4XFIA

Cysteine dioxygenase variant - y157f at ph 6.2 with homocysteine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfiA00
5T3NA 4AQ2A 2OZ6A 3L2HA 3B02A 4QM9A 1RC6A 5EFUA 3SCFA 1NE6A 4Z82A 2ZKLA 3EO6A 4XF0A 5J3UA 4JVAA 5KHKA 1RUNA 4FBFA 2XGXA 4ORFA 2CV6A 2GC0A 1FXZA 2N7GA 3N4MA 1OMIA 4AXOA 5BUVA 3O14A 2BEOA 2XKPA 4EROA 3C3VA 1CAWB 3R6SA 2CAVA 4RD7A 1OFNA 3H7YA 4XFFA 1ZZ8A 4O9EA 4MX3A 1ZVFA 3EBRA 4L11A 2GZWA 4UXAA 1VP6A 3HIFA 3H3UA 1GQHA 4HZFA 4IEQA 1IPKA 1XE7A 1Y3TA 2EAAA 4BYYA 3KGLA 1O3TA 3KSCA 3LZZA 2WFPA 4LULA 4OLLA 3LA7A 4KU8A 1FI2A 1ZRCA 1Q5OA 2BGCA 3LOIA 3H9AA 4F8AA 5BY5A 2EA7A 1V70A 5LEKA 5JAXA 5LRSA 5BV6A 5CADA 4HN1A 4HSJA 5F1RA 3ES4A 3G7DA 5FCCA 1LRHA 1FT9A 4PIYA 1J59A 3ST7A 1DGWA 1YFYA 2H6CA 1YFUA 4BIFA 5KHIA 2D93A 4XFIA 4YSFA 3BPZA 1RTVA 1X82A 2XLAA 4I2OA 4QXKA 3OTFA 3ELNA 4IEYA 3E6DA 3IWZA 5FQ0B 4BH9A 2XLFA 4HSLA 4AQ6A 1Y9QA 2PAKA 5KBFA 4DINB 2FMYA 2MHFA 1RGSA 2IXIA 3LAGA 2QCSB 1G6NA 5KHHA 3USSA 4JV4A 3HT1A 3EJKA 1ZRFA 1LR5A 3H1MA 3I54A 4XEZA 2UY9A 4MV2A 2ET7A 2IXCA 1CAUB 1QXJA 4LTAA 4XFBA 2CGPA 1SFNA 3LWCA 4OFGA 2QDRA 5CVRA 5FLHA 4Q0QA 4UBHA 4NVPA 1ZZ9A 4N9HA 3FHIB 2IXKA 1SQ4A 3ACLA 3IBMA 2VPVA 1UCXA 2K9ZA 2CAUA 4I0BA 4IEOA 4QM8A 1IPJA 2PHDA 1NZCA 2UYAA 4LA2A 3E5UA 3CF6E 2XKOA 3EHKA 4LA3A 4MZUA 3RPQA 5I8YA 4KL1A 1LKNA 1CAXA 3U11A 4XF9A 4AVBA 3CLPA 4P9GA 1J3PA 5LRRA 4J1XA 2OA2A 4H7LA 3FX3A 4IEWA 5EZWA 4ZU5A 5K8SA 4IERA 4YARA 1I5ZA 3D0SA 1Q3EA 3GBFA 3U10A 4JTOA 2QVSB 3NJZA 1Q43A 5JCTA 5I93A 3FE5A 1NE4A 1UPIA 1VR3A 4FAGA 3JZVA 3QACA 3NL1A 2GU9A 1EPZA 3GYDA 4PIXA 5I8SA 4XF3A 4AVCA 4FAHA 2Y0OA 1XE8A 4X6QB 5C6CA 1ZX5A 2BNNA 4QGLA 4HMZA 4O9GA 3H7JA 3H1WA 3WW1A 3PVBB 1X7NA 3QOPA 2O1QA 4QGMA 5J48A 4MGIE 4KU7A 4GULA 1EP0A 1TQ5A 1J58A 4I01A 4J1WA 3D82A 4XFHA 3SMHA 1UD1A 4MUVA 4I0AA 3CL1A 3HT2A 2MNGA 2HJIA 2XL9A 1QY4A 3OF1A 2OZJA 2P17A 4HLTA 4HVOA 4KWLA 4YYOA 4X6RB 5HI0A 1EY2A 1GQGA 3E6BA 1DGRA 2O8QA 2PTMA 4XFGA 5LEJA 1RL3A 1CAVB 1O5LA 2D5HA 5I0SA 3ETQA 3ROUA 4L2NA 1O3RA 3S0MA 4LUKA 3DV8A 4B29A 1WLTA 4K8FA 2OYZA 3MPBA 5I0RA 1OD5A 2GC2A 4MGYE 2V09A 1YWKA 1QWRA 3BALA 1DZRA 4QGNA 3S7EA 1QXRA 2XLGA 1OI6A 4D7SA 5KHJA 2F4PA 1ZRDA 3LA3A 2GH2A 2K0GA 4XFAA 2GC3A 4Q0VA 4XF1A 2I45A 3IIAA 4ONUA 3SHRA 2KXLA 3PLQA 3I59B 3E97A 4EWDA 2WC2A 3U0ZA 2IXHA 3UKVA 3SCHA 4I02A 4Q0UA 3D0JA 2IXLA 5FQ0A 4AVAA 2DCTA 4PJYA 1U12A 2H0VA 1I6XA 1ZZ6A 2D40A 4WZCA 4XETA 2ETEA 3RNSA 3CEWA 1WGPA 4HVQA 1X8MA 3ZDSA 1UIKA 3RZZA 2PYTA 2D5FA 4EWEA 2PFWA 4TLFA 1O5UA 4KWJA 1ZZCA 3EQEA 4R52A 1DZTA 1CAUA 1RUOA 1XRUA 3LA2A 1ZZ7A 3M3IA 3H1YA 3VHRA 4E2GA 3MZHA 4PIZA 3FJSA 2MPFA 3BCWA 3CJXA 3DN7A 4R8HA 2XL7A 4YRDA 5FLIA 4XFCA 1J1LA 2IXJA 2B5HA 2Z2SB 2GC1A 2PAMA 4HVRA 4I09A 4MGKE 2VECA 3UKTA 4LLOA 2C0ZA 1JUHA 1ZNPA 2Q4SA 4IEXA 2PHLA 5AVPA 3ES1A 4IETA 3OCPA 3WW4A 5I91A 2UYBA 2IC1A 3NW4A 3NVCA 5I8TA 1O4TA 4A2UA 2BNMA 2EVXA 3UKNA 4WBBA 5FDBA 5FPZA 4I3PA 1WA4A 5JSPA 1CAWA 5BXXA 1ZRRA 3CO2A 3S7IA 3OGJA 1YUDA 1O3QA 3IDBB 3TNQA 2FQPA 5JSRA 3SXWA 1YLLA 2Q0AA 5JR7B 5J7MA 1ZREA 4Q0SA 4CYDA 4LUMA 4QMAA 3HQXA 2UY8A 5I0UA 2BYVE 4N9IA 3KGZA 1NYWA 2QNKA 3PNAA 4IESA 1PMIA 2HKXA 4JTNA 5D1IA 1CX4A 1O3SA 4E2QA 3M70A 3KCCA 4D7TA 1NXMA 2H6BA 4EWAA 3H8UA 4META 3FZ3A 2ATFA 4Q0PA 2PA7A 2Q30A 1O7FA 3DKWA 1UIJA 2OPKA 5I0TA 3E5QA 4BHPA 1LB2A 4MGZE 2PAEA 4HBNA 3TNPB 5BPXA 4YNIA 1CAVA 3H50A 