4XFIA

Cysteine dioxygenase variant - y157f at ph 6.2 with homocysteine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfiA00
1O3SA 3S7IA 2CV6A 4KWJA 2OYZA 1CAWA 3O14A 1YLLA 4Q0PA 1DGRA 1RTVA 5K8SA 1FXZA 3E6CC 2D93A 1ZRCA 1FI2A 2XLGA 5FLHA 3LOIA 5BV6A 4D7SA 1J58A 4E2SA 4YSFA 2CAVA 4QX5A 3D0SA 4N9IA 3KMHA 1O5UA 3ETQA 1LB2A 3E5QA 2PFWA 1NE6A 2K9ZA 3I54A 2B5HA 3S0MA 2UYBA 2MPFA 3EHKA 2Z69A 4XETA 4QM9A 3SCFA 3H8UA 4WZCA 5JSRA 4XFGA 5I8SA 5BPXA 3PVBB 3U11A 2Q1ZB 4AXOA 1I5ZA 1DZTA 5FLJA 2C0ZA 4KL1A 1Q5OA 4XFFA 1UIJA 3DL3A 4HN1A 2DCTA 4KWLA 4HBNA 3N4MA 2H6CA 4PJYA 4R52A 1H1IA 4AVBA 3OGJA 4ONUA 2UY9A 4YARA 1X8MA 1O7FA 5BY5A 3ACLA 1UW8A 4O9EA 3U10A 3CJXA 4MV2A 4LA3A 5I8YA 4XFCA 3R6SA 2V09A 5FPXA 3MDPA 4IEOA 3BU7A 2ZKLA 2VQAA 4YYOA 1IPKA 5JAXA 5E16A 4BIFA 4DINB 2ETEA 4F7ZA 5BUVA 3H1YA 2IXCA 4N9HA 1RUOA 4WVZA 2QDRA 2QVSB 4HVOA 4ZU5A 3VHRA 3WW1A 5JR7B 1QXJA 2XGXA 2IXHA 1NYWA 2OPKA 4IESA 3C3VA 5D1IA 4J1XA 2ET1A 3BPZA 5BXXA 1ZRFA 1I6XA 1EP0A 2EVXA 4XFAA 4UXAA 1YFWA 3B02A 5JCTA 3SCGA 4LEJA 4IEWA 4MUVA 3I7DA 1J3QA 3H1MA 1ZZ7A 5FQ0A 4HVRA 5EFUA 2Y0OA 1CX4A 5HI0A 4OFGA 3EQEA 3DN7A 3CL1A 4IEQA 4Q0QA 3I59A 3ST7A 4LLOA 4JTNA 3RNSA 3GYDA 3D0JA 1Q43A 4OLLA 2XHKA 3H1WA 4MH0E 1PM7A 4J1WA 1YFYA 1ZNPA 2GH2A 4XF1A 4EROA 3LAGA 4MGZE 1O3TA 2Q4SA 4PIXA 1SEFA 3RYKA 4IEVA 4UBHA 3E97A 1J3PA 3QOPA 2N7GA 3E6BA 5CADA 2Q0AA 1CAVA 3USSA 2OZ6A 3E5UA 4HN0A 4I0BA 5I0SA 2PTMA 4KWKA 1ZVFA 4QXKA 5J48A 3SHRA 4MGIE 4PIZA 1EY2A 2EA7A 4MZUA 3DKWA 5LRRA 4QGMA 5C8WA 2BNMA 4KU7A 3MYXA 2XKOA 3CLPA 3SXWA 2XLAA 3OTFA 4HZFA 4QM8A 1VP6A 4ZU4A 4I02A 1LRHA 2WC2A 1X82A 4FAHA 3EJKA 4B29A 4L2NA 4BHPA 1XE8A 1X8EA 5I0RA 1DZRA 4QGLA 2ATFA 4XFHA 3RYPA 2UY8A 2Q30A 2XKPA 5I91A 3EO6A 4EWAA 3KGLA 3FZ3A 4LUMA 5LRSA 3KGZA 4F8AA 2GC2A 3U0ZA 4XEZA 1OD5A 4XF3A 1QWRA 1GQGA 5FCCA 3BB6A 4XF9A 1HW5A 3IIAA 1JUHA 3LA2A 3UKTA 1CAVB 3NSTA 5JSOA 4K8FA 2BNOA 4Q29A 2GU9A 3ELNA 3RPQA 1YWKA 3H3ZA 4JTOA 1O3RA 3MPBA 5EZWA 1UIKA 1UPIA 1J59A 3IDBB 3CEWA 1G6NA 2F4PA 2GZWA 4ORFA 3NJZA 4D7TA 1X7NA 2PHDA 1J1LA 3WW4A 4R8HA 3WW2A 2BGCA 2QJVA 2QCSB 3CF6E 3PLQA 4X6QB 2IXJA 2MHFA 2IXLA 3CO2A 2UYAA 3EBRA 2P17A 2B9UA 1ZRDA 4GULA 3NKTA 5FPZA 4QMAA 3HQXA 5I93A 4IETA 4IEXA 2FQPA 4IERA 4UBGA 4IEUA 4HSJA 3OD0A 4BYYA 4ZU7A 4FBFA 1XE7A 4IEZA 1ZZBA 5I0UA 3H3UA 3H9AA 3M3IA 2VPVA 3BCWA 3RYRA 2E9QA 5T3NA 4EWEA 4KU8A 4E2GA 3TNPB 3SCHA 4AQ6A 1Q3EA 2PAMA 1CAUB 1U12A 1OI6A 1RC6A 2IXIA 3H7YA 2OZJA 3NW4A 1V70A 4LA2A 4Z07A 4AVAA 4I09A 1H1MA 4I0AA 3DV8A 3OCPA 4X6RB 1RUNA 1ZZ9A 3HIFA 4EV0A 3BALA 4CYDA 4HMZA 3OF1A 3IDCB 1CAWB 4TLFA 1Y9QA 2IXKA 2GC0A 4LULA 1Y3TA 3NL1A 5KHKA 1TQ5A 3FFQA 1CAUA 1EYBA 2O8QA 1ZZ6A 2BEOA 4LUKA 1LR5A 2KXLA 1UD1A 3NVCA 1CAXB 1RGSA 4I3PA 2WFPA 3IWZA 3H7JA 2GC1A 3ROUA 4MX3A 3LA7A 2BNNA 1UCXA 1WLTA 3RDIA 2PYTA 3FX3A 3D82A 3FE5A 5E1RA 5KHGA 2I45A 3LWCA 2CGPA 1CGPA 1XRUA 1SQ4A 2XLFA 2ZCWA 2D40A 2QNKA 3JZVA 2PAKA 2FMYA 1EPZA 2PA7A 1VJ2A 1NZCA 1CAXA 2D5HA 1WA4A 2PQQA 4Q0VA 3G7DA 3I59B 4JVAA 3GBFA 5JSPA 2Z2SB 3LZZA 5KHHA 4IEPA 2EAAA 3UKNA 1VR3A 3E5XA 1RL3A 3HT2A 4XF4A 1YUDA 5FLIA 3FJSA 4RD7A 1YFUA 4QGNA 3M70A 4XF0A 4E2QA 5C6CA 2VECA 3KCCA 1ZZCA 4XFIA 4META 3UKVA 2IC1A 5I8TA 2HKXA 5LEJA 4I2OA 4NVPA 2BYVE 2CAUA 2PAEA 1DGWA 2PHLA 3QACA 5LEKA 2O1QA 3ES1A 1ZZ8A 5KBFA 5I0TA 5KHJA 3FWEA 2K0GA 1ZREA 1LKNA 2D5FA 5FDBA 1ZRRA 3TNQA 4HSLA 2H0VA 2B8MA 1J3RA 1QY4A 1ZX5A 4YRDA 2H6BA 3L2HA 2ET7A 2XL9A 4YNIA 1PMIA 4FT8A 4Q0SA 1IPJA 3PNAA 1YHFA 2GC3A 4JV4A 5CVRA 4WBBA 1WGPA 4AVCA 2MNGA 4L11A 1O3QA 1FT9A 4LTAA 1OFNA 1GQHA 4O9GA 1QXRA 4Z82A 3S7EA 4I01A 4FAGA 1SFNA 4MGKE 1O5LA 5AVPA 5FQ0B 3KSCA 4BH9A 5KHIA 2OA2A 3RZZA 1L3JA 4H7LA 3SMHA 3E6DA 4XFBA 4IEYA 1NE4A 4AQ2A 5F1RA 2XL7A 5J7MA 1OMIA 1NXMA 3FHIB 2HJIA 3MZHA 4MGYE 4HLTA 1YFXA 3IBMA 5CU1A 4EWDA 3ES4A 3LA3A 4HVQA 3ZDSA 3WW3A 4Q0UA 2GAUA 3HT1A 1O4TA 3H50A 4PIYA 5J3UA 4A2UA 4P9GA
chains in the Genus database with same CATH superfamily
1GZ9A 4XUNA 4ZS3A 1FPN2 1W9YA 4BA6A 1LHNA 3KV9A 1VBD1 1OF4A 1QHDA 1XJAA 1YLLA 2PELA 3BGAA 5IVCA 1UY1A 2D93A 2P4EA 2Y34A 1RUI3 1IG3A 2ZGQA 2R16A 2JIJA 5FYHA 4XDOA 1GQPA 3PVOA 2HEYF 4FXGB 5BV6A 4LBQB 4E2SA 1HX6A 1BCXA 2A75A 4YSFA 1HRI1 3KMHA 5JZGC 5FY4A 4AGVA 3OGVA 4GAZA 4E4HA 3BOWA 3ETQA 3JU9A 3B3QE 3APBA 4CUCA 1F31A 1POV0 1GICA 3MF9A 2PFWA 2JKXA 3PUAA 4XYXA 1JS9A 2ZMLA 2EICA 1QQP1 3M7AA 3EHKA 1NUKA 2Z69A 3OUJA 4FPEA 2QQNA 1TEIA 1BJQA 2VMEA 4NMIA 5CFCA 1NXD1 1A8DA 5A7WA 3VBRB 1YQCA 1CZSA 1AXKA 2W68A 4XFGA 5FYZA 5I8SA 1W2UA 3B00A 1RUF2 2RG4A 4RL7A 2VZPA 4O65A 3A7QA 4ZXEA 1MS8A 1DZTA 5L7OB 3GF6A 5FLJA 3DEMA 2WIIB 5IFTA 5AC92 1MQTB 1PGW2 1COV3 2GH8A 3POWA 2W94A 1UIJA 2WZR2 1O91A 1NLQA 1QJZA 3RG0A 2XVKA 2Q1FA 3UJQA 1SFYA 2WA4A 5L19A 5L7OC 3VDAA 5IVBA 2HWE3 1T2XA 3DKQA 3VN4A 4P08A 2H6CA 1NAEA 3HOBA 4QKFA 1H1IA 1A34A 4JZRA 2ZHMA 3OGJA 4C8DA 3SNMA 2P5BA 2Y6HA 1AR72 1X8MA 1O7FA 1UOJA 3ZPOA 1V6KA 2R072 5IUQA 1NQJA 5JPNB 2I74A 1W39A 2VZUA 2WN2A 1ULGA 2XUMA 3ZKYA 3GJBA 3AXDA 3RZJA 5AFEA 3ZO0B 3DUIA 3GNEA 1O59A 4AQTA 1M4WA 4GQ7A 4LHSA 