND2C 3THCA 3KV6A 3FFQA 4XUTA 2XB6C 2XWBB 4CUAA 3D82A 2ENRA 5ACA1 2G1MA 5FMOS 5A32B 2NLRA 2H6CA 1COV2 2A6XA 1F8VA 4UWDA 1LHWA 5FWJA 3IDAA 3T30A 2WFF3 3PLQA 3V0BA 3BIEA 3M70A 1UZWA 5CKQA 3AVRA 4DNYA 2PHLA 1VAMA 5A3LA 4EN6B 2DWRA 5CG8A 1BJQA 1J58A 3SC7X 5BNNB 1M06G 2XJQA 5SV8A 3JD73 4LKFA 3O1MA 2X05A 1A78A 3GYDA 3ROUA 3A23A 2DVAA 2J1EA 4BQXA 1LJ7A 1GP5A 2IXJA 3AP5A 3B9IA 4IE6A 1ND2A 4QPGA 5DG2A 2EA7A 3WNPA 3O5SA 1PNGA 1W2NA 2J42A 3GHNA 3E5QA 2NPIA 4OHZA 4W6WA 3POSA 4CDUB 1V6LA 1YLLA 4GJZA 4NWWA 1KFXL 4QX2A 3ZYHA 2YZ4A 3N9MA 5F2WA 5CFDB 5HI0A 3LEIA 1W3VA 2HWD2 3LIHA 1LODA 3TOJA 2V5DA 3K4ZA 5EJ3A 2PHUA 2JDNA 1XQNA 4W50A 3J8F2 1WMDA 4XJ8A 2WNVB 3OD4A 2D6KA 3KLSA 1YFXA 1RHI1 1QXRA 1DCSA 1GSLA 2PFWA 4NROA 4NUBA 3CMGA 2BYVE 4BMEA 1CIYA 5FAXA 3U11A 2JDAA 2WFF1 4NAOA 3ASIA 2B42B 4XC9A 4BK5A 3JCIA 2AACA 4QX5A 3M3OA 3RSJA 2DCJA 4AF9A 3O1SA 1OA4A 2FMDA 1VBA1 2F4PA 3PU3A 3VBRB 1VBE3 5J3UA 1JZ2A 4IE4A 1UYYA 3VKMA 2WN2A 1Q56A 2ZABA 1ZYBA 3LCPA 1CX4A 1VBB2 2C1FA 5A6YA 2W3JA 1OVSA 2B9VA 3WP4A 3V0AB 2B46X 3PUHA 2JDUA 4Z2AA 3ECQA 3AZVA 3H9AA 5ABJA 5IT6A 3NMBA 1RUC1 4P9YA 2EALA 4SLIA 5FZCA 4KWKA 2EIDA 3ZO0B 5BNOB 2VCBA 1NXD1 1PVC1 3TEXA 3WX5A 2LS6A 1I3HA 2BJSA 4LMFA 3UJOA 4BQWA 1CGPA 3AFGA 4CEYC 4PI2A 1MZ6A 3VKNA 4O9EA 3VBUA 4K21A 4QU1A 2DCZA 2QJVA 1QGLA 4XFFA 1JOBA 1W28A 4QT6A 2AGSA 5FJHA 5DPNA 1D2SA 1ZBA1 1YIFA 2Z79A 3P5BA 2FZ2A 2ZCWA 1J59A 4J1XA 1KGYA 1PIV2 1V9U2 3WCRA 2RHPA 1NCRC 2V5YA 3O12A 4IE5A 4I09A 4C0HA 2LTNA 1XYOA 1JYVA 1GNHA 2R042 5L9BA 2VZOA 5GZEA 4HK9A 4DUXA 1C3HA 1SLAA 2I45A 2WWSA 3BALA 2QQOA 2JDHA 3A4UA 5K7PA 2SBAA 4IL7A 5FREA 4BU2A 1QXJA 1H2MA 1RUH3 1YI7A 4YNIA 4LA2A 2E9QA 3VHNA 1BMV1 4PDWC 1JU4A 1Y43B 3A21A 1C8M3 1BVVA 1WUVA 3HBZA 4J6GA 3VHOA 1O8PA 4HVRA 5GLUA 4CTEA 5BNPA 1C8M1 4V1PA 4TLGA 4AVAA 4OI2A 5DAWA 1XSQA 3MLJA 1J3PA 4CDWA 4XMAA 1CPMA 1YRZA 3JBG1 3NV4A 1OC1A 3WHTA 4Y5Z0 2BDRA 2CV6A 5FZLA 4Q0SA 2E31A 2W87A 3EB7A 1GYKA 3LB9A 4WM8A 3K51A 1W8ZA 4Y22A 2JD4A 3UGGA 3LSDA 2WSVA 4N53B 4BCUA 2HWE3 4PIYA 1VBE2 2XONA 5FP7A 4V2VA 5LA0A 1JHJA 3MPBA 2BGPA 4FP3A 4CP2A 4DXRA 1F5JA 5JVVA 4EROA 4HSJA 1GQGA 5A3PA 3RMYA 1D4M1 4UF0B 3LA7A 1XJAA 4CP9A 4IV3A 4QU2A 2D3RA 2VCMA 1WD3A 5FR3A 3J4UH 3AXEA 4XJWA 2GMEA 1RUJ2 2O0OA 4I30A 4OYUA 3ZM8A 4F7ZA 5H9RA 5KHHA 4ONUA 4RQPA 4FXGB 3WVJA 5AC91 5C5TA 1CAWA 4K20A 2YBPA 3GCWA 4O9GA 1B35A 2VY0A 4R4ZA 1MEC1 2R49A 2X09A 4Q1PA 1OI6A 2OZJA 5FP8A 1FT9A 4D6QA 2C9KA 1EUTA 1U5XA 1RJ8A 2VW2A 5TSWA 4Q0QA 1QHDA 1G9CA 4JTOA 3KHBA 3JU9A 3E97A 2TUNA 2CHHA 4CXXA 3WDWA 1CQ9A 2ADDA 1IG0A 2G4IA 1LU2A 1E5RA 1WCDJ 3DYPA 4N7UA 2R30A 4XAEA 5D21A 4GWJA 5C71A 3N9LA 1EAH2 5ANNA 3THTA 1DLLA 2WO2A 1GWLA 4AHXA 5CISA 5FZOB 1RUJ1 4LT5A 2XWJB 2R16A 4XDQA 4PJYA 2VZTA 3AZZA 4GZ9A 2AH2A 4M00A 5FZ3A 4COVA 2PA7A 4BM8A 4E4DX 3VZMA 2BPA2 2LALA 4XBQA 4AFCA 3OEAA 5F37A 1HRV3 2RS12 2A73B 4GB32 1AYM2 1CAVB 1O5LA 1IPSA 4RYDA 3WW3A 3CJIB 4D69A 2IXIA 5FY0A 2P37A 1K5MA 1ND3C 4B1LA 2AREA 1PO23 4MXWB 4OMCA 2A70A 1W05A 1CX1A 3WZ1A 4MVTA 3ES1A 2DUPA 3BTYA 3I2GA 3VBHC 3LKJA 3PHMA 3KT7A 5E6HA 3CNAA 4M3CE 2Q8OA 1HRV1 4GMP0 5JIAA 3UJQA 2VUAA 1PX3A 1RMU1 3TEYA 3H8OA 3BN6A 4QPGC 3JD71 1F2NA 2E7TA 3VDAA 2WR9A 1NOVA 4OI4A 3RG0A 3TN91 4EWAA 2XUMA 3OB8A 3H8UA 3O1VA 4Q8LA 3N9PA 2K2SA 4HANA 5DDJ2 1VE0A 3PMSA 5FUNA 1N1SA 1I5ZA 3IWZA 5ACA3 1PZ7A 1MACA 3DKWA 1IGOA 1C4RA 4PLOA 3LAGA 5F6KA 2ZJCA 5BUVA 4HZFA 4NO4A 4M01A 3TB0A 4AVVA 2BGOA 2VCAA 2CDOA 3AYCA 3V0AA 4W65A 1Z7S3 2WQZC 5CBLA 5IVFA 2P6HA 3N9OA 4BWOA 3KMHA 2IC1A 4OHXA 5I91A 1S1AA 1ZREA 3LIGA 3H8XA 5FXXA 4BPZA 1KQRA 1VR3A 1AL22 2D5HA 3ZXDA 1V6MA 4XJZA 2PYTA 1KFUL 5AC93 1YFYA 4YM3A 4QGNA 3PVOA 3OGGA 3B02A 4P02B 2Y0IA 3WP5A 2WKKA 4RS5B 4YW6A 4OUSA 3WD5A 2J1VA 1QH6A 2GN3A 4W6XA 3R4DB 4LK6A 1OKOA 2QQVA 5T52A 5IK7A 2J1TA 4YSFA 1W90A 1APNA 1W9YA 3GJBA 3NNFA 1PO11 2VQAA 1G9FA 2D6MA 5FYZA 5BY5A 4Y1XA 4XCBA 3IKWA 4AI2A 1EV11 2VTFA 2PHDA 4ZXEA 3DKQA 1HB2A 5FMBA 2VZQA 2ARXA 2JG8A 2ZEXA 4ES9A 4AFMA 1RJ7A 