4LEJA 5KHGA 2GAUA 4UBGA 4XF4A 4ZU7A 4IEUA 3OD0A 2QJVA 5E1RA 3WW3A 3E6CC 5C8WA 1SEFA 3BU7A 1HW5A 4ZU4A 3NKTA 4IEZA 1J3QA 4IEPA 1L3JA 1ZZBA 4FT8A 2VQAA 4MH0E 4EV0A 3KMHA 4KWKA 2Z69A 1EYBA 2B9UA 5FPXA 3RDIA 2E9QA 1CAXB 3MYXA 3MDPA 2PQQA 1YFWA 3FWEA 4WVZA 1H1IA 3NSTA 1H1MA 3I7DA 3RYRA 1PM7A 1YHFA 2ET1A 5E16A 3WW2A 5JSOA 3I59A 3SCGA 3H3ZA 4E2SA 2ZCWA 3RYKA 2BNOA 5CU1A 2Q1ZB 4IEVA 4Z07A 4QX5A 4HN0A 1YFXA 5FLJA 1VJ2A 4Q29A 4F7ZA 1X8EA 3DL3A 1UW8A 3FFQA 2B8MA 2XHKA 3BB6A 3E5XA 1CGPA 3IDCB 1J3RA 3RYPA
chains in the Genus database with same CATH superfamily
3NAPB 3MV01 5FXXA 5T3NA 1UXZA 2OZ6A 3B02A 4HOOA 1K3IA 3ENRA 5EFUA 5HCAA 1JZ4A 2Y38A 1OURA 1VBC3 4YW4A 4A3XA 5BNNA 4FBFA 2XGXA 1RUNA 1JH5A 2CV6A 4AHZA 4LMFA 3MLKA 5JIAA 1A78A 3O1UA 4Q8LA 3PMEA 3AVSA 4FPEA 1HKDA 4IE6A 5FIXA 2VGDA 4FPLA 1TMF1 1UY3A 1W6OA 2BEOA 1X9PA 3AP6A 3C3VA 3AZXA 1CAWB 3J8F2 3RJRA 3AKRA 4AGVA 1JYNA 1UKRA 5FYVA 2W95A 1S2BA 4XFFA 2ARXA 3F2ZA 3OB8A 3O0WA 5GLUA 1CJDA 2J1VA 3PL0A 4CEYC 4MX3A 3KHCA 5FZDA 4BOWA 1QJU2 4L11A 1N3PA 2ZGNA 5F3GA 4NHYA 4UXAA 2WA3A 3HIFA 3H3UA 2P37A 1BEV2 3RSJA 2BQPA 4W65A 2ZJCA 1XE7A 5T5JA 2RS52 1RUJ1 3B9CA 1RUF3 4JHZA 1MVEA 3QLQA 5CBLA 3MI8A 4YZ4A 5C8CB 1W05A 1G9CA 5T5PA 1JS9A 1WWYA 3TOJA 3UYJA 5JUVA 1GANA 1LAJA 1SBFA 4Q4V3 5BY5A 2ZS6B 1QNYA 2FHRA 4YLZA 2FZ1A 2RMU3 1OQEA 2WAOA 2WL1A 3T2PA 5LRSA 4D6RA 5BV6A 3SISA 3V0AB 1OF3A 1HB3A 2QUOA 4FTEA 1NCRB 5F1RA 3CJIA 4MHRA 2VMCA 3BTXA 2Y8KA 1MQTB 3G7DA 1S55A 1DCSA 4FXGB 1FT9A 5T50A 2BWCA 1J59A 4IW3A 2CWSA 1DGWA 3MIEA 5T54A 4PLOA 2D93A 2ARCA 3WDWA 4YSFA 3BPZA 2VZPA 3IM0A 3MV11 1UPSA 4I2OA 1RXGA 4DXSA 1YJKA 3WLUA 4BQ4A 2VBPA 1MEC3 4JC1A 5FZEA 5AC93 1UWWA 5IK7A 5CIRA 1YQ6A 2MEV1 3OTFA 3ELNA 1WUVA 3WDUA 3IWZA 4UYBA 3O12A 1UXXX 2V72A 4JDMA 1RUD3 5DDJ3 1ND2A 4Q1RA 2OIIA 1Y9QA 2VULA 3C7GA 2PAKA 2XQRA 1HN1A 3VKNA 4DINB 4RGKA 1JODA 4PQ9A 4ES9A 3TEZA 4QU2A 3H8OA 3GHNA 1UZ0A 3S6PA 3TN92 1G6NA 2YGLA 4LBOA 1N1YA 4MGQA 3PIGA 3USSA 1EUUA 3WNNA 1FMD3 1HRI1 1KFUL 4URTA 5GKAC 5EPAA 5L7OB 3PVNA 4LBQB 3AP4A 3G6JB 2UY9A 2OX0A 2ET7A 4R9CA 4WM8C 4XFBA 1AL21 1W2UA 2YU1A 1OSGA 1COV3 4K9SA 2ZX2A 4I0WB 1N47A 1T6GC 4CDUB 2ARAA 4QB2A 2WJSA 4FSJA 4AG4A 2GN7A 4P02B 5BNOB 3ETPA 1ASJ1 2EF6A 5FRAA 1ZZ9A 4N9HA 3FHIB 3A23A 5DZGA 4BMBA 1SQ4A 5B4NA 2ZGSA 4CU8A 1RMU3 1KGYA 1V6LA 2C9AA 3I97A 3IBMA 3GALA 2VPVA 1D4VB 4YVWC 3I2HA 2RDNA 3KD4A 1D2SA 1LOFA 2CAUA 3KT7A 4I0BA 1NX9A 4PF1A 5IVVA 2F6BA 3E5UA 4A41A 2BPA2 1QKQA 2XOMA 4CEYA 1I3HA 1LKNA 3AXEA 2RE9A 2ZOEB 4DXRA 5KC6A 1WCQA 1H4GA 1BCXA 1PX4A 1VRH2 2WLPA 3PVOA 5FK8A 3W21A 2WZR1 5FMCA 4MG2A 2D6LX 2VQUA 3J26N 3OY8A 1RUG3 4G9SB 4H7LA 3FX3A 2YYOA 3CZUA 1IS5A 4I30A 4ZU5A 1SCSA 4YARA 2JDAA 1DYPA 3TAYA 1V6OA 3D0SA 3ZFGA 3L9JT 2Z4FA 1DQ6A 3U10A 3UNPA 2BRTA 2QVSB 3NJZA 2R16A 1JZ6A 1YJLA 1VBC2 4DPNA 4PDWA 1VBE1 1PGW1 4CU6A 2E7TA 2W52A 2YBKA 1AXZA 1NE4A 1HRV3 1VIWB 1UPIA 2NLRA 2Q5TA 2VOXA 3GGLA 5DG1A 5JOZA 4CDWB 4FAGA 3FHAA 1ONAA 1OPMA 1OD3A 1W8OA 1Y4WA 2WNUC 2ID4A 3JZVA 3NL1A 3GYDA 3NV2A 3RI9A 2Z42A 3LSDA 3VBUB 3WUDA 2HWD3 4AQSA 1V9U3 3B5LB 4LQRA 5E6HA 3VN4A 4AVCA 5BNPB 1S0IA 3VBFB 4E9KA 1BLZA 2C24A 2WSUA 3K2OA 3QD6A 4X6QB 1AHSA 1E5RA 1AZDA 1PIV1 1SPPB 2BNNA 1XE0A 1H8VA 3KQ4B 3AXDA 3LDBA 4XBNA 4AVVA 2W47A 4QKNA 1M4WA 5JLVA 5IFTA 5KXBA 1UL9A 3PVBB 3ZMNA 2WQ8A 4CCLA 1VBD3 2DUQA 3VZOA 4I01A 