3IKWA 5L9RA 4FPYA 4LR4A 1L7LA 4UFMA 1MS4A 5E16A 4QB6A 2ETEA 1E5RA 1RVF1 1D4M1 2WT1A 1OUSA 3AMMA 3H1YA 1PIV2 3L2YA 1NA1A 1QJX3 1GV9A 4GJZA 2XJRA 3KLSA 4Q4Y3 1FPN3 3C7GA 4RHV3 5DZEA 2YZ4A 2KD7A 3CJIA 4HL0A 3VHRA 1NX9A 2VJXA 2X29A 2WO2A 4QKDA 5IJRA 5JR7B 3WCSA 1W28A 4LORA 4M01A 2BBAA 3AP7A 4HKLA 2NMOA 2IXHA 3S6PA 1JYTA 3VL9A 3CZJA 5GZGA 3TN91 2OPKA 4QX1A 1YQ2A 1ZBE1 3C3VA 4K9SA 5CFDC 4KG0A 2X05A 5C8CB 3HJRA 4FP2A 5D1IA 4YW1A 4IV1C 1GNHA 5FZ1A 1B35A 5FZ6A 2ZX4A 4UOJA 2WSUA 2CWSA 4BDVB 4YFZA 2RS33 2W47A 1YFWA 2RS12 3B02A 5DDJ1 3SCGA 5BNNA 1X50A 4IEWA 4R9DA 5A32B 3ZSEA 5A6XA 2JG9B 2XWJB 4QQOA 3C7HA 4ZPIA 4KGQA 4PCRA 1ENRA 1HQWA 1YCIA 4CRQA 4L97A 2JD9A 3RZKA 2YMZA 4XIOA 4OFGA 3W59A 3O1SA 4M3CA 4Q0QA 4NRPA 3ST7A 2HWD2 5DMYA 1RJ7A 2ZAAA 2GALA 5FZ7A 1OKOA 1VAKA 3GYDA 4HONA 4ZXKA 1IS3A 1MS9A 2YV8A 2VOXA 3D0JA 5E89A 1LNSA 4AOCA 2BFUS 1K5MB 1RYYA 5FK8A 4AEJA 1OURA 1VBE3 1NCQB 1DGWX 3T1LA 2XJSA 2MEV3 1DDLA 3GDBA 3H1WA 1ACCA 1KDMA 1LODA 2JDZA 2DDUA 3A0NA 3VV1A 4J1WA 2DBIA 3ASIA 3MIGA 5FMCA 2W39A 3MIBA 1AL0G 3LAGA 1ONAA 2WJSA 4BQYA 4QXBA 1UKRA 3GZAA 3ZFEB 3AKPA 2WO3A 4OUMA 4JGYB 4CDQC 5F3CA 5IK8A 2ARAA 4FTEA 2JB8A 2Y6JA 1FATA 3B5LB 4M4PA 2C5DA 4AVVA 1VBB2 5C3QA 1R1A1 5T52A 4UFLA 3CMGA 3O1VA 2OZ6A 1CX1A 1LOAA 1GUIA 1D7PM 4KWKA 4XTMA 4NIAA 4QX7A 3P3PA 4QQHA 4QXKA 2XBO1 3OOXA 4XE9A 4A4AA 5J48A 1IS6A 2R7EB 3SHRA 3KT7A 1EY2A 3ZXFA 4MZUA 2HWB2 2P1BA 4KU7A 4ATEA 3NAPB 4XOGA 3TEYA 3T0DA 4BB3A 2XKOA 1V6NA 4NPMA 2LM3A 5ABJB 4DUVA 5FZBA 2X8KA 4ZZ5A 4AE2A 5CIRA 1NY71 1RUC2 1MQTC 4Q4W3 3C7EA 1VBC2 4QM8A 4MHUA 5C5TA 1LRHA 1US3A 1LOEA 4Y4YA 1MZ5A 2EXIA 2Q8EA 2ID4A 1QIQA 1W0PA 2HBTA 1W04A 2HWB3 1DZQA 2DURA 2Z4FA 4BHPA 3N9LA 4TTGA 4EZHA 1S2EA 2AYHA 3LCPA 4LO6B 3FMGA 5LA1A 2UY8A 2XKPA 3D6EA 3EO6A 4CE8A 2A3YA 5LRSA 1XPWA 4QKNA 3UL2A 5JWPA 1GZTA 4JGZB 5FZFA 3Q8EA 3VZNA 2ZTNA 3BIEA 2O14A 2P6HA 3VD7A 4KQ7A 4RR3B 4JGYC 4XUTA 5JOXA 4BQ2A 5JXGA 4XF9A 3BU0A 3IZOA 4B1MA 1WUVA 1VB4A 2W1QA 2QKDA 5CG9A 2XQXA 4BZ4A 4COZA 5A33B 5FOJB 1UY4A 5F3GA 5GLWA 4FFHA 2VZ1A 1NA1B 2W2IA 1JH5A 1QGLA 2DBNA 4RGGA 5F6KA 2VZ3A 3ACHA 4Y1XA 1QJU1 2VZOA 5F39A 2QZ2A 1PO11 4AEKA 3IDBB 3CEWA 2VAUA 2F4PA 4Y33A 4ORFA 5FBJA 2CWMA 3THTA 4AGGA 2JKBA 4RS5C 1EUTA 1JYIA 4NAMA 2JE8A 3RJ2X 1QJY1 5FYCA 2QCSB 1WMFA 3CF6E 3PLQA 2IXJA 1GP5A 1QQP3 2MHFA 5FXVA 2A6WA 2A70A 2OUHA 4TSVA 2VW0A 3AL5A 5FXXA 4TZDA 4IE7A 1KJRA 3NKTA 4LNVA 5FPZA 1N1YA 2ZGLA 4EYUA 3DPRA 1B35B 1H1AA 3T0AA 4ARXA 4CDXA 4RYDA 2ZEZA 5I93A 3WP4A 3J9SA 4COYA 2R1DA 5A3NA 1C1LA 3VBSB 3VBOB 3ZSLA 2RS13 4Q8KA 2BP6A 4CEWC 5DUWA 4KBBA 3IAPA 2B39A 1T6GC 4OI4A 1CIYA 3SITA 1QMJA 4COUA 4ZU7A 4FBFA 1PO21 3LEGA 2XXZA 4XHXA 1ZZBA 5I0UA 4C1XA 3H3UA 4A3XA 1VBA3 3M3IA 2ZGPA 2GMEA 3D5OA 4GIQA 1H6XA 4JRLA 4Q4Y1 2JDKA 1WBFA 3ON7A 4EWEA 1XNBA 5A7PA 3VBFC 4Y20A 2VZVA 3POFA 2AZ5A 5T55A 4GB32 3FHQA 2ZXQA 2IZWA 5FRAA 3J8F3 1OI6A 3RFRA 3WOGA 3AYAA 5IW0A 3JB8A 5JIUA 1OQDA 1PIV3 1V70A 1V6OA 3NNFA 3NW4A 3GJAA 1RVF3 4RS5A 3K51A 1WKYA 4Z07A 2PMWB 4QKBA 5DUXA 3B93A 1VE0A 4YW3A 3VDDC 3AL6A 2JEMA 1RUNA 1UOGA 1ZZ9A 1VPHA 2GNDA 1YQ8A 3R0RA 4LQRA 5A3UA 3OF1A 3H42B 1CAWB 3IDCB 3I3BA 1GWMA 2FCUA 2YUEA 1DQ4A 1PVXA 5LK7B 2VTXJ 5ACA2 4YWAA 2GP5A 4LULA 1SPPA 2HEWF 2RJKA 2VR4A 5KXEA 3RGBA 1XNDA 1ZZ6A 5F5CA 2BEOA 2WO7A 5SV5A 4FPKA 4LUKA 1DLCA 2KXLA 1GP6A 4I3PA 4OULA 4QDRA 1WMXA 4JDMA 4HXCA 3ROUA 3FLRA 4GWMA 2VOWA 3RDIA 1O8SA 3J4UH 4FOQA 2XVLA 3FX3A 2AUYA 3D82A 1OPOA 3BTAA 5AC93 2HBUA 3KM5A 1GBGA 3MW4A 2I45A 5CG8A 3LWCA 2C4XA 3MBWA 1XRUA 2D6OX 2XLFA 4XJWA 1NLRA 2EIGA 3CDZB 2KA3A 1HXS1 5A3LA 3T30A 5AFBA 1BBT3 4DY3A 3OEAA 3IM0A 3N7JA 2PA7A 4MSVA 2AACA 5DG2A 3DXTA 1MQTA 1XNAA 2W0XA 1CAXA 2V73A 2ZGTA 3FUOA 4MVTA 4WM8A 4LBLA 1LAJA 1SLLA 4YW6A 4JGZA 5JXJA 4B7KA 2PQQA 2VNGA 1BMV2 5A80A 2ZMNA 2JDHA 5F3EA 5F2SA 3NAPC 4LIUA 4BQXA 3X29B 1WW7A 1GYKA 1JMUB 1PK6B 2DVFA 1UL9A 3LZZA 2VUCA 3VKOA 4IEPA 1K5MA 4G4FA 3W20A 3FUQA 3HBKA 5E6HA 4EN8B 1K5MC 2VQ0A 1RB8G 1C8M3 2ADDA 5FY5A 3M70A 4S2FA 2DVGA 5C6CA 1N1VA 1W6MB 3POIA 4IGPA 5I8TA 3AP9A 4JCKA 4GJYA 4NVPA 5EV7A 1JI6A 1OQEA 1CJDA 2Z42A 2AC1A 3ZIWA 3KZ4C 3BODA 4C0BA 3AP5A 5ISLA 3LF7A 3BI3A 4JKLA 3FWEA 1H8TB 1CN1A 1KFUL 3J7MA 2E63A 2G1MA 1LKNA 4DUXA 5FZ4A 5FP9A 4AVSA 1REEA 2GNBA 2GN7A 2ERFA 1CESA 3VB9A 4OHYA 5BNOB 5EHDA 3I2KA 4YFWA 1XSRA 3AK0A 2Q1MA 2RR13 3W5MA 1STMA 5CZKA 3WR0A 2DUPA 1PMIA 3POGA 4FT8A 4Q0SA 3WHTA 4Q4W1 1NY72 3JQWA 5FREA 1Y9MA 3I3QA 3LSDA 1UYPA 3A21A 3SEPA 3PNAA 1NLSA 1HB1A 2YGMA 3NV1A 4JV4A 4RA0A 5FKBA 1AR92 1QEXA 2X53S 1E5IA 1FOD3 3AKSA 4WBBA 4AVCA 2FDGA 5FZHA 4YM0A 2Q8CA 1UYZA 4GB31 3VZKA 5F9TA 1W2AX 3WF2A 3S7EA 4FPJA 4I01A 2ZZJA 1W6QA 3NMBA 1QJU3 2JG9C 1UAIA 2OKXA 1XU1A 5C33A 3BKZA 4PLOA 1QOOA 2A7AA 4QPIA 4AEDA 4XJ8A 2OA2A 4OZXA 3J26N 1W8ZA 5GZDA 1L3JA 2VMIA 2YBPA 4N90A 4AL9A 3GBWA 1W2OA 4AQ2A 1DG6A 4E27A 1YO8A 1NXMA 4NWVA 3FHIB 2XB6C 5EP9A 4YZ3A 3ZYRA 3ZXLA 2CHHA 3MZHA 4JKMA 1LTEA 4ASLA 1YFXA 3IBMA 4OQ8A 3WXPA 1D4VB 3O1TA 1H2LA 1W8HA 3LA3A 4MADA 2BBVA 4PF5A 2WA3A 4CU7A 1PVC2 4LMFA 3GM8A 1IZ3A 4Q0UA 