4XFHA

Cysteine dioxygenase variant - y157f at ph 6.2 with cysteine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
b'ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 55
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfhA00
4BIFA 4F8AA 2ZCWA 2HKXA 2IXIA 1Q43A 4IEXA 4BYYA 4I3PA 5I8YA 3C3VA 1WA4A 3RYRA 4X6RB 3S7EA 4LULA 1O3QA 3CEWA 4Z82A 1Y9QA 4I02A 2B8MA 3CF6E 4IEOA 5BV6A 4H7LA 5I0UA 5JSOA 2Z69A 3PVBB 1CGPA 1YHFA 1EPZA 3UKNA 2H0VA 1UW8A 2XLGA 2GC2A 3E5XA 2XKPA 2K0GA 3LAGA 3NSTA 1TQ5A 2V09A 1LR5A 5I93A 1VP6A 4XFFA 5KHHA 3RNSA 3E6BA 4IEZA 1ZZBA 3RZZA 1Q3EA 1EY2A 1PMIA 1X8MA 2N7GA 3H7JA 4XFAA 1OD5A 4OFGA 1J59A 5BPXA 3BU7A 3G7DA 2BGCA 2EA7A 3E5QA 3OCPA 3DKWA 4XFIA 1QY4A 5JCTA 3CJXA 3BPZA 1DZTA 2P17A 4QMAA 1O5UA 4LA3A 1J58A 5E16A 1GQGA 4PIXA 4MUVA 4BH9A 5LRSA 4FAGA 5CU1A 3I54A 2QCSB 1OI6A 2HJIA 2ET1A 1H1MA 2DCTA 3H9AA 1VR3A 5FDBA 4YNIA 3IIAA 1QXRA 1UPIA 4FBFA 5KHKA 1ZZ8A 3OF1A 1CAUB 4AVAA 3HIFA 1O7FA 3ZDSA 3GBFA 3EBRA 2PAEA 3H3ZA 3S7IA 3OGJA 4FT8A 1FXZA 5KHIA 4EWEA 2PFWA 4QGLA 1CAUA 3MPBA 2QVSB 5I0RA 4Q0SA 2CAUA 4JVAA 4QXKA 3FWEA 1DGRA 1QXJA 4XF4A 2PHDA 1UIKA 1CX4A 4IEVA 2PAKA 4X6QB 3SXWA 5FQ0B 1YFUA 5I91A 2CAVA 4IEPA 4XF9A 1ZNPA 3BCWA 4AXOA 3SCHA 4ZU7A 3ELNA 4XFHA 2XL9A 3LOIA 2MNGA 4HSJA 2D93A 3KGLA 4L2NA 3E97A 1LB2A 3QACA 3RYPA 5FQ0A 5FLHA 4F7ZA 4QGMA 3KSCA 2GC1A 5F1RA 2C0ZA 1ZX5A 3M70A 5FPXA 4QM9A 1JUHA 5KHJA 5K8SA 3IDBB 1YFYA 3N4MA 5AVPA 4I01A 1RC6A 4OLLA 3U10A 3ETQA 2OYZA 4XFCA 3SMHA 2VQAA 3H7YA 4MGKE 1ZRRA 3ROUA 4D7TA 3ST7A 4KWLA 2UY8A 3FFQA 4IERA 4EV0A 4CYDA 2BYVE 3MDPA 3EQEA 3LA3A 2GU9A 1ZZ6A 3SCFA 4EROA 2PYTA 4IEQA 1RGSA 1ZZCA 2BNNA 2D5HA 1XRUA 3KCCA 4PJYA 4YARA 3ES4A 3OD0A 2OZJA 4LUMA 2XL7A 3U11A 4HBNA 1UIJA 4AQ6A 3DV8A 3NJZA 3PNAA 1I6XA 2UYBA 4HMZA 2O1QA 2XHKA 4J1WA 1V70A 2PA7A 4WBBA 3TNPB 5T3NA 1O3RA 2IXKA 1UCXA 1SEFA 4A2UA 5JAXA 2ET7A 4MV2A 2Q1ZB 4UBGA 3H3UA 3I59B 4I09A 2GZWA 2XKOA 2PAMA 2QNKA 4P9GA 5HI0A 3MZHA 1ZRCA 3I7DA 5J48A 3WW2A 3WW3A 4O9EA 4K8FA 3I59A 3QOPA 1J3QA 4AQ2A 2D5FA 2O8QA 4MX3A 1YFXA 4KL1A 2E9QA 4LA2A 4XFBA 5FPZA 3LWCA 4HSLA 3KGZA 2XGXA 5CVRA 3O14A 3FZ3A 1ZREA 4Q0VA 4Q0PA 5BY5A 1ZRDA 2WFPA 3D0SA 4TLFA 4XETA 3TNQA 2Q4SA 4HVOA 2B9UA 2Z2SB 4Q29A 1CAXB 4HN0A 3M3IA 4UXAA 2PTMA 1SFNA 3LZZA 4HLTA 1LKNA 2IXLA 3H1MA 1CAXA 5I8SA 1IPJA 3DN7A 4ORFA 4ZU5A 1X8EA 2UYAA 4RD7A 1CAVB 4XF3A 5LRRA 4D7SA 3LA7A 3H1YA 5J7MA 4IEUA 1ZRFA 2FQPA 5CADA 3RPQA 3PLQA 2QDRA 1Q5OA 1ZZ9A 5C6CA 1WGPA 3BALA 3UKVA 1CAVA 1X7NA 4Z07A 3CL1A 3HT2A 3MYXA 3UKTA 4JV4A 3D0JA 1XE7A 2OZ6A 2Y0OA 4HN1A 4JTOA 4AVCA 1O3SA 1Y3TA 1GQHA 1CAWB 3NKTA 2WC2A 3BB6A 5EZWA 4GULA 3SCGA 4YYOA 4EWDA 3HQXA 3S0MA 4O9GA 1CAWA 3IBMA 2EAAA 1PM7A 3U0ZA 5FCCA 3VHRA 2OA2A 4QGNA 4XF1A 1EYBA 5E1RA 4META 4UBHA 3FE5A 1RL3A 5FLIA 4MGYE 3ACLA 4QX5A 5FLJA 2BEOA 1OMIA 4LTAA 2CV6A 2Q0AA 2VPVA 3R6SA 2FMYA 3FJSA 2GAUA 3SHRA 4IETA 4AVBA 1U12A 1FI2A 3LA2A 2IXCA 2I45A 1FT9A 2K9ZA 1I5ZA 2OPKA 1DZRA 4LUKA 2PQQA 2Q30A 3EHKA 5BUVA 3NVCA 4QM8A 3CO2A 3ES1A 4E2SA 1OFNA 3B02A 5EFUA 1WLTA 1NE4A 4HZFA 2H6CA 2VECA 4HVRA 3JZVA 5JR7B 2ETEA 5J3UA 3RDIA 4Q0UA 5I0SA 1IPKA 3E5UA 3L2HA 4WVZA 4KU7A 1QWRA 4B29A 1YWKA 2GC0A 1X82A 4Q0QA 1RUOA 3WW1A 1NZCA 4NVPA 3RYKA 3H50A 1H1IA 1UD1A 1ZVFA 5JSRA 5KBFA 1J1LA 3USSA 4MGZE 2BNOA 3H8UA 4N9IA 4BHPA 5JSPA 2ATFA 2B5HA 4JTNA 5C8WA 3H1WA 4LLOA 4MGIE 4E2QA 2QJVA 1ZZ7A 5I8TA 3FX3A 3FHIB 1G6NA 5D1IA 2UY9A 4YRDA 2D40A 3OTFA 2F4PA 4FAHA 1YUDA 4IEWA 4XF0A 1DGWA 4KU8A 2MHFA 1NYWA 1XE8A 2BNMA 4XEZA 2MPFA 4R8HA 5BXXA 2EVXA 4ONUA 1HW5A 1O4TA 3NW4A 2IXJA 4N9HA 2ZKLA 1O3TA 4J1XA 3E6DA 4I0AA 1RUNA 4ZU4A 4IEYA 1J3PA 4DINB 1L3JA 1J3RA 2GC3A 4MH0E 4XFGA 4PIYA 3HT1A 3WW4A 5LEKA 2IC1A 2PHLA 3NL1A 1NXMA 5KHGA 1RTVA 4EWAA 4L11A 4PIZA 1LRHA 3EJKA 3KMHA 4E2GA 3IWZA 4KWKA 4I2OA 5LEJA 1SQ4A 1YLLA 3E6CC 2IXHA 1O5LA 4IESA 2CGPA 1YFWA 3DL3A 4WZCA 3EO6A 3GYDA 2XLAA 5I0TA 4HVQA 3CLPA 4MZUA 3IDCB 1EP0A 4LEJA 2KXLA 4KWJA 4I0BA 4R52A 2GH2A 2XLFA 4YSFA 3D82A 2H6BA 1VJ2A 1NE6A
chains in the Genus database with same CATH superfamily
2I74A 1CIYA 1MQTB 2HKXA 1HDKA 1LHWA 4IXLA 5D21A 2XJVA 4YM3A 3RQ0A 3LQCA 3C3VA 1QJY1 4GWIA 4NRPA 2W9XA 4HG6B 2BU9A 5GLTA 2W68A 4LOTA 4KMQA 1GSLA 4CEYB 3O1VA 3Q8AA 4IV3C 4N90A 1POV1 3IIIA 3CEWA 3J26N 4I02A 4OCTA 4Z82A 2GNMA 2YFZA 5SV8A 5I0UA 2A6WA 5JSOA 2RS53 1YHFA 3VDDA 5JOYA 2VOKA 4XJUA 1ASJ3 3D4KA 1R1A3 1ULEA 2H0VA 2RDNA 1YQCA 3WG3A 3T1MA 2ORZA 5IVYA 5A3OA 1Z7S1 2QQNA 3E5XA 5JOWA 5K0UB 3O12A 4NJ4A 1YI7A 3PUSA 2XKPA 1DHKB 1AR82 5FXZA 4MO3M 4GJZA 1EUUA 4C0HA 3E6BA 3ZOIA 3FMGA 1ENSA 2JE7A 1AX1A 3BYWA 1OPMA 2YPJA 2QQWA 5E8AA 1H0BA 1OD5A 1R64A 2ERFA 3VDDC 1J59A 4LHLA 2BGCA 1XNBA 2EA7A 1VBA2 5L9RA 3E5QA 3V0BA 2PHFA 4HKLA 4O61A 1ENQA 1QY4A 2LM3A 3AKQA 3N3HA 4OHVA 5FZIA 4L99A 2EXIA 3Q9OA 2AEYA 4CUCA 4LK6A 3CJXA 3WP6A 4M01A 4AHXA 3PIJA 4YG6A 3BPZA 4AG4A 2FZ1A 2A6VA 4AGGA 5F32A 1VBB2 4PIXA 4GWJA 3RJRA 1YI9A 5LRSA 1BZWA 5KXDA 4FAGA 1S0DA 1H9PA 1OI6A 3ZO0B 2FDGA 1W9FA 3THTA 2WT1A 4Q4Y1 2DCTA 2X09A 4CP9A 3VBRB 5FDBA 4IUGA 1FPN2 3CNAA 1V6IA 2CL2A 