4CPBA 4YVSC 3ZPOA 1NCQB 1RUF2 3VHOA 5GZCA 3JD73 3ILRA 4LK6A 3SMHA 5J09A 3VUOA 2WO1A 5ABJB 4QB6A 3PTYA 4AFAA 3CL1A 2MNGA 3VBRC 2OT7A 3CMGA 2P17A 4HLTA 2B45X 4HVOA 4Q4V2 5CYYA 2FCVA 4YYOA 5F2WA 2R32A 2VTXJ 3RMXA 2PTMA 2RMU2 2Q1FA 5LEJA 1BMV2 1SLAA 1CX1A 2LW8A 1O5LA 5I0SA 1HQWA 3ETQA 3KF3A 5CKMA 1R083 3ZXAC 4AQTA 2YFZA 5KWRA 1UYPA 4LUKA 1WLTA 1GBGA 1N3OA 2VD7A 3MPBA 2ZTNA 2QQPA 1N1TA 2O8OA 4AAXA 1W9WA 4BQ2A 1OD5A 1EPWA 2GC2A 5ANNA 3UJQA 2JDPA 3WHUA 3WQ1A 3ZYGA 4CU9A 3TEYA 3ZN6B 3GF6A 3GM8A 4RHV3 2WR9A 1MEC2 3WVJA 5AC92 1NA1A 2KR2A 2KM2A 3HMYA 3VZLA 1RVF3 2QQOA 4Q26A 1GP4A 3ZN4A 1RUD2 2XLGA 5DDJ2 3MW2A 4HONA 5B2GB 2E32A 4ZS2A 4D7SA 3V65A 4D8MA 5GJ6A 5FYUA 1FOD1 2UWBA 4LO6B 3VZMA 4FPGA 2ZGUA 2XHNA 2CNAA 2BBVA 1XXNA 2EAKA 2OPWA 4N53B 4ONUA 4Q2FA 4WM7C 4ITCA 3AKQA 2KXLA 4ARXA 4DXZA 3DCQA 3E97A 4QX3A 4Q4Y1 1DP0A 2A7AA 4RS5C 1FMD2 3L2YA 3U0ZA 5JXGA 2HYXA 2IXHA 3HNBM 5FZ3A 3K75B 4FFFA 3SCHA 3THTA 3ZX7A 2JG8A 2X09A 2Z79A 3KF5A 4Q0UA 4QDSA 2WZPP 4DEVA 2JIGA 4QPIC 1WW5A 5F6KA 4CXWA 2VUCA 4WVMB 4GMP0 1COV2 3SLIA 3PMSA 5CFDC 2DCTA 3VD4A 2H0VA 2XWBB 2D40A 1SZBA 2XJQA 4WZCA 5EQUA 5IVJA 1RUE3 2G19A 1LU2A 3A4UA 5DG2A 3SEPA 5FR3A 2VR4A 2YMZA 1C8M3 4UI9L 1C1FA 1WCSA 1RMU2 2KA3A 3AMNA 3HBZA 1RXFA 3NV4A 5F5CA 5FP9A 2VZSA 1LECA 5JOWA 3R4UA 5FUNA 5BNNB 3ME2A 4H55A 3ZPYA 1QDCA 1X9TA 1O5UA 5FY8A 1UOFA 3T4VA 4BXSV 5KXCA 1X50A 3R4DB 2HEVF 3SKVA 5FMOL 1JW6A 4CVUA 3MBWA 5FMBA 1RUOA 5CEHA 2BFUS 4GJZA 1W2OA 1I5PA 2NMOA 4CDXC 3VD9A 1LOEA 2GNDA 3AYCA 1H6YA 1TME3 2HEYF 3GCXA 1CN1A 3AX4A 3O0XA 5H9RA 4PIZA 2EALA 2JICA 4A7KA 4B4RA 4BB3A 3AYDA 1JZ7A 4UFMA 1SFPA 1UY4A 3MHZA 2VCCA 1XJAA 3UETA 4HK8A 2G9GA 4MYEA 1F4HA 2PMWB 2B5HA 4M3CF 4EQVA 5JPMB 3HOBA 5IAVA 2GC1A 3UKTA 4NHLA 2C0ZA 2AENA 3OGSA 5D8AA 1AR63 1HRV2 3F95A 3VBRA 2Q4SA 2VNOA 4RGGA 3LEKA 4ET7A 2XVGA 2VZ3A 1HXS3 4OYUA 4IEXA 1L7QA 4YWAA 1O91A 3WG3A 2HWD2 2C6SA 1V9U2 2WRAA 3T09A 2NQYA 1OT5A 2WUHA 4N7UA 3NW4A 1QF3A 2YV8A 3VBSB 3PU3A 4KG0A 5F37A 5JVVA 2BNMA 3CJIB 5A7SA 4WBBA 5FXVA 3UKNA 4QQPA 5FDBA 5FPZA 1PVC3 4Y5Z0 4M01A 4N7IA 3OSDA 4LHKA 2FDKA 2W9XA 5FTTC 1CAWA 5CB7A 1W06A 5FZMA 2LM3A 4R4XA 4GQ7A 3AMHA 2EXIA 3JD72 2JB8A 4W4ZA 5FY9A 1GLHA 2VCBA 4YVSB 3THDA 1SG3A 4CUGA 1ZA7A 2E51A 2FQPA 3SNMA 2Q0AA 2I2SA 1H30A 2W68A 1A34A 1DQ1A 1OKQA 1CIWA 1RUI3 4AOCA 5J7MA 4CCMA 4LUMA 5A1AA 4QMAA 1ND2B 4QPGC 4GH4C 1QQP1 3NNGA 3LSEA 1U0AA 5I0UA 2DFCA 5C8CA 1B09A 1NYWA 1R082 1KDKA 1PMHX 4RS5A 1AR93 2WO7A 5A3NA 1JTZX 3GBGA 2DCYA 2W94A 1YQ8A 5LW9A 2OVUA 4QHBA 1A8MA 1RHI1 4D7TA 5H9PA 2D6OX 3DECA 2X5IC 3AZZA 4QPIA 3RZHA 3LIHA 5EHDA 2PA7A 2Q30A 3A7QA 3DXTA 4TN7A 3K51A 2OPKA 5CFDA 4RHV2 4AEMA 4ASLA 2VH9A 1NCRA 5C70A 3LEIA 4TWTA 3WCRA 2G9FA 1RVF2 1MQTA 1Q8QA 2PLV1 5LA0A 2CWMA 2PAEA 1KEXA 1PGL2 3WINE 1W6PB 1CAVA 3H50A 5KHGA 1AYM3 1IG3A 1US3A 2GAUA 3WG2A 4ZU7A 4CXXA 4ASKA 3AMMA 5E1RA 4CUAA 4S2GA 3BTAA 1D0HA 5E8AA 2ZHMA 5JI9A 2AR6A 5DXDA 5C8WA 3BU7A 1HW5A 3I8TA 1NQJA 2WAAA 4ZU4A 5IK8A 1MZ6A 2A6ZA 3T2QA 3ZYJB 3J4UH 4JCKA 4MO3M 1W6NA 4M0HA 1J3QA 4CDXA 1PNGA 2JG9A 4LE4A 4S2DA 1W28A 4P9LA 3I2JA 4MH0E 4LKDA 4EV0A 5BNQA 2A71A 3KMHA 1GICA 4P5HA 5FJKA 1EYBA 4PF5A 4Z1VA 3RZJA 2GH8A 4LXLA 4BU2A 2A6WA 2D43A 5LBFA 2XH6A 2E9QA 3WF4A 4CEYB 3NRUA 3MDPA 3NJVA 2VMDA 2PXJA 2VJXA 4WVZA 1BVVA 4C1XA 1A6CA 2VZRA 3I7DA 1RUE2 3RYRA 1PM7A 1YHFA 4YGBA 3VV1A 5E16A 