5C3QA 5D2AA 2O8OA 3I3EA 1S0JA 4GMP1 3MHZA 1EY2A 2FBEA 2WFF2 4JX0A 4YM0A 5FLJA 5FZ4A 1XE7A 3E5UA 3PJYA 4N43C 1K42A 1LEMA 2GC1A 1X8MA 2PXJA 2R0FA 3EXUA 4GIQA 4YVSC 1O3QA 1E5IA 1JN2P 1X50A 2DCTA 5C4WC 1W6QA 1E5SA 1MS4A 4JGYA 1Z0HA 1RUH1 4P14A 4FOWA 5F5QA 1PIV1 1HLCA 2VMGA 3AYDA 4P9LA 1PHMA 1C57A 3AYAA 5A3NA 1Q43A 3DL3A 4FAHA 1KS4A 4AGRA 2VVDA 1R093 3RJ2X 3ALQA 3BKZA 4S2FA 1JZ4A 4LPLA 5T5PA 4AFAA 1IZ3A 4IESA 3P6BA 5T5JA 4HPKB 3HNMA 5EWSA 1UY4A 4NIAA 1DBNA 2RV9A 4NHYA 3WY6A 2VUJA 1JYXA 1BCXA 3PIGA 1EAH1 1ZRDA 4COWA 2QZ2A 1DQ0A 4RGAA 5FZ8A 5JSOA 3M8LA 2RJ2A 3VZNA 5M0TA 5FZ6A 3FHIB 4RR3B 2E51A 4XJUA 1O5UA 1Q3EA 2ZX1A 5GZFA 1MZ5A 3ZYBA 5DG1A 5J36A 1AXKA 1GP6A 3WW4A 3ACIA 3PVBB 3X29B 1OA3A 1OH4A 1H8VA 1PVC3 1R1A1 1VBA2 4OZOA 4AFBA 4XF4A 2DFCA 3HEIA 4NMIA 3OF1A 4A41A 4D0QA 1R64A 1BK1A 4OHVA 5LZ6A 3MO4A 3UKNA 3RDIA 4FSJA 1K45A 2CY6A 1RXGA 2G9GA 3C7GA 1I1EA 4DIQA 2UWCA 2FDHA 3LDBA 3NQHA 3KV9A 2ZA9A 3VKFC 4BIOA 4N7IA 2NM1A 2XHNA 4CDUC 2P17A 4R9DA 5FYTA 1TG7A 3DV8A 1VBD2 2VC9A 3NV2A 2VNGA 3VBSC 3ZFGC 5J7MA 4JAAA 2ZBJA 2EF6A 2ZZJA 1PO13 4WVZA 4QHOA 3VD9A 1PZ9A 1U5YA 5L9VA 2RMU2 1LESA 3HR9A 1CVNA 3TNQA 3DPRC 3RZGA 4K40A 1F15A 3WQBA 1W8FA 5FO7B 2KA3A 2ZMLA 5FYUA 4NWVA 4JGZA 1W6NB 2W9XA 3AMQA 2HWB2 2QDRA 3CIHA 4YM1A 1HN0A 5F6LB 1OT5A 1LOFC 3JB8A 4OVEA 1MS5A 3H42B 4LO8A 4WM8B 4LEJA 4XUOA 3ZVXA 3SCHA 4ZPIA 3CJIC 3SLIA 4XF1A 3W5NA 4B4PA 1QWRA 3ES4A 4I0AA 4XJAA 1MS9A 1RUOA 4YFZA 4MO3M 2DV9A 4COYA 4Y33A 5L7OA 1RTVA 4Q0UA 2X10A 2TEPA 3I7DA 2PMWB 5ACA2 3VD4A 3KGZA 3PIJA 1XNKA 4HXCA 2LUWA 2YYOA 4ZONA 5FYVA 1QJX2 3M3IA 4PIXA 4AEDB 4ATEA 5HXMA 2YHJA 1JOJA 1W06A 4PQ9A 1UY2A 2TBVA 2WABA 1RUJ3 4AGGA 4OLLA 1R1A2 3O1TA 3DF0A 3U78A 2DBIA 2JICA 4TN7A 4AEDC 5IATA 1HXS2 2VQUA 4HSLA 5JPNB 1LB2A 4RHV1 3IAPA 3FLTA 4XW3A 3GCXA 5KXEA 1C5HA 2NN8A 4XF0A 2WT2A 3TN93 4FAGA 4LBJA 1OQEA 1SFPA 4N90A 2W0XA 2ZX3A 4CPBD 4EZ4A 1FPN2 1XSRA 3WLUA 4Y20B 3FBYA 1H1AA 1JS9A 2B45X 4LQRA 4P5HA 3UGFA 1Q8VA 2PHTA 4U2AA 4BA6A 4DQAA 5FQ0A 3AVSA 3VD5A 2PHXA 2ZPXA 5HV0A 4P08A 3WF3A 1BZWA 2D6NA 1OLMA 4UFIA 4XABA 3WF0A 5F5IA 2FCUA 2W1UA 3SKJE 5JSRA 2RDNA 3I54A 4A6SA 3B5LB 2EAAA 1POV3 3HNYM 2N7GA 1J83A 3VBHB 2JB8A 1AHSA 4A4AA 4XHBA 5F32A 1ULPA 1LRHA 4GJYA 3MF6A 3K4AA 4CP9B 1SG3A 3J8F1 1RL3A 1FNYA 2H6BA 4Z8BA 2VNRA 3AMNA 4CUGA 1V70A 2HWE1 1T6BX 1DHKB 4NVPA 5FXZA 2X8KA 2XJPA 5FWEA 4ZU4A 4DEQA 4FTBA 1LHVA 2ZXQA 1DIWA 2Z4FA 4RGGA 2W52A 4MLOA 5C8WA 1O4YA 1LOCA 4IGPA 4EN8B 2LRPA 1LHUA 4C1WA 5KHGA 5DUXA 3S57A 5LY1A 4C8DA 5J1XA 1S0DA 3T0BA 1AX1A 5FZIA 4LHNA 1V9U3 2UURA 2LROA 4QX3A 3LPFA 5ERLA 2YGMA 4YW1A 3ZN5A 4A45A 3MFCA 5FK7A 1G9BA 3MI8A 4FCAA 4YGBA 3BIWE 3T3YA 1MEC3 2WO1A 2YC0A 5FPUA 3LOBA 1QJY2 4CUBA 2K46A 4H2AA 4MOAA 1NY72 3BOWA 4BQ2A 4I3GA 3WT3A 4XJ9A 4S2HA 4YVWC 3ZN6B 1WW6A 4GWIA 4YARA 3PUSA 4URTA 2BEOA 2WYFA 2R1DA 4BLIA 1DGWX 2CWSA 2QQNA 1RUH2 4HPKA 3WDUA 5A70A 3MIHA 4UFLA 3ZXGA 1EPZA 4HVQA 2K9ZA 1UF2C 2GMPA 3GGLA 4ZS2A 3RVHA 1NQJA 2BFUL 4LR4A 1TMF2 1ZBE3 1RMU2 4PLNA 3RPQA 4A3XA 4DO0A 4MZUA 5A7QA 3GBGA 5BNOC 1WW4A 1TZOA 3JBG3 4LO5B 5FY8A 3S6PA 3GNEA 5FV3A 2EXIA 1PIV3 5CYYA 3ZFFB 1MQTA 2ZX2A 3V0BB 1C8M2 1O59A 3MYXA 4RR3C 3VLBB 3KCYA 4EV0A 3N7KA 4PBPA 1IG3A 3T0AA 2ARAA 4QKDA 4XZUG 3S5AA 1W8HA 1YFWA 2EXHA 4ASLA 1OH3A 1GZTA 1KJLA 1DQ4A 4Q27A 1MS3A 2WNUA 1RUC3 3PU8A 4Y1VA 5BPXA 4CDXA 1REFA 2VOWA 2OPKA 2MEV1 2WBKA 1WCQA 4GMP3 1IS5A 2D3SA 4L11A 4LBLA 3KZ4C 5GM0A 3N7MA 5FZ9A 1N1TA 3U4SA 4D3WA 1GKBA 3DYMA 4FPCA 5FBJA 2I2SA 1GBGA 1LKNA 1NE6A 5FPLA 5IAVA 2BNOA 3AKQA 4N8MA 4X8PA 5HCBA 4JRAA 5A6XA 3N9NA 2C9AA 1CAUA 3LEMA 1OPMA 4LBQB 3A0NA 3CZJA 2DU0A 5A7SA 5DUUA 3VHPA 3O1OA 4MHUA 1Y4WA 4CCOA 2BRTA 3MW2A 1JW6A 4CRQA 1RHI3 3NKGA 2DTYA 3C7EA 3AKTA 5K4LA 2VMCA 4CDQA 2PLV2 1QF3A 3WNLA 1XU2A 1QDCA 4GKYA 1HQNA 5HCHA 1DZQA 4XF9A 2AYHA 4CDUA 2HH9A 1ZA4A 4AAXA 1UOFA 4BXSV 1GOGA 1AYN2 4QGMA 3SCGA 4QDRA 1ST8A 4YZ4A 5DAXA 4B4QA 1QJFA 1GOHA 1REDA 4XFGA 2ZEWA 1UD1A 4Y3OA 1TVGA 5A7OA 2QTWB 4NJ4A 2P3KA 