3U37A 3V0AB 1W6NA 3GCXA 4RN5A 3HT1A 3HNYM 3H50A 4PIYA 1AXYA 4P9GA 2HWD3 5F32A 4KWJA 5CA6A 1J84A 4AK3A 1CAWA 1AR73 4GKXA 4DPNA 4AFAA 3ZYPA 1DGRA 1RTVA 1POQA 2QDNA 4UWDA 3E6CC 5FXWA 1VALA 1SPPB 5L36A 1ND2A 2XG3A 1QJY3 3QH7A 3N7MA 4EN6B 3OEBA 2VNVA 1D0HA 1KQRA 5FLHA 3KD4A 1E57A 1IPSA 2J1TA 2B9VA 3POSA 4NAOA 3LD8A 5F5QA 5BNPB 3FBYA 4D7SA 3LFMA 5DZGA 1N3PA 1O4YA 2CAVA 4QX5A 2JD4A 1AUYA 1LGBA 1XXNA 3RSJA 1O5UA 1S0FA 5DAWA 4AFMA 3SEEA 3TN92 5IVEA 1GLHA 1RUF3 2PLV2 5FPBA 1F4AA 3IIIA 3ZLIA 4D6SA 3E5QA 5EPAA 5KXBA 5FY9A 3S0MA 1JYNA 2MPFA 3UK9A 3H8XA 1JHJA 5CEHA 5FY0A 2DTWA 2EXKA 4IV3B 5APAA 3JBG3 1TNRA 3U75A 1H30A 1ULDA 2W1WA 2WBKA 3WG2A 1JZ8A 2W08A 2GP3A 3VBFB 3KS7A 1OLQA 1WLDA 5FYTA 1OD3A 5BPXA 3H8OA 2R49A 5FZCA 5C71A 4NE9A 2WKKA 5LY2A 4BPZA 3N9QA 3MV11 2XMLA 1EAH3 3WDXA 2G4IA 4M0NA 1ULPA 4H7MA 1GNYA 2QFEA 2LTNA 5IAVA 4HN1A 4CEWA 1BLZA 1RXGA 2R042 2DCTA 3JQXA 4YZ4A 5FZ9A 4KWLA 4FO9A 3PJQA 1C3HA 4NO4A 2JJ6A 1VAVA 3ZFGC 3J8F1 5KC5A 4ONUA 3WF3A 3KF3A 4P02B 1WMEA 4BXFA 4BQWA 5CBLA 1G8WA 1W8WA 2WFF2 4Q26A 2RJ2A 5I8YA 4NWWA 4MV2A 3WVJA 4LA3A 2QQIA 4Y20B 4XFCA 5A1FA 4RR3A 5HPOA 1OA3A 2V09A 2IVIB 4WM7B 4D6QA 4EZ4A 1LOFC 1RUH3 3BU7A 2JDPA 2XWBB 4CZSA 5HBAA 5KC6A 1UY0A 1OKQA 3WF0A 5IFPA 4OUSA 1W03A 2EIEA 4W50A 2AH2A 4H2AA 1ASJ2 2VQAA 3WINE 4CPBD 4MXVA 2QZ3A 1IPKA 5FO9B 1PGW1 5JAXA 2EXJA 4BIFA 2VMHA 5KWRA 2DV9A 1GOHA 4BXSV 5BUVA 3HD8B 3MICA 1UKGA 1NG0A 1U5XA 1W9TA 4UFJA 4EN9B 1RUOA 4G3YC 2JB4A 2QDRA 4Q8LA 3ZVXA 2HWE1 5BYNA 1FX5A 1CWPA 3I3EA 4A44A 2NMNA 4AEDC 1YIFA 1Z7S3 2CYFA 2WABA 2D6MA 3ZYIB 4K20A 1QXJA 4PBPA 4LK7A 5FYBA 5IVYA 3WDUA 5JXIA 2X5IA 1RMU2 3PJYA 1XB9A 3MFAA 1GWKA 5AC91 4RGAA 3ZFFB 1Y7BA 2SBAA 5DPNA 4GMP1 1LOBA 1SBEA 2PHUA 1SDDB 3B69A 3TEZA 4J1XA 3I2JA 5LASA 3ENRA 2ET1A 4PI2A 3CHXA 3HN1A 2VH9A 1R092 2WL1A 1RIRA 5DG1A 3BPZA 4JX0A 3W9AA 1EP0A 4CPBA 4CCLA 4FPFA 3RJRA 1N3QA 4XQ4A 3VL8A 1HQNA 1R093 1VLNA 1UX6A 2E7TA 3LEKA 3I7DA 2YYOA 1FPN1 2J1EA 3USUB 4DXSA 1F4HA 1HV0A 1RUI2 5GZCA 3H1MA 5FQ0A 5EFUA 5HXMA 1HRV1 3T0BA 1CX4A 3AVSA 3AZXA 3EQEA 3DN7A 2ZX3A 3CL1A 4Y1UA 2QTWB 5L73A 1OF3A 2VW1A 1AR81 3I59A 1W9FA 3AJZA 4LLOA 4MGQA 3VKNA 4NHKA 4JTNA 4UT5A 4CDQA 3H8RA 1KXGA 1UMHA 5A1LA 3T08A 1LHUA 1Q43A 3PURA 3UT0A 4YG3A 1C8M1 3ZR6A 1K12A 3HN3A 4LE4A 3VBUB 5C3PA 4MH0E 1VBC3 3O0XA 3GZEA 4OVEA 4A41A 5TSWA 1KJLA 4KGGA 1AYM3 2OIIA 4OHVA 4DB5A 2PHRA 3VHPA 4XF1A 5J98B 3S57A 3WZ1A 1SFPA 3NAPA 4IXLA 3PUHA 3KT4A 1BK0A 5FJKA 3RYKA 1N3OA 1W6MA 1W90A 4FP3A 3QOPA 5FMDA 4JDNA 4WVMB 3AC0A 3PU3A 3N9MA 4SLIA 4OZOA 1FMD3 5FZDA 2WWUA 4OHXA 5EXOA 3USSA 4CDWA 4LO7A 3O1OA 5JVVA 5DAVA 4XVHA 5EJZB 4A7ZA 4I0BA 4W65A 5FPVA 3TEXA 4AFBA 5I0SA 2PTMA 2WFF1 1ZVFA 1EPWA 1TMF2 2ZEXA 1A78A 1N1TA 3WX5A 1RUG3 3ECQA 1MVQA 1PX3A 1CVNA 2EA7A 3DKWA 4QQPA 4E4SA 2BNMA 1OFSA 1OXCA 2P3IA 1R1A2 2R041 2OW4A 4AAXA 3RRDA 4GB33 2R0HA 5FFOC 2IFRA 5J1XA 1F5JA 2EIBA 4HPKB 4AW7A 3SH3A 4NRMA 5CNAA 4YVSA 1KD7A 1TMF1 2OT7A 2XJVA 3N9NA 5J36A 5F6LB 2ZABA 4FPGA 3U4XA 4B29A 2O0OA 2BZDA 1XE8A 3K2OA 5T5JA 1UZVA 5I0RA 1DZRA 4XFHA 2ATFA 3RYPA 4AI8A 5I91A 4XQDA 3CU7A 4PDWC 5A6YA 2FZ2A 3LIGA 4LUMA 2HWC2 2QQMA 3OGSA 3KGZA 3N7KA 5FBZA 5CFDA 1MS0A 2F6BA 2W92A 3M4FA 3MGUA 4OUEA 4V1PA 3MO4A 3VD3A 2XJTA 1M06G 4Q4X2 5C8CC 5FCCA 2D97A 3ZSJA 1RUF1 5GLTA 2V4VA 3IIAA 2Y60A 1R081 1DBNA 1KITA 3QLQA 2WNUC 2WZR3 3UKTA 5FZ0A 2VUAA 3OBZA 3JBG1 3PTYA 5JSOA 1MS1A 4K8FA 1KFXL 2BNOA 3AJYA 3V0AA 3ELNA 1PNGA 1NA1C 3GHNA 3ZXAC 1H4GA 1OHFA 1O3RA 2VO5A 4YGCA 1NCRC 3VZJA 3CJIB 3MUY1 2RS31 4L92A 1WBLA 1Z7S1 4BWOA 3D8CA 1G6NA 2FCVA 4QPWA 5IK5A 2GZWA 4DIQA 2VL4A 5A3OA 1ND2B 2W9XA 1X7NA 1J1LA 5HCBA 3WW4A 1ZBE2 4UFKA 2BGCA 2QJVA 2ZMKA 2DUQA 4X6QB 4CXYA 1AL21 2UYAA 1X9PA 4PQQA 4LBKA 3WHUA 2B9UA 4A3ZA 1QJX2 4AQSA 1MS5A 1BYHA 4CDUC 3HQXA 4IETA 4IEXA 2W46A 3WUDA 4GXLA 2LRPA 2RDSA 1ZRIA 3GGLA 1AR61 1FOD2 4HOOA 3AYDA 2DU1A 2A6VA 2VM9A 2ZGSA 3FL7A 4LHLA 4LBJA 3UETA 3ZYBA 5DZFA 4EN0A 2RVAA 1W6OB 3WY6A 1WWYA 1IKQA 3ACFA 3UJOA 1XE7A 4IEZA 5JZGA 4AI3A 1IKPA 1NT0A 5JIAA 3H9AA 2Y26A 2ZA9A 3IPVA 3O1UA 3HQUA 2VPVA 4XMAA 4Z1VA 4XURA 3JXSA 4XCBA 2E9QA 4LO8A 1IS4A 1S2BA 4UF0B 4W4ZA 3C8XA 1AYN3 3EMRA 2ZX2A 3NNMA 2VUDA 3THCA 2R30A 4AQ6A 1BK1A 1Q3EA 2JENA 1U12A 2PAMA 3KV5A 4FFFA 1RC6A 4D69A 3H7YA 5CKMA 1OLMA 2BV4A 4FXKB 4LA2A 5K4LA 4Q4V2 5LZ6A 1OVSA 5HXVA 4F83A 2J22A 1J1TA 3O7OA 2HWB1 4Y4RA 3LSEA 4JGYA 3GBGA 3ZN6A 4INDA 3SLIA 3MIDA 4HMZA 4HKWA 4CYDA 1RUH2 1LECA 4AYUA 2ZHNA 3ALQA 3KVAA 5B2GB 1VBB3 4URAA 4PLMA 3VDBA 4QU1A 1GSLA 1TQ5A 1F9KA 2RS53 1IOAA 1CAUA 3FFQA 3S5QA 4JDOA 3VBUC 1EYBA 1GMMA 2QQUA 1APNA 3LEIA 4LKSA 1LR5A 5FTTC 2JDAA 2ORXA 2GMPA 3AP6A 2YFUA 1H9WA 1A3KA 1V00A 2PN5A 4WZFA 4A7YA 3ABZA 3H7JA 2GC1A 4MX3A 1HRI2 1ULFA 1BZWA 5A7QA 1UCXA 4JKKA 4QX8A 2YDEA 4CP2A 4AI1A 4OHZA 2PXJA 3PUQA 2PYTA 3KQ4B 5A3MA 1C28A 3FE5A 2ES3A 3B9IA 5KHGA 2VVEA 2YFZA 1JYVA 1DYPA 3WV6A 2BGPA 3OBAA 1H6YA 2CGPA 1I5PA 2BQPA 3RZGA 1FYUA 1SQ4A 4ASMB 4DRVA 3JCIA 3NNLA 1PK6A 1W0OA 2WAAA 3WQ0A 2YHJA 3OUHA 2HLEA 5C3SA 1H9PA 1AL22 4DUWA 2ZX0A 4Y5SA 