4HKWA 2Y6GA 3ZFGB 4MSVA 4LBQA 4FO9A 1JBCA 1LCLA 1R1A1 4Z92B 1JYVA 2DTYA 3I59A 3K48A 1WLCA 3SCGA 2EXJA 3HD8B 4BQXA 5LB6A 1VAKA 3LPGA 1YIPA 4UFIA 1U5XA 3RYKA 2VUJA 1K45A 2GNMA 3DUIA 5GLVA 4RR3C 2P3KA 3IMNA 1AUYA 2A6VA 4JRAA 4A45A 2DBIA 2HWB1 4COUA 4XQWA 4Q29A 5BNOA 2BGPA 1UW8A 5C9AC 1XQNA 3VBOC 4WV8A 1S0JA 3ZFEC 2DU1A 2BUKA 2VW2A 2BJSA 1DBNA 1TME2 4YM2A 5M0TA 2WLQA 3DGTA 3IDCB 5HCFA 2ZAHA 5CNAA 1V6JA 1J3RA 2R0HA 3RYPA 4NPLA 3DEMA 1MS3A 3J7MA 4RFT0 5EJ3A 1JZ8A 4OULA 4AQ2A 1HV1A 2GMMA 2ZEXA 4K40A 3ZOIA 4Q4X1 1PO13 1YEWA 4OHXA 5KHKA 4HFSA 4Z82A 3EO6A 4XF0A 4AEKA 1CR7A 4JVAA 4QPWA 5J3UA 5HCHA 2OXBA 4FP2A 4OI2A 4PQQA 1WBFA 4TZDA 2GC0A 3N4MA 1H1AA 1SDDB 4FVVA 4DO0A 1AR62 4Y1XA 4RSUA 2J1TA 4Y4RA 5BUVA 3VDCA 2JDYA 3O14A 3H8RA 1HXS2 1O59A 2XKPA 3MIDA 4IE4A 4ARYA 3R6SA 5DAWA 4RD7A 3ABZA 3EB7A 4LT5A 1OPOA 4JAAA 1ASJ3 1OFNA 3GZUC 2A73B 3H7YA 4BZ4A 4NRPA 5L19A 1ZZ8A 2GMEA 4XTMA 4BQYA 4BQ1A 4OUMA 3Q8AA 4LORA 2ZKNA 2RS11 3OYWA 3EBRA 2W1UA 3RMYA 3WDYA 1GSLA 3RZGA 2XJSA 4C0BA 2PN5A 4Q27A 2ZMKA 2W1QA 3ZYIB 3JBG2 5ACA3 1PVC2 2RR11 2ZHNA 1EV12 4TYSA 4AZZA 1DQ5A 1C1LA 1Y3TA 2JEMA 3HNMA 3VBUA 1G9FA 1LESA 2D6KA 3GZEA 3KSCA 2CHHA 4S2HA 4V2WA 1V6IA 3LZZA 2WFPA 4LULA 2VCAA 1FI2A 1SPPA 1RUC1 2WZR3 1FNZA 1LGNA 2KD7A 1QJY1 5FZ0A 2E6VA 3THCA 4XJWA 1NA1B 5FZ9A 4LHSA 3I2DA 2K2SA 4KG8A 1JOBA 5LEKA 3ECQA 4GALA 1RUI2 1W8FA 4XJ9A 1OC1A 5CADA 4HN1A 3ZSJA 4QX7A 4LO7A 1NCQA 2HWE1 2WYFA 4Y1YA 4JZRA 4RYDA 4DZGA 5CKNA 3V64A 3W59A 1TNRA 4PIYA 4YVWB 1AR83 4GJYA 3ST7A 4DY3A 5KHIA 1YFUA 4R4ZA 4W8JA 4BIFA 1JYWA 5FPAA 4A7YA 3D8CA 2Y26A 3CNAA 4XFIA 3UGFA 1TMF2 4BQ3A 5FO8B 1DQ0A 1RTVA 4EZHA 2GNBA 5FZAA 2JE9A 4JHTA 3SC7X 3AFGA 1KD7A 3IN9A 1PIV3 2VW1A 4V2VA 1QXPA 2J7MA 2WT0A 4RA0A 5D2AA 3FUOA 4E8CA 4Y33A 5LY2A 4FTBA 4UFLA 5B4XA 1S0BA 2XLFA 3VHNA 1Y7BA 3IT8A 3P3NA 4XZUG 4G3YC 4AQ6A 3J7LA 4NN0A 1PZ7A 1AYM2 1GOFA 2JE8A 2Y6HA 4QQLA 2BVVA 3WX5A 5FREA 2D97A 5LK5A 1N1VA 1W6QB 1AYN1 2R043 3LAGA 4N43C 1C28A 2QCSB 1PVXA 2AGSA 4P00B 1LENA 4RR3A 5KHHA 5JOXA 3K3OA 4JV4A 4DY5A 2WNUB 5F5IA 1HB1A 4A6OA 5C9AA 1Z78A 2BERA 1F15A 2VO5A 4A4AA 4XMIA 4ATFA 5JXJA 2CGPA 3BIWE 1SFNA 1UX7A 5DAPA 3ZIWA 5EYYA 5DUWA 1W8ZA 4M3CE 2UURA 5DZFA 1ZBA3 3FUQA 3LPFA 4IQPA 1SDWA 4N53A 5FZ8A 2GSYA 1DFQA 4O65A 1IQDC 3N9PA 4M4RA 1LODA 3WF3A 2IXKA 3BKZA 4OI4A 2Y6JA 4QQ2A 2XJTA 3TWIA 2SLIA 2YPJA 1UKGA 4CU7A 2RJ2A 3PUQA 4GWIA 3WEZA 1HDKA 1R091 1VBB1 1C57A 5LK7B 3M3OA 4WVMA 1O8SA 1IGOA 3POSA 4IGOA 1QGLA 1VRH3 2HWF1 2UYAA 3DYOA 4IXLA 3SH5A 1VRBA 3VBRB 3TB0A 3S5QA 5JR2A 2XKOA 3EHKA 2QQVA 4LA3A 4MZUA 3I2IA 3RPQA 3J9SA 3QH7A 3TYJA 5AFEA 4CCCA 4BIOA 3N9QA 4OZXA 3CLPA 4P9GA 5HCBA 2I07B 1NY71 2OA2A 5K8SA 3WXPA 4NHKA 5F39A 1I5ZA 5ANQA 2YG0A 4PBPA 3JU9A 1UY1A 4FOQA 4JTOA 1Q43A 1PO12 4JGYC 4WVWA 1URXA 3ORJA 5JCTA 2UWAA 4OHWA 3OGRA 2B42B 4FPJA 1QH6A 5I93A 3DYMA 4YW5A 2XWJB 1XBFA 4LKFA 1POV0 1G9AA 4ZZ5A 4COWA 3QACA 2ILMA 2Y6LA 4LNVA 3NKGA 3URFA 2PHWA 3KLSA 3AJZA 2A3WA 4XF3A 3U78A 4LBJA 1ASJ2 1XE8A 3O7OA 5C6CA 3CDZB 3ZN5A 2RJKA 3D5OA 1UOJA 4K7JA 3WG4A 1ENQA 3POFA 1S0GA 2HYKA 4UW3A 5FZGA 1DG6A 4WM7B 4CUCA 5ACA2 1VAMA 2JDKA 1JHNA 1TQ5A 4RS5B 1J58A 1W2NA 2TEPA 3IIIA 3MF6A 4KH9A 3D82A 4H3WA 2VQ0A 4FTSA 2WFF3 1CZSA 2QQJA 4QDQA 3SITA 2YC2A 4QPIB 4B8EA 2VMIA 2C5DA 2WZR2 3ZYFA 3HT2A 5CFDB 3B3QE 3M7AA 3VBSA 1QY4A 3AP9A 5FZCA 1ZBE1 5FY5A 