2XUEA 4A42A 4LBQA 1XNCA 1LEDA 1Z7S1 3WF2A 1C28A 2XMLA 3MGUA 3KCXA 2VCCA 2Y6JA 1IOAA 1HW5A 4AI0A 3KS7A 1DGLA 3VBFC 1QMJA 4PHZA 1NA1C 2IXLA 2JKXA 2WNOA 1VBE1 3T4HB 4I02A 5GALA 5FY5A 4RHV3 4C91A 1WLDA 1MS8A 3UT0A 3BTAA 4QHBA 2A1XA 3M4FA 2GC2A 4CCCA 3O0XA 3MDPA 4DUVA 1C5IA 3VBUC 3JBG2 1H2LA 4QAWA 2P3JA 1CZSA 1FAYA 1RVF1 1X7NA 1XNTA 3F95A 1YEWA 2E7QA 4XPVA 4E2GA 5L7OB 4M3CB 2Q0AA 2XPJA 1RMU3 5H9SA 3AP4A 3E1F1 4HKLA 1BEV1 1NA1A 2YPJA 5GLWA 4FFGA 4OULA 4QB2A 4XAAA 3URFA 3T2QA 1WMXA 4KU8A 2JWPA 5DZFA 4EWEA 5JXIA 4INDA 1W8TA 3NO8A 4WZFA 4K6BA 3WNOA 1BMV2 4K7JA 3JD72 2BBVA 3D0JA 5FUIA 4AVTA 4EJRA 3TRSB 4FTEA 4GKXA 2VH9A 2VOVA 4BDVB 2A3YA 1K5MB 2BOJA 4UBGA 3WP6A 3AZXA 2SLIA 5FKCA 2P1BA 2XLAA 4PDWA 3OOXA 2CU5A 1QDOA 1HXS3 1QJY3 5C3SA 2H0BA 2O14A 3D3AA 2RS52 2VJXA 2CWMA 2HBUA 2WC2A 3MPPG 3OBZA 4QQ2A 3FN9A 3GJAA 2ZACA 2W95A 5FK8A 4I3PA 1YC61 3OEBA 4ORFA 3ZYJB 4YVSB 2QQPA 5G04L 4UI9L 4ET7A 4MHRA 1AZDA 1WGPA 4Q0PA 5FZAA 1DQ6A 2C24A 4A6OA 3O14A 5JAXA 3N9QA 1M4WA 2RS31 4Q4W1 5GLVA 3U14A 1VAVA 1TME3 1VRH2 2WJSA 4ZS3A 4BK4A 4IEPA 1W2UA 4AOCA 4X8NA 1GWMA 1IS6A 5F3GA 1VPHA 5LATA 1HKDA 4Q8KA 1TNFA 3RYPA 3U07A 2ATFA 5GKAC 2BP6A 1L3JA 2XL7A 4QQOA 2XH6A 5D1IA 5HCFA 4CDWC 5LW9A 3BTZA 2PN5A 1JYIA 4CE8A 1FV3A 4CDXB 4HT1T 1RUF2 1OA2A 1RXFA 2KD7A 2WINB 2Z2SB 4K1ZA 5IVJA 3LSEA 3OGJA 5DABA 3WUDA 4C90A 1PNFA 1SBDA 3R0RA 2VNVA 4QB6A 1GQPA 5A33A 1YJKA 1GANA 2RS51 3JQXA 1NLRA 4IXLA 4NHKA 2FD8A 3S0MA 2GNMA 5JMOA 3I2KA 1HJFA 3LGRA 3WW2A 5I8SA 4AQ6A 1DGRN 1D4M3 5FYSA 1JUHA 1DLCA 1AR92 4CZSA 5FTTC 1D4VB 4LHSA 3HAGA 1YJLA 4WM7A 2AEZA 4QPIC 1GNZA 2FZ1A 1W9TA 5FLHA 2BWAA 3E6BA 3WF1A 4I0BA 1IS3A 3HMYA 1AR82 3MUZ1 3EQEA 1Y9QA 3POBA 4JKMA 5LASA 4FPFA 4KI5M 3GZEA 1DFQA 5IW0A 5LY2A 1ZRIA 5A3OA 5FIXA 2CL2A 4AHYA 5K8SA 1X33A 2ZGRA 1DQ2A 1VRBA 4FPHA 3RJRA 4DS0A 5FZKA 3BGAA 4NAMA 2PAKA 4HMZA 1UN1A 3W9AA 1HIXA 2FDGA 1W6MA 2JEMA 2QZ3A 1XU1A 4EN0A 1FPN1 2VM9A 1V9U1 2XG3A 5C8CB 3E6DA 2ADEA 3KT4A 3NW4A 5FY9A 3B69A 2VR4A 3CEWA 3Q8BA 2EXKA 4KWJA 1VRH3 4PT6A 1S0GA 1F9KA 1GQHA 1STMA 1BBT3 3GDBA 4X6RB 4AK3A 2X5IA 4RFRB 1A8MA 5FPZA 3UK9A 1UOGA 3T08A 5DAVA 1G9AA 3O1PA 4BZ4A 3BPSA 1AR83 1WLTA 4MGKE 3TWIA 5FQ0B 4HONA 3HQXA 2C4XA 1W04A 4XTPA 4LK7A 1WLWA 2HYXA 1ZBA3 2JD9A 3H3ZA 3FBMA 2GC3A 2DVFA 3VBUB 3FWEA 4DOUA 5JOYA 1AR93 4JRLA 3RZHA 1T6GC 4AXOA 1VB4A 1XNBA 1IS4A 5EHDA 1YO8A 4XOGA 3AP6A 1VAKA 3QH6A 3VBHA 4M0HA 3O0WA 1LNSA 2ARBA 3SHRA 2ZGPA 2DTWA 3J7HA 2QNKA 2HWB1 3FHAA 1JOPA 3I3MA 2GU9A 2ZMNA 1H2KA 2ET1A 5CVRA 5CFDC 1GZWA 4XQ4A 3ZSJA 5FZEA 1PM7A 2ZOEB 2WFPA 3O1RA 1OHFA 4LTAA 3DN7A 1KS5A 4KWLA 1UMZA 3W21A 4QPYA 1TEIA 5KC5A 3MICA 1VBA3 1UIJA 1ND3B 2V73A 2DURA 3ILFA 2G19A 3FUOA 4RQPB 3RYRA 3JQWA 4XFCA 1HV1A 2E63A 1AXZA 2E32A 2JDPA 2V72A 5FKBA 2PTMA 2UY8A 2G9ZA 2D6OX 5EIYB 1JYNA 2YBSA 1ZRRA 2A6YA 1CN1A 2W1QA 4ATFA 2ZX0A 3QCWA 3POYA 3KQ4B 4HL0A 1MS0A 1UKGA 2YG0A 4JVAA 1RUF1 2VMDA 2ZMKA 3AMPA 3AXDA 3WUCA 3NWKA 4YFWA 4J1WA 5C9AA 4GQ7A 2DF7A 5JMCA 3AZYA 1AL23 1H4HA 4WM7B 3ZFFA 3H1MA 2FCVA 5CADA 3FX3A 2CYFA 5IVYA 2WRAA 4COZA 1JODA 3ACFA 2HEYF 1ZBE2 1YUDA 4IERA 1KDMA 1CAUB 4Q2FA 1YXWA 2Y0OA 4X6QB 1WCUA 2WT0A 2EAKA 5C9AB 1W0NA 1FNZA 1FV2A 5C70A 1PGSA 4NHXA 3RFRA 1N3QA 5F3CA 1ACCA 1OOPB 5KHIA 1AXYA 1AR72 1SPPA 3HT1A 1QNYA 1CZTA 3FC0A 1UYZA 3PNAA 3VBOB 3WHUA 1R083 4LKSA 4E4SA 5HV4A 2BVVA 3TEZA 1PMHX 3CO2A 5L19A 3LZZA 4QXCA 5FYBA 5CNAA 5JOZA 1US2A 2XGXA 5A7WA 2ZHMA 4LLFA 4JHZA 1F35A 1G7YA 1LGCA 4Q0VA 4YVSA 5BNPC 4ZHNA 4QQPA 1AJKA 1NZIA 4LUKA 5I0SA 1O3TA 1SFNA 2ARCA 2W46A 4IW3A 5B4XA 1AX0A 2JE8A 1IPJA 2RR13 2ZX4A 3B7MA 4A7KA 1F5FA 4B4RA 4CU8A 5LA1A 1W6OB 3RS6A 1GOFA 3MF9A 3J7MA 3FE5A 4BJ0A 1YQCA 1C1LA 3FMGA 4BB3A 5T50A 4K1YA 3OPTA 1S2EA 4XCAA 1WZXA 3ZXAC 2YFUA 4QQLA 3H7YA 3POEA 1W6OA 1PMJX 1WKYA 3TAYA 4C0BA 4CSWA 4L92A 3SNMA 1AL0G 4QMAA 4LO4B 1W2TA 1CIWA 2VBDA 3MW4A 3FHQA 4UBHA 5FZ0A 5JXGA 3HPNA 1AYN3 4NN0A 3K4DA 1OLME 4A3ZA 4M3CA 1HRI1 3HWJA 4RQPC 1EAH3 5IVEA 5FYIA 5F9TA 1UWWA 4IV3B 