2FMYA 1EPZA 3RVHA 4QXCA 1VJ2A 2VCAA 1BVP1 1HLCA 4UYBA 4XILA 2PLV3 5J37A 4RS5B 2BRTA 4BMBA 1FV3A 1L7RA 2FDJA 1FMD1 2VNOA 2XJUA 4YW7A 4Q4X1 2A6XA 1LGCA 1WW5A 1XNCA 2JE9A 3FLPA 4URTA 1H8VA 3HMYA 1W06A 5FK7A 2OPWA 2ZGNA 5I0DA 2QQPA 3O0VA 2RS11 4I3GA 1OH3A 4XBLA 1TVGA 1SLBA 1W8FA 3QH6A 4QX0A 5HV0A 4W6YA 4AEDB 4XAAA 2ZGKA 2A1XA 4N53C 3PHMA 1RL3A 3RMXA 5EJ1B 2WO1A 2EALA 3JD72 2HWF2 1UO9A 2VVDA 2ZGRA 4KMQA 4RD7A 3FN9A 5GKAC 4YZ5A 2E7QA 4E2QA 5ACA1 3VUOA 5K0UC 1S0JA 2V5YA 1YC61 4XFIA 4ITCA 1VMFA 4META 5FYUA 3UKVA 3ZN4A 2Y6FA 2HKXA 5LEJA 5JOYA 4CP1A 3HNMA 1VRH2 2O1QA 1D2SA 2HWC1 1ZZ8A 2JECA 2ZBJA 4K7JA 2TNFA 3R4UA 2WN3A 4AEMA 4XZUG 1HN1A 4OMCA 4DQAA 3I8TA 1PM4A 1ZRRA 3N9OA 1W6QB 4HSLA 5T50A 2Z79A 5C70A 1AXZA 1J3RA 1GZCA 1XBFA 1ZYBA 1PIV1 4UFHA 4B4RA 5FYIA 1QY4A 1GOFA 1PK6C 1U5YA 3L2HA 5FZGA 5FYMA 5LW9A 1LOGA 2YBKA 5F8PA 4KI5M 2D3SA 3DYOA 2RE9A 1MPXA 1CQ9A 2DVAA 2UURA 3BN6A 1C8NA 1ENQA 1ZBA1 4QPGB 3ZR5A 5LB6A 1KS5A 3IMNA 3W5NA 2WZR1 3B9CA 1WGPA 2D7FA 1UQXA 2BW8A 4L11A 2C26A 3HWJA 1O3QA 3WQ7A 1UXXX 2DWRA 2XHNA 1S0BA 2TEPA 5C5UA 2VE1A 1SLCA 5F2WA 5AVPA 2JDNA 5FQ0B 3ZXJA 1GZWB 1SLAA 1UPSA 2IFWA 2JG8C 2WT2A 2X10A 4HK9A 3SISA 1QQP2 4YGEA 1GOGA 2VBPA 3D4KA 3SC7X 5KHIA 3VD9A 3A0KA 5JI7A 1AYM2 4CDUB 3FBMA 3URFA 3E6DA 4XFBA 5LBBA 4IEYA 4PI0A 1XC6A 2BJSA 3VDDB 2G9ZA 3DF0A 4DO0A 5J7MA 1GNZA 1R083 2HJIA 4XJZA 4B1LA 1O4ZA 4HLTA 4EWDA 3ZM8A 1DCSA 1AL23 3J7LA 4LBQA 3T4HB 2D98A 3SKJE 3ZYHA 5GLZA 4ZHNA 2ORZA 1AR62 1RJ8A 3MIFA 1G9FA 4QB2A 2QQLA 3VBUA 4GH4C 1O4TA 3AFKA 4MXWA 1O3SA 4E8CA 2CV6A 2OYZA 3AYCA 1QJX1 2ARXA 1W6PB 1NCQC 3Q8BA 4P9LA 2IWGB 4Q0PA 5K8SA 2FZ1A 4BQ5A 1XNKA 2I2SA 3BOPA 3KHCA 5HCHA 3SH5A 3AKRA 1BQPA 1ZRCA 2YU2A 1VBD3 2ZJCA 1GFF2 1V0AA 4YM1A 3T3YA 4R9CA 4BCUA 2Q5TA 2XLGA 1BBT1 3LOIA 4FPOB 2DF7A 1W99A 5JR2A 3V64A 1LOFA 3D0SA 4EQVA 2CDPA 2R061 5SV8A 4JRAA 2FCTA 2R073 3VBSC 4WVWA 1ALYA 2ADEA 4ISRA 1QOSA 4YGBA 1MVEA 2K9ZA 4RGKA 4XJUA 5G04L 5AVAA 2CTVA 1RUD1 2W91A 3K77A 1QJFA 3I4IA 5CFCC 3LFIA 1F5FA 3Q8AA 4XETA 4LXLA 1N47A 2HYKA 3BPSA 1GZWA 1ST8A 1WLCA 3ORJA 2VULA 1RUJ3 2DCKA 3SCFA 4WZCA 4CP9A 4SBVA 3T2TA 5JLVA 1IQAA 1DQ1A 1H2NA 4GKYA 2ZHKA 3AFGA 2YGLA 4YW5A 2VCBA 2Q1ZB 5FJHA 3U11A 4AXOA 2OUJA 1I5ZA 4FQ4A 1B09A 2C0ZA 1IS5A 2ENRA 4KL1A 5F37A 3A22A 4XFFA 1XYNA 3DXUA 1JZ4A 3DL3A 2V72A 3IMMA 4DEQA 5FR3A 2B4KA 3UYJA 3WDVA 1HN0A 5G05L 2NP0A 1EUUA 1L7QA 1RUJ2 1DU3D 1JW6A 5A7OA 3N4MA 4WVVA 3I2OA 2ZGMA 4PJYA 2VGDA 4CUGA 4AVBA 1PHMA 4S2GA 2K2SA 3UGHA 3NWKA 4YARA 4O61A 3PIJA 2WQ4A 1UZZA 3U10A 1UW8A 5A7WB 2MEV1 1W8NA 3CJXA 2BERA 2W1UA 4UW5A 3R6SA 2VD7A 1DLLA 1D0GA 1AHSA 3MDPA 3W58A 2J1AA 1SHWB 5E8AA 4IEOA 1ASJ1 1W9WA 4GMP0 2FHRA 2GN3A 4NHLA 4CCEA 2RM22 1C57A 4HETA 3T2PA 3VGIA 2ZKLA 1D4M3 3SH4A 1QNWA 3GALA 5FP4A 2VOKA 2YROA 4YW4A 2D3RA 1UYYA 3LPFA 3LQCA 5C8CA 3TBDA 4CCDA 5LATA 4K6BA 1JOPA 4TWTA 5DAPA 5A3PA 3ZDVA 3OY8A 5DAQA 2HH9A 3OJBA 5C4WA 3KQRA 5CAZA 2IXCA 5J96B 4WVZA 1ZM1A 4HK8A 2QVSB 1R1A3 2FD8A 1I1EA 2O8OA 4HVOA 3ZFGB 2JG8A 3WW1A 4BM8A 4EE2A 1P8JA 3KVBA 2WDBA 1IQDC 3ZYJB 4DMIA 4FCAA 1GWLA 1FNYA 1D2QA 3KCXA 4YVSC 1NYWA 5FWEA 1QDCA 4XBNA 2JICA 4H55A 4XMIA 5LBEA 4IESA 4E4ZA 2NYYA 2VG9A 2HWD1 4WVMA 2C1FA 3C7OA 3V65A 3TN93 2B46X 4PDWA 5ERLA 5EYXA 3T09A 2HYXA 1PZ9A 4NRQA 3OY8B 4QDQA 5FY1A 1BEV1 5BXXA 2BOIA 1ZRFA 4LOSA 1I6XA 4XFAA 2EVXA 4CCCA 4QD2A 3QD6A 2RMU2 5JCTA 4LEJA 1F2NA 4MUVA 1TE1B 2RMU1 3FC0A 4LK6A 4JHZA 1OLME 3POBA 4FQZA 1ZZ7A 4HVRA 1Q8VA 1R64A 2ZZQA 4ES8A 5DAXA 5H9SA 3MLKA 4BE3A 4IW3A 2TBVA 1V6JA 5BNPC 2CY6A 2BVBA 4IEQA 4Y3OA 5JDBA 5KXDA 1G9CA 1HRV2 3HEIA 1QH6A 4XAEA 4IGQA 4AF9A 4YG6A 5A3TA 5ANNA 2F17A 2CL2A 5HCFA 4CXWA 5E88A 4CP0A 1U5ZA 1Q8PA 4OLLA 1C5HA 4KBZA 4P9JA 1C4RA 1G9BA 4FTBA 4HG6B 5IHRA 1UYXA 1BXHA 1UZ0A 2XR4A 5FZOA 1JOBA 2IVJA 4B3NA 4N53A 3IAQA 3OSDA 2A5ZA 5GALA 1YNAA 3ACGA 3MW2A 4W6WA 3AYEA 3U07A 5C9AC 2WAOA 2XJPA 4PBOA 4Y5Z0 3K3OA 5GLUA 3TOJA 2NPIA 3FLTA 2VQTA 3NNGA 1S0GA 1LHOA 2Q8DA 4E4DX 4MGZE 2RM23 2YB7A 1DF0A 3ATGA 3ZFFA 4CU8A 4PIXA 2WS91 3ZN6B 4S2HA 3NO8A 1TNFA 1X36A 1AR91 4D8MA 2E51A 1J3PA 3BVCA 4FTSA 2N7GA 1WCSA 3WQ1A 3E6BA 1EAH1 3WP6A 2HWF3 3OBTA 2LW8A 5K0UB 2Q0AA 1OOPC 2E26A 3NRUA 4Z2AA 1REFA 3AP4A 5D8AC 4R4ZA 4ISQA 1LCLA 2R0FA 3GHMA 1YYNA 1RUH1 2P37A 4RQPC 3PMEA 5FP8A 3B7MA 1QH7A 3MHZA 3D3AA 2RJLA 3NJXA 2YXSA 1JU4A 3NV3A 4M0HA 4PIZA 4V2WA 1VBC1 3GCWA 1W9SA 4QGMA 4QWNA 1W8OA 5DABA 3TAYA 3PTRB 2VBBA 4ZS2A 2QQJA 4B8EA 4CVUA 2SLIA 4IGOA 4M3CE 3TEWA 4CEYA 2XLAA 3MV01 5JI9A 4Q4W2 1H2KA 1RUC3 4HZFA 2GNMA 2YC2A 1SBDA 3CBNA 3I2IA 3C2UA 3WDTA 3THDA 3K4AA 3WDYA 3EJKA 5BNOC 5IAXA 4LHNA 5J09A 2JIGA 4Q2FA 3OPTA 4LBQD 4AZZA 4OYUA 1OQ1A 4UFIA 3JB4C 4QGLA 3U1XA 3LDKA 4IV3C 3LKJA 5JOZA 3AMNA 5IVJA 1YQ5A 1H8TC 5EIYB 4IDZA 1XSQA 5D2AA 3WCRA 4XQWA 1C8M2 4YZ1A 1W8TA 4BLJA 2WFF3 3IN9A 4XABA 2EXHA 3I2GA 3PDQA 1JZ2A 4Q27A 4F8AA 2GC2A 3U0ZA 4XEZA 1OD5A 3CIHA 3B01A 2R062 4FI9A 3KF5A 3JUUA 3ZFEA 4WM7A 3LOBA 1XU2A 1KDKA 3CNAA 1IHMA 4HPKA 4J25A 3IPVB 4JAAA 4JHTA 3LDRA 4TN7A 1Y4WA 5EJ3A 3POYA 1Q8QA 1HJFA 2ARCA 2E53A 