4ASMB 5CZKA 4UAPA 1EY2A 5HI0A 4YGDA 3C7HA 1GQGA 3E6BA 3T1LA 2QTWB 2VE1A 1H2MA 4FFGA 4KWUA 4BA6A 4DRVA 4BMEA 2CSGA 1FV3A 1CAVB 4N43A 2DDUA 4DNYA 3QH6A 1PGW2 1W2TA 2VTFA 4GB31 4HG6B 5A7NA 1MZ5A 1O3RA 4YVSA 3S0MA 2YZ4A 3ZLIA 1AR82 2FBEA 4LBKA 4C0HA 4JQTA 2OYZA 2HH9A 4Y5SA 1IZ3A 1HB2A 1S0DA 5A3WA 1JYXA 4ISQA 1EAH1 4MGSA 1W9FA 2VNVA 3N9MA 1W6NB 4CDXB 1ND3C 1Z7S3 2V09A 2WZEA 5FYCA 1G7YA 1LHNA 1YWKA 2JG9B 4YW6A 2PHTA 1PIV2 3BALA 4IV3C 3HVDA 3O5SA 1QXRA 2DU0A 3N7MA 4QHOA 4D94A 4IE7A 3DYPA 4OUEA 3POGA 4YW1A 5GZGA 4XZPA 2QE3A 1JYCA 3Q8EA 1CVNA 1OI6A 1LULA 1BBT1 3N35A 4BLIA 2JENA 4AI2A 1G9DA 4XFAA 2R042 2DUPA 4XF1A 4XIKA 2I45A 3EMRA 4YW7A 3PLQA 3I59B 3PUIA 1W3XA 2DCKA 4EWDA 1GWKA 5J96B 1AF9A 5C4WC 3TEWA 3ITQA 2R063 5IYYA 5LASA 4P9WA 1W6PA 2LUWA 2W1SA 3D0JA 4CDQC 5FQ0A 1GUIA 4AVAA 1QQP3 2VZUA 3AYAA 3OUHA 1QJFA 1VLNA 3P5BA 5CFCC 1US2A 1ZBA2 5FYTA 1MZFA 4XETA 4TXWA 4Y1VA 3T08A 2WA4A 4BE3A 5LY1A 4JGYA 2YFUA 1DGWX 4GWNA 2ZGKA 1X8MA 3J8F1 3M2MA 2DVGA 1UY2A 2ZGTA 3VKFC 5K0UC 2PFWA 2VU9A 3KVAA 2RG4A 1QJU1 2W08A 1F5JA 4KWJA 4NJ4A 4TLFA 3EQEA 4E4ZA 3KS7A 1CAUA 3T0AA 1BEV1 2VBBA 2D6PA 3M3IA 1CPNA 3H1YA 2VVEA 2PELA 1QJX3 2RS51 4B7EA 4E2GA 3LGRA 4GH4B 2NMNA 4QPGB 5A3PA 1CESA 4UWDA 1LU1A 5IATA 2W91A 4Y3OA 1P8JA 1IKPA 2MPFA 3DN7A 3AFKA 3OYWB 4R8HA 5F32A 1UN1A 2ZHLA 2FDGA 4CP9B 5EXOA 3K4ZA 4W6WA 5F3IA 4PLNA 4COYA 1C3HA 1POV3 4LIUA 5A1FA 4EN7B 4HVRA 4Q8KA 3OJBA 2X5IB 5FYBA 1K5MC 1DYOA 1QEXA 2UWCA 3WP3A 4FPHA 5JIUA 4AAPA 5JZGC 1GP5A 3WDXA 1UZYA 2GDFA 5EP9A 1BKZA 3CU7A 3BYWA 4GIQA 4LITA 2CY6A 4XE9A 4XBLA 5AVPA 2GMPA 3OCPA 2VBDA 3ZKYA 2Y33A 5I91A 2W39A 2UYBA 3FMGA 3MO4A 4X8PA 2DVDA 2YGMA 2XB6C 4QT6A 1MZEA 3NVCA 4P9YA 4AE2A 4NIGA 3Q8BA 1UO9A 1HJGA 1R1A3 2CGOA 2JB4A 3M1HA 4LJHA 4XPVA 4A2UA 4XJZA 1V6MA 4BJ0A 4I3PA 4Y22A 4QX8A 4H14A 3WNKA 4CCOA 1WMFA 2P6CA 1OUXA 1ND3A 1HB4A 4RL7A 1NQDA 5JXIA 2Q8OA 1ZRRA 4JGZC 2G9ZA 3S7IA 2R073 2V4VA 2WFF2 2EICA 2ZX1A 4XACA 1YUDA 5A7OA 1DZQA 1F31A 3AP5A 3LFIA 4YZ3A 1O3QA 1S2EA 3TNQA 1UU5A 1VBA3 5A7QA 1YLLA 3TN91 4CCKA 4LHLA 4LPLA 4HL0A 1RUH3 4XUNA 4BK5A 3OBZA 4Y26A 4YM0A 1HN0A 1SFYA 3VKLA 1JOJA 4Q0SA 4GAZA 1BYHA 1D4M1 4FFHA 2XVKA 1HJFA 3VD7A 3ZXLA 1JZ5A 2W3JA 5C5UA 5A70A 5JOYA 2I74A 4AHWA 4WM8A 4AI0A 4IESA 3ASIA 1PMIA 2HKXA 5D1IA 2OKXA 2RS33 3ACFA 1UOGA 2J1EA 2WS93 1Z0HA 2Y34A 3AZYA 3AM2A 3C7FA 3WF2A 2NYYA 3DF0A 3FN9A 1VPHA 2VMHA 2WABA 1GNYA 1FX5A 4RR3B 3AYEA 3GHMA 1PK6C 3B7MA 1PZ8A 3FZ3A 1PO23 4IV1C 5IUQA 5C9AB 1O7FA 2RM23 1KRIA 4GXLA 1Z7S2 1CD3G 5FY0A 4B3NA 2TUNA 4BHPA 1RINA 1ZM1A 1CPMA 3HNYM 4GA9A 4YVWA 5BPXA 4YNIA 2BZDA 2OQ6A 2RR13 4XAAA 3X29B 4DUVA 4XF4A 2VMEA 4UF0B 4IEUA 3IKWA 2QJVA 1W8HA 2W0XA 2V73A 4AVSA 3WW3A 4XURA 3BI3A 4UOJA 1OVSA 3JXSA 1UZZA 1UF2C 3KVBA 1UZWA 4OHYA 3GJAA 3LDKA 4AFDA 3R0RA 2DVAA 3WHTA 1ZZBA 2R062 2WBKA 3SQOA 5GZFA 4KWKA 2WYSA 1T6BX 2B9UA 3ATGA 1OFSA 1YC61 4LIVA 5DUXA 1VBC1 1QQP2 4CCNA 4I3GA 2GN3A 4CEWC 3RQ0A 3ZXKA 2PQQA 1W6QA 2W87A 1H1IA 3MIFA 4OUSA 1ULPA 1GU3A 1SBEA 2OW4A 2DWRA 3HQRA 2BGOA 5EWSA 3VBHC 4EYUA 1H2KA 2WNUA 3KT4A 2HWC1 2QFEA 1GNHA 3WW2A 5EJ1B 1XC6A 1UOBA 4K21A 5FXZA 1RB8G 1E5HA 4CCDA 1GKBA 4NIHA 1R1ZA 1W8UA 2CDOA 1H8TC 4E4DX 1KXGA 5FZ4A 1E5SA 2WN3A 2DBNA 3J7HA 2W92A 4OHVA 4CXYA 3RJ2X 4HN0A 4F7ZA 1W03A 4NHXA 1O4ZA 5FV3A 5GZEA 3DL3A 3LEMA 3MW3A 4W6YA 1XNDA 2VNRA 3B94A 4BM8A 2ADEA 