3THPA 1JZ3A 2X5IB 3DPRB 5DAQA 1YHFA 5KWRA 1VJ2A 1CESA 1VMJA 5IK8A 3S5QA 3PJQA 5J98B 3VD7A 4CCEA 2R061 1YQ6A 3LDRA 4D6RA 1UNBA 3IDEA 5ANQA 5CKNA 1R091 3K3NA 4P5YA 4B1MA 4BQ3A 4QKBA 4FOQA 2F17A 2VW0A 4TWTA 5FFOC 4ISRA 2VW1A 2WNEA 4FT8A 4N53A 4OI1A 2PAEA 1K5MC 4BIFA 4XXPA 1MZFA 1YYNA 4P00B 4PI0A 2DBNA 2FMYA 2JB4A 3ITQA 4Q4Y1 5F8PA 4K3UA 5BYNA 5T3NA 3ACHA 5DDJ3 5JDBA 4M4RA 4MGYE 4Z07A 3UGHA 1KRIA 5L9RA 4FOVA 1LAJA 2VL4A 3RZZA 1IQAA 2D3PA 2QQUA 4OZXA 1SDDB 4AQTA 5IJRA 1UY1A 2DUQA 2ZGSA 1RUD2 1ENXA 4MGQA 2OQ6A 1COV1 3AL6A 3DPRA 1HB3A 2QQMA 1RUD3 3W20A 5FO9B 1GICA 3NNMA 5IWFA 3V56A 1LOAA 1SBEA 3ZR6A 2WO7A 2A5ZA 2ZGUA 3M3EA 1EV13 2HWE2 2OIIA 2GP3A 1MR5A 2PQQA 3LWCA 4RN5A 4AW7A 3HNBM 3BTXA 4I0WB 4XFAA 2WA4A 2HWD3 4AHWA 4KNCA 1SDWA 3MUY1 3IMNA 1GNYA 2DVBA 2RE9A 4CPBA 3ZN6A 3RGBA 1GV9A 3I59A 4MXWA 2RM22 1HJGA 1UPSA 4LHKA 3P3NA 4FBFA 1LOFA 2KXLA 3T2TA 3VBRC 5CU1A 5C6CA 4ARXA 1HB4A 1ALYA 2RJKA 2Q1MA 3OSDA 1Q5OA 4DINB 2FHRA 2JIJA 1L7QA 2J1RA 3KWVA 4CDQB 2X53S 4Y26A 5FDBA 2YUEA 4DUWA 5A6ZA 1S0BA 1UQXA 3T09A 1AR73 2WAOA 5C5UA 1ENQA 2ZAAA 4AWDA 3VDDA 3VBFA 1H2NA 5FZGA 1H0BA 3ZXLA 1OLQA 2VAUA 5FXVA 5LRRA 3KSCA 3C2UA 4QXBA 5CAZA 3AJZA 3MIDA 2G9FA 5CKMA 5LA2A 4GA9A 4RD7A 2VZSA 4Q1RA 1XC6A 4GWNA 4HVOA 4OUEA 4LOSA 5SV5A 1CD3G 2Y6FA 2XHKA 5JOXA 4XQWA 1BHGA 4ASKA 4RA0A 2R6QA 4JDMA 3N7LA 3BU7A 3FFZA 3ORJA 3VZKA 4Y22B 1V6KA 2WA3A 2VGDA 3NAPA 1XNDA 3POGA 3TBDA 2VU9A 2ZGNA 4XE9A 4ZU7A 4BH9A 2J1UA 3MLLA 3NSTA 4TSVA 4G4FA 2GH2A 1IPKA 2Y60A 2XDVA 4UW6A 4W8JA 2QE3A 1H6YA 3LQCA 1RB8G 4FI9A 1PO21 1PGL2 3ELNA 1RUI1 1U5ZA 2JDZA 3GBFA 3CDZB 3O1UA 2E33A 1ZRFA 5H9PA 1SZBA 4XFHA 3R05A 1JYTA 2LM3A 2JG8C 4UFKA 1UYXA 3ZXFA 1Q8PA 3OYWA 4G3YC 1RUG2 3ZFFC 5I0UA 1UOJA 3GZTB 1IKPA 1EP0A 4CEWC 2OS2A 2UYAA 2DCKA 2YDEA 4IV3C 4IGQA 3RWKX 3NV1A 1QOSA 2RMU3 1W8NA 2YC2A 3IM0A 1V6OA 5EV7A 1KJRA 2HJIA 4CVUA 1GWKA 1S0FA 2PELA 3EHKA 2WLPA 3ST7A 3USSA 4A2UA 2P2KA 5EYXA 4D6SA 1GP4A 3K75B 3SITA 3B94A 1KEXA 3DECA 3ZMOA 4XDOA 1TE1B 1AR63 4FQZA 4JZRA 1NXMA 5I8YA 2JE9A 2QUOA 2XVGA 3U4XA 1WA4A 4LA3A 3LEKA 5CEHA 4O61A 2QBXA 1ZZ6A 2XJRA 1CAVA 1BQPA 3ENRA 4LUMA 1F4HA 1NCQB 3APBA 3ZXKA 3E6CC 3HOBA 3FUQA 2WO3A 2W68A 4CCLA 1GLHA 4CXYA 1VMHA 1W2OA 2JDMA 3PTYA 5C4WB 1XBFA 1W03A 5E89A 2ZEYA 4I2OA 3ZIXA 4Q4V1 1J84A 3IIIA 4NRQA 1EPWA 3L2HA 3ETPA 4YWAA 1J3QA 3LFMA 1RUE2 2ZKNA 4YGEA 1OFNA 3GF6A 5F39A 3OBRA 3NVCA 5JI7A 1P8JA 1SACA 2DDUA 4K9SA 1ZBA2 5CG9A 2P3YA 3D4KA 2J7MA 1RIRA 3DYOA 5JXJA 2Z5WA 1LCLA 1YI9A 5KHJA 2TNFA 1OMIA 2QQWA 1DP0A 1G86A 2GNTA 1QXPA 2W47A 4A7ZA 4AI9A 4BQYA 3RI8A 2VBPA 3M1HA 5FUPA 2VOKA 1WCKA 2GDFA 2WNUC 1BBT2 3B93A 4UXAA 4QX1A 2XOMA 3AP9A 3W59A 5I93A 2XJSA 4D7YA 2C0ZA 4QQHA 4OHWA 3C7FA 3A22A 5FXWA 3T2PA 3WNMA 2GN7A 3VL9A 4OQ8A 1ZZ8A 5DN2A 1DYPA 1LENA 2WZR1 2WZ8A 5I0TA 5JUVA 2BWCA 1VBC2 2VOTA 1SPPB 2VMHA 1A3KA 3AFKA 4E4HA 3Q8FA 1NYWA 3KVBA 4UT5A 4G9SB 2VZVA 2A71A 1DGWA 1JMUB 2CGNA 2HWF1 1W39A 3UESA 1H9PA 3MIBA 4AEMA 4JGYB 5JSPA 1WMFA 3E5XA 4JDOA 3PUQA 4TZDA 5H9QA 5T5LA 2D6PA 2Q8EA 1UKRA 2VUDA 2UYBA 1LHNA 2W91A 4LXLA 3H3LA 4UYBA 2OYZA 3VBSB 3ZFGB 3W58A 3WV6A 4NHMA 5A6QA 2IFWA 1GU3A 4AQ2A 4XHXA 4CDWB 5CZKA 4EN9B 4XBNA 3OPWA 3QOPA 4FFIA 5FZMA 4CCMA 3H1WA 3IPVB 2C5DA 4UW4A 4D94A 1RUG1 1QQP3 4KQ7A 3D6EA 5LBCA 1HQWA 3ZDSA 2RM21 4HETA 2ILMA 3GHMA 2B9UA 4B7EA 3I2JA 1AUYA 3MW3A 3UL2A 5CFCB 2HWC2 5FOJB 5FZOA 4Q4W2 3WNXA 4AQSA 4URAA 2RG4A 1POV0 2YC4A 3WG2A 3LA2A 2D40A 1QJU3 2V4VA 3VBRA 1AYN1 4R52A 4PDWB 3H1YA 4XVHA 2VO5A 1OD3A 4LKEA 5GLTA 1PGW2 2I07B 2QQLA 2Q8DA 3RRDA 1UY3A 2OX0A 4F83A 3MFAA 1W0OA 4FO9A 2VMEA 1Z7S2 1XYNA 4YZ5A 1OBNA 3HD8B 1ULOA 4GH4A 3VZOA 4LNVA 2WNVA 4Q5OA 1UY0A 1H9WA 4O65A 4UOJA 5E1RA 1JXNA 5IFPA 4QM9A 3RQ0A 4HBNA 5LBEA 1NKGA 5BV6A 3N4MA 1TQ5A 1XPWA 4QX0A 4XFIA 3AZWA 4P9GA 2RDSA 5CFCA 3AKPA 4RHV2 5FP9A 4CEYA 4WVVA 2WSUA 4WZCA 5B2GB 4HKWA 4FPLA 4BOWA 2VZRA 1H8TC 5FY7A 5FZBA 3GXUA 4AFDA 1W8UA 3USUB 3ZSLA 2MEV2 4KWUA 1D2QA 3EYPA 4WVWA 4GB31 4YVWB 4Y20A 3RI9A 