5FAXA 3SQOA 5A3TA 1IKPA 1QXRA 4FPGA 1YQ8A 3ZYPA 1RXFA 2WZR1 3DXUA 5I0DA 5KHKA 2HWB1 3WNOA 3ZVXA 3CJIA 1CAUB 2EAKA 1O7FA 2ZMLA 4J25A 1RUI1 1UAIA 3GBFA 2WO7A 3EBRA 3LEKA 4Q4W2 4V2WA 3MHZA 4FT8A 2PFWA 1C28A 2QVSB 3LFIA 3EB7A 3AMHA 4Q0SA 5DQ0A 5E89A 1NX9A 4N7IA 5C8CA 2FDHA 1ZA4A 3WF4A 5CISA 1KRIA 1HIXA 2D3SA 3FWEA 1LNSA 1TMF2 1N1SA 3JQXA 3OYWB 5K4LA 1POV3 3MF6A 4JDMA 5D2AA 1SBEA 3NV4A 1QKQA 2PHDA 2VAUA 2YU2A 1GZ9A 2I07B 3PUIA 4WVMA 3OG2A 5H9SA 3CJIC 3GF6A 5I91A 2CAVA 4IEPA 3AZVA 4JRAA 4AXOA 2JX9A 1IKQA 2WN3A 2XBO2 3ELNA 3J8F2 4ZU7A 3DYMA 1WA6X 4RS5B 3K51A 4HSJA 4NHYA 1N1VA 2D93A 3KGLA 3MPPG 4DEQA 3KB5A 4QQPA 1RHI2 4QKFA 5FQ0A 5IW0A 1YIFA 5FLHA 3WDVA 4ASMB 4F7ZA 3Q8CA 2WNEA 3OBZA 2KR2A 3KHBA 4MGSA 3TEYA 1U5YA 1H4GA 2WR9A 4Q4X2 5FPXA 1QU0A 4GWMA 1JUHA 1NLSA 3A22A 4CP1A 2A6XA 3N4MA 2VBDA 2DU0A 1EAH3 5JPMB 2LUWA 2XOMA 1MVEA 3ENRA 1LESA 2OYZA 4DRRA 4C1WA 3SMHA 2LROA 1XNDA 2H0BA 3H7YA 3Q8EA 3MIFA 2XVKA 3KCYA 5FZ9A 2PHWA 3ZN4A 3ROUA 4D7TA 1XYNA 4CCLA 1YYNA 3AP5A 5EP9A 4EV0A 1UY1A 2DCJA 3ACGA 2IZWA 2BYVE 1ST8A 4RGKA 3C7HA 3O0WA 1SACA 3EQEA 4L92A 4LKDA 5BNOA 1QJU2 3WY6A 5FPUA 5C7GA 2YBPA 3ZFEB 5J36A 1N47A 3NRUA 1E5RA 2QQVA 2FDFA 1HXS2 2XVLA 4EE2A 5FP8A 3W59A 3DGTA 4AVTA 3WINE 3ITQA 2WZR3 3IZOA 1XB9A 2CGNA 4AFMA 3GALA 1JYCA 4LITA 4QQLA 2BQPA 1F5FA 1RUI3 2YG0A 5LASA 1Z0HA 2OZJA 4LUMA 4LIVA 1W8TA 5IK4A 1BLZA 4Q2FA 4UT5A 2HBUA 1O91A 5JXJA 1DP0A 2UYBA 1XYOA 5BNOC 2VULA 4D69A 1AR71 3I8TA 4XJAA 4F3JA 1BQPA 1PK6B 1ZA7A 1Y43B 1HRI2 1GZWB 2RM23 1OURA 3FUOA 3KF5A 3V0BB 4SBVA 3HD8B 4WBBA 5EWSA 5KC5A 3ZSMA 4QHBA 1DYOA 3UT0A 2CDPA 4PT6A 2FD8A 3VKOA 1SEFA 2HYXA 4NHLA 4GZ9A 4W8JA 1LGCA 5CEHA 2Q1ZB 4LORA 4A45A 3AM2A 1DCSA 2BBAA 5FPVA 3I59B 3BTYA 1S2BA 3UESA 3VBFA 2PAMA 1DQ2A 5IT6A 3MZHA 4Q4W1 5A70A 3T30A 3ZYIB 3Q8FA 4MHUA 3RG0A 1Q8SA 1UU4A 4YVSA 1VPHA 4O9EA 5C3SA 1L7QA 3PMEA 4QPIA 3FC0A 3WUCA 5T52A 3WHTA 4AQ2A 4A6OA 3ZR5A 5EIYB 2RS13 1AR61 1HRV2 2VMIA 3ILRA 1XSQA 2E9QA 1QH6A 2V5YA 1TMF1 5FYZA 1LOAA 5FZ8A 5HPOA 4CEWA 1WMFA 1NA1B 1W28A 1N3PA 1W06A 3NNLA 1NCQB 4ZXKA 2PLV1 5HCBA 1HN0A 3OEAA 1PO22 4P9YA 4YZ1A 1ZRDA 1ZREA 2WFPA 5ACA1 3VBFC 4AEDB 2V72A 2BWAA 2VOVA 2VCCA 3BN6A 2XBO1 3J8F1 5JVVA 5EYXA 2Q4SA 2W92A 3VDCA 2VMCA 3WNXA 5C8CB 1O8SA 4YVSC 3LPGA 1WCDJ 4ASKA 1RHI1 3O1SA 3P1IA 1F5JA 3OY8B 1PIV1 4QPIC 4AQSA 2JDUA 1W0PA 1AR83 4IW3A 3WDTA 4EYUA 3O7OA 2E31A 5F8PA 4OHYA 3OSDA 1GYKA 3PVEA 4YM2A 2ZTNA 5I8SA 1HQNA 3DECA 4CEWC 1IPJA 5DUVA 1W8FA 1JZ3A 1PZ7A 2K46A 4KWUA 4ZU5A 4BXSV 4EZHA 5FY1A 1X8EA 1YNAA 2RG4A 4EN0A 3V56A 2FCUA 3AJYA 5FZ6A 5CFDA 5GLZA 3VBHB 2KM2A 3MI8A 5DG1A 1JI6A 3LA7A 3H1YA 4UAPA 5J7MA 1ZRFA 1VBA3 5CADA 4WM7B 3RPQA 3SKVA 1V6MA 3ZYFA 4CUAA 4GKYA 1Q5OA 1ZZ9A 4XTMA 1WGPA 1W2OA 2BVBA 4SLIA 3BALA 4ZS3A 3ZX7A 3UKVA 1CAVA 1X7NA 1PHMA 1CZVA 1JOBA 5M0TA 1H8TA 2JD9A 5DAQA 1ENRA 4LBOA 1AXZA 3AKPA 3MYXA 5FPBA 4BMEA 1VBE2 2WA4A 1RVF1 4JKLA 5JI7A 2AGSA 2EF6A 4JV4A 1OF3A 3IMNA 4Y5SA 1VBB3 3WR0A 2Y0OA 4JTOA 1Q8QA 1PNFA 1JTZX 3U4SA 4L0PA 3ZXLA 5CFDC 3AP4A 2WC2A 4MG2A 1HXS1 2WLPA 2R072 4HPKA 5LBBA 1FPN3 5ABJB 4YYOA 5FREA 1ZBE2 4FPJA 4YW5A 3HQXA 3BVCA 4PBOA 3VD3A 2DVAA 3AFKA 1CAWA 2HWD2 2XJTA 3AJZA 3K77A 5CKQA 5AVAA 5BNOB 1H8TC 4UFIA 3ZFFA 3VHRA 3HWJA 1FAYA 4MXVA 3U07A 3FE5A 1BEV3 2QDNA 5C4WA 1RXGA 4CVUA 3KHCA 3ZN6A 3WP3A 1FV3A 2G19A 1HRI1 4MGYE 5CNAA 3ACLA 4XTPA 4ZPIA 1UZZA 4DXZA 3VDAA 1APNA 4OQ8A 1WMDA 4CDUA 4QD2A 3VD7A 1LOBA 3KF3A 5FYCA 1IQDC 3V65A 1W8OA 2B4KA 3POIA 3P3NA 1W03A 2VPVA 3MLJA 4BISA 3S5AA 2R042 5FO9B 4XJ8A 5FZMA 1POQA 3N9QA 1AXYA 4IETA 3MW2A 1PGSA 5A1LA 1FI2A 3LA2A 2XBO3 3ZFFC 2E7QA 2I45A 2K2SA 5FYHA 1PVC3 3WF2A 4AVSA 2D3PA 3TEXA 5C4WC 5A1FA 5FFOC 3I49A 4QQOA 1ODNA 1OQDA 3K48A 5EJ1B 3O5SA 3CO2A 4M3CA 4OI4A 1CD3G 1HRV1 4XILA 4Q4X3 3TN92 1VB2A 3AYAA 1XNAA 4L8QA 5H9RA 1OXCA 4A7YA 4CDUC 4CU9A 1MS3A 3UL2A 3WX5A 4MLOA 2YB7A 5F5AA 2R062 1NE4A 4A44A 3NNJA 1RIRA 4U36A 1F4AA 2JDMA 2R49A 1HJFA 4CSWA 2Y8KA 3M3QA 3VGIA 1K12A 5J3UA 3M3CA 3BIWE 4Q0UA 2YUEA 4Q27A 4OMCA 5FUNA 5L9BA 3O0XA 2WKKA 1AX0A 1I3HA 4LE3A 3DF0A 5A32A 1XPWA 2NMOA 1RUOA 1IQAA 2W08A 3BODA 2XH6A 4PI2A 1KFUL 4OUEA 2AR6A 1JYIA 4NVPA 4FPKA 5T5OA 4DNYA 2RMU3 1VRBA 1QJU3 1J1LA 2O8OA 4MGZE 2BNOA 3WSOA 1MS8A 4RHV3 4LKSA 2O14A 5J09A 2HLEA 1AR92 4BE3A 2WSVA 2HWC2 3QH6A 3TYJA 5C71A 1YQ2A 3T4HB 3ORJA 4Y1YA 5L7OA 5CZKA 4HKWA 5FXVA 1SHWB 1VALA 4JQTA 1R093 1SLAA 2VMHA 2JG9B 4IEWA 1DGWA 1OLMA 4BM8A 1UMHA 1NYWA 1ND2A 2MHFA 3A0KA 3B00A 2VZQA 5JOXA 1N1YA 1V9U2 4IE0A 1CJDA 2MPFA 4XEZA 4CCNA 1DDLA 2R16A 3D8CA 1HRI3 4ISRA 4CXYA 2JDAA 2EVXA 4ONUA 2R071 1BBT2 1X36A 3KZ4C 4CDQB 3NW4A 2QFEA 4QDSA 4TLGA 1ZBA3 3C7EA 2AZ5A 2EIDA 2ZKLA 4GH4B 1CESA 2DCYA 2HWD1 2BFUL 2YMZA 4F83A 4BQ1A 4DXRA 4I0AA 1RUNA 5L7OC 1K5MB 4XURA 3LEIA 3WG1A 1UU6A 4IE5A 4WVVA 4NO4A 4E4DX 2Y6JA 2TBVA 3JU9A 4RR3A 4GB32 3WEZA 3NAPB 4FO9A 1ND2C 2BPA2 2VUDA 4GXLA 3J7HA 1DG6A 1LJ7A 1VMFA 4FVVA 2X10A 2DDUA 2PHLA 2W2IA 4C91A 3O1OA 3RZMA 1RTVA 3ZSLA 3PUQA 4EWAA 3LEMA 5FK7A 1ULDA 3VKMA 5FZ7A 4GAZA 3QBQA 1JYXA 3IDAA 1OH3A 1W6OB 2IVIB 