4ZXEA 2VNGA 2XHKA 1UYZA 4XJAA 5DN2A 1QJX2 1RUF1 2WWUA 1CGPA 4AHYA 5KXDA 3NJYA 1IS6A 2EIBA 1X36A 2ZEYA 1AR73 4AK3A 4WZFA 5FZIA 5A6YA 4AL9A 3I3EA 4QM9A 2GP5A 4JGZA 3UESA 3H42B 1G86A 3HR9A 2ZX0A 2ZKLA 4Q4V1 2WIIB 4ORFA 4PLMA 3FBYA 2YY1A 4YZ2A 1FXZA 2N7GA 1OOPC 1OMIA 1OQDA 3PVEA 4AXOA 3RZKA 2YUEA 3LF7A 2RDSA 5FYMA 1Q56A 4YFWA 4EROA 1BVP1 3P6BA 1D2QA 1OLMA 2CAVA 2DYCA 2WZ8A 3K3NA 4QQHA 4C1WA 2A3XA 4DUWA 3KCYA 4M00A 3VZJA 2ZX3A 1JI6A 3HN1A 3JBG3 5T55A 3AL5A 3AVRA 5SV8A 1EV13 3RWKX 5L7OC 1H6XA 2VZTA 1W2AX 2WN2A 2RDRA 2XBO1 5L9VA 1H2LA 1R1A2 3BUCA 1MEC1 4N43B 5AC91 1G8WA 1GQHA 5FBJA 5LZ6A 1KDMA 3KV4A 1O4YA 3PIJA 4K6BA 4QPYA 3WUCA 4LO5B 1WD4A 4AWDA 4O7XA 4KI5M 4IV1A 4K1YA 2EAAA 4YG3A 4NIIA 3KGLA 4V1PA 1RUD1 1JOPA 2WNVC 3ACIA 5DDJ1 3N7JA 1IPSA 4OMCA 5DABA 4YPJA 1BXHA 3H3LA 2R072 4NRQA 4PI2A 1GR3A 1SMVA 4KU8A 1KITA 2XJRA 1ZRCA 2BGCA 4DXTA 1HLCA 3AMPA 1VBA2 3KWVA 3H9AA 2BU9A 2CGNA 3ZMOA 1RUH2 4KMQA 2P3JA 4FPKA 1V70A 4WM7A 5GM0A 2FDHA 4Y1UA 2WO3A 4HSJA 1QHDA 4Q4X2 2VAUA 4UFHA 1UX6A 3LQCA 3ES4A 1AX2A 2FDJA 1J1TA 1TMF3 5FCCA 3POWA 1LHVA 1DYKA 2YBSA 2D98A 2ZACA 3K4DA 3ZYPA 3ZSEA 4DIQA 4JDNA 3JCIA 2H6CA 1ODNA 5LA2A 2RS32 1NLQA 2WS92 2YC4A 3C7OA 3C8XA 3PUSA 5F3EA 1XYNA 4JKKA 2WNOA 2ZX4A 4CCEA 1W8NA 4COZA 1PO22 2ERFA 5F5QA 5E89A 5LBCA 3WP5A 4CEWA 2RM22 3V56A 4AEDC 3I2OA 1AX1A 2EXKA 4PT6A 5L9BA 4IEYA 1RMU1 4XDQA 5FQ0B 1RUJ3 1IHMA 1HQLA 2XXZA 3GCWA 3RRDA 3IPVA 3KHBA 1Y43B 4CDWC 4HSLA 5FWEA 1VMFA 5FO9B 2RR12 3ZSLA 4AYUA 4QX2A 3SKJE 2FMYA 4JGYB 2MHFA 2WT1A 5BNPC 5CA6A 4PBOA 5LBBA 4LKSA 3VBFC 2IXIA 4XTPA 1Q8OA 2JDHA 3KT1A 5C5TA 1FPN1 2WDBA 3S30A 3ZFFC 4XUTA 3HT1A 1QJY2 3K46A 1L7RA 1Q8SA 1RUG1 3EJKA 5F5AA 2A5ZA 1ZRFA 1DDLA 3D4KA 1GQPA 1ZBE3 1OUSA 4XEZA 4RFRB 4MV2A 3T30A 3WCSA 1BHGA 2DFBA 2IXCA 3W20A 1CAUB 3GDBA 4J6GA 2QQWA 2QDRA 5CVRA 4JQRA 5APAA 1MS1A 2JWPA 2HWE2 5FLHA 4CP1A 3LEGA 4UBHA 3RFRA 5FOBB 4HPKB 3W5MA 4LE3A 4IL7A 3USUA 3WY6A 3W9AA 3ZXDA 3RWNA 3M3EA 4OCTA 1DQ4A 1YI7A 4AFCA 2JD9A 4C8DA 2HWD1 1EAH3 2MEV3 2ZA9A 3JB4C 1IS3A 1S0FA 3VL8A 4NWVA 4CUBA 2FDIA 3TRSB 3QBQA 2JIJA 2K9ZA 2LTNA 2R1BA 5K7PA 4L8QA 4IEOA 2BBAA 4CTEA 1LJ7A 3IB3A 5FZFA 1NZCA 3PTRB 3AKTA 4LA2A 4KGQA 3CF6E 4OI1A 1REEA 3BTZA 3VDBA 3O0VA 2BFUL 5FP3A 1VBD1 3E1F1 3AB0A 4NE9A 1A8DA 3U11A 4A6SA 2PHFA 3IDEA 1VMHA 3IMMA 5C33A 1KQRA 4MGTA 5LRRA 1HRI3 3JD71 3AMQA 3ILFA 5EZWA 4IEWA 4PHZA 3I2GA 4NAOA 1FV2A 1AR72 2NZ9A 4GWJA 2OS2A 5JPNB 1Q3EA 3GBFA 3WT3A 2BOIA 1ENSA 5J36A 1AL23 5FO7B 1FNYA 4SLIA 4Y22B 2VUDA 2J1AA 1SCRA 2XDVA 3ILNA 5EJZB 5FYIA 2BW8A 3LE0A 1RYYA 1ND3B 4XW3A 1GWMA 3T3YA 2QZ2A 1VR3A 1C4RA 4QPGA 4GH4A 1YQ2A 1Q8PA 4IV3B 4BDVB 4YZ1A 3ZO0B 2GU9A 2CYFA 4PIXA 1ULDA 1RJ8A 4L99A 1QOTA 1MS4A 5I8SA 4CP9A 1C8NA 2VC9A 2IVIB 2ZAAA 3A21A 2WQ4A 3A0KA 3ZVXA 1AL0G 3VDDC 1ZX5A 4D3WA 4FOVA 1KS5A 3BTYA 2X5IA 4HMZA 3GZAA 2IWGB 3H7JA 5A3UA 3WW1A 1ENRA 4RHV1 1X7NA 3QOPA 2X05A 4QGMA 3RS6A 5J48A 4D7YA 3B93A 2Y6KA 3WSOA 5CG8A 2VL4A 1RVF1 1EP0A 4LR4A 4WM8B 3KV9A 1K42A 2J1UA 2QBXA 3RZMA 1PGL1 4Y20B 2H0BA 4XAEA 4UFKA 2ZGPA 4ZPIA 4HANA 5FZ7A 1F9KA 1UAIA 4AEDA 4CP0A 5HPOA 4XFHA 3SEEA 3B00A 5FUIA 1CZTA 4CDQB 4Z2AA 3POIA 2X53S 4L9BA 1BJQA 5FAXA 1UD1A 2B46X 5C3QA 4YGEA 3POBA 4H7MA 2C1FA 4TLGA 2HJIA 2XL9A 1OH3A 4N90A 4DQAA 1NY72 4KWLA 3OF1A 1G9BA 4K8RB 4YM1A 3T1MA 1VBE3 4X6RB 2R7EB 4B4PA 3DKQA 2O8QA 1JHJA 