3NV3A 3A7QA 2BOIA 2PAMA 3WDXA 1ASJ1 1HDKA 2IXHA 1JI6A 3MV01 5LWBA 3ZFEC 3T1LA 1R081 2A6VA 5E88A 4E4ZA 2Y6KA 2WWJA 1S2BA 1X8EA 4HKOA 4YGDA 2D6LX 5CA6A 3S7IA 3IMMA 1RUE3 1RUI3 1HRV2 2RS13 3D0SA 4NPMA 1OOPA 2ZGLA 3I2OA 5BNNA 3ATGA 4DZGA 1OSGA 3I97A 2B39A 4FPGA 4B3NA 2AR6A 2BUKA 1LU1A 2O8QA 4LO6B 1MQTC 2NYYA 2YBKA 2YU2A 4Y1UA 3VV1A 1O3RA 3IAQA 4KBZA 4RR3A 3WDYA 2YFZA 2A75A 5A32A 1GZCA 4WBBA 3AJYA 1RUF3 2XLFA 4JTNA 3PVNA 3PDQA 1H8TB 1X36A 3DGTA 3VDCA 4LIVA 1ZZBA 4N9IA 4DXTA 1AJOA 1J1LA 1MS1A 3ZXEA 2VVFA 1W6PA 4XXAA 1AR62 5K9YA 3EO6A 3FL7A 1TMF1 1S55A 3INAA 3OUHA 1ENRA 4HG6B 4DMIA 1W9WA 3DXTA 1ODNA 1XRUA 5LB6A 1ND2B 4WM8C 3ZFEB 4AE2A 1JZ8A 4COUA 3THDA 5BNOA 4RS5A 1Q8OA 4DPNA 1YWKA 2FCTA 3O0VA 3Q8CA 1NCQC 4IEZA 2XVLA 1ZZCA 4YW7A 3AKSA 2OKXA 3T2OA 5B4NA 3UNPA 3I2HA 1QIQA 2WQ4A 3IBMA 4XMIA 4KL1A 2WUHA 5CB7A 4AGVA 5FYCA 5BNQA 3RZMA 1DDLA 4ES8A 1AR71 1N3OA 1JZ6A 3NJVA 2XLGA 5I8TA 1W6MB 2YGLA 4IV1B 1RITA 4IEQA 4CDQC 4NIDA 2V09A 4BLJA 1OF3A 2QCSB 4UW3A 3GBWA 1QKQA 2PLV3 1RUG3 4F8AA 5KHKA 1K3IA 2D44A 5C8CC 1DYOA 2JG8B 5LK7B 3OTFA 1JZ7A 1NCQA 2ZGQA 1SCSA 4BHPA 2EIEA 4JKLA 5EQUA 3NNGA 3IPVA 3VDDB 4AG4A 5JLVA 1MPXA 3QLQA 1NX9A 2CGPA 1R082 2CAUA 3VL8A 3NJXA 1U5IA 2NMNA 2WL1A 1SBFA 2XXZA 2OZ6A 1HB1A 5FP3A 3U1XA 3ZKUA 2BBAA 2CNAA 2L9LA 5D8AA 2FDFA 1ZVFA 2GMMA 2A7AA 2IZWA 3VBOA 1FOD3 5C8CA 1JZ5A 3M3CA 5T55A 3HQUA 4AEKA 5G05L 2D93A 4U36A 2WDBA 3AB0A 1FOD1 4LJHA 2Y33A 2W1SA 1V00A 4N43B 3ZPOA 1VP6A 1WD4A 2WWUA 3C3VA 4XFBA 4LIUA 4HK8A 2BFUS 3KB5A 4L2NA 5FOBB 5D8AC 5J37A 4UFMA 2VXJA 4PLMA 4BMBA 3LF7A 2EXJA 3NRUA 4JDNA 3WQ0A 2Q5TA 3P1IA 5GZCA 2BNMA 2GP5A 2NMOA 4YZ1A 3BU0A 1DZRA 1W3XA 4MADA 2E53A 2GNDA 5AFBA 1Y3TA 1NLSA 5HCAA 1UCXA 1H4GA 3OUIA 1QJX1 3MV11 3PMEA 4Q29A 2GAUA 3POJA 3SKVA 4E8DA 1UU4A 3IZOA 1NE4A 4GXLA 4IEVA 2VQTA 5IAXA 2Q4SA 3NJYA 3JXSA 4HN0A 1L7LA 2PHRA 4R9CA 3KM5A 3ETQA 1FOD2 1HRI3 1WBLA 5A1FA 1GZWB 2ZAHA 4IE7A 4P9JA 1LOBA 3OGSA 4CU7A 1MEC2 3OD0A 3I8TA 4YGCA 4JGZB 3I2FA 1AX2A 3U37A 5DXDA 1PX4A 1H1MA 1WA6X 2VZUA 5F5AA 5FZ7A 5LEJA 1ZRCA 4D7SA 1QJEA 3POFA 4N9HA 2JECA 4EE2A 5FPBA 2ZGOA 1EV12 3ON7A 4NE9A 3QD6A 1AR61 5C9AC 3H7JA 1T2XA 3OPZA 5JR2A 2J1AA 2UY9A 3QH7A 2B4KA 3LA3A 4QDQA 4JQTA 1CONA 1RUC2 3JUUA 4FXKB 1UZVA 5ABJB 4ZXKA 1W99A 2RDQA 3ZLIA 2FDJA 1OUSA 2ET7A 2YPDA 4YW4A 1SLBA 2D7FA 1QOTA 2JIGA 4S2DA 4UF0A 5F5CA 3POIA 1VIWB 1LTEA 1UXZA 2DUOA 3B3QE 3H3UA 2ZTNA 4Y1YA 3WP3A 4CCKA 4E2SA 2BVBA 2Q1FA 4NPLA 1KITA 5CIRA 1S4CA 4ASMB 4Q26A 1NCRA 4MXVA 1IQDC 1VALA 4FPOB 5GZDA 4JQRA 4Y5SA 2R041 4YZ2A 4IDZA 2DCYA 3OJBA 4OFGA 2HBTA 2VZ1A 4FVVA 4QD2A 3AK0A 4GD4A 2WNUB 3AYEA 1MZEA 3I4IA 1VMFA 2RS32 2XR4A 1VBB3 2ZZQA 3GM8A 3H8RA 1HV0A 2D98A 3K2OA 1NA1B 3MZHA 2NQYA 1XNAA 1ZZ9A 1CAXA 2MHFA 4LHLA 2R073 5FPAA 1ZNPA 2BERA 3USUA 5A1AA 1J3RA 2IWGB 5IYYA 2VPVA 3CKHA 1FI2A 3HQRA 1W8OA 3W5MA 1W6QB 4N43A 2OQ7A 2ZEZA 3CLPA 5K0UB 1O4TA 1X9TA 3CU7A 1RUI2 2D97A 3FZ3A 4KG0A 2F4LA 2BU9A 2HKXA 1OOPC 1GR3A 4XILA 3B01A 5FZ1A 4CYDA 4QPIA 1UXXX 2J22A 2VTXA 1VBB1 3ACGA 3AM2A 4HLTA 3I3BA 1RUE1 4RGKA 5JWPA 4LE4A 1Y7BA 2K0GA 3MLKA 1B09A 5JZGB 3L9JT 4R4XA 3LEGA 5LEKA 1FMD3 3IDBB 3WW1A 3FLPA 1W9SA 4XQDA 5JXHA 3GALA 1PVC2 2P3IA 1JHNA 1OQ1A 2ZKLA 1ASJ3 2P6CA 2HWB3 1FX5A 4AVCA 5EPAA 5J48A 4P9XA 3VBFB 3KV4A 2JDYA 2ZGTA 1W8WA 4L99A 4YW2A 2A6WA 1MVQA 1US3A 1X82A 2PHWA 3HJRA 4LULA 4QKNA 1FYUA 2VQ0A 4DXZA 2XKOA 4BQ1A 1PO12 3BVCA 2WS92 1AR91 3PVEA 5A1LA 1MQTB 2YY1A 4IEXA 1QU0A 3OY8A 1KDKA 2JDKA 3ZYPA 4CEYB 1OXCA 1REEA 1RYYA 2XJUA 3M2MA 3UKTA 4AVBA 1UO9A 1N47A 1RVF2 2X5IC 1AR81 2Y8KA 4QM8A 4ITCA 5A7PA 3SH3A 3B00A 4WV8A 2XJTA 4Y4YA 2EICA 3OGVA 3AP7A 1HX6A 4KBBA 4KGGA 3WDTA 1N3PA 1HN1A 1VBD1 4Z2WA 2VTXJ 3SXWA 3GZAA 1X9PA 4Y4RA 5FYYA 3M7AA 4DXSA 1O3SA 2BNNA 2HWC1 4LLOA 2WS93 3DCQA 2ZGKA 2JENA 2QVSB 3I3QA 4EWDA 4DRRA 4FOYA 2WQ8A 1LECA 1UX6A 1VBC3 1OVPA 2W92A 3HVDA 3AX4A 4NHLA 5CFDA 5KBFA 5K0UC 4MGSA 1ND3A 5GZGA 1QQP1 1BKZA 1O4ZA 3Q8EA 4F3JA 5IVCA 1SHWB 5FBZA 2ZHKA 2ORXA 5IFTA 