4X8PA 3VZMA 3ZPYA 3PMSA 3QCWA 2J7MA 3LA2A 5CKNA 3EYPA 4UF0A 3I2HA 2NZ9A 1OLRA 1RXFA 2WUHA 1IG0A 4Q29A 2P3YA 2UU8A 2JX9A 1REDA 2ZGUA 4GZ9A 1TG7A 1UZYA 1YWKA 3KWVA 2VZTA 4JQTA 3ZN5A 3TYJA 2BGOA 3MPBA 1QXPA 2ZHLA 5EZWA 3JBG2 1UPIA 2KR2A 1OSGA 3ZFGA 4D6RA 1RMU3 3WF1A 2XOMA 1R091 2AEYA 1R082 5ABJA 4AVTA 1MR5A 4CA9A 2PHDA 4NR1A 1Z7S2 4XACA 3WP5A 3WW2A 3WP3A 4AHXA 2PQSA 1TME3 2WR9A 2YC4A 4RR3C 1JBCA 5JUVA 3PIGA 3PVNA 3VBRC 5FZAA 2YPJA 1Q8SA 3EBRA 1AR83 3HPNA 2LROA 1Q8OA 2V5DA 2E32A 4IE0A 1AYN2 2G19A 4XUPA 4QMAA 4YM2A 3VBFA 3BTZA 1PGL2 5FXZA 3UGFA 2QBXA 1ASJ3 5IYYA 2AGSA 3OG2A 1PO23 2FQPA 4UBGA 4QHOA 4A45A 4IEUA 1HB3A 2PHXA 1ULOA 2BOJA 3VHNA 1T6BX 2G9GA 1KGYA 4DZGA 1MS3A 4Q1PA 4MOAA 4DRRA 1YRZA 4N43A 3MIEA 4ZONA 1ZBA2 2QQOA 4M3CB 3WG1A 3ACIA 5IK7A 3RYRA 5DXDA 2RDNA 1VBA1 1S55A 1NCRA 4CCNA 4L99A 4UW6A 3GXUA 2CDOA 5HCAA 2VTXA 3WEZA 5JSRA 4M00A 3EXUA 1MEC2 4XUOA 1QJEA 1UU6A 2ZACA 3WUCA 3VBOA 3ME2A 3J8F2 3K75B 3VKFC 1FV2A 1YXWA 2VCMA 4KWUA 1H0BA 3T4VA 3BIWE 2WNUA 4KH9A 4GWJA 3HNBM 4I09A 2JWPA 1S0DA 4J6GA 3CZUA 3VBHA 1ND3C 1AF9A 3DV8A 3F2ZA 3OCPA 4I0AA 4NIIA 4QAWA 1K42A 3LE0A 3UESA 1ND2C 2OX0A 4C90A 3HIFA 4EV0A 1AR93 5LBFA 4NPRA 4P9YA 1W6PA 4XDQA 5IK4A 2VZRA 2VCCA 4AG4A 1NCRB 2Y6LA 3BTXA 2X09A 4HKOA 4W8JA 1PX4A 2VMDA 2GSYA 2VMFA 3NL1A 1DFQA 4QX2A 4XJAA 3W21A 1SMVA 5FV3A 4EN7B 2O8QA 1AYN1 2WLPA 5LK5A 3AB0A 5A7SA 4Z2WA 3MLLA 3IDAA 1UD1A 2WNUB 1CAXB 3HAGA 4RFRB 1JZ6A 2FDKA 2WFPA 5A1AA 1LGNA 2ZOEB 3IWZA 3VD5A 1VRBA 1E5SA 1LULA 5EYYA 2Q8OA 1W3VA 1GP4A 1AR82 4QHBA 1J83A 1FAYA 1DYOA 5KR7A 4GA9A 5E1RA 2VQUA 1UOFA 1RHI1 1XE0A 4QPIC 1PMHX 4CU6A 2RV9A 4RQPB 4XUQA 1RUI1 3KV4A 4D94A 1LHVA 3USUA 2VBDA 1OBNA 2D40A 1WD3A 2QNKA 4LT5A 4AWDA 1K3IA 3WDWA 2D6LX 1A6CA 1SG3A 3WT3A 2W5FA 5LWBA 4AFCA 5BNQA 1VIWB 4CDWC 4MGSA 1NZCA 3N7LA 1BMV1 2FDHA 3AZZA 3AZYA 4FOVA 2C9KA 3DCQA 4GWNA 2WZEA 3VBHB 5A6ZA 4ZKTB 1PVC1 1WA4A 2W52A 3OGGA 4LBOA 3WNNA 2J1VA 2CU5A 5FYYA 2GDFA 4NOTA 1PO12 4PQ9A 4XXPA 2VOVA 4Q0VA 2VC9A 5C9AB 3I59B 4DS0A 2RS52 2WZ8A 4JVAA 5CKQA 2EIDA 3GBFA 4S2DA 2VNRA 4RQPA 1O8PA 4NUBA 4CCKA 1BKZA 1HXS2 2PHWA 2W95A 4R9AA 4Z92B 5FY8A 3KHBA 1Z78A 2Z2SB 1KRIA 1JYCA 1VR3A 3E5XA 4ES9A 2C9AA 4GH4B 1RHI2 3HT2A 4XF4A 4ZY9A 3WG3A 4BK5A 1YUDA 5FLIA 3MIHA 3DYPA 3FJSA 4LO5B 5D8AB 3VKMA 3RZHA 4QGNA 3RQ0A 5FZEA 5FUPA 3KCCA 4TXWA 4LO4B 1W0NA 2IC1A 4YVWC 2BYVE 2PAEA 2PHLA 1DGWA 1LESA 1RMU1 2FDFA 1WD4A 1UMZA 1C1FA 4JGZC 3ES1A 3T2OA 5C9AA 2XH6A 4LKFA 4OQ9A 5KBFA 5I0TA 4Q4V1 3WNKA 2K0GA 1SLTA 3AM2A 3MEPA 4MXWB 4U36A 2JG8B 1TME1 4XTPA 3RWKX 1JTZX 2B42B 1X33A 2RR11 5FDBA 4NHXA 3BYWA 5CISA 3Q9OA 2H0VA 2VU9A 4NHYA 3AKTA 3T1MA 4P9WA 4B4QA 3P1IA 4DY5A 2JDUA 1ZX5A 4LKEA 2H6BA 4YRDA 2ET7A 2D43A 2XL9A 2WT0A 1V9U1 4YNIA 4CDXB 1RUC1 4PLNA 1IPJA 1S0CA 3RI9A 4CEYB 3BTYA 4CUAA 1OH4A 1R1ZA 2EF6A 4P9XA 4AHYA 1YHFA 4YVSB 2DFBA 1UN1A 5CVRA 4Y1ZA 3WF4A 5C3RA 3LB9A 2MNGA 4F3JA 4KG8A 1YI7A 1FT9A 1GQHA 1QXRA 2X5IC 4I0WB 1HXS3 1SFNA 1O5LA 4CTEA 4L9BA 2R32A 2BVVA 1ENXA 2CNAA 1HJGA 1B35C 3AMQA 4Y26A 4RHV2 2VMCA 3RZZA 4BH9A 5FZ8A 4FPLA 3SMHA 3WLUA 2AREA 1SBFA 1ZBE3 4BU2A 1Y43B 2B45X 2DFCA 4R4XA 5F5AA 5F1RA 1WCKA 1SZBA 3SQOA 4MGYE 4CDQB 4DXZA 4Y1VA 3WD5A 3M3EA 1F35A 3POEA 1ND3A 4BQ4A 3WW3A 1QU0A 3RI8A 2ZAHA 4N53B 4TLGA 3CJIC 3L9JT 1H2MA 1WW4A 2Y8KA 4OI2A 3S7IA 3ZYFA 1RUE3 3JD73 2FDIA 3O14A 4YGDA 1V6IA 3K46A 4XIKA 1FXZA 2UWCA 3LIHA 4UI9L 3ZSKA 3I49A 3MUZ1 4FFGA 3V0BB 4YG0A 1FI2A 1QJY2 5F5IA 5FUNA 2LALA 2ZGOA 4DOUA 1HIXA 5FO8B 3VBHC 3IB3A 3R4SA 1XQNA 1J58A 5ANQA 4M3CF 5FYSA 2FBEA 4N9IA 1ND3B 1Y9GA 1K45A 4CEWB 4BMEA 1W3XA 3VBOC 3DPRB 2XVGA 1W2TA 3AMPA 1LB2A 5C4WB 1NQDA 3ZXKA 1NE6A 3I54A 2B5HA 4OI0A 2UYBA 3M2MA 1LEMA 3I3DA 4UW4A 4LIVA 4XXAA 2VXRA 4QM9A 4A6SA 4CSWA 3H8UA 3ZIXA 5T5PA 4LPLA 1W8UA 2DCYA 1X9TA 3HR9A 1YQ6A 4FVVA 4IV1B 2DU0A 1GKBA 2YY1A 4QHZA 4XHBA 4BQ3A 3PVBB 2JXAA 4ET7A 2BTVC 1XYPA 3U4SA 4AFDA 2CSGA 2ARBA 5FKCA 4CCJA 2RHPA 1Q5OA 1JODA 2ZEYA 1G7YA 1MEC3 1OA4A 1US2A 1RUG2 4N7IA 3U14A 3Q8CA 5ABJC 3I3MA 3R4DB 3J7HA 4GWIA 3OPZA 4NIDA 1F8VA 4RHV1 4MYEA 4HBNA 4BISA 1POV1 1RINA 3KV6A 4R52A 2VMGA 4CDXC 2R063 5FZIA 1VMJA 5T5LA 5FPAA 2R071 5T5OA 1MZFA 1JZ7A 5FZKA 4NHMA 2UY9A 3WG4A 2YC0A 1LU1A 3RS6A 5BY5A 3ACLA 4O9EA 5FMOS 5CFCB 5K9YA 2AEZA 3NNJA 1G9DA 1YJLA 3P5BA 2WNVB 5DUUA 3TB0A 4K1YA 5FPXA 1QF3A 4LHKA 1RUJ1 4LOTA 1CIWA 3KT1A 1OUXA 2A73B 4YYOA 3OYWB 4XDPA 1JHNA 4LKDA 4YVWB 5C7GA 3K4ZA 4DINB 3AZVA 3NJVA 2VTFA 2Y6KA 3K48A 3ZFEC 4F7ZA 2XBO2 5L9VA 1XYOA 1NCQA 2YPDA 1AR71 3NKGA 4JC1A 4N9HA 3NV2A 1RUE2 1H8TA 2YBSA 3P3NA 2PHTA 1PGL1 1BHGA 3PL0A 4IV3A 4ZU5A 5GZFA 3RZMA 2JG9A 2QQKA 1ZREA 2XGXA 1NKGA 2WLQA 1PVC3 1WW6A 4IQPA 5BNOA 2WNOA 4AHWA 1WZXA 4ATFA 2WS92 4Y5TA 2Y0IA 3LPGA 3PUSA 1V9U3 2FMDA 1RHI3 2OQ6A 1Z0HA 3ILRA 4Y24A 3OYWA 4N7UA 4CXXA 5IATA 1DQ2A 2D3PA 1HDKA 4K3UA 4K40A 2A3WA 2DUOA 3O12A 3A4UA 2QE3A 5FWJA 5FAXA 4CDWB 1HB4A 4FSJA 1YEWA 4HT1T 4XPVA 3RMYA 1RUD2 4UXAA 1QJU2 1PO13 4AR2A 3FHAA 4AAPA 2VW2A 3N36A 1VBD2 4K8RB 3OB8A 4IE4A 2ZPXA 4WM8B 2J1UA 1J3QA 2WSVA 2WZPP 