1PO23 1JZ8A 1WW5A 1JOPA 5LEJA 3NNMA 1SQ4A 1WW4A 5LBFA 4LO7A 1PGL2 3E6CC 1SLCA 2CWSA 3RI9A 2RV9A 4R9AA 1UNBA 2RJKA 1X9TA 2DCKA 4IESA 2QZ2A 3ZM8A 3ON7A 4RR3C 2RR12 5H9QA 4AEMA 5D8AA 3EO6A 2Z5WA 1TVGA 4NN0A 3LOBA 4MZUA 2QKDA 5B2GB 3IDCB 4LEJA 2LRPA 2VQ0A 3CBNA 4R52A 2GNTA 3UK9A 2GH2A 2XLFA 1CX1A 2YC0A 1C3HA 4FQ4A 1L7LA 2H6BA 1VJ2A 1W0NA 2WBKA 3ZXEA 4CCCA 4AE2A 3W5NA 2PN5A 3VL9A 2X29A 1W8NA 4BIFA 3O0VA 1NCRA 2IXIA 1URXA 1REDA 1V6NA 2NMNA 1WLDA 1LAJA 3RYRA 2ZHLA 5D8AC 4K1ZA 1QOOA 4EN8B 1IOAA 3BGAA 1HX6A 5FO8B 4FPOB 2Q8OA 1MQTA 2YXSA 1QJX2 1Y9QA 1VBE3 1PMHX 1OOPB 1T6GC 2WNUB 4DUXA 3MIDA 2CGOA 2A6YA 2RVAA 3PHMA 4U2AA 4NPLA 3AC0A 4KGGA 5JMCA 1CGPA 5FJKA 1F15A 2R6QA 5DABA 3U78A 1HQWA 3UKNA 3RZLA 1W39A 2GNDA 3OPZA 2P2KA 4ZZ8A 1UW8A 5APAA 3OBAA 2JECA 1NCRC 3KQRA 3ZSKA 1GNZA 2WDBA 2XLGA 1ZBE3 5TSWA 2O0OA 4E8DA 3JUUA 2EIBA 4BU2A 3LDRA 5DUUA 1US3A 5FZKA 2V09A 1LR5A 3FUQA 1VP6A 1QJY2 1VAMA 3AK0A 4COUA 1EUTA 1MQTC 1AL22 5K0UA 4CP0A 4LNVA 1PMIA 2A3YA 2OX0A 3OGSA 4COYA 3JD71 2N7GA 2VZSA 4XFAA 4JC1A 4HFSA 5DG2A 1V9U1 4CEYC 1DQ6A 2D6LX 2W46A 5JXGA 2F6BA 4B3NA 1RUG3 2Y6GA 3K4ZA 3MFCA 2TUNA 5FV3A 1BBT1 2B7YA 4WM8B 1KS4A 1Z7S2 1TE1B 2WN2A 1WWYA 5FYIA 5C5UA 2R043 4QMAA 1O5UA 4ARYA 4BDVB 3OUHA 4LA3A 1C8NA 5A33B 4QX0A 1UZYA 1GQGA 2FCVA 4O65A 5K0UC 3DUIA 1S1AA 1W6QB 2QCSB 1SBDA 2HJIA 2P4EA 1YEWA 2ET1A 2PHTA 2ZKNA 3L2YA 4GB31 2QQPA 3VD5A 4FP2A 4YNIA 4ET7A 4TYSA 5BNNB 2YBSA 4ARXA 4EN7B 3TN93 5GLVA 3IIAA 4XDPA 4YG0A 1UPIA 4H55A 4N43B 3OF1A 5FZDA 2R063 4AVAA 3LGRA 3VBRA 5A3WA 4XUNA 1EV11 4XJZA 1ZRIA 2W1WA 3UV9A 2PAEA 3H3ZA 1UY2A 3OGJA 2ZX1A 2NN8A 1E5SA 4LXLA 4EWEA 3L9JT 1G9CA 4FOYA 4QGLA 3WNNA 1CAUA 3MPBA 4QAWA 4GWNA 4Z1VA 3DPRB 5KR7A 1AHSA 3H3LA 2RR11 4K7JA 3NV1A 4JVAA 3FBYA 1OC1A 5FYTA 1BK1A 3LB9A 3AL5A 1LEMA 4Q4Y2 3P3PA 5JI9A 1QXJA 3HR9A 1K42A 1QEXA 2DFCA 1OLQA 2B39A 4XF4A 4K1YA 3I3BA 5FZAA 3RFRA 1UIKA 3RMYA 2HBTA 5C3OA 4DRVA 2PAKA 2ZHMA 2ZHNA 1F8VA 3VBRC 2LS6A 2HWB2 3MFAA 3FN9A 5C5TA 1PNGA 2Y26A 5CKNA 1W6PB 2CU5A 4XFHA 2XL9A 5FYMA 3ZXAC 3IB3A 4QB1A 4G4FA 2MNGA 3MUY1 1AL0G 2VOWA 4L2NA 4S2FA 3I2FA 5JIAA 1AR93 3RYPA 4N8MA 3AP6A 2HWC3 3FFZA 4BQ3A 4QGMA 1V6LA 4RS5A 4CXWA 2BBVA 1ZX5A 3OBTA 4HANA 1JW6A 2VW1A 4URAA 4UW6A 1S0CA 1BHGA 1HV0A 3A23A 5F2SA 2SBAA 4BQYA 3URFA 5LA1A 2ZGQA 1V9U3 1CZTA 3ZXKA 1MEC2 2G9FA 5FBJA 1IGOA 4JHZA 4AFCA 1RYYA 4CUBA 1ZRRA 4XQDA 2QTWB 2YHJA 1W9YA 3FFQA 4EN6B 3MV11 2W1QA 4RS5C 2YDEA 4YZ4A 4AGVA 1HB1A 3HJRA 3ZYGA 4Q4V2 1AL21 3ZR6A 3F2ZA 2XONA 4DY5A 3K3NA 1ZZ6A 2ENRA 3N7JA 2UURA 1AYM1 5CAZA 2PYTA 4IEQA 1N1TA 4GB33 1ZZCA 4GALA 5EJZB 2JDYA 3WXPA 1NKGA 3GCWA 1WUVA 2P3IA 4LK7A 3WG2A 4CUGA 2D5HA 5HCAA 5FZ1A 3H42B 2XPJA 4NUBA 3ZFEA 3UYJA 2WO2A 4NRMA 2OQ6A 1RUD2 4A7KA 4PDWB 3OD0A 4I30A 5T50A 3IAPA 3U11A 4E8CA 1U5IA 1UIJA 3M3EA 4NHMA 3PNAA 4P00B 5FMBA 3VBUB 4NPRA 1LOFA 4BWOA 4HMZA 3THDA 4YWAA 1YJKA 3O1PA 3VLBB 3I2KA 1SDWA 2XHKA 2JIJA 1V70A 1O4YA 5A80A 4FFFA 1JZ2A 3TNPB 5FJHA 1K5JA 1XYPA 3MO4A 3RZJA 1CIWA 3T1LA 1O3RA 2WO3A 2JWPA 1UCXA 2J1EA 2WA3A 4JQRA 3RWNA 4RQPB 4DO0A 2ET7A 3ZFEC 1PK6A 5JAXA 4PQQA 1GZWA 1PVXA 2C6SA 4HT1T 1WMXA 2CSGA 1J1TA 1KQRA 1R082 1W6MA 2ARCA 2GZWA 1LGBA 2J1UA 4CPBA 3UGHA 3JB4C 1D7PM 1VBD1 3PVOA 2JDPA 1LOFC 3WW3A 1HLCA 2B45X 4LO5B 4K8FA 5HXMA 1O4ZA 3I59A 4FSJA 3WNLA 2JXAA 3GZAA 1H9WA 2JDHA 1RB8G 1NLQA 4M0NA 3T0DA 2VBBA 1AR72 5FMDA 5FKCA 1DLLA 2VTFA 4W50A 3QH7A 4Y24A 4Y4RA 4CZSA 1Q8PA 5FPZA 4BK4A 4W6WA 1QJX3 1MACA 1N3QA 1PK6C 1IS5A 3LDKA 1ZM1A 2V4VA 1V6OA 1RUJ1 5BY5A 3PL0A 5IK7A 3D0SA 4KI5M 4IE6A 1X9PA 4RFT0 5FP7A 1NA1A 4HVOA 2NYYA 1NCQA 4Q29A 4UWDA 3M3IA 5IAXA 1D2SA 2PTMA 3ILNA 4QWNA 5F6KA 4FTEA 1OKQA 2DVGA 4AEDA 4Y20B 2BJSA 3D6EA 4BA6A 4Y22B 3VKLA 1LKNA 2A7AA 1QJY3 3CZJA 1AR62 4NIGA 2IXLA 1M4WA 4Q1PA 1BYHA 1CVNA 2JENA 5FWEA 3OY8A 2XQXA 5FMOS 3ZMNA 3INAA 2YU1A 1SBFA 4KQ7A 1BMV2 1OA2A 2HWE2 4C0BA 1S0IA 5LRRA 2PLV2 2Q1FA 2YFUA 3AX4A 4IV1B 3T2TA 4A41A 4D7SA 4AI8A 2QBXA 5LBCA 1NA1C 5ACA2 1MEC1 3LF7A 1DYKA 3PLQA 1NCQC 3O1UA 4YGEA 4IE7A 4TZDA 2X5IB 1W04A 1DLCA 1DYPA 3WUDA 3VBHA 4AEDC 2UU8A 1Z78A 1Z7S3 5FY5A 3CL1A 1PIV2 5FZ0A 3SITA 2ZEZA 4WM7A 3UKTA 5C8CC 2IUWA 2VC9A 4C1XA 1I1EA 4E4SA 3KM5A 4Q4V1 5J1XA 3VZLA 1D4VB 1KXGA 1RUC1 2OZ6A 4HN1A 4AVCA 4Z92B 3S57A 1O3SA 3VKNA 4FFGA 1CJPA 4YZ5A 4PQ9A 3VBOB 4GULA 3I2JA 2ZZJA 2YBKA 5ERLA 4YG3A 3V0AB 4FPEA 1JS9A 2Z42A 5JOZA 1PZ9A 3ECQA 4G3YC 3WVJA 3VZKA 3S0MA 1UYZA 1UMZA 2BVVA 3R4DB 3IBMA 4O9GA 2OUHA 2Q5TA 3VBHC 2PELA 1R1ZA 1RUD1 3AVSA 2R32A 4N7UA 5ABJA 3AZYA 4WM7C 2VZVA 2ZACA 5HBAA 1KITA 2GN3A 1S0EA 5FY8A 5K9YA 1EYBA 5E1RA 4NAMA 1TEIA 3LFMA 5FY7A 1RVF2 3AKRA 3HBZA 2R7EB 3IMMA 1RL3A 1F4HA 1LGNA 3AKTA 3NKGA 1VMJA 3N9NA 1PO11 3B7MA 4YLZA 1JZ5A 4QX5A 1UYYA 4LBQD 1UWWA 1JZ6A 1WLWA 4Q4Y3 5FLJA 1W0OA 5HXVA 4P5HA 5BNPB 2ES3A 1E5HA 3B5LB 2VCAA 2ZEYA 3C2UA 3VBSA 3JCIA 2QE3A 3FJSA 1OLRA 2B46X 1UF2C 2GAUA 1XE0A 1R081 1OHFA 2HWB3 2RDSA 1U12A 2AEZA 3NNFA 3PVNA 5ABJC 1COV1 4K40A 3HNBM 3I4IA 3ACHA 4WVWA 1ODMA 1HQLA 4W65A 3WD5A 2OPKA 2PMWB 3GM8A 3M7AA 4COVA 5DN2A 3EHKA 2QZ3A 4OI1A 