3AKRA 3QBQA 1PVXA 1ZBE1 3IIAA 3ZKYA 2R063 1CZVA 3VDDC 5ABJC 3AMMA 2W94A 4Z92B 1NQDA 2OT7A 1CWPA 4CCNA 2YXSA 3ZSMA 1W6NA 3KD4A 1N1YA 1QJU2 2Q30A 4H14A 4HN1A 4UAPA 4YYOA 3EJKA 4Q4V3 5K0UA 1SMVA 4EQVA 4CXWA 2XBO3 4GWMA 2GNBA 4CU9A 2HWC3 3VKOA 4AI8A 2DVDA 4GALA 1QEXA 4QGLA 4Q4V2 5KXDA 1VB2A 2RS53 2UWAA 3SEPA 2H0VA 4KG8A 4R8HA 2WZR2 2WNVC 5LA9A 1YFUA 1SCRA 1F4AA 5C3PA 1VBD3 4XIKA 4O7XA 4ZZ8A 4MSVA 4FTSA 2XQXA 4RL7A 3FLRA 2KM2A 2R072 4XDPA 3WOGA 4OI0A 1NT0A 3MIFA 2NZ9A 5FZHA 5T54A 4AZZA 3TEWA 1V0AA 2WZPP 3VUOA 5D8AB 5EFUA 1QY4A 3S7EA 4MX3A 3BB6A 1UAIA 4CA9A 5IVVA 3S30A 2EIGA 5ISLA 2HLEA 3Q8AA 2WYSA 5HBAA 4E27A 3ZSEA 2MNGA 4PIZA 2IXKA 2PHFA 4CEWB 1GUIA 2CTVA 4DFSA 1FXZA 2I74A 1JU3A 4Q4X1 5A7NA 4TYSA 2GH8A 1PGW1 4YZ3A 2ETEA 3ZX7A 1LHOA 1QJY1 3U0ZA 2JXAA 5C4WA 1W2AX 1XXNA 5E8AA 1URXA 4EYUA 3NNJA 3G6JB 1PM4A 4CEWA 5AC92 4J25A 2VNOA 3VZLA 3VD3A 3KF3A 1W0PA 1QJZA 1PK6B 1Y9MA 2OA2A 2VD7A 4XUNA 2VMFA 2YU1A 1ZZ7A 4LBOA 5EP9A 3NJZA 4XUQA 1UZ0A 4FFHA 2FDKA 2Y26A 2BV4A 1AYM3 3ACLA 1DQ1A 1R092 1TMF3 3DUIA 3RZKA 4FPKA 1YNAA 3KHCA 4XACA 3LD8A 2A3XA 2D43A 4OQ9A 4DY3A 1AL21 4MG2A 5FO8B 2XQRA 1BEV3 5EJZB 5JPMB 4IEWA 1NZCA 2O1QA 3WG3A 1WW5A 1E5HA 3WNNA 1O6UA 1XYPA 1MVEA 3C7OA 4YG0A 4BXFA 3KT1A 4H55A 2GSYA 3V64A 2AENA 1LULA 2Y6HA 4UFJA 3RZLA 3PTRB 2R071 3OCPA 2OXBA 4LBKA 4RS5C 1ASJ2 2QQKA 5FMDA 1CR7A 1K12A 2JG9C 1R1ZA 3AMHA 2QFEA 5APAA 2R062 3V65A 4XBLA 2HWF2 1AYM1 1PK6A 4IQPA 4XUPA 1QNWA 2BZDA 2DVGA 2RS11 2WZEA 4XYXA 1TME2 1FMD2 4E8CA 5LRSA 3EBRA 1V6NA 3CQOA 4LITA 1A34A 1K5JA 3VDBA 4M3CF 4Z82A 2JE7A 5HXVA 2XKPA 3I2DA 5DUWA 5E16A 1WCSA 5EYYA 4YW3A 3RZJA 5FZFA 1UMIA 3IT8A 4Q4X3 1BXHA 2YB7A 1UYPA 2D5FA 2JG9A 4GB33 5FJKA 5FPVA 3OUJA 5LBFA 2HEWF 3N35A 3UV9A 4JV4A 2FDIA 5F1RA 1SLIA
chains in the Genus database with same CATH topology
1S2KA 1B35B 2JX9A 1HQLA 1S0CA 1UU6A 3WQ1A 4H7LA 4AI1A 2UWBA 5FPXA 3GZUC 5FLIA 4GH4B 2XJVA 3BODA 1RUNA 1DQ5A 3JZVA 4IV1C 1WBFA 3ZPYA 3WG4A 4NR1A 1BBT1 4W6YA 3CJIA 5JOWA 1VRH1 3J26N 4IEYA 2Z69A 2E6VA 1TNRA 2JJ6A 1WMEA 3B9CA 1Z78A 3KGLA 1BVP1 3BOPA 1FPN3 1DU3D 2XBO1 4DY5A 3JB4C 1V6IA 4AI3A 1LOEA 4LE3A 4UW5A 1WLCA 1ZX5A 3VN4A 4PBOA 2DU1A 1G6NA 4TLFA 3R6SA 2B8MA 4Y1ZA 3TNPB 4B29A 5AFEA 2RM23 4CP0A 1KD7A 2VXRA 3WXPA 4AEJA 2A6ZA 1N1VA 2OW4A 5JI9A 5L7OC 1IHMA 2Z42A 1O7FA 1W6PB 1VBC1 5BXXA 5KC6A 2ERFA 2VOXA 4GH4C 3ILNA 4XIOA 1JUIA 1CPNA 2HWD1 2XVKA 1CJDA 3ZN4A 2WS91 2HWF3 2CAVA 3D5OA 3VGIA 3ZYGA 2OUJA 1HRI2 1E57A 2VMIA 1UW8A 1LOGA 1RHI2 4QPGB 1S0IA 1RUD1 3K48A 4M0NA 5AVAA 3VKLA 4C1XA 3NAPB 5AVPA 3RWNA 3T1MA 1DG6A 2ZS6B 2WIIB 3WQ7A 4XEZA 1Q8SA 2QKDA 2OVUA 5CFCC 1S0EA 4HFSA 1OLRA 1SLLA 2W08A 1QOOA 2WLQA 5JR7B 4MUVA 2A3WA 1LGNA 3H50A 2GALA 3J9SA 4EN7B 2YMZA 2RR11 1LGBA 3ZYIB 3OBTA 2XL9A 4WVMB 1OKQA 4KH9A 4YRDA 5BNPB 1YCIA 4H7MA 4FPEA 1SLCA 3LOIA 1NG0A 3ZFEA 4LBQD 1SEFA 2RR12 3A0KA 3QACA 5JCTA 3J8F3 3NKTA 1HXS1 3MEPA 4MGZE 5L73A 2BGCA 4META 1G9DA 4JGYC 1VLNA 4SBVA 1FMD1 4B7KA 3WR0A 1POV1 4IETA 1RGSA 3RMXA 4A7YA 4I01A 1ULGA 4FPYA 5FRAA 3SH5A 3RNSA 1ONAA 2BTVC 4AHZA 1YIPA 2IFRA 4N53C 3WG1A 4L9BA 1KXGA 4GULA 1A8DA 1PZ8A 3MIGA 4PCRA 2QDNA 4QPIB 3ZYRA 4MGIE 1EYBA 2ZGMA 4IEOA 5GLZA 1B35C 3RYKA 4BE3A 1QH7A 3ME2A 1ULDA 4MYEA 1WW7A 3WCSA 3Q9OA 2RMU1 2DFBA 4XF3A 2XBO2 2W39A 4YVWA 4FPJA 1BEV2 1PMIA 1DYKA 1IKQA 4IEUA 3L2YA 1OD5A 2R32A 5FCCA 4MH0E 1ULCA 4WM7C 2R043 3VBSA 3ZFGA 4L97A 3ILRA 4DB5A 5L36A 4Q4X2 4RSUA 3FJSA 4KGQA 3G7DA 2DYCA 4FP2A 4YG6A 4CP1A 1D0GA 1UIKA 1UL9A 1DF0A 1NCRB 1ULEA 3N7JA 5IK4A 3CJXA 4OUMA 1FATA 1DZTA 2GZWA 1UZZA 2BQPA 3VBOC 1H1IA 2X29A 3POWA 1ENSA 2WT1A 4KU7A 4LO7A 2FQPA 1JH5A 1G8WA 1OFSA 4LBNA 1NY71 4JGZC 3CL1A 3R4SA 4Y24A 4AYUA 3SISA 2F6BA 5A3MA 3OY8B 4Q4Y2 3CF6E 4D7TA 1OQDA 4DRVA 5DZEA 5IK5A 1C1FA 3VHRA 1Q8QA 5EXOA 4YG3A 4L8QA 2JKBA 2VVEA 5DZGA 3TN92 4ZKTB 1SLTA 3D8CA 1D0HA 2GC0A 4E2QA 1QJU1 5KXBA 1UZYA 2MEV3 3KQRA 4ZU5A 2Y38A 4R9AA 3ZSKA 4MV2A 1CAWB 4IV1A 5JZGA 2IXCA 5KXCA 1BYHA 4AEDA 1R1A3 3VZJA 5I0RA 