3M4FA 4CSWA 4QKDA 1KJLA 2JD4A 1ULCA 2D5HA 2VXJA 3B9IA 1GZWA 3B01A 3ROUA 2VCMA 1OA4A 1UNBA 2J1RA 5F7UA 3DV8A 1AXKA 3A0NA 2E7QA 4K8FA 5K0UB 2EXHA 3GJBA 1LGCA 4N8MA 3GZTB 1XYPA 1WMXA 5FFOC 2AREA 5I0RA 2V4AA 3POEA 3BIEA 5IVEA 4FCAA 3ZR6A 4MGYE 3MLLA 1HIXA 4D0QA 1C8M1 2VZ1A 3KM5A 2D6MA 3FBMA 4NMIA 5G05L 4QHZA 1OVPA 4XOGA 1CZVA 1DQ2A 3B69A 4F3JA 3S7EA 5A7WB 1RJ7A 2RDQA 2R0FA 1RUJ2 1GP6A 1VMJA 2JDMA 3VKOA 4BLJA 2L9LA 3WQ0A 1AJOA 2NP0A 4URAA 4ZS3A 4DUXA 1VB4A 2VOWA 2P3IA 2YHJA 1YXWA 2YXSA 4GKYA 1WW7A 4OHZA 4QXBA 3I3BA 2Y64A 4P14A 3K77A 2F4PA 1ZRDA 5CAZA 3LA3A 2PHUA 1F35A 1K5MB 2GH2A 3OEBA 3RI8A 3I3DA 1UYXA 3VBOA 3OGVA 3IIAA 3ZFEA 4QKBA 3RVHA 3SHRA 1HQNA 2QQIA 3LD8A 2CU5A 5FJHA 1DLCA 1SLTA 1V0AA 3VZNA 2JXAA 1OBNA 1ZBE2 3UKVA 5A80A 4P5YA 3AZVA 1D4M3 2A6YA 1GZTA 2IXLA 4UF0A 2Y0IA 4MOAA 3VHPA 1U12A 1MS8A 1I6XA 1ZZ6A 2NM1A 4BQWA 4FOWA 5A7PA 1AR61 4AI1A 5A33B 4DMIA 3RNSA 2ORZA 1VALA 4L97A 4RQPC 4YW3A 4MXWB 4DS0A 2K46A 1WGPA 4FPCA 4NUBA 4Q4W1 2O0OA 2MEV2 1EAH2 3ZDSA 2VM9A 3BOPA 1WMDA 3AKSA 3OGGA 4JGZB 4DB5A 2PQSA 1TE1B 2PYTA 4QU1A 4DOUA 2D5FA 4FQ4A 4EWEA 3ACHA 5K9YA 4P9XA 3SH3A 1ZZCA 1W6MA 1TNFA 4MXVA 1FOD3 1V6KA 2ZEZA 4ISRA 3M3QA 1U5IA 4IUGA 4LOTA 4R52A 3PDQA 4XDPA 3LA2A 2W2IA 1PVC1 4PCRA 2YROA 2A3YA 1OKOA 5A6QA 5FMDA 3VHRA 5FPLA 2P1BA 3CZJA 4HETA 4Q4Y3 3J7NA 2XUMA 4QD2A 1HRI2 3BCWA 1QMJA 1VB2A 4YRDA 4CZSA 4XFCA 2BOJA 4Y1ZA 1WBLA 5DQ0A 1IS4A 1J1LA 4EE2A 2Z2SB 1XOYA 1AL22 4XUOA 4OI0A 4MGKE 4XBQA 2VECA 1CONA 4LLOA 2OQ7A 4CE8A 5FOJB 2FDFA 1S1AA 3WD5A 1RUI1 4IV1B 3UGHA 3ZYHA 4ATEA 1DHKB 1KS4A 3BU0A 3ZR5A 2TBVA 5FY4A 5H9SA 4XDOA 4AVTA 4FOYA 1SACA 2E7AA 3WP4A 1NOVA 2VOVA 4FXKB 1YYNA 2DURA 2Q8EA 5FZBA 1AR91 3ES1A 4MADA 2IZWA 3IZOA 2HWC3 3K4AA 1LOFC 5F6LB 2RVAA 5I8TA 3ZYBA 3MEPA 3LIGA 1O4TA 4NIDA 1MACA 1K12A 2EVXA 4WVVA 4XILA 4OQ8A 5LA1A 1NKGA 1WCUA 2NPIA 4Z8BA 1WA4A 5JSPA 1OLQA 3HJRA 4P9JA 3WG1A 4B1MA 1W8WA 1MS9A 1PGSA 2BVBA 3CO2A 4E27A 2Y6FA 3R05A 4FQZA 1AYM1 4R9BA 3N7LA 3NV3A 4NO4A 5HXVA 2ZGRA 5FZ6A 3ZFGC 1YCIA 2E63A 2QQUA 4CEWB 3SXWA 5DAXA 1MS5A 1Y9GA 2C26A 3CKHA 4D69A 4U2AA 4PDWC 5GZDA 2YPDA 4XCAA 1YRZA 2AYHA 1VBE2 2XR4A 3RGBA 3WNPA 3VBHB 4ZHNA 4CYDA 3UV9A 2VUAA 1ZREA 2Z5WA 3IPVB 5IVCA 1GYKA 4GMP1 1H0BA 2UY8A 2XMLA 3W58A 2GNTA 3KGZA 4IGQA 4AGRA 4JTNA 5HV4A 3FHQA 4BQ5A 1CX4A 1H8TB 4XQDA 3GNEA 3MPPG 1SBDA 4E2QA 5BYNA 3A22A 2RJLA 1OA3A 1NXMA 1ZRIA 2H6BA 3VB9A 3N36A 4LBLA 3H8UA 4META 1GV9A 4YGCA 5F8PA 2ARBA 3WR0A 4EWAA 2J22A 2ATFA 4Q0PA 5LA9A 3DKWA 1UIJA 1REDA 5IWFA 4TSVA 4K1ZA 1GOHA 1LEDA 2R30A 2XBO3 2VTXA 3O1TA 5T52A 4RQPA 3I2KA 4HBNA 1BQPA 5JWPA 3BGAA 4NPMA 3PU8A 2P4EA 4UBGA 5C71A 3DXUA 3USUB 4BYYA 3LOBA 3PURA 1SLIA 5A3OA 2A70A 1WLWA 3E6CC 1GZCA 5C7GA 1OOPB 1R64A 1WA6X 2TNFA 2JDZA 1F2NA 2AZ5A 3NKTA 4IEZA 5KXEA 3O1MA 3MIGA 1L3JA 4FT8A 2W46A 5HBAA 1D4M2 1PO11 1TEIA 1BK1A 2O14A 3VD3A 1APNA 1OQ1A 3RDIA 1OLRA 3LCPA 1O8PA 1YFWA 1RHI3 2CTVA 2DV9A 2QQMA 2WKKA 4M4PA 3ZM8A 5IAXA 4XJUA 4YG6A 3T2TA 1E5IA 1GFF2 4ZKTB 5ERLA 1DU3D 2JECA 3AJYA 4Y4YA 1NA1C 1XNKA 5D21A 2A75A 3NQHA 4B1LA 5FPUA 2WNVB 2G1MA 1POQA 2PLV3 1JXNA 2OUHA 4RN5A 1SLCA 2AC1A 3H3ZA 3ZSKA 4E4SA 4KBZA 2BNOA 3FL7A 3WF1A 4F83A 1UMZA 2WQZC 4L92A 2Q1ZB 3OBAA 4IEVA 5FMOS 1FOD2 4HPKA 4Q5OA 4QX5A 3LDRA 4UW4A 5C3PA 5IK4A 1VJ2A 3UT0A 4BCUA 1X8EA 4KQ7A 5A6XA 5ACA1 1OF4A 5C3SA 1OH4A 3BB6A 1QH7A 3KZ4C 