5BUVA 2TNFA 3GZEA 5GZCA 1UY4A 4QM8A 4E2SA 4AI2A 3BIEA 1WLTA 3FHAA 4XUQA 1TG7A 3VZMA 1W6MB 3JQWA 4P9LA 3VBSC 4CTEA 1GUIA 5A3NA 4FOVA 1S2KA 2E53A 4YGDA 1NAEA 1UZVA 3MICA 4UFMA 4XUPA 1XXNA 4QT6A 1V0AA 3WZ1A 5T54A 3RDIA 5CBLA 3CDZB 4I3GA 5I0SA 1IPKA 1P8JA 4YW1A 5J96B 1QWRA 4A3XA 1YWKA 4BB3A 1DZQA 3JBG1 3UNPA 4YW3A 4FXKB 5FIXA 5DDJ1 2VNGA 1H1IA 3BU0A 3T3YA 3N7MA 4BQXA 1CN1A 1ZVFA 5JSRA 1QMJA 1XU1A 3AYCA 4FI9A 5EJ3A 3SH3A 3H8UA 1WZXA 5T5JA 1BMV1 3SKJE 1OT5A 2HWE1 1BCXA 2AC1A 2ATFA 3PURA 4S2DA 1UX6A 4B8EA 1W2AX 5E6HA 1XNTA 3H1WA 4K21A 1O6UA 4AI3A 4LLOA 1LOEA 2R0HA 3P5BA 3CMGA 4D94A 3AMQA 2QJVA 5I8TA 3FX3A 1MS9A 3AZZA 5C6CA 1MS4A 5D1IA 2UY9A 5A7QA 3ZXFA 1OBNA 4KH9A 1RUD3 2ADEA 2OVUA 1FOD1 2F4PA 2BP6A 1H2NA 1UZ0A 2Y0IA 5CG9A 3GXUA 2W39A 1YC61 2D6MA 4JDOA 5DUXA 4MHRA 2J42A 1G9AA 1XE8A 4Z2AA 4PF1A 4DUVA 5JZGB 1MS0A 1WMEA 2W47A 4UOJA 4H2AA 4COWA 1QGLA 3KCXA 1MS5A 1W8HA 4NMIA 1QNYA 4BQ5A 3K46A 3W5MA 2JG9A 1IS3A 1O4TA 5E88A 3OPTA 5CFCB 1AYN2 2AUYA 2WYFA 1Q8OA 1XJAA 3THPA 1O3TA 2JDNA 4KBBA 2WUHA 1KJRA 4XZPA 4ZU4A 3DYPA 5F6LB 4RSUA 1UU5A 3AZXA 4OI0A 4CDQA 1D4M1 1J3PA 4FFHA 3SH5A 4D6SA 1F35A 4GH4A 4AAPA 4R9DA 4OVEA 2VZRA 1GNHA 4C90A 4PIYA 3HT1A 1TME2 3WW4A 4Y1ZA 5GZDA 1AR73 4CU6A 1K5MA 2BTVC 3AKSA 1NXMA 1TNRA 2W94A 2JG9C 4NWWA 1JH5A 2W52A 1GQPA 2P6CA 3NAPA 2BGPA 3N9OA 5ANNA 5FR3A 2XJUA 2XJPA 3ACFA 3A0NA 1UYXA 1BVP1 2ZX2A 3KMHA 2OPWA 4LJHA 3WQ1A 4E2GA 5HCHA 2RE9A 3IWZA 3MEPA 4XXPA 4FTBA 5FZOB 2GSYA 2WFF2 4Y5TA 5J37A 2VVFA 2J1RA 2R30A 4CDQC 5LA0A 1O5LA 1OA3A 2GMMA 2HWF2 4Q4W3 4GH4C 1W3VA 3DL3A 1W6OA 4NIAA 2XLAA 4QX7A 5I0TA 3T0BA 1JU4A 3B3QE 4OMDA 3VBSB 1OUSA 4YFWA 1K5MC 4B7KA 4LE4A 1AR63 4GQ7A 4XBQA 3NAPC 4KWJA 5A7WB 4I0BA 1ONAA 3MV01 1TMF3 4EN9B 4YSFA 2BDRA 5AC91 3D82A 3WNKA 3SEPA 1GANA 2PLV3 3OEBA 1FNZA 3Q8BA 3RI8A 2CHHA 4K8RB 5ACA3 4MGQA 3NO8A 3J8F3 1LCLA 3PU3A 4Q26A 4I3PA 5A7PA 2WLQA 2JDKA 1WW6A 2ZGOA 1MVQA 1XQNA 4JZRA 1N3OA 3W58A 1GOGA 1OF4A 1RHI3 4O7XA 1PIV3 2ZEXA 3AYDA 4BLJA 1LOCA 4HKOA 4IEOA 3CF6E 4M00A 4GKXA 5FUPA 2BOJA 2WJSA 2Z69A 4OHZA 1PMJX 5F3CA 2A70A 2DCZA 1PM4A 4TN7A 4LO8A 1OOPA 1GFF2 2WNUA 1W8WA 2ZJCA 5ISLA 3LAGA 1UOJA 3NSTA 5C3QA 2C4XA 4XFFA 5KHHA 3OBRA 3RNSA 1G9BA 4DQAA 4WZFA 1LTEA 1ZZBA 4JGZB 1H2LA 1Q3EA 3PUHA 2D6KA 2WSUA 3I2GA 4P14A 3R05A 2Q8DA 1X8MA 1OQEA 5CYYA 1RVF3 4QPYA 4AQTA 2DWRA 3WG4A 2VH9A 3WDUA 2VMGA 4LPLA 3NJXA 4Z2WA 1WCKA 4CCEA 1CR7A 1LEDA 1OVSA 3OCPA 1OOPC 2WNUC 4K6BA 2DUPA 3DKWA 3MGUA 4XFIA 4MYEA 3VL8A 4Q5OA 1HXS3 2VU9A 1AYN1 2Z4FA 3HVDA 4BJ0A 1UXXX 5LATA 3RZKA 1JYVA 2ZGLA 4XMAA 5FMCA 4LHNA 1UN1A 1QDCA 1J58A 4P9WA 1ND3B 1T6BX 2FCTA 4P9IA 3J4UH 3ZKYA 3MUZ1 3POEA 4MUVA 4WM8A 4BH9A 3AFGA 5CU1A 1JODA 5CG8A 3QLQA 1H1MA 5FO7B 5IFTA 3H9AA 2G9ZA 3JD72 4GA9A 1TME1 2P3KA 2BW8A 4XIKA 5A33A 3OGRA 4P9XA 4UI9L 1W6QA 3G6JB 4BQ4A 3OJBA 4FBFA 4FQZA 2XHNA 4YW2A 1ZZ8A 4UFJA 3NMBA 3HIFA 3WDXA 5DAVA 1W6NB 5BNNA 1GP6A 2QQIA 2VOXA 4NROA 4CDXB 2WIIB 5IK5A 4LBNA 4LT5A 1IS4A 1FXZA 2WFF1 1CPMA 2WS92 4N43A 5A6XA 3LPFA 1SLBA 4WM8C 4JGYB 5DAXA 2HWF1 4XMIA 2RJLA 1DIWA 5FXXA 2D3RA 3MIBA 4XDQA 4OI2A 1JZ4A 1RUE1 1C1FA 4IGQA 5SV5A 1MR5A 1S4CA 3DPRA 3J7LA 3LIHA 3PU8A 1HRV3 1UOBA 3POFA 1CX4A 2NQYA 4TXWA 4IEVA 5FZ3A 4E4HA 3SXWA 4UFLA 5BNNC 1ZNPA 1I9RA 1J83A 4XUTA 3RJ2X 3POJA 1EV12 3ZSJA 3TEWA 1UOFA 4N43C 1C8M1 1DQ5A 2D43A 2MEV1 3ATGA 5IVCA 3QACA 2A1XA 2R1DA 4XXAA 3CU7A 1Y9MA 3AB0A 4XC9A 3KSCA 5F1RA 1W6PA 1BKZA 5EQUA 1V00A 1YIPA 2C0ZA 1QF3A 2YPDA 3M70A 4DY3A 4EJRA 3TBDA 4QM9A 2E7AA 1I5PA 4HONA 3DPRC 1ASJ2 4FPCA 4M3CF 1HB4A 4RYDA 4URTA 4XW3A 5K8SA 1YFYA 5IJRA 4P5YA 5AVPA 1RUH1 4I01A 2ZGMA 4XJWA 1D2QA 3S5QA 1RC6A 3KV9A 3T2OA 5FP4A 3U10A 4CCOA 4D3WA 3H8OA 3KT4A 3KS7A 4XFCA 2WQ8A 2XMLA 5L9VA 4ZXEA 2BWCA 4AEJA 1ACCA 3N35A 4E4ZA 4Y33A 3KV5A 2WZPP 5GZFA 1AF9A 2VVEA 4QPGA 2VNOA 2L9LA 4D7YA 2ORXA 4KWLA 5IVFA 3WV6A 5FY4A 4CYDA 3PJQA 3LA3A 1QQP1 4CE8A 3SCFA 1RUF2 3ZPYA 4RGGA 4JCKA 4MXWB 1NXD1 1Y7BA 1RGSA 1A3KA 2VZPA 2CDOA 2Y6HA 4K20A 2C1FA 1L7RA 3H0OA 1VBC2 3OOXA 2NP0A 2BNNA 2Y38A 3ILFA 1GV9A 4XHBA 1XRUA 2A3WA 5IUQA 1E57A 3KCCA 4IDZA 3ZFGB 4DXSA 2R073 4PJYA 3WQ7A 4BXFA 4YARA 1GU3A 3TEZA 2XL7A 5FXWA 2DF7A 4HBNA 5DAWA 3B69A 1MPXA 2HWD3 3NJZA 5A7SA 1I6XA 1K3IA 3OGGA 5FY0A 2DV9A 4XHXA 2EIEA 3ZKUA 4PDWA 4UYBA 3AXEA 1WCSA 1KDKA 1VRH1 1AYM2 2XR4A 2PA7A 1MS1A 1WCUA 5G04L 1IS6A 5T3NA 3VBUA 2OT7A 4PI0A 5IATA 2IXKA 1NG0A 2VM9A 2VNVA 3MW4A 3NWKA 4A2UA 2HEWF 5GALA 2PHXA 4MV2A 3NV2A 2X05A 2VTXA 3H3UA 3ZYJB 3R0RA 1DGWX 4I09A 3ZLIA 4CDWB 3M1HA 2VO5A 5LW9A 5HI0A 5CIRA 2ZS6B 4A3ZA 4BIOA 1ZRCA 4RQPA 4IL7A 4FXGB 1SCSA 2WS91 4QKNA 3WW2A 4DPNA 1AJKA 5J48A 5JIUA 3UETA 4GMP0 2DVBA 1QIQA 3QOPA 1J3QA 3B9CA 4LHSA 4PDWC 5FZFA 5T5PA 3VZNA 3WF1A 1LHUA 2D5FA 4MSVA 4X8PA 1DGLA 1UY3A 2O8QA 4MX3A 3VBUC 4KL1A 5T55A 2VZTA 2R1BA 2WNVB 3IDEA 3ZYRA 4DIQA 4HSLA 4BQWA 3KGZA 5CB7A 2XGXA 4KG0A 1WD4A 1RMU1 2A5ZA 3O14A 4XABA 3FZ3A 5CVRA 2JE8A 4Q0VA 4Q0PA 5FPAA 2W5FA 1IZ3A 2GP3A 4LBLA 4CCMA 4TLFA 4XETA 1J84A 5IVVA 2JG8B 3FLPA 4QXBA 4CU7A 2J1VA 4RQPC 1Y9GA 2Z2SB 1F2NA 3SH4A 1CAXB 