2VG9A 3KCCA 3NAPC 3UKVA 1JTZX 1U0AA 3N36A 4K8FA 4YW5A 3MIEA 5IUQA 2AUYA 1QJX3 2P34A 4YLZA 5FMOL 2AZ5A 4P9WA 3HT2A 1ZM1A 1RC6A 2HYKA 5DUVA 4H3WA 1O91A 3WDVA 1OPOA 1RINA 5JZGC 3TYJA 5J09A 3IDCB 1UU5A 3HN1A 3HIFA 4RFT0 4BYYA 4E9KA 4R9BA 5A33B 2VECA 4XZPA 1PO22 1PGL1 3BCWA 2MPFA 1I9RA 4JCKA 5EZWA 1V6JA 2R0HA 5BNNC 4NOTA 3BPZA 1SFYA 1COV3 1H8TA 2WZR3 1J1TA 3ZMNA 3WINE 2E7AA 4FQ4A 1QQP2 2JG9B 2VULA 4B8EA 4QXKA 2CGOA 3N3HA 3ZIWA 1XE8A 5DDJ1 4S2GA 2YV8A 2Q1ZB 4Q4Y3 2RS33 5T5OA 2RJLA 1H30A 4NPRA 1JBCA 4XETA 3SCFA 5J96B 2UU8A 2R1BA 4ISQA 3NL1A 5JIUA 2PLV1 1D4M2 1GZ9A 2HEVF 1ULFA 1A6CA 1UPIA 3O7OA 2B5HA 1C8NA 3U10A 1AF9A 3SH4A 3ZXJA 5GJ6A 1SQ4A 3SMHA 2ES3A 3I59B 4LBMA 4P9IA 5LK5A 1F31A 3IN9A 1DGRA 2BW8A 4OHYA 1GFF2 4PF5A 4AVSA 3H0OA 2ZHLA 4JC1A 2B7YA 3R4UA 4WVMA 2NP0A 1CAXB 2ZHNA 1LR5A 2YROA 3P3PA 1JYCA 1AVBA 1CJPA 1I6XA 1U12A 3M3QA 1TME1 4XTMA 2EVXA 2OUHA 1RVF3 4Q4W3 3OYWB 4YM2A 1PK6C 4CDXC 5C33A 1ND2C 3FFQA 2XB6C 2XWBB 3D82A 2ENRA 5ACA1 5FMOS 5A32B 2NLRA 2H6CA 1COV2 2A6XA 1F8VA 1LHWA 2WFF3 3PLQA 3V0BA 3M70A 2PHLA 1VAMA 5A3LA 4EN6B 2DWRA 5CG8A 1BJQA 1J58A 5BNNB 1M06G 2XJQA 5SV8A 3JD73 1A78A 3GYDA 3ROUA 2DVAA 1LJ7A 3AP5A 2IXJA 3B9IA 1ND2A 4QPGA 5DG2A 2EA7A 3O5SA 1PNGA 3GHNA 3E5QA 2NPIA 4OHZA 4W6WA 3POSA 4CDUB 1V6LA 1YLLA 4NWWA 1KFXL 2YZ4A 5CFDB 5HI0A 2HWD2 1LODA 3TOJA 5EJ3A 2PHUA 1XQNA 3J8F2 1WMDA 4XJ8A 2WNVB 3OD4A 2D6KA 3KLSA 1YFXA 1RHI1 1QXRA 1GSLA 2PFWA 2BYVE 4BMEA 5FAXA 3U11A 2WFF1 3ASIA 2B42B 3JCIA 4QX5A 3RSJA 3M3OA 4AF9A 2DCJA 1OA4A 2FMDA 1VBA1 2F4PA 3VBRB 5J3UA 1VBE3 3VKMA 1Q56A 2ZABA 1ZYBA 3LCPA 1CX4A 1VBB2 2C1FA 3WP4A 3V0AB 2B46X 3ECQA 3AZVA 3H9AA 5ABJA 5IT6A 4SLIA 1RUC1 4P9YA 2EALA 3ZO0B 4KWKA 5BNOB 1NXD1 1PVC1 3WX5A 1I3HA 3UJOA 1CGPA 3AFGA 4CEYC 1MZ6A 3VKNA 4O9EA 3VBUA 4K21A 4XFFA 2DCZA 2QJVA 1QGLA 4QT6A 2AGSA 1D2SA 1ZBA1 1YIFA 2Z79A 2FZ2A 2ZCWA 1J59A 4J1XA 1PIV2 1V9U2 3WCRA 2RHPA 1NCRC 2V5YA 3O12A 4I09A 4C0HA 2LTNA 1XYOA 1GNHA 2R042 5GZEA 4HK9A 1C3HA 1SLAA 2I45A 2WWSA 3BALA 5K7PA 3A4UA 2SBAA 4IL7A 5FREA 1QXJA 1H2MA 1RUH3 1YI7A 4YNIA 4LA2A 2E9QA 3VHNA 1BMV1 4PDWC 1Y43B 1C8M3 1BVVA 1WUVA 3HBZA 4J6GA 3VHOA 5GLUA 4HVRA 4CTEA 5BNPA 1C8M1 4V1PA 4AVAA 4OI2A 3MLJA 1J3PA 4CDWA 4XMAA 1CPMA 1YRZA 3JBG1 3NV4A 3WHTA 4Y5Z0 2CV6A 4Q0SA 1GYKA 3LB9A 4WM8A 3K51A 4Y22A 2JD4A 3LSDA 2WSVA 4N53B 4BCUA 2HWE3 4PIYA 1VBE2 3MPBA 4FP3A 4CP2A 1F5JA 5JVVA 4HSJA 1GQGA 3RMYA 1D4M1 3LA7A 4IV3A 4QU2A 2D3RA 1WD3A 3J4UH 3AXEA 4XJWA 2GMEA 1RUJ2 2O0OA 4I30A 4F7ZA 5H9RA 5KHHA 4ONUA 4RQPA 4FXGB 3WVJA 5AC91 1CAWA 4K20A 4O9GA 1B35A 2VY0A 4R4ZA 1MEC1 2R49A 4Q1PA 1OI6A 2OZJA 1FT9A 1U5XA 1RJ8A 2VW2A 5TSWA 4Q0QA 1QHDA 1G9CA 4JTOA 3JU9A 3E97A 2TUNA 3WDWA 1CQ9A 2G4IA 1LU2A 1WCDJ 4N7UA 2R30A 1EAH2 3THTA 1DLLA 4AHXA 1RUJ1 4LT5A 2XWJB 2R16A 4XDQA 4PJYA 3AZZA 2AH2A 4M00A 4COVA 2PA7A 4BM8A 4E4DX 3VZMA 2BPA2 2LALA 4XBQA 4AFCA 1HRV3 2RS12 2A73B 4GB32 1AYM2 1CAVB 1O5LA 3WW3A 3CJIB 4D69A 2IXIA 2P37A 1K5MA 1ND3C 2AREA 1PO23 4MXWB 2A70A 3WZ1A 4MVTA 3ES1A 2DUPA 3VBHC 3LKJA 3PHMA 3KT7A 3CNAA 4M3CE 2Q8OA 1HRV1 4GMP0 5JIAA 3UJQA 2VUAA 1RMU1 4QPGC 3JD71 1F2NA 2E7TA 1NOVA 4OI4A 3RG0A 3TN91 4EWAA 2XUMA 3H8UA 4Q8LA 2K2SA 4HANA 5DDJ2 3PMSA 1N1SA 1I5ZA 3IWZA 5ACA3 1PZ7A 1MACA 3DKWA 1IGOA 1C4RA 4PLOA 3LAGA 5F6KA 2ZJCA 5BUVA 4HZFA 4NO4A 4M01A 3TB0A 4AVVA 3AYCA 3V0AA 4W65A 1Z7S3 2WQZC 5CBLA 4BWOA 3KMHA 2IC1A 4OHXA 5I91A 1S1AA 1ZREA 4BPZA 1KQRA 1VR3A 1AL22 2D5HA 3ZXDA 1V6MA 4XJZA 2PYTA 1KFUL 5AC93 1YFYA 4YM3A 4QGNA 3PVOA 3OGGA 3B02A 2Y0IA 3WP5A 2WKKA 4RS5B 3WD5A 4OUSA 1QH6A 2GN3A 4W6XA 3R4DB 5T52A 4YSFA 1APNA 1PO11 2VQAA 1G9FA 2D6MA 5BY5A 4Y1XA 3IKWA 4AI2A 1EV11 2PHDA 2ARXA 2JG8A 4ES9A 4AFMA 1RJ7A 2O8OA 1S0JA 4GMP1 1EY2A 2FBEA 2WFF2 4YM0A 5FLJA 1XE7A 3E5UA 3PJYA 4N43C 1LEMA 2GC1A 1X8MA 2R0FA 3EXUA 4GIQA 4YVSC 1O3QA 1JN2P 1X50A 2DCTA 5C4WC 1W6QA 1MS4A 4JGYA 1Z0HA 1RUH1 4P14A 4FOWA 5F5QA 1PIV1 1HLCA 2VMGA 3AYDA 4P9LA 1PHMA 1C57A 3AYAA 1Q43A 3DL3A 4FAHA 1KS4A 4AGRA 2VVDA 1R093 