4NIGA 1NZIA 5JZGB 5DN2A 2XONA 1YI9A 2Y0OA 1HKDA 2C6SA 3R05A 4BJ0A 4COVA 2XPJA 5HI0A 4Z8BA 2VXJA 4ZZ8A 2YU1A 2ZX1A 3G6JB 1U0AA 1AVBA 3RNSA 2A3XA 5LA2A 4YVWA 3ZFFC 1S1AA 2ILMA 1AX2A 1UMIA 1ODMA 1JZ5A 1DQ0A 1UWWA 2XHKA 2W3JA 4E8DA 1AYM1 3O1RA 3UNPA 4PF1A 5GJ6A 5D8AA 1DGRN 1OOPA 3OBRA 1PM7A 3K4DA 1RUE1 1YFYA 1ZNPA 4M4RA 3BUCA 2GH2A 3WNMA 4A7KA 3O1MA 4EROA 5FIXA 3ILNA 4TYSA 2RMU3 5JPMB 4QX3A 4XW3A 1G86A 3V56A 2Q4SA 4O7XA 5JXHA 1O3TA 5FP3A 1SEFA 2WWJA 4XCAA 3ZXDA 4Y22A 4IEVA 4UBHA 4A42A 3E97A 4JQRA 2WYSA 2ZEWA 3AXEA 1BVVA 2AR6A 3M8LA 5IVVA 5BNPA 1UXZA 4WM8C 3ZOIA 1O6UA 1CONA 5CADA 1S0IA 4NROA 1CAVA 2BDRA 4B4PA 4AI2A 3E5UA 1WCDJ 4HN0A 2UWBA 4XJ9A 3MI8A 3O5SA 4N8MA 5B4XA 1DQ6A 2R043 5A32A 4DFSA 2Z5WA 2E7AA 4FFIA 4MGIE 4R9BA 1SDWA 3INAA 5LRRA 2RDQA 5C8WA 4AI9A 1LOCA 3MYXA 5CFDB 2EAKA 4Q4Y2 3CLPA 1VAMA 4LE3A 1EAH2 4B7EA 3AKQA 4IUGA 1AJKA 2NQYA 2VZQA 1RUG1 4IV1A 3SXWA 4BLIA 4E9KA 4EJRA 3OTFA 3WNXA 3ZX7A 2GNTA 2VUJA 4AGRA 1VP6A 2R6QA 4ZU4A 4RFT0 4I02A 5FPLA 2WC2A 1GR3A 2ZS6B 1X82A 3ITQA 5FP7A 1MEC1 4FAHA 1VBE2 2WNEA 5BNNC 4CU9A 1HB2A 4I30A 4IE6A 4L2NA 2HWF1 1HQLA 3HQRA 1X8EA 1DP0A 1POV3 2DCJA 4QPYA 2Q30A 3VD4A 1TMF3 5F3IA 1HRV3 4EWAA 3KGLA 2F4LA 3FZ3A 1U5IA 5FOBB 4CCOA 4COWA 2NLRA 1VRH1 3WQBA 4XC9A 2BFUL 1DHKB 3OD4A 4XF3A 1QWRA 3S5AA 1ZA7A 5LY1A 1GQGA 2V4AA 3BB6A 3WNLA 3VDDA 1W6NB 1PGSA 1HW5A 1OT5A 1PZ7A 4N43B 5GM0A 2NM1A 1JUHA 4UAPA 3JD71 1JN2P 2OXBA 1SCSA 3KCYA 1C5IA 1CAVB 1AZDA 3NSTA 1E5HA 2OQ7A 3A23A 2A6ZA 2GU9A 5LCWL 5CYYA 3RPQA 1DQ5A 1S4CA 3H3ZA 1AX0A 3AX4A 4JTOA 1BEV3 5DDJ2 2G9FA 3B94A 4BK4A 1UIKA 2W87A 1J59A 1A8MA 2A71A 1PZ8A 2A6YA 2D6NA 2TUNA 2Y6GA 3KB5A 2QUOA 4LLFA 5A70A 4C0HA 4GD4A 2DVBA 3NJZA 4N43C 1UX7A 4D7TA 4DXTA 3V0BA 1UY3A 5A3WA 4P9IA 4R8HA 3MPPG 1SCRA 1DGLA 2L9LA 3AMHA 2VZSA 3DECA 2IXLA 2E6VA 3CO2A 2LUWA 3POJA 4H14A 4Q1RA 2P17A 2Y64A 5IVFA 5A33A 2BWAA 2DVDA 1ZRDA 1HRI3 4GULA 2XUEA 5FY7A 3I2FA 1S0EA 4AHZA 1DYKA 3O1PA 1WCQA 1LENA 2E31A 2PHFA 3FFZA 4UW3A 3ZMNA 1GU3A 3PU8A 3DPRC 4ASKA 4IERA 5L7OA 4QXHA 4CCMA 3SKVA 1ENSA 1HV1A 5BNNB 1RITA 4HSJA 3P6BA 1FNZA 1Q56A 1WCUA 2LS6A 3OD0A 4BYYA 5LA9A 3VBRA 4Y1YA 1QOTA 4KNCA 4Q5OA 4BOWA 3ILFA 4FOYA 1W05A 2WRAA 5DQ0A 4PHZA 3MLJA 3RZLA 5DUVA 3BCWA 1G9AA 1VMHA 1UOBA 2RM21 1JXNA 2DCZA 2UWAA 2WS93 3GZTB 4MLOA 2CGOA 2VVFA 4YPJA 5T3NA 4OCTA 2WWSA 1CZTA 2HWE2 4KU8A 4D0QA 4E2GA 3C7FA 3THPA 1EV12 4CDUA 3TNPB 4ARYA 4YW2A 3WNOA 1CR7A 3SCHA 3U78A 3VBSA 1UY2A 2W1SA 3I2DA 1CAUB 1COV2 1EV11 1UU5A 5FYVA 4XBQA 4A6OA 5L9BA 3EB7A 2IXIA 1OOPB 1TME2 5T54A 2OZJA 2OVUA 4G9SB 3VHOA 4FPHA 3H0OA 4X8NA 3QBQA 4AVAA 1H1MA 3NV4A 1SACA 4H3WA 4MHRA 3MFCA 2K46A 1WLWA 4WV8A 2RDRA 2E33A 4X6RB 3VDCA 4WM7C 4IE5A 2XQRA 1N1SA 2BPA2 1COV1 1H4HA 1QNYA 3BALA 1KEXA 1SLIA 5IWFA 1XNTA 3ZYGA 2HWC3 3PUIA 1FOD1 4TLFA 1OVPA 1TZOA 1VB2A 1OPMA 1Y9QA 2IXKA 2GC0A 5IT6A 1Y3TA 1QDOA 1PNFA 3J7NA 4CUBA 4NJ4A 4D3WA 4GH4A 5KHKA 2X5IB 2YG0A 2R1BA 3GZUC 4QDSA 3MF6A 1VBB1 5GLVA 1MACA 1LJ7A 3WSOA 4YM3A 4V2VA 5JMOA 2J42A 1JOJA 2JE7A 3NVCA 1RGSA 3O0WA 4NPLA 2RS51 5K7PA 1W6OA 1IGOA 3N9PA 1UU4A 3HBZA 3LA7A 3HVDA 2P3KA 2BNNA 1WLTA 4DXRA 4LBMA 2OS2A 3ZKUA 4CEYC 2IUWA 4QT6A 1ULEA 4YZ2A 1ODNA 1BBT2 2NN8A 2WYFA 3AZWA 3TRSB 5H9RA 2P6CA 2JDYA 3E1F1 1CGPA 2D44A 4C91A 5CB7A 3OGRA 4PDWB 4QB1A 5FMBA 2ZCWA 5FMOL 4DEVA 1XOYA 1AR63 1JU3A 1JYXA 2I07B 2CGNA 4RSUA 3JZVA 2PLV1 4K1ZA 3TWIA 5FO7B 2PAKA 1V6MA 4DNYA 2Y38A 1YIPA 2WQ8A 3RWNA 3IT8A 1BEV2 1YJKA 1FMD2 5DDJ3 2VOTA 3WNPA 1KS4A 3K3NA 4OMDA 5FZLA 4QPGA 2C24A 4D7YA 3VKLA 2D5HA 1W2NA 3VZOA 3IDEA 5H9QA 2RS32 4IL7A 5LBCA 4YLZA 3G7DA 3ZXEA 3ZMOA 5B4NA 1S2KA 3CQOA 4OHWA 4QQLA 5C3OA 3ETPA 4HFSA 2BWCA 4MGTA 5JSPA 5ACA3 4Q4X3 5FPUA 5KHHA 3NQHA 2EAAA 3UKNA 2J1RA 1V6LA 2KM2A 2H0BA 2WNVA 1ULCA 1WA6X 1ZA4A 2WQZC 4MG2A 5A6QA 4FOWA 4P5HA 1NOVA 5FZOB 3M3CA 1YFUA 5JOWA 5M0TA 4XF0A 1OA2A 4LJHA 2VECA 1ZZCA 2B7YA 1JZ3A 1RVF2 2QQWA 1CZVA 2P2KA 4I2OA 2CAUA 2WINB 3QACA 5GZEA 1DIWA 5K0UA 4HANA 1GANA 4MO3M 5LEKA 1I3HA 5KHJA 4Y22B 2GMMA 2AENA 2WNVC 5FZMA 2VY0A 2D5FA 5H9PA 1LHWA 5A7NA 1F15A 2DYCA 3TNQA 3NJYA 2MEV2 3F95A 2B8MA 2QQVA 2J1SA 2P34A 1VBE1 4GALA 4P5YA 1VRH3 2P3JA 4NIHA 1D4M2 4QPIB 1RUD3 1LEDA 1ZBA3 1JYWA 2Y33A 2JDMA 1VBA2 3LDBA 3Q8FA 5FZ3A 5JMCA 5KXCA 4C1WA 3N3HA 4W6XA 4QPGC 2DTYA 2GC3A 3VLBB 1URXA 3I97A 3M1HA 4FPCA 3LEMA 1JUIA 1OC1A 1V9U2 1PO22 3OUIA 2D6PA 2HEVF 4LTAA 5HV4A 5LA0A 1OFNA 1UNBA 3DGTA 4P00B 4BQ1A 4O9GA 3M3QA 4Z82A 1AX1A 4K21A 1CPMA 4MGKE 3MW3A 4FAGA 1PMJX 3PVEA 4Q4V3 3T2QA 3N35A 4XZPA 2RR12 1CJPA 1K5JA 3ZSMA 4LITA 5EQUA 2BUKA 3KSCA 4P14A 4CP9B 3ZXGA 4PT6A 4H7LA 3OPWA 1AJOA 2XJQA 5F7UA 4QQ2A 4BIOA 4U2AA 5C4WC 1NE4A 2XBO3 2XL7A 1EV13 1OMIA 2ZKNA 1I9RA 1QKQA 3H3LA 3VZLA 3DYMA 1CD3G 4QU2A 3UGGA 5CU1A 4LBNA 3ES4A 5EWSA 4AI0A 2XDVA 4HVQA 5D21A 4L8QA 1WMDA 2BU9A 3ZDSA 1LU2A 1MZEA 4OI1A 1CPNA 4NN0A 5FUIA 1UF2C 2D6KA 2GAUA 1MZ6A 3S30A 3UV9A 3CKHA 3LGRA 4GMP3 3M3OA 5J3UA 4A2UA 1UZWA 3AVRA 4L0PA
chains in the Genus database with same CATH topology