1VBD2 2Y34A 4UXAA 3F95A 1NQDA 4PBPA 3FBMA 4FPFA 3ZSEA 4IQPA 1X33A 3MIEA 4HLTA 4YM0A 5F3EA 2D6NA 5JDBA 5JXHA 1EAH2 2RS51 3H1MA 4K9SA 3KD4A 4HXCA 1GNYA 2D6OX 5A3MA 2WQ4A 1ASJ1 4ORFA 1U0AA 4CP2A 1W05A 2EALA 4Y20A 1JYNA 5FYBA 1R1A1 4CA9A 1WBFA 1REFA 4Y22A 1V6KA 2Y6FA 3I3EA 5DUWA 3RMXA 3IPVB 3FLTA 2F4LA 1US2A 4BLIA 2A6ZA 2I2SA 1JYTA 2WYSA 1RUJ2 4JDNA 1XBFA 2VJXA 2FQPA 1JUIA 1OUXA 3HBKA 3VV1A 1F31A 4D0QA 2FDIA 1Y4WA 1SLTA 2UWAA 4PHZA 3CIHA 4IV1A 4MVTA 5FYVA 1UX7A 4UFHA 5FRAA 3RGBA 3UJOA 2JD4A 5GZGA 3WLUA 3HT2A 2WAOA 5A7OA 2D97A 1SZBA 3LDBA 5T5LA 3LE0A 3ABZA 3O1MA 3QD6A 2X5IA 4Y3OA 4YVWB 1RUF1 3SC7X 2ZPXA 1GR3A 5FZ4A 4UW3A 3NKTA 3BB6A 2PHRA 1CZSA 3JD73 5EZWA 1VBC1 1SLLA 2UWCA 3J7NA 4QPGB 4QB2A 2XJRA 4UF0A 2Y6KA 2QQJA 2EXHA 2J22A 3GZTB 1S0BA 1YQ5A 4CXXA 3PUAA 1ULCA 4IV1C 3VBOA 5FWJA 1BBT3 2A75A 5A1AA 3V0AA 5FCCA 4XZUG 1G8WA 4PF5A 2RM22 4QGNA 4XF1A 1GLHA 1REEA 4AHWA 1SLIA 3BOPA 4FOQA 2X5IC 1OPOA 4XBLA 5LY2A 2YC2A 4OYUA 3C7GA 1RUC2 2ZA9A 5DZEA 3B94A 3SEEA 4XIOA 1BJQA 5IHRA 5FKBA 5GZEA 3I3DA 5C9AB 3HNMA 3EMRA 4UW5A 2Y33A 2BEOA 1OMIA 2X53S 4LTAA 4N53B 2JB8A 3R6SA 1JXNA 2DFBA 3VBOC 5IFPA 5JPNB 5GJ6A 4AVBA 3E1F1 1SPPB 1OVPA 1VLNA 2OW4A 2E26A 5BNPA 1EV13 1WBLA 2WABA 2RS12 4NOTA 1DZRA 2V5DA 3I3QA 2PQQA 4B1MA 1Q56A 3NVCA 1W8ZA 1JHNA 4RN5A 5KXCA 1A34A 3ES1A 2C9AA 2QQKA 5A7NA 2ZAAA 1PO12 2RR13 1ULOA 1D0GA 2ZABA 5C33A 1ULGA 2VZ1A 4PLOA 4RFRB 2JJ6A 2A3XA 1AUYA 1S0GA 2VECA 2YROA 3GCXA 2WT0A 1CPNA 1Q8VA 1NOVA 3TWIA 3WHUA 4HVRA 3JZVA 5JR7B 3U14A 5F5CA 5BNPC 2J1SA 5FZBA 2G1MA 1COV2 2W0XA 3OPWA 3ETPA 4NWVA 4OHXA 4WVZA 1GWMA 4B29A 2BRTA 3WOGA 3KT7A 1OKOA 1FATA 4JKKA 3VHPA 1YRZA 2HYKA 3WF3A 4BZ4A 1A78A 3TOJA 2XJSA 4AOCA 2XVGA 1NZCA 2B42B 5A3LA 3RYKA 4XUOA 1LENA 2VNRA 1EAH1 3VKFC 4AYUA 4INDA 5AFEA 1QH7A 1RUF3 1MZ6A 4JX0A 2VQUA 4TWTA 3USSA 2ILMA 4A6SA 3PJYA 5JSPA 2IFRA 3IT8A 2V4AA 3NJYA 1NT0A 1UZWA 2P5BA 1W2NA 2SLIA 4P02B 2XG3A 3H8RA 1VBC3 4G9SB 2D44A 3BTZA 4E9KA 2B9VA 4M0HA 3CZUA 4UW4A 4MGIE 4YW6A 2XQRA 1W8UA 1ZZ7A 4IE4A 1HB3A 3FHIB 1LHOA 3P6BA 4ZS2A 4YRDA 3WF0A 3GHNA 4QU2A 1SMVA 3AP7A 2D40A 3OTFA 4K3UA 1HN1A 1VAVA 4FAHA 2CY6A 2EICA 1SG3A 2D98A 5EXOA 3JBG2 1VAKA 1YUDA 3CKHA 4CRQA 1SDDB 3O1TA 3VDBA 5JLVA 4R4XA 5DDJ2 2VQTA 4XF0A 3ASIA 4AI9A 4KU8A 4CCJA 2P3JA 1AL23 1OFSA 2BNMA 2HEYF 2TEPA 1UO9A 2EXJA 2ZHKA 4LO6B 1AYM3 1U5ZA 1WCQA 5BXXA 3POSA 1HKDA 4B7EA 1HW5A 2NM1A 2ID4A 4H7MA 4LBMA 4ZONA 5F2WA 2AREA 5FP9A 1B35B 5GM0A 3UJQA 3X29B 4MGTA 3AXDA 3WNMA 1PX3A 4DXTA 3U37A 5JZGA 4N9HA 4AHZA 2VZ3A 4Y1UA 5FZLA 4HL0A 3ZIXA 1BEV2 4QHZA 4IEYA 2W91A 3RVHA 4ES9A 5CFCA 2ZGNA 1FOD2 4PLMA 3AP9A 2RM21 2J1TA 3DEMA 4DINB 4DS0A 4IGPA 1KD7A 3BTXA 4DUWA 4QB6A 4XACA 5FYUA 4OHWA 3I2DA 1FV2A 1PX4A 4PCRA 4XFGA 4AWDA 4UF0B 3GJAA 1UKGA 1WW7A 5CKMA 3C7FA 3HOBA 5KHGA 1H4HA 2F17A 3OD4A 4OQ9A 4CCDA 4XAAA 4BOWA 5JZGC 3BI3A 2IVJA 3EJKA 4QXHA 1PVC2 4AHYA 1JMUB 4HK9A 4XAEA 5IWFA 3EXUA 4I2OA 1JOJA 5CFCC 4RL7A 5KWRA 1H2MA 1YLLA 3QCWA 4NR1A 4IV3B 3I3MA 2RS11 5L36A 1SCRA 1JHJA 1STMA 4L97A 1XNKA 4ZKTB 1D4M2 1VBD3 4D6RA 5FZOA 3GYDA 3PMSA 3CLPA 4XVHA 1AVBA 4GD4A 2WT2A 3WQBA 3VD9A 5JR2A 1S0FA 3W21A 4QU1A 2J1AA 4AVVA 3LKJA 1DGRN 1QHDA 1UOGA 1LU2A 3N9MA 3AL6A 4DMIA 3HNYM 4Y1VA 5LA9A 3U4XA 1NE6A 2VOTA 2QQUA 1RUJ3 4F8AA 5A7WA 2WL1A 2ZCWA 3VUOA 2ZX4A 1AR81 1Q43A 3K4AA 4IEXA 4YW7A 4HETA 2Q8CA 3NNGA 3TRSB 3PIGA 4Q1RA 2RS32 4BYYA 3DYOA 5F7UA 1WA4A 2JDZA 4YGBA 5I8YA 2GN7A 4X6RB 3S7EA 3HQRA 1YJLA 3HMYA 4LULA 2RMU2 2NZ9A 4LBKA 3VDDB 1O3QA 2JE9A 2W87A 3VHOA 4XPVA 3H8XA 5A3UA 5BV6A 2B8MA 2XWBB 4KG8A 3W20A 4H7LA 4RHV2 5F9TA 1YXWA 1WD3A 3PVBB 3USUA 2R0FA 4AGRA 5C70A 1VBA1 1EPZA 2OS2A 3V64A 1A6CA 4NPMA 3KLSA 5AC92 1ENXA 3LD8A 3OGVA 1OH4A 4NRQA 5FYSA 4AEKA 4DEVA 2C24A 3HN3A 1LODA 1LOGA 4Y26A 4AI0A 2GC2A 4DOUA 5FP3A 4NIHA 4LO4B 3SLIA 2DURA 2VXRA 2JIGA 2BOIA 1MEC3 2K0GA 3OB8A 4R9BA 5FMOL 1TQ5A 1R092 1FMD2 4LIUA 4MADA 5I93A 4XJ9A 1VBB1 1POV0 4IEZA 4Q8LA 1KDMA 3ZMOA 2RDQA 3K4DA 5IYYA 3FHQA 3RZZA 5C3RA 2Y6LA 1EY2A 5LK5A 4ITCA 1JZ7A 3A7QA 5FPLA 2AENA 2CYFA 2D7FA 3VHNA 2GNBA 3H7JA 1FPN1 5EHDA 4OFGA 1T2XA 2ZMNA 4Q4V3 4QX1A 4YGCA 4YW4A 1RUC3 5BPXA 3BU7A 3G7DA 4CCKA 4JGZA 1W9SA 1ZBA2 2HH9A 3A21A 1W9TA 4XDOA 4QPWA 4Y5Z0 2YV8A 1O8PA 3POYA 4Q8KA 2ZMKA 5JCTA 4H3WA 4IGOA 2Q1MA 3VZJA 1DZTA 2P17A 4CP9B 1BEV1 2A73B 2CTVA 1JU3A 2ZX3A 1SFPA 2PXJA 5E16A 2OUJA 4OUMA 2XWJB 3LEGA 3I54A 2JKXA 4QXCA 5FYYA 1GP4A 5DMYA 5F37A 3CJIB 3T0AA 1VR3A 1QOTA 3BTAA 4QDQA 1ND3A 2X8KA 2FBEA 3NJVA 1W9WA 3AMMA 4JGZC 3J7MA 4BK5A 3BKZA 2P3YA 3M3OA 2LW8A 1PO13 4RA0A 4AFAA 3VD4A 3WCRA 1KJLA 1KGYA 2W1UA 2YGLA 5AFBA 5IK8A 2C5DA 3HEIA 3OUIA 1UL9A 3WDYA 3CQOA 1FYUA 3ZDSA 4A7ZA 1E5IA 1PVC1 4KNCA 3S7IA 2KA3A 5KHIA 2FDKA 3B9IA 1R083 4AF9A 3LSDA 5IAVA 1TNFA 1VMHA 1GICA 1COV3 1DQ0A 5I0RA 1W6NA 1UYPA 1H2KA 4Q4X1 4WVMB 2CAUA 3ZDVA 4QXKA 4CDXA 5B4NA 1S2EA 4FOWA 2VD7A 3R4UA 1ND3C 4XBNA 1DGRA 2E32A 4M3CE 4JGYA 1MZFA 1C5IA 2XUEA 1LECA 3GHMA 2ZGPA 4NHXA 3KVAA 3ZXJA 4X6QB 1RITA 3AZWA 2VXJA 5FQ0B 1YFUA 1GOFA 4XF9A 3BCWA 3SCHA 1UKRA 1FX5A 3LOIA 4AAXA 3GBGA 