3RJ2X 3ALQA 4S2FA 5T5PA 4AFAA 1IZ3A 4IESA 5T5JA 4HPKB 5EWSA 1DBNA 3WY6A 2VUJA 1BCXA 1EAH1 1ZRDA 4COWA 2QZ2A 1DQ0A 4RGAA 5JSOA 3M8LA 3VZNA 3FHIB 4RR3B 2E51A 4XJUA 1O5UA 1Q3EA 2ZX1A 5GZFA 1MZ5A 5DG1A 5J36A 1AXKA 3WW4A 3PVBB 3X29B 1OA3A 1H8VA 1PVC3 1R1A1 1VBA2 4AFBA 4XF4A 2DFCA 3OF1A 1BK1A 4OHVA 3UKNA 3RDIA 4FSJA 2CY6A 2G9GA 1I1EA 2UWCA 3VKFC 2ZA9A 4BIOA 4N7IA 2NM1A 4CDUC 2P17A 4R9DA 3DV8A 1VBD2 3NV2A 2VNGA 3VBSC 3ZFGC 5J7MA 4JAAA 2ZBJA 2EF6A 2ZZJA 1PO13 4WVZA 1PZ9A 1U5YA 2RMU2 1LESA 3HR9A 1CVNA 3TNQA 3DPRC 4K40A 5FO7B 2KA3A 2ZMLA 4NWVA 4JGZA 1W6NB 3AMQA 2HWB2 2QDRA 4YM1A 5F6LB 3JB8A 1LOFC 4OVEA 1MS5A 4LO8A 4WM8B 3ZVXA 4LEJA 3SCHA 3SLIA 3CJIC 4XF1A 4B4PA 1QWRA 3ES4A 4I0AA 4XJAA 1MS9A 1RUOA 4YFZA 5L7OA 2DV9A 4COYA 1RTVA 4Q0UA 2TEPA 3I7DA 5ACA2 3KGZA 1XNKA 2LUWA 2YYOA 1QJX2 3M3IA 4PIXA 4AEDB 4ATEA 2YHJA 1JOJA 4PQ9A 2TBVA 1RUJ3 4AGGA 4OLLA 1R1A2 3DF0A 2JICA 4AEDC 1HXS2 4HSLA 5JPNB 1LB2A 4RHV1 3FLTA 4XW3A 5KXEA 1C5HA 2NN8A 4XF0A 2WT2A 3TN93 4FAGA 4LBJA 1OQEA 4N90A 2W0XA 2ZX3A 1FPN2 3WLUA 4Y20B 3FBYA 1H1AA 2B45X 4P5HA 1Q8VA 2PHTA 4U2AA 4BA6A 4DQAA 5FQ0A 2PHXA 2ZPXA 1BZWA 2D6NA 5JSRA 3I54A 3B5LB 2EAAA 1POV3 2N7GA 3VBHB 1AHSA 4XHBA 1LRHA 3MF6A 3J8F1 1RL3A 1FNYA 2H6BA 4Z8BA 2VNRA 3AMNA 1V70A 2HWE1 1DHKB 4NVPA 2X8KA 2XJPA 4ZU4A 4FTBA 1LHVA 5C8WA 1DIWA 4RGGA 2W52A 4MLOA 1O4YA 1LOCA 4EN8B 1LHUA 4C1WA 5KHGA 5DUXA 1S0DA 1AX1A 4LHNA 1V9U3 2UURA 3ZN5A 4YW1A 2YGMA 3MFCA 1G9BA 3MI8A 4FCAA 4YGBA 3BIWE 1MEC3 2YC0A 3LOBA 1QJY2 1NY72 3BOWA 4I3GA 3WT3A 4XJ9A 4S2HA 4YVWC 3ZN6B 1WW6A 4YARA 4URTA 2BEOA 2R1DA 4BLIA 1DGWX 2CWSA 1RUH2 4HPKA 3WDUA 3MIHA 3ZXGA 1EPZA 4HVQA 2K9ZA 1UF2C 2GMPA 1NQJA 2BFUL 4LR4A 1TMF2 1ZBE3 1RMU2 4PLNA 3RPQA 4A3XA 4MZUA 3GBGA 5BNOC 1WW4A 3JBG3 4LO5B 3S6PA 3GNEA 2EXIA 1PIV3 3ZFFB 1MQTA 2ZX2A 3V0BB 1C8M2 3MYXA 4RR3C 3VLBB 3KCYA 4EV0A 3N7KA 4PBPA 1YFWA 2EXHA 4ASLA 1KJLA 4Q27A 1DQ4A 4Y1VA 2WNUA 1MS3A 1RUC3 5BPXA 4CDXA 1REFA 2VOWA 2OPKA 2MEV1 4GMP3 1IS5A 2D3SA 4L11A 4LBLA 3KZ4C 5GM0A 3N7MA 1N1TA 4D3WA 1GKBA 4FPCA 2I2SA 1GBGA 1LKNA 1NE6A 2BNOA 3AKQA 4X8PA 5HCBA 4JRAA 2C9AA 1CAUA 1OPMA 4LBQB 3A0NA 3VHPA 2DU0A 5DUUA 3MW2A 1JW6A 4CRQA 1RHI3 3NKGA 2DTYA 3AKTA 4CDQA 2PLV2 1QF3A 1XU2A 1QDCA 4GKYA 1HQNA 1DZQA 4XF9A 2AYHA 4CDUA 1ZA4A 4QGMA 1AYN2 3SCGA 4YZ4A 4B4QA 1REDA 4XFGA 1UD1A 2P3KA 4LBQA 1XNCA 1LEDA 1Z7S1 1C28A 3MGUA 3KCXA 1IOAA 1HW5A 4AI0A 3KS7A 1DGLA 3VBFC 1QMJA 1NA1C 2IXLA 1VBE1 4I02A 5GALA 4RHV3 4C91A 1WLDA 1MS8A 3BTAA 4QHBA 3M4FA 2GC2A 3O0XA 3MDPA 1C5IA 3VBUC 3JBG2 1H2LA 1RVF1 2P3JA 1FAYA 1X7NA 4XPVA 2E7QA 4E2GA 5L7OB 4M3CB 2Q0AA 2XPJA 1RMU3 5H9SA 3AP4A 4HKLA 1BEV1 1NA1A 2YPJA 5GLWA 4OULA 3URFA 4KU8A 5DZFA 4EWEA 4INDA 3NO8A 4WZFA 4K6BA 1BMV2 4K7JA 3JD72 2BBVA 3D0JA 4EJRA 4AVTA 3TRSB 4FTEA 4GKXA 2VH9A 2VOVA 2A3YA 1K5MB 4UBGA 3WP6A 3AZXA 2SLIA 2XLAA 4PDWA 1QDOA 1HXS3 1QJY3 2H0BA 2RS52 2WC2A 2CWMA 3MPPG 4QQ2A 2ZACA 4I3PA 4ORFA 3ZYJB 4YVSB 2QQPA 1AZDA 1WGPA 4Q0PA 1DQ6A 3O14A 5JAXA 1M4WA 2RS31 4Q4W1 5GLVA 1VAVA 1TME3 1VRH2 2WJSA 4IEPA 1W2UA 4X8NA 1IS6A 1HKDA 4Q8KA 1TNFA 3RYPA 3U07A 2ATFA 5GKAC 4QQOA 1L3JA 2XL7A 5D1IA 2XH6A 5HCFA 4CDWC 4EROA 1JYIA 2PN5A 1FV3A 4CDXB 4HT1T 1RUF2 1OA2A 4K1ZA 2WINB 2Z2SB 3LSEA 3OGJA 3WUDA 4C90A 1PNFA 1SBDA 3R0RA 5A33A 1YJKA 1GANA 2RS51 3JQXA 1NLRA 4IXLA 4NHKA 3S0MA 2GNMA 3WW2A 3LGRA 4AQ6A 5I8SA 1DGRN 1D4M3 1JUHA 1AR92 4CZSA 5FTTC 1D4VB 3HAGA 1YJLA 4WM7A 4QPIC 1GNZA 2FZ1A 5FLHA 2BWAA 3E6BA 4I0BA 1IS3A 3HMYA 1AR82 3EQEA 1Y9QA 4FPFA 1DFQA 4AHYA 5K8SA 2CL2A 1X33A 2ZGRA 1DQ2A 4FPHA 3RJRA 4DS0A 2PAKA 4HMZA 1UN1A 3W9AA 1HIXA 1W6MA 2JEMA 2QZ3A 1XU1A 4EN0A 1FPN1 1V9U1 2XG3A 5C8CB 3E6DA 3KT4A 3NW4A 3B69A 3CEWA 2EXKA 4KWJA 1VRH3 1S0GA 1F9KA 1GQHA 4X6RB 1BBT3 4AK3A 2X5IA 1A8MA 5FPZA 3UK9A 1G9AA 4BZ4A 1AR83 1WLTA 4MGKE 3TWIA 5FQ0B 3HQXA 4XTPA 1WLWA 1ZBA3 3H3ZA 3FBMA 2GC3A 2DVFA 3VBUB 3FWEA 4DOUA 5JOYA 1AR93 4JRLA 1T6GC 4AXOA 1VB4A 1XNBA 1IS4A 1YO8A 4XOGA 3AP6A 1VAKA 3QH6A 3VBHA 4M0HA 3O0WA 2ARBA 3SHRA