1GZ9A 1FPN2 4BA6A 1LHNA 1VBD1 1QHDA 1YLLA 2PELA 2D93A 1RUI3 2ZGQA 2R16A 3PVOA 2HEYF 4FXGB 5BV6A 4LBQB 4E2SA 1HX6A 1BCXA 2A75A 4YSFA 1HRI1 3KMHA 5JZGC 4AGVA 3BOWA 3ETQA 3JU9A 3B3QE 3APBA 1F31A 1POV0 1GICA 3MF9A 2PFWA 4XYXA 2ZMLA 1QQP1 3M7AA 3EHKA 2Z69A 4FPEA 1TEIA 1BJQA 5CFCA 1NXD1 1A8DA 3VBRB 1AXKA 2W68A 4XFGA 5I8SA 1W2UA 3B00A 1RUF2 4RL7A 1MS8A 1DZTA 5L7OB 3GF6A 5FLJA 2WIIB 5AC92 1MQTB 1PGW2 1COV3 2GH8A 3POWA 1UIJA 2WZR2 1O91A 1QJZA 3RG0A 2XVKA 3UJQA 1SFYA 2WA4A 5L19A 5L7OC 2HWE3 3VN4A 2H6CA 1H1IA 2ZHMA 3OGJA 3SNMA 1AR72 1X8MA 1O7FA 1V6KA 2R072 5IUQA 1NQJA 5JPNB 2I74A 1W39A 1ULGA 2XUMA 3AXDA 5AFEA 3ZO0B 3DUIA 3GNEA 4AQTA 1M4WA 4GQ7A 3IKWA 4FPYA 4LR4A 5E16A 1MS4A 2ETEA 1RVF1 1D4M1 2WT1A 3H1YA 3AMMA 1PIV2 3L2YA 1NA1A 1QJX3 1GV9A 2XJRA 3KLSA 4Q4Y3 1FPN3 4RHV3 5DZEA 2YZ4A 3CJIA 4HL0A 3VHRA 2X29A 5JR7B 3WCSA 4M01A 3AP7A 4HKLA 2NMOA 2IXHA 3S6PA 3VL9A 5GZGA 3TN91 2OPKA 1ZBE1 3C3VA 4K9SA 5CFDC 4KG0A 5C8CB 4FP2A 4YW1A 5D1IA 4IV1C 1GNHA 1B35A 2ZX4A 2WSUA 2CWSA 4YFZA 2RS33 1YFWA 2RS12 3B02A 5DDJ1 3SCGA 5BNNA 1X50A 4IEWA 4R9DA 5A32B 3ZSEA 2JG9B 2XWJB 4QQOA 4KGQA 4PCRA 1ENRA 1HQWA 1YCIA 4CRQA 4L97A 2YMZA 4XIOA 4OFGA 3W59A 4M3CA 4Q0QA 3ST7A 2HWD2 1RJ7A 2ZAAA 2GALA 1VAKA 3GYDA 4ZXKA 1IS3A 1MS9A 2YV8A 2VOXA 3D0JA 5E89A 2BFUS 1K5MB 4AEJA 1VBE3 1NCQB 1DGWX 3T1LA 2XJSA 2MEV3 1DDLA 3H1WA 1KDMA 1LODA 2JDZA 3A0NA 3VV1A 4J1WA 3ASIA 3MIGA 2W39A 3MIBA 1AL0G 3LAGA 1ONAA 2WJSA 1UKRA 3GZAA 3ZFEB 3AKPA 4OUMA 4JGYB 4CDQC 5IK8A 4FTEA 1FATA 3B5LB 2C5DA 4AVVA 1VBB2 1R1A1 5T52A 2OZ6A 1LOAA 4KWKA 4XTMA 3P3PA 4QQHA 4QXKA 2XBO1 4XE9A 5J48A 1IS6A 3SHRA 3KT7A 1EY2A 3ZXFA 4MZUA 2HWB2 4KU7A 4ATEA 3NAPB 4XOGA 2XKOA 1V6NA 2LM3A 5ABJB 2X8KA 4AE2A 5CIRA 1NY71 1RUC2 1MQTC 4Q4W3 1VBC2 4QM8A 1LRHA 1LOEA 4Y4YA 1MZ5A 2EXIA 1W0PA 2HWB3 1DZQA 2DURA 4BHPA 2AYHA 3LCPA 4LO6B 3FMGA 2UY8A 2XKPA 3D6EA 3EO6A 2A3YA 5LRSA 3UL2A 5JWPA 4JGZB 3VZNA 2ZTNA 4KQ7A 4RR3B 4JGYC 5JOXA 4XF9A 1WUVA 1VB4A 2QKDA 5CG9A 4BZ4A 4COZA 5A33B 5FOJB 5GLWA 1NA1B 1JH5A 1QGLA 4RGGA 5F6KA 4Y1XA 1QJU1 2QZ2A 1PO11 4AEKA 3IDBB 3CEWA 2F4PA 4ORFA 2CWMA 3THTA 4AGGA 2JKBA 4RS5C 1JYIA 3RJ2X 1QJY1 3CF6E 2QCSB 1WMFA 3PLQA 2IXJA 1QQP3 2MHFA 2A6WA 2A70A 2OUHA 4TSVA 2VW0A 4TZDA 1KJRA 3NKTA 4LNVA 5FPZA 1N1YA 2ZGLA 3DPRA 1B35B 1H1AA 4CDXA 5I93A 3WP4A 3J9SA 4COYA 2R1DA 1C1LA 3VBSB 3VBOB 3ZSLA 2RS13 4Q8KA 4CEWC 5DUWA 4KBBA 2B39A 1T6GC 4OI4A 3SITA 1QMJA 4COUA 4ZU7A 4FBFA 1PO21 4C1XA 4XHXA 1ZZBA 5I0UA 3H3UA 4A3XA 1VBA3 3M3IA 2ZGPA 2GMEA 3D5OA 4GIQA 4JRLA 4Q4Y1 1WBFA 4EWEA 1XNBA 3VBFC 4Y20A 5T55A 2AZ5A 4GB32 2IZWA 5FRAA 3J8F3 1OI6A 3WOGA 3AYAA 3JB8A 5JIUA 1OQDA 1PIV3 1V70A 1V6OA 3NW4A 4Z07A 4RS5A 1RVF3 3K51A 5DUXA 3B93A 4YW3A 3VDDC 2JEMA 1RUNA 1ZZ9A 2GNDA 3R0RA 3OF1A 3IDCB 1CAWB 2YUEA 1DQ4A 1PVXA 5LK7B 5ACA2 4LULA 2HEWF 2RJKA 5KXEA 1XNDA 1ZZ6A 2BEOA 5SV5A 4FPKA 4LUKA 2KXLA 4I3PA 4OULA 4JDMA 3ROUA 3FLRA 4GWMA 2VOWA 3RDIA 3J4UH 4FOQA 2XVLA 3FX3A 2AUYA 3D82A 1OPOA 3BTAA 5AC93 3KM5A 1GBGA 3MW4A 2I45A 5CG8A 3LWCA 1XRUA 2D6OX 2XLFA 4XJWA 1NLRA 2EIGA 2KA3A 1HXS1 5A3LA 5AFBA 1BBT3 4DY3A 3IM0A 3N7JA 2PA7A 4MSVA 5DG2A 1MQTA 2W0XA 1CAXA 2V73A 2ZGTA 3FUOA 4MVTA 4WM8A 4LBLA 1SLLA 4JGZA 4B7KA 2PQQA 2VNGA 1BMV2 2ZMNA 3NAPC 3X29B 1WW7A 1GYKA 2DVFA 1PK6B 3LZZA 1UL9A 3VKOA 4IEPA 1K5MA 4G4FA 4EN8B 3FUQA 1K5MC 2VQ0A 1RB8G 1C8M3 3M70A 4S2FA 2DVGA 5C6CA 1N1VA 1W6MB 5I8TA 3AP9A 4JCKA 4NVPA 5EV7A 1OQEA 1CJDA 2Z42A 3ZIWA 3KZ4C 3BODA 4C0BA 3AP5A 3FWEA 1H8TB 1CN1A 1KFUL 2E63A 1LKNA 4AVSA 1REEA 2GNBA 2GN7A 2ERFA 1CESA 4OHYA 5BNOB 4YFWA 3AK0A 2Q1MA 2RR13 3WR0A 2DUPA 1PMIA 4FT8A 4Q0SA 3WHTA 4Q4W1 1NY72 3JQWA 5FREA 3LSDA 3PNAA 1NLSA 2YGMA 3NV1A 4JV4A 4RA0A 1AR92 2X53S 4WBBA 1FOD3 3AKSA 4AVCA 4YM0A 4GB31 3VZKA 5F9TA 3S7EA 4FPJA 4I01A 2ZZJA 1W6QA 1QJU3 2JG9C 1UAIA 5C33A 1XU1A 4PLOA 1QOOA 2A7AA 4QPIA 4AEDA 4XJ8A 2OA2A 4OZXA 3J26N 5GZDA 1L3JA 2VMIA 4N90A 3GBWA 4E27A 4AQ2A 1DG6A 1YO8A 1NXMA 4NWVA 3FHIB 2XB6C 3ZYRA 4YZ3A 3ZXLA 3MZHA 1LTEA 4ASLA 1YFXA 3IBMA 3WXPA 1D4VB 1H2LA 3LA3A 2BBVA 4PF5A 2WA3A 1PVC2 1IZ3A 4Q0UA 3V0AB 1W6NA 3HT1A 3H50A 4PIYA 1AXYA 4P9GA 2HWD3 4KWJA 5CA6A 4AK3A 1CAWA 1AR73 4GKXA 4DPNA 4AFAA 3ZYPA 1DGRA 1RTVA 2QDNA 3E6CC 1VALA 5L36A 1ND2A 2XG3A 1QJY3 3QH7A 3N7MA 4EN6B 1D0HA 1KQRA 5FLHA 3KD4A 1E57A 3POSA 5F5QA 5BNPB 3FBYA 4D7SA 5DZGA 1N3PA 1O4YA 2CAVA 4QX5A 2JD4A 1AUYA 1LGBA 1XXNA 3RSJA 1O5UA 1S0FA 4AFMA 3TN92 1GLHA 1RUF3 2PLV2 3E5QA 5KXBA 3S0MA 2MPFA 3UK9A 2DTWA 2EXKA 4IV3B 3JBG3 1TNRA 3WG2A 1H30A 1ULDA 2W08A 3VBFB 3KS7A 1OLQA 1WLDA 5BPXA 2R49A 2WKKA 4BPZA 1EAH3 3WDXA 2G4IA 4M0NA 4H7MA 2QFEA 2LTNA 4HN1A 4CEWA 2R042 2DCTA 3JQXA 4YZ4A 4KWLA 4FO9A 3PJQA 1C3HA 4NO4A 2JJ6A 1VAVA 3ZFGC 3J8F1 5KC5A 4ONUA 1WMEA 5CBLA 1G8WA 2WFF2 4Q26A 5I8YA 4NWWA 4MV2A 3WVJA 4LA3A 4Y20B 4XFCA 4RR3A 1OA3A 2V09A 4WM7B 1LOFC 1RUH3 3BU7A 4CZSA 2XWBB 5HBAA 5KC6A 1OKQA 4OUSA 2AH2A 1ASJ2 2VQAA 3WINE 4MXVA 2QZ3A 1IPKA 5FO9B 1PGW1 5JAXA 2EXJA 4BIFA 2VMHA 5KWRA 2DV9A 5BUVA 3HD8B 3MICA 1UKGA 1NG0A 1U5XA 4EN9B 1RUOA 4G3YC 2QDRA 4Q8LA 3ZVXA 5BYNA 2HWE1 1FX5A 2NMNA 4AEDC 1YIFA 1Z7S3 