4QX3A 1B09A 3GBWA 3OUJA 3E97A 1LB2A 4UFKA 1NY72 1ZYBA 2RS31 4J6GA 2GC1A 4QDRA 1NUKA 5B4XA 4CDXC 4E27A 1AJOA 1FNYA 3RZGA 2RMU1 1QJU1 2DUQA 2DTWA 4JGYC 2VY0A 5BYNA 3WDWA 3JBG3 4R4ZA 2QUOA 4YM1A 5EYYA 5KHJA 3UGFA 2ZAHA 1RUE2 3IDBB 4I0WB 4RHV1 5DDJ3 3WCSA 3ZIWA 2E7TA 4B1LA 4YFZA 1DQ1A 5KC6A 4OLLA 2OXBA 2DVFA 3ETQA 4QQHA 3I2HA 3C7OA 5FZCA 1WKYA 4XQ4A 5FBZA 4BPZA 1C5HA 5EV7A 2WZEA 3JXSA 3O1RA 2VQAA 5GLUA 3UGGA 2HWE3 4ZZ5A 4B4PA 4LR4A 4MGKE 1H1AA 3JB8A 3ZYBA 1C8M2 2MEV2 2JEMA 3ST7A 2GH8A 1R091 2UY8A 4IERA 1FMD1 5EPAA 4DZGA 3MDPA 3USUB 2E63A 3RS6A 1LULA 4ISQA 2GDFA 3MLKA 3S6PA 2GU9A 1FOD3 2WWSA 4JRLA 4RGAA 3U1XA 2BFUS 4R9CA 4EROA 2VE1A 1RUG2 1OLME 2ZGKA 1ULFA 4LLFA 3I2IA 4JKMA 2Y64A 4M4RA 3NV3A 1RUH2 4FP3A 5LBEA 4YZ2A 1W99A 1ZBA1 1BVVA 3GDBA 3MIGA 4M4PA 2BERA 1BK0A 1UQXA 3MBWA 2ZBJA 4MXWA 3SISA 5K7PA 2PHUA 4GJYA 4Z8BA 2W95A 5GKAC 3ES4A 5IVEA 2ZGRA 1GZCA 1C57A 1OD3A 2HEVF 1HJGA 1BXHA 1VIWB 3LSEA 5F39A 4JHTA 1A8DA 3HQUA 4AQ6A 3DV8A 2UWBA 3ZFGA 2XUMA 3WQ0A 1S55A 3MLLA 5DXDA 5L73A 1M06G 2JKBA 3T2QA 4AZZA 2O1QA 5G05L 4BMBA 4GMP1 1D4M3 1QQP2 4J1WA 4X8NA 3ME2A 1ALYA 1YCIA 2WRAA 3VBFB 3AMPA 2E51A 2GALA 3APBA 3DKQA 4LHKA 2A71A 1PO21 4YVSB 4UBGA 1UPSA 5FOBB 4QPIB 3I2OA 1CQ9A 2XKOA 1QXPA 2LALA 2QNKA 4P9GA 1OA4A 2WQZC 3S30A 3FLRA 3ZFGC 1H6XA 3I7DA 3IM0A 4OZXA 5FY9A 4CEWB 2C9KA 4EZ4A 1XOYA 2RS33 4CDWA 1G9DA 2YY1A 1XSRA 1GZTA 1QNWA 2IWGB 4Y4YA 2FZ2A 1YFXA 1VRH2 4LA2A 3RZHA 4XFBA 4A42A 4JAAA 4AI1A 3LWCA 1UY0A 1W3XA 2VR4A 3M4FA 3TB0A 5KXEA 3T08A 3WNPA 2BUKA 3EYPA 3ZYHA 2VMEA 5LZ6A 3KVBA 2IFWA 2WNVA 1KEXA 2XXZA 3TNQA 5AC93 3LCPA 3HAGA 1F9KA 1MZ5A 2B9UA 4FPHA 4LMFA 2WWJA 4XQWA 5F3IA 2DUOA 4HN0A 2PQSA 3C8XA 4HOOA 1SFNA 4LBQA 1NY71 1ULPA 4W6XA 5LY1A 2KD7A 3LZZA 4CDWC 5JUVA 5LCWL 1H30A 2OIIA 2CNAA 1VBE1 2E6VA 2QQOA 3KT1A 2JG8A 1AXKA 3N7LA 1FMD3 1RJ7A 2JICA 2ZGTA 5ANQA 5CFDB 4ES8A 5KXBA 3DXTA 3B93A 3BUCA 1CAXA 2ZGUA 3PTRB 1WLCA 3AVRA 2AH2A 2FHRA 3DN7A 2G9GA 5H9PA 1RINA 1VE0A 2UYAA 5HV0A 4RD7A 4W4ZA 1CAVB 2XB6C 2ZGSA 4XF3A 4D6QA 1RMU2 2LTNA 5LK7B 1ZBE1 1H8TB 1QDOA 2WNVC 3GZUC 3KV6A 4IEUA 5DPNA 3W9AA 1CONA 2VUJA 2QDRA 4OULA 2W3JA 3B01A 3RWKX 3GJBA 1PGW2 2EIGA 2VBPA 3IPVA 1DF0A 3BPSA 3M8LA 1LHNA 5FOJB 4Z07A 5A3PA 2JG8C 2FMDA 2V73A 4BCUA 3N36A 1DU3D 4HPKB 4FPLA 3VB9A 1AZDA 5DZGA 5CA6A 3D0JA 1XE7A 2RS52 4OZOA 2NPIA 5J98B 4CPBD 2WO1A 4XCAA 1Y3TA 1TZOA 4GMP3 1GQHA 5FZHA 3T09A 1RUG1 1X50A 2YYOA 1HB2A 1CAWB 3RRDA 2VZOA 2VCMA 2ZEWA 1R1A2 2Y60A 4AK3A 4DB5A 4YPJA 5F5QA 3SCGA 2ADDA 2ZXQA 4C8DA 2G4IA 1DFQA 4EWDA 3ZFFB 4YVWA 2R041 2E33A 3ZXGA 2WINB 1SFYA 3MIHA 3ALQA 4B4QA 5JMOA 2QQMA 5C4WB 4LKFA 4A4AA 1AYN3 2EAAA 3ZN6B 1A8MA 1PM7A 2DBIA 3U0ZA 1QJEA 2OA2A 2DBNA 4CDUB 4WV8A 4META 4UBHA 4TTGA 5A6ZA 5HV4A 4NHKA 2OKXA 3FL7A 4HK8A 3TN91 2C26A 5FLIA 1W2TA 3KQ4B 1OSGA 1C1LA 2BV4A 4FPYA 1XNCA 2R061 1OQ1A 1TME3 2D6PA 4ATEA 4YVWC 3ACIA 4H14A 1W90A 2CV6A 2Q0AA 3N9LA 5LA2A 2FMYA 2JB4A 2J7MA 4AFDA 4XCBA 4TSVA 1LHVA 2DTYA 1HV1A 2QQLA 1AX2A 3SHRA 4NIIA 4QPGC 1GMMA 5C9AA 2IXCA 4M3CB 5JWPA 5L19A 4FTSA 2P34A 1FT9A 4N53A 2K9ZA 1I5ZA 4LUKA 2DYCA 4QQ2A 5BNQA 2Q30A 2EXKA 2WFF3 1G7YA 3IN9A 2NLRA 3WP5A 2VZUA 4ZHNA 2RHPA 1SPPA 5FZGA 4ASLA 4D8MA 2HWF3 2WAAA 1OFNA 3B02A 4PLNA 1GBGA 5EFUA 1IG3A 2VTXJ 3THCA 3PTYA 4LOSA 4CEYA 4XYXA 2VG9A 4HZFA 4XE9A 2AACA 2VCBA 1RUE3 2H6CA 1VB4A 2VUAA 2Z79A 1DBNA 5A32B 2P1BA 5F3GA 5F5IA 2ARAA 1AR91 1EPWA 3ZXDA 2GMEA 2P37A 2ETEA 3N9PA 2HWC1 2VUCA 4S2GA 4B4RA 5C9AC 1IHMA 5FTTC 3E5UA 4N53C 2RJ2A 1MZEA 3L2HA 4KU7A 4KGQA 4LKEA 3TAYA 1C8M3 2MEV3 1JN2P 2GC0A 1X82A 4Q0QA 1PZ8A 3I97A 5FUIA 2BZDA 2GMPA 4P9JA 3WW1A 2WZ8A 3KWVA 2OQ7A 1KS5A 3H50A 1UD1A 4W6YA 3GGLA 5KBFA 4AFBA 1GP5A 2XJQA 3A4UA 4LBJA 5FK8A 3J9SA 4BHPA 4N9IA 4GIQA 5C3PA 4NAOA 2B5HA 4JTNA 2YZ4A 1NQJA 3D5OA 5C8WA 3LIGA 1RUH3 1LU1A 4LBQB 5L7OB 4E2QA 2VMDA 1IPSA 3T2PA 1D0HA 5JXIA 1G6NA 1PGW1 3DCQA 1ND2B 3K3OA 3NQHA 5IVBA 1G86A 3PDQA 4DFSA 2P6HA 4QX2A 1V6JA 4Y1XA 1DQ4A 4QKBA 5A6YA 1O59A 3BOWA 3T4VA 3K2OA 4LQRA 5LB6A 1H6YA 2VW2A 2AYHA 4OUSA 3VZOA 3AYEA 4R8HA 4BQ2A 1QQP3 3KV4A 1C4RA 4AR2A 1CWPA 5IVJA 4V1PA 3M2MA 3HPNA 3POBA 4EQVA 4NIDA 2Q8EA 3ZPOA 2IXJA 1RJ8A 4RR3B 4J1XA 4MOAA 5GLWA 1PGL1 4NE9A 3GNEA 2VVDA 3E6DA 1G9FA 4AW7A 1B35A 5FZEA 1XC6A 4YZ3A 1L3JA 2VL4A 3POGA 3VN4A 4FCAA 4ATFA 5LWBA 1J3RA 2ARXA 2ZX0A 2GC3A 1KFXL 4MH0E 1QOSA 1UMIA 4KBZA 4COZA 1UXZA 1YQ6A 5LEKA 2VMFA 3WP4A 2IC1A 2YC4A 3NL1A 4XOGA 3ZN5A 2W1SA 1VRH3 1JBCA 3CHXA 2WZR2 3IAQA 4QX8A 1GKBA 1XU2A 4V2VA 3K75B 3OYWA 2WWUA 4L11A 2BGOA 1QJFA 4PIZA 1LRHA 1RUI2 4QHOA 2ARBA 2YGMA 3U75A 5A6QA 2XDVA 1YO8A 3MF9A 4KWKA 5D8AB 3RSJA 3AMNA 1GOHA 1W2UA 2VGDA 1B35C 2IXHA 4FFIA 2DU1A 4L9BA 3HN1A 3R4SA 1GWKA 1NLRA 2RDRA 2CGPA 4S2HA 5DZFA 1YFWA 4WZCA 2ZZQA 1JYWA 5HCFA 2WS93 1K45A 2GP5A 4CU8A 4HVQA 1QJX1 1S0JA 3MW3A 4IV3A 1EP0A 3WT3A 1NZIA 1H8VA 2KXLA 1NCRB 2FDJA 4AL9A 1GWLA 3IKWA 2DVDA 2VW0A 3SNMA 2ZOEB 1U5XA 2WNOA 4QKDA 1IG0A 3POWA 4ZY9A 4P08A 3N7KA 5DAPA 1RMU3 1QJZA 3D3AA 2CWMA
chains in the Genus database with same CATH topology