2CYFA 2D6MA 3ZYIB 4K20A 1QXJA 4PBPA 3WDUA 2X5IA 1RMU2 3PJYA 3MFAA 5AC91 4RGAA 3ZFFB 1Y7BA 2SBAA 4GMP1 1LOBA 1SBEA 2PHUA 3B69A 4J1XA 3ENRA 2ET1A 3HN1A 2VH9A 1R092 2WL1A 1RIRA 5DG1A 3BPZA 3W9AA 1EP0A 4FPFA 3RJRA 1N3QA 4XQ4A 3VL8A 1HQNA 1R093 1VLNA 1UX6A 2E7TA 3I7DA 2YYOA 1FPN1 3USUB 5GZCA 1HV0A 1RUI2 3H1MA 5FQ0A 5EFUA 1HRV1 1CX4A 3AZXA 3EQEA 3DN7A 2ZX3A 3CL1A 4Y1UA 5L73A 2VW1A 1AR81 3I59A 3AJZA 4LLOA 3VKNA 4NHKA 4JTNA 4CDQA 1KXGA 1LHUA 1Q43A 4YG3A 1C8M1 3VBUB 4LE4A 4MH0E 1VBC3 3O0XA 4OVEA 5TSWA 1KJLA 4KGGA 1AYM3 2OIIA 4OHVA 4DB5A 2PHRA 3VHPA 4XF1A 5J98B 3WZ1A 4IXLA 3NAPA 3KT4A 3RYKA 1N3OA 1W6MA 4FP3A 3QOPA 4JDNA 4WVMB 4SLIA 1FMD3 4OHXA 5EXOA 3USSA 4CDWA 4LO7A 5JVVA 4A7ZA 4I0BA 4W65A 4AFBA 5I0SA 2PTMA 2WFF1 1ZVFA 1EPWA 1TMF2 1A78A 1N1TA 3WX5A 1RUG3 3ECQA 1MVQA 1CVNA 2EA7A 3DKWA 4QQPA 4E4SA 2BNMA 1OFSA 2P3IA 1R1A2 2R041 2OW4A 3RRDA 4GB33 2R0HA 5FFOC 2IFRA 1F5JA 4HPKB 4AW7A 3SH3A 5CNAA 4YVSA 1KD7A 1TMF1 2XJVA 5J36A 3U4XA 5F6LB 2ZABA 4FPGA 4B29A 2O0OA 1XE8A 5T5JA 5I0RA 1DZRA 4XFHA 2ATFA 3RYPA 4AI8A 5I91A 4XQDA 3CU7A 4PDWC 2FZ2A 4LUMA 2HWC2 3KGZA 3N7KA 5FBZA 5CFDA 1MS0A 2F6BA 3M4FA 3MGUA 4V1PA 2XJTA 1M06G 4Q4X2 5C8CC 5FCCA 2D97A 3ZSJA 1RUF1 5GLTA 3IIAA 1R081 1DBNA 1KITA 3QLQA 2WNUC 2WZR3 3UKTA 2VUAA 3PTYA 3JBG1 5JSOA 1MS1A 4K8FA 1KFXL 2BNOA 3AJYA 3V0AA 3ELNA 1PNGA 1NA1C 3GHNA 3ZXAC 1H4GA 1OHFA 1O3RA 4YGCA 1NCRC 3VZJA 3CJIB 2RS31 4L92A 1WBLA 1Z7S1 4BWOA 3D8CA 1G6NA 5IK5A 2GZWA 1ND2B 1X7NA 1J1LA 5HCBA 3WW4A 1ZBE2 2BGCA 2QJVA 2ZMKA 2DUQA 4X6QB 1AL21 2UYAA 4LBKA 3WHUA 2B9UA 4AQSA 1QJX2 1MS5A 1BYHA 4CDUC 3HQXA 4IETA 4IEXA 3WUDA 4GXLA 1AR61 1FOD2 3AYDA 2DU1A 2A6VA 4LHLA 2ZGSA 4LBJA 5DZFA 1W6OB 3WY6A 1IKQA 3UJOA 1XE7A 4IEZA 5JZGA 4AI3A 1IKPA 5JIAA 3H9AA 2Y26A 2ZA9A 3IPVA 2VPVA 4XMAA 4Z1VA 2E9QA 4LO8A 1IS4A 1S2BA 1AYN3 2ZX2A 2R30A 4AQ6A 1BK1A 1Q3EA 2JENA 1U12A 2PAMA 1RC6A 4D69A 3H7YA 4FXKB 4LA2A 4Q4V2 5HXVA 4F83A 1J1TA 3O7OA 2HWB1 3LSEA 4JGYA 3GBGA 3ZN6A 4INDA 3SLIA 3MIDA 4HMZA 4HKWA 4CYDA 1RUH2 1LECA 4AYUA 2ZHNA 3ALQA 5B2GB 1VBB3 4PLMA 1GSLA 1TQ5A 1F9KA 2RS53 1IOAA 1CAUA 3FFQA 3VBUC 4JDOA 1EYBA 1APNA 1LR5A 5FTTC 3AP6A 2GMPA 1H9WA 1A3KA 1V00A 2PN5A 4WZFA 4A7YA 3H7JA 2GC1A 4MX3A 1HRI2 1ULFA 1BZWA 1UCXA 4CP2A 2YDEA 4AI1A 4OHZA 2PYTA 5A3MA 1C28A 3FE5A 2ES3A 3B9IA 5KHGA 2VVEA 1DYPA 3WV6A 2CGPA 2BQPA 1FYUA 1SQ4A 4ASMB 4DRVA 3JCIA 1PK6A 1W0OA 3WQ0A 2YHJA 1H9PA 1AL22 2ZX0A 2FMYA 1EPZA 1VJ2A 1BVP1 1HLCA 4XILA 2PLV3 5J37A 4RS5B 4BMBA 1FV3A 2VNOA 1FMD1 2XJUA 4Q4X1 2A6XA 1LGCA 1WW5A 1XNCA 2JE9A 3FLPA 4URTA 1H8VA 3HMYA 2ZGNA 2QQPA 3O0VA 2RS11 4I3GA 4XBLA 1SLBA 3QH6A 4W6YA 4AEDB 2ZGKA 4N53C 3PHMA 1RL3A 3RMXA 3ZXGA 2EALA 3JD72 2HWF2 2VVDA 2ZGRA 4YZ5A 4RD7A 5ACA1 5GKAC 3VUOA 2E7QA 4E2QA 5K0UC 1S0JA 2V5YA 4XFIA 4ITCA 4META 3UKVA 3ZN4A 2HKXA 5LEJA 5JOYA 4CP1A 1VRH2 2O1QA 1D2SA 2HWC1 1ZZ8A 2JECA 2ZBJA 4K7JA 2TNFA 3R4UA 4AEMA 4DQAA 3I8TA 1ZRRA 1W6QB 4HSLA 5T50A 2Z79A 1AXZA 1J3RA 1GZCA 1ZYBA 1PIV1 4B4RA 1QY4A 1PK6C 1U5YA 3L2HA 1LOGA 2D3SA 2RE9A 1CQ9A 2DVAA 2UURA 1C8NA 1ENQA 1ZBA1 4QPGB 1KS5A 3IMNA 2WZR1 3B9CA 1WGPA 2D7FA 2BW8A 4L11A 3HWJA 1O3QA 3WQ7A 2DWRA 1S0BA 2TEPA 1SLCA 5AVPA 5FQ0B 3ZXJA 1GZWB 1SLAA 1UPSA 2IFWA 2JG8C 2WT2A 4HK9A 3SISA 5KHIA 1QQP2 4YGEA 3D4KA 3A0KA 5JI7A 1AYM2 4CDUB 3FBMA 3URFA 3E6DA 4XFBA 4IEYA 3VDDB 3DF0A 5J7MA 1GNZA 1R083 2HJIA 4XJZA 1O4ZA 4HLTA 4EWDA 1AL23 4LBQA 2D98A 5GLZA 1AR62 1RJ8A 3MIFA 1G9FA 3VBUA 4GH4C 1O4TA 3AFKA 4MXWA 1O3SA 2CV6A 2OYZA 3AYCA 1QJX1 2ARXA 1W6PB 1NCQC 4P9LA 4Q0PA 2IWGB 5K8SA 2FZ1A 1XNKA 2I2SA 3BOPA 3SH5A 3AKRA 1BQPA 1ZRCA 1VBD3 2ZJCA 1GFF2 4YM1A 4R9CA 4BCUA 2Q5TA 2XLGA 1BBT1 3LOIA 4FPOB 2DF7A 3V64A 1LOFA 3D0SA 2R061 5SV8A 4JRAA 2R073 3VBSC 4WVWA 1ALYA 4ISRA 1QOSA 4YGBA 1MVEA 2K9ZA 4XJUA 5AVAA 2CTVA 1RUD1 5CFCC 3I4IA 1F5FA 4XETA 1N47A 2HYKA 1GZWA 1WLCA 3SCFA 2VULA 1RUJ3 2DCKA 4WZCA 4SBVA 3T2TA 5JLVA 1IQAA 1DQ1A 1H2NA 4GKYA 2ZHKA 3AFGA 2YGLA 4YW5A 3U11A 2Q1ZB 4AXOA 2OUJA 1I5ZA 4FQ4A 1B09A 2C0ZA 1IS5A 2ENRA 4KL1A 4XFFA 1XYNA 3DL3A 3WDVA 2NP0A 1RUJ2 1DU3D 1JW6A 3N4MA 4WVVA 2ZGMA 4PJYA 2VGDA 4AVBA 1PHMA 4S2GA 2K2SA 3NWKA 4YARA 2WQ4A 1UZZA 3U10A 1UW8A 2MEV1 3CJXA 3R6SA 4UW5A 1DLLA 1D0GA 1AHSA 3MDPA 3W58A 5E8AA 4IEOA 1ASJ1 4GMP0 4NHLA 2FHRA 2GN3A 2RM22 1C57A 4HETA 3VGIA 2ZKLA 1D4M3 3SH4A 1QNWA 3GALA 2VOKA 2YROA 4YW4A 2D3RA 5C8CA 3TBDA 4K6BA 4TWTA 3OY8A 3OJBA 5C4WA 5CAZA 3KQRA 2IXCA 5J96B 4WVZA 1ZM1A 4HK8A 2QVSB 1R1A3 1I1EA 2O8OA 4HVOA 3ZFGB 2JG8A 3WW1A 4BM8A 3ZYJB 4DMIA 4FCAA 1FNYA 1D2QA 3KCXA 4YVSC 1NYWA 1QDCA 4XBNA 2JICA 4H55A 4XMIA 4IESA 4E4ZA 2NYYA 2VG9A 2HWD1 4WVMA 2C1FA 3V65A 3TN93 2B46X 4PDWA 5EYXA 1PZ9A 3OY8B 1BEV1 5BXXA 1ZRFA 1I6XA 4XFAA 2EVXA 4QD2A 3QD6A 2RMU2 5JCTA 4LEJA 1F2NA 4MUVA 1TE1B 2RMU1 3FC0A 4FQZA 1ZZ7A 4HVRA 1Q8VA 2ZZQA 4ES8A 5H9SA 3MLKA 4BE3A 2TBVA 1V6JA 5BNPC 2CY6A 2BVBA 4IEQA 5JDBA 5KXDA 1G9CA 1HRV2 1QH6A 4AF9A 4YG6A 5HCFA 2CL2A 5E88A 4CP0A 1U5ZA 1Q8PA 4OLLA 1C5HA 4P9JA 1G9BA 1C4RA 4FTBA 1BXHA 4B3NA 4N53A 2A5ZA 5GALA 1YNAA 4W6WA 3MW2A 3U07A 3AYEA 5C9AC 3TOJA