2I74A 1MQTB 4IXLA 2HKXA 1HDKA 1LHWA 2XJVA 4YM3A 3RQ0A 3C3VA 1QJY1 5GLTA 2W68A 4CEYB 1GSLA 4IV3C 4N90A 1POV1 3CEWA 3J26N 4I02A 4Z82A 2GNMA 5SV8A 5I0UA 2A6WA 5JSOA 2RS53 1YHFA 3VDDA 5JOYA 2VOKA 4XJUA 1ASJ3 3D4KA 1R1A3 1ULEA 2H0VA 3WG3A 3T1MA 1Z7S1 3E5XA 5JOWA 5K0UB 3O12A 1YI7A 2XKPA 1DHKB 1AR82 4C0HA 3E6BA 3FMGA 1ENSA 2JE7A 1AX1A 1OPMA 2YPJA 5E8AA 1H0BA 1OD5A 2ERFA 3VDDC 1J59A 4LHLA 2BGCA 1XNBA 2EA7A 1VBA2 3E5QA 3V0BA 2PHFA 4HKLA 1ENQA 1QY4A 2LM3A 3AKQA 3N3HA 4OHVA 4L99A 2EXIA 3Q9OA 3CJXA 3WP6A 4M01A 4AHXA 4YG6A 3BPZA 4AG4A 2FZ1A 2A6VA 4AGGA 1VBB2 4PIXA 3RJRA 1YI9A 5LRSA 1BZWA 5KXDA 4FAGA 1S0DA 1H9PA 1OI6A 3ZO0B 3THTA 2WT1A 4Q4Y1 2DCTA 3VBRB 5FDBA 1FPN2 3CNAA 1V6IA 2CL2A 5FAXA 1IKPA 1QXRA 4FPGA 3ZYPA 2WZR1 5KHKA 2HWB1 3ZVXA 3CJIA 1CAUB 2EAKA 1O7FA 2ZMLA 1RUI1 1UAIA 3GBFA 3EBRA 4Q4W2 4FT8A 2PFWA 1C28A 2QVSB 3AMHA 4Q0SA 5E89A 4N7IA 5C8CA 1ZA4A 1HIXA 2D3SA 3FWEA 1TMF2 1N1SA 3JQXA 3OYWB 1POV3 3MF6A 4JDMA 1SBEA 3NV4A 1QKQA 2PHDA 1GZ9A 2I07B 4WVMA 5H9SA 3CJIC 3GF6A 5I91A 2CAVA 4IEPA 3AZVA 4JRAA 4AXOA 2JX9A 1IKQA 3J8F2 2XBO2 3ELNA 4ZU7A 4RS5B 3K51A 4HSJA 1N1VA 2D93A 3KGLA 3MPPG 3KB5A 4QQPA 1RHI2 5FQ0A 1YIFA 5FLHA 3WDVA 4ASMB 4F7ZA 2WNEA 1U5YA 1H4GA 4Q4X2 5FPXA 1QU0A 4GWMA 1JUHA 1NLSA 4CP1A 2A6XA 3N4MA 2DU0A 1EAH3 5JPMB 2LUWA 1MVEA 3ENRA 1LESA 2OYZA 4DRRA 4C1WA 3SMHA 1XNDA 2H0BA 3H7YA 3MIFA 2XVKA 3KCYA 2PHWA 3ZN4A 3ROUA 4D7TA 1XYNA 1YYNA 3AP5A 4EV0A 2DCJA 2IZWA 2BYVE 3O0WA 4L92A 1SACA 3EQEA 5BNOA 1QJU2 3WY6A 3ZFEB 1N47A 1HXS2 2XVLA 3W59A 3DGTA 4AVTA 3WINE 2WZR3 2CGNA 4AFMA 3GALA 1JYCA 4QQLA 2BQPA 1F5FA 1RUI3 1Z0HA 2OZJA 4LUMA 5IK4A 4Q2FA 1O91A 2UYBA 5BNOC 1XYOA 2VULA 4D69A 1AR71 3I8TA 4XJAA 4F3JA 1BQPA 1PK6B 3FUOA 1Y43B 1HRI2 1GZWB 2RM23 3V0BB 4SBVA 3HD8B 4WBBA 5EWSA 5KC5A 3ZSMA 4QHBA 3VKOA 1SEFA 4NHLA 1LGCA 2Q1ZB 3AM2A 3I59B 1S2BA 3VBFA 2PAMA 1DQ2A 5IT6A 3MZHA 4Q4W1 3ZYIB 3RG0A 1Q8SA 1UU4A 4YVSA 4O9EA 3PMEA 3WUCA 4QPIA 3FC0A 4AQ2A 5T52A 3WHTA 2RS13 1AR61 1HRV2 2VMIA 3ILRA 2E9QA 1QH6A 2V5YA 1TMF1 1LOAA 4CEWA 1WMFA 1NA1B 1N3PA 1NCQB 4ZXKA 2PLV1 5HCBA 4P9YA 1PO22 1ZREA 4YZ1A 1ZRDA 2WFPA 5ACA1 3VBFC 4AEDB 2VOVA 2BWAA 3J8F1 2XBO1 5JVVA 5EYXA 2Q4SA 3WNXA 5C8CB 4YVSC 1WCDJ 1RHI1 4QPIC 1F5JA 3OY8B 1PIV1 4AQSA 1W0PA 1AR83 3WDTA 3O7OA 4OHYA 3PVEA 1GYKA 4YM2A 2ZTNA 5I8SA 1HQNA 4CEWC 1IPJA 5DUVA 1PZ7A 4ZU5A 1X8EA 1YNAA 4EN0A 3V56A 5CFDA 3AJYA 5GLZA 3VBHB 2KM2A 3MI8A 5DG1A 3LA7A 3H1YA 5J7MA 1ZRFA 1VBA3 5CADA 4WM7B 3RPQA 1V6MA 4GKYA 1Q5OA 1ZZ9A 4XTMA 1WGPA 5C6CA 2BVBA 4SLIA 3BALA 3ZX7A 3UKVA 1CAVA 1X7NA 1PHMA 1H8TA 1ENRA 4LBOA 1AXZA 3AKPA 3MYXA 4BMEA 1VBE2 2WA4A 1RVF1 5JI7A 2AGSA 2EF6A 4JV4A 3IMNA 1VBB3 3WR0A 2Y0OA 4JTOA 1Q8QA 1PNFA 1JTZX 3ZXLA 5CFDC 3AP4A 2WC2A 1HXS1 2WLPA 2R072 4HPKA 5ABJB 1FPN3 4YYOA 5FREA 1ZBE2 4FPJA 4YW5A 3HQXA 4PBOA 2DVAA 3AFKA 1CAWA 2HWD2 2XJTA 3AJZA 5AVAA 5BNOB 1H8TC 3ZFFA 3VHRA 3HWJA 1FAYA 4MXVA 3U07A 3FE5A 1BEV3 2QDNA 5C4WA 3ZN6A 3WP3A 1FV3A 1HRI1 4MGYE 5CNAA 3ACLA 4XTPA 1UZZA 4DXZA 1APNA 1WMDA 4CDUA 4QD2A 1LOBA 3V65A 3P3NA 2VPVA 3MLJA 2R042 5FO9B 4XJ8A 1AXYA 4IETA 3MW2A 1PGSA 1FI2A 3LA2A 2XBO3 3ZFFC 2E7QA 2I45A 2K2SA 1PVC3 4AVSA 2D3PA 5C4WC 5FFOC 4QQOA 1OQDA 3K48A 3O5SA 3CO2A 4M3CA 4OI4A 1CD3G 1HRV1 4XILA 4Q4X3 3TN92 1VB2A 3AYAA 4L8QA 5H9RA 4A7YA 4CDUC 1MS3A 3UL2A 3WX5A 4MLOA 2R062 1NE4A 1RIRA 4U36A 2R49A 5J3UA 3M3QA 3VGIA 3M3CA 3BIWE 4Q0UA 2YUEA 4Q27A 3O0XA 2WKKA 1AX0A 1I3HA 4LE3A 3DF0A 5A32A 2NMOA 1RUOA 1IQAA 2W08A 3BODA 2XH6A 1KFUL 2AR6A 1JYIA 4NVPA 4FPKA 5T5OA 4DNYA 2RMU3 1QJU3 1J1LA 2O8OA 4MGZE 2BNOA 1MS8A 4RHV3 5J09A 1AR92 4BE3A 2WSVA 2HWC2 3QH6A 3TYJA 4Y1YA 5L7OA 4HKWA 1VALA 1R093 1SLAA 2VMHA 2JG9B 4IEWA 1DGWA 4BM8A 2MHFA 1NYWA 1ND2A 3A0KA 3B00A 5JOXA 1N1YA 1V9U2 4XEZA 1CJDA 2MPFA 1DDLA 2R16A 3D8CA 1HRI3 4ISRA 2EVXA 4ONUA 2R071 1BBT2 1X36A 3KZ4C 4CDQB 3NW4A 2QFEA 1ZBA3 2AZ5A 2ZKLA 4GH4B 1CESA 2DCYA 2HWD1 2BFUL 2YMZA 4F83A 4BQ1A 4I0AA 1RUNA 5L7OC 1K5MB 3WG1A 4E4DX 1UU6A 4WVVA 4NO4A 2TBVA 3JU9A 4RR3A 4GB32 2BPA2 3NAPB 4FO9A 1ND2C 4GXLA 1DG6A 1LJ7A 4FVVA 2PHLA 4C91A 1RTVA 3ZSLA 4EWAA 1ULDA 3VKMA 3QBQA 1W6OB 1PO23 1WW5A 5LEJA 1SQ4A 1WW4A 1PGL2 4LO7A 3E6CC 1SLCA 2CWSA 3RI9A 4R9AA 2RJKA 2DCKA 4IESA 2QZ2A 4RR3C 2RR12 5H9QA 4AEMA 5D8AA 3EO6A 2Z5WA 4NN0A 3LOBA 4MZUA 2QKDA 5B2GB 3IDCB 4LEJA 2VQ0A 4R52A 3UK9A 2GNTA 2GH2A 2XLFA 2YC0A 1C3HA 4FQ4A 2H6BA 1VJ2A 3ZXEA 4AE2A 2PN5A 3VL9A 2X29A 4BIFA 3O0VA 1NCRA 2IXIA 1URXA 1REDA 1V6NA 2NMNA 1WLDA 3RYRA 2ZHLA 5D8AC 4K1ZA 1QOOA 4EN8B 1IOAA 5FO8B 1HX6A 4FPOB 2Q8OA 1MQTA 2YXSA 1QJX2 1Y9QA 1VBE3 1OOPB 1T6GC 2WNUB 3MIDA 2CGOA 2A6YA 3PHMA 4U2AA 4KGGA 5JMCA 1CGPA 2R6QA 3UKNA 1HQWA 1W39A 2GNDA 3OPZA 2P2KA 1UW8A 2JECA 1NCRC 3KQRA 3ZSKA 1GNZA 2XLGA 1ZBE3 5TSWA 2O0OA 3JUUA 5DUUA 2V09A 1LR5A 3FUQA 1VP6A 1QJY2 1VAMA 3AK0A 4COUA 1MQTC 1AL22 5K0UA 4CP0A 4LNVA 1PMIA 2A3YA 4COYA 3JD71 2N7GA 4XFAA 4JC1A 4HFSA 5DG2A 1V9U1 4CEYC 1DQ6A 2D6LX 2F6BA 4B3NA 1RUG3 3MFCA 2TUNA 1BBT1 2B7YA 4WM8B 1KS4A 1Z7S2 1TE1B 2R043 4QMAA 1O5UA 4LA3A 1C8NA 5A33B 1UZYA 1GQGA 5K0UC 3DUIA 1S1AA 1W6QB 2QCSB 1SBDA 2HJIA 2ET1A 2PHTA 2ZKNA 3L2YA 4GB31 2QQPA 4FP2A 4YNIA 4TYSA 5BNNB 4EN7B 3TN93 5GLVA 3IIAA 4YG0A 1UPIA 4H55A 4N43B 3OF1A 2R063 4AVAA 3LGRA 3VBRA 1EV11 4XJZA 3UV9A 2PAEA 3H3ZA 3OGJA 2ZX1A 2NN8A 4EWEA 3L9JT 1G9CA 4FOYA 4QGLA 1CAUA 3MPBA 4GWNA 4Z1VA 3DPRB 1AHSA 2RR11 4K7JA 3NV1A 4JVAA 3FBYA 1BK1A 3LB9A 1LEMA 4Q4Y2 3P3PA 5JI9A 1QXJA 3HR9A 2DFCA 1OLQA 2B39A 4XF4A 4K1YA 3RMYA 1UIKA 4DRVA 2PAKA 2ZHMA 2ZHNA 1F8VA 3VBRC 3MFAA 2HWB2 1PNGA 2Y26A 1W6PB 4XFHA 2XL9A 3ZXAC 4G4FA 2MNGA 1AL0G 2VOWA 4L2NA 4S2FA 5JIAA 1AR93 3RYPA 3AP6A 2HWC3 3FFZA 4QGMA 1V6LA 4RS5A 2BBVA 1ZX5A 3OBTA 4HANA 1JW6A 2VW1A 4UW6A 1S0CA 1HV0A 2SBAA 3URFA 2ZGQA 1V9U3 3ZXKA 1MEC2 2G9FA 1IGOA 4AFCA 1ZRRA 4XQDA 2YHJA 3FFQA 4EN6B 4RS5C 2YDEA 4YZ4A 4AGVA 3ZYGA 4Q4V2 1AL21 4DY5A 1ZZ6A 2ENRA 3N7JA 2UURA 1AYM1 5CAZA 2PYTA 4IEQA 1N1TA 4GB33 1ZZCA 4GALA 3WXPA 1WUVA 2P3IA 3WG2A 2D5HA 5HCAA 2XPJA 3ZFEA 1RUD2 4A7KA 4PDWB 3OD0A 4I30A 5T50A 3U11A 1U5IA 1UIJA 3M3EA 4NHMA 3PNAA 3VBUB 4NPRA 1LOFA 4BWOA 4HMZA 1YJKA 3VLBB 1SDWA 2XHKA 1V70A 1O4YA 3TNPB 1XYPA 1O3RA 1CIWA 3T1LA 1UCXA 2WA3A 4JQRA 3RWNA 4RQPB 5JAXA 2ET7A 3ZFEC 1PK6A 1GZWA 1PVXA 4HT1T 1J1TA 1KQRA 1R082 1W6MA 2GZWA 1LGBA 3JB4C 1VBD1 3PVOA 1LOFC 3WW3A 1HLCA 2B45X 4LO5B 4K8FA 1O4ZA 3I59A 4FSJA 2JXAA 3GZAA 1H9WA 1RB8G 4M0NA 1AR72 1DLLA 3QH7A 4Y24A 4CZSA 1Q8PA 5FPZA 4W6WA 1QJX3 1MACA 1N3QA 1PK6C 1IS5A 1ZM1A 1V6OA 1RUJ1 5BY5A 5IK7A 3D0SA 4RFT0 1NA1A 4HVOA 2NYYA 1NCQA 4Q29A 3M3IA 1D2SA 2PTMA 3ILNA 5F6KA 4FTEA 1OKQA 2DVGA 4AEDA 4Y20B 3D6EA 4BA6A 4Y22B 3VKLA 1LKNA 2A7AA 1QJY3 1AR62 2IXLA 1M4WA 4Q1PA 1BYHA 1CVNA 2JENA 3ZMNA 3OY8A 5FMOS 3INAA 1SBFA 4KQ7A 1BMV2 1OA2A 2HWE2 4C0BA 1S0IA 5LRRA 2PLV2 3AX4A 4IV1B 3T2TA 4D7SA 4AI8A 5ACA2 1NA1C 1MEC1 3PLQA 1DYKA 1NCQC 4YGEA 4TZDA 2X5IB 3WUDA 1DYPA 3VBHA 4AEDC 2UU8A 1Z78A 1Z7S3 3CL1A 1PIV2 3SITA 4WM7A 3UKTA 5C8CC 4C1XA 1I1EA 4E4SA 3KM5A 4Q4V1 4Z92B 1D4VB 1KXGA 1RUC1 2OZ6A 4HN1A 4AVCA 1O3SA 3VKNA 1CJPA 4YZ5A 4PQ9A 3VBOB 4GULA 2ZZJA 4YG3A 3V0AB 4FPEA 5JOZA 2Z42A 1PZ9A 3ECQA 4G3YC 3WVJA 3VZKA 3S0MA 4O9GA 1UMZA 2BVVA 3R4DB 3IBMA 2OUHA 2Q5TA 3VBHC 2PELA 1R1ZA 1RUD1 4N7UA 2R32A 5ABJA 3AZYA 4WM7C 5HBAA 2ZACA 1KITA 2GN3A 1S0EA 5K9YA 1EYBA 5E1RA 1TEIA 1RVF2 3AKRA 3HBZA 1RL3A 1LGNA 3AKTA 3NKGA 1PO11 3B7MA 4YLZA 4QX5A 4LBQD 1WLWA 4Q4Y3 5FLJA 1W0OA 5HXVA 4P5HA 5BNPB 2ES3A 3B5LB 3VBSA 3C2UA 3JCIA 2QE3A 3FJSA 1OLRA 2B46X 1UF2C 2GAUA 1R081 1OHFA 2HWB3 3PVNA 1U12A 5ABJC 1COV1 4K40A 3I4IA 4WVWA 1HQLA 4W65A 3WD5A 2OPKA 4COVA 3M7AA 3EHKA 2QZ3A 4OI1A 5BUVA 2TNFA 5GZCA 4QM8A 4E2SA 4AI2A 1WLTA 3VZMA 1W6MB 3JQWA 4P9LA 3VBSC 4CTEA 4FOVA 1S2KA 2E53A 4YGDA 3MICA 1XXNA 4QT6A 3WZ1A 5T54A 3RDIA 5CBLA 4I3GA 5I0SA 1IPKA 4YW1A 5J96B 1QWRA 4A3XA 1YWKA 1DZQA 3JBG1 4YW3A 4FXKB 5DDJ1 2VNGA 1H1IA 3N7MA 1CN1A 1ZVFA 5JSRA 1QMJA 1XU1A 3AYCA 5EJ3A 3SH3A 3H8UA 5T5JA 1BMV1 1BCXA 2ATFA 2HWE1 4S2DA 4B8EA 1UX6A 3H1WA 4K21A 4AI3A 4LLOA 1LOEA 2R0HA 4D94A 3AMQA 2QJVA 5I8TA 3FX3A 1MS9A 3AZZA 1MS4A 5D1IA 2UY9A 3ZXFA 4KH9A 1RUD3 2OVUA 1FOD1 2F4PA 1H2NA 2Y0IA 5CG9A 2W39A 2D6MA 4JDOA 5DUXA 1G9AA 1XE8A 5JZGB 1MS0A 1WMEA 4COWA 1QGLA 3KCXA 1MS5A 1QNYA 2JG9A 1IS3A 1O4TA 5E88A 5CFCB 1AYN2 2AUYA 1Q8OA 3THPA 1O3TA 4KBBA 1KJRA 4XZPA 4ZU4A 5F6LB 4RSUA 1UU5A 3AZXA 4OI0A 4CDQA 1D4M1 1J3PA 3SH5A 4GH4A 4R9DA 4OVEA 4C90A 1GNHA 4PIYA 3HT1A 1TME2 3WW4A 4Y1ZA 5GZDA 1AR73 1K5MA 2BTVC 3AKSA 1NXMA 1TNRA 2JG9C 4NWWA 1JH5A 2W52A 3NAPA 2XJUA 2XJPA 3A0NA 1BVP1 2ZX2A 3KMHA 1KRIA 3WQ1A 4E2GA 2RE9A 3IWZA 3MEPA 4XXPA 4FTBA 2GSYA 2WFF2 5J37A 2VVFA 2R30A 4CDQC 1O5LA 1OA3A 2GMMA 2HWF2 4Q4W3 4GH4C 3DL3A 1W6OA 2XLAA 5I0TA 3B3QE 3VBSB 4YFWA 1K5MC 4B7KA 4LE4A 1AR63 4GQ7A 4XBQA 3NAPC 4KWJA 4I0BA 1ONAA 1TMF3 4EN9B 4YSFA 5AC91 3D82A 1GANA 2PLV3 3RI8A 1FNZA 5ACA3 3NO8A 3J8F3 1LCLA 4Q26A 4I3PA 2WLQA 1WW6A 2ZGOA 1MVQA 1XQNA 3W58A 1N3OA 1RHI3 1PIV3 3AYDA 4BLJA 1LOCA 4HKOA 4IEOA 3CF6E 4M00A 4GKXA 2WJSA 2Z69A 4OHZA 2A70A 2DCZA 4LO8A 1OOPA 1GFF2 2WNUA 2ZJCA 3LAGA 3NSTA 4XFFA 5KHHA 3OBRA 3RNSA 1G9BA 4DQAA 4WZFA 1LTEA 1ZZBA 4JGZB 1H2LA 1Q3EA 2D6KA 2WSUA 4P14A 3R05A 1X8MA 1OQEA 1RVF3 4QPYA 4AQTA 2DWRA 3WG4A 2VH9A 3WDUA 2VMGA 4Z2WA 1WCKA 1CR7A 1LEDA 3OCPA 1OOPC 2WNUC 4K6BA 2DUPA 3DKWA 3MGUA 4XFIA 4MYEA 3VL8A 1HXS3 2VU9A 1AYN1 2ZGLA 4XMAA 4LHNA 1UN1A 1QDCA 1J58A 4P9WA 1ND3B 4P9IA 3J4UH 4MUVA 4WM8A 4BH9A 3AFGA 5CU1A 5CG8A 3QLQA 1H1MA 5FO7B 3H9AA 3JD72 4GA9A 1TME1 2P3KA 2BW8A 4XIKA 5A33A 4P9XA 1W6QA 3G6JB 3OJBA 4FBFA 4FQZA 4YW2A 1ZZ8A 3HIFA 3WDXA 5BNNA 1W6NB 2VOXA 4CDXB 2WIIB 5IK5A 4LBNA 4LT5A 1IS4A 1FXZA 2WFF1 1CPMA 2WS92 4N43A 1SLBA 4WM8C 4JGYB 2HWF1 4XMIA 2RJLA 1DIWA 2D3RA 3MIBA 4XDQA 4OI2A 1RUE1 1C1FA 5SV5A 1MR5A 3DPRA 1HRV3 1CX4A 2NQYA 4IEVA 3SXWA 5BNNC 1ZNPA 1I9RA 3RJ2X 1EV12 3ZSJA 4N43C 1C8M1 1DQ5A 2D43A 2MEV1 3ATGA 3QACA 2R1DA 4XXAA 3CU7A 3AB0A 3KSCA 5F1RA 1W6PA 1BKZA 1V00A 1YIPA 2C0ZA 1QF3A 3M70A 4DY3A 4EJRA 3TBDA 4QM9A 2E7AA 4M3CF 3DPRC 1ASJ2 4FPCA 4XW3A 5K8SA 4URTA 1YFYA 5AVPA 1RUH1 4I01A 2ZGMA 4XJWA 1D2QA 1RC6A 4D3WA 3U10A 3KT4A 3KS7A 4XFCA 2BWCA 4AEJA 3N35A 4E4ZA <