4CA9A 2ZZJA 2QKDA 4GD4A 4P08A 1LOAA 4Q4Y2 2ZABA 2DTWA 2UU8A 4XHBA 1FPN3 4FPFA 2JG8C 4JX0A 3L2HA 3O1OA 1GNZA 4C90A 3O1PA 1RC6A 1UU4A 3ZDVA 5JMOA 3SCFA 1NE6A 1D7PM 1W9TA 3NNJA 2HLEA 3U14A 2D7FA 3WQBA 1JU3A 3DPRC 4CP2A 3IAPA 1QJEA 2ZBJA 2JX9A 4AEDB 5J1XA 4FFIA 2D3PA 4AEJA 2JE7A 1GWLA 3NNMA 1AR81 2WT2A 4LHNA 3OD4A 4O9EA 4JRLA 2HWC2 1ZVFA 3RG0A 3P1IA 3ZXGA 3O1SA 3WDVA 5IK5A 1QDOA 5A3LA 1ZYBA 2AACA 2IUWA 5GLZA 2D3SA 2GZWA 3S57A 2J1SA 2HWB3 4MVTA 2FD8A 4W6XA 1VP6A 4IEQA 1LOBA 1GZWB 4HZFA 4B7KA 1IPKA 1WZXA 2XG3A 1LOCA 3ZFFB 4IV3A 4COVA 5JDBA 1DGRN 2WNEA 4BISA 1XSQA 2B7YA 3BOWA 3V0BA 5ISLA 3PHMA 1H9PA 1QIQA 4AHXA 4AI9A 3O1RA 1O3TA 4OLLA 2BP6A 3LA7A 5FZOB 4R9DA 1W39A 5T5OA 4QB1A 1Q5OA 1XNAA 3LOIA 4MLOA 5IW0A 3I4IA 3HBKA 2IVJA 3T0BA 4M3CB 2R041 3KV5A 4KNCA 4MHUA 4Q4X3 2Q1MA 4F8AA 1JUIA 1LTEA 4E4HA 2EA7A 2WWSA 5JAXA 4XMAA 1J84A 2D3RA 1YQ5A 4XIOA 3INAA 5D8AC 1B35C 1XYOA 2EIDA 5A32A 4Z2WA 2FZ2A 1NUKA 1NZIA 3NV1A 5C4WA 5FZLA 4Y20A 2AUYA 1LRHA 1XU2A 2XQXA 4CDQA 3NAPC 1YFYA 3NNFA 2VMGA 3BODA 2W5FA 3VBOB 3HAGA 3ZFEB 3NNLA 5TSWA 1S2KA 1PM4A 1ZBA1 1IKQA 2RS13 5CFCA 3I3MA 3MUZ1 1X82A 2JDNA 2XLAA 1VE0A 4CRQA 5FZKA 2VVDA 3KB5A 1AJKA 4C91A 4QXKA 1WW4A 5IJRA 3AP7A 3E6DA 4Y5TA 2FCTA 3N3HA 1OHFA 4AFBA 2XBO2 4BH9A 3FFZA 4INDA 4LBNA 5DAQA 2V5DA 1LGBA 5L9RA 3ZYRA 3D6EA 2X29A 5K0UA 4BK4A 1MR5A 3HQUA 4EJRA 1VRH1 2P34A 5GLWA 5KBFA 4AF9A 1RUC3 5EIYB 1CIYA 1DGLA 1QJY3 5C3OA 1RGSA 3MICA 4FI9A 4A42A 3Q8CA 2DCJA 3FLPA 4EZ4A 5FP7A 4GKXA 3ZKUA 1PMJX 5IT6A 1ODMA 1LR5A 3MIHA 5A7WA 5C3RA 3H1MA 2HWE3 3JUUA 3I54A 3IAQA 1XPWA 3U4XA 1W6MB 5C8CC 1NLSA 1DIWA 1QXJA 1UMIA 4LTAA 1TVGA 4EN8B 1WW6A 4JKLA 3LWCA 3OG2A 4OFGA 4QDRA 1QU0A 2HEWF 3VDDB 1CWPA 1W99A 1YI9A 5JI7A 4Q0QA 1K5MA 3FLRA 1IG0A 4XJ8A 1H4HA 1RHI2 2W1WA 1DF0A 5JZGA 4NVPA 1F5FA 1YQCA 4A7ZA 1TG7A 1XNCA 1W90A 4B4QA 3T0DA 2D6NA 1NCRC 3DPRA 3NWKA 5F3CA 2E33A 3BVCA 3ACLA 1MQTC 3AKPA 4NPRA 2PLV2 4M0NA 3PJYA 3WNXA 4QXCA 1UCXA 4YW2A 1WCKA 1OXCA 3CHXA 1WMEA 1JZ3A 3TBDA 5J37A 2ZMLA 3ZXJA 3HEIA 2ZGOA 4QM8A 1IPJA 4XQ4A 1PX3A 2PHDA 4OMDA 4AI3A 5CISA 1HV0A 3KQRA 5A33A 1FATA 1S4CA 1AYN3 1W3VA 2VQTA 4KGGA 1CAXA 4KL1A 1QNWA 4MXWA 5I8YA 1ULOA 1ULEA 4XF9A 2R49A 4AVBA 4IDZA 3M8LA 5LBEA 5K4LA 4QXHA 3O1VA 4QQOA 1J3PA 4XHXA 3VD5A 1ULGA 2WFF1 1W6OB 2E53A 4J1XA 1JZ2A 5DUVA 2JG9C 3HN3A 4IERA 1FPN2 5FP4A 2RMU1 1XNTA 2GALA 4Q1PA 2C4XA 1BMV1 1UMHA 3ZSMA 1RUG2 2QQLA 4CPBD 3S5AA 5FPBA 2AH2A 1XB9A 4NR1A 4OQ9A 3FE5A 2AEZA 3AC0A 4DEQA 2Y60A 1LHUA 4H2AA 3FLTA 2D44A 1T2XA 1S0CA 1EPZA 2PHRA 3MIBA 4UT5A 4DRRA 3I49A 3FC0A 5DZEA 1B35A 4FAHA 2Y0OA 5FXWA 1R093 1VBB3 2V5YA 4Q4W3 5IVYA 2VVFA 3MUY1 4QGLA 3KCXA 1PK6A 3NAPA 4O9GA 2HWF3 2PHXA 4CDUC 4NRMA 3H1WA 1Z7S1 3P3PA 2HWB2 5BNOC 2O1QA 4BWOA 3MGUA 4MGIE 4KU7A 3LKJA 4HT1T 1STMA 1SLBA 1V6NA 1FAYA 2VY0A 4GULA 1UZVA 4LLFA 3MLJA 1NT0A 1SHWB 3N9OA 4J1WA 4LOSA 5GLTA 5CG9A 4YZ5A 3OOXA 1JU4A 1O6UA 3EXUA 4HKOA 1VBD2 2XJUA 1QJZA 2FCUA 5I0DA 4MUVA 4I0AA 1FMD1 2QQNA 2BDRA 5LCWL 4NWWA 5CKQA 4FPOB 1A3KA 2OZJA 3WZ1A 1UYYA 3U4SA 2R6QA 2ZGQA 4XUQA 1DGRA 3MFCA 1SLLA 1J83A 2DVFA 2P3YA 4RQPB 4XFGA 3I2FA 1RL3A 1COV1 4HXCA 1YNAA 3ZXEA 4AI8A 4R9AA 1YO8A 2R061 4UFJA 1W0OA 4YM3A 4TTGA 1OLME 4L2NA 3OBTA 4B29A 3UK9A 4D6QA 1S0EA 3IDAA 5HXMA 1WD3A 4LKEA 1UU6A 2RS12 5T5LA 4K3UA 1F4AA 1I1EA 3VBHA 1NAEA 1W9SA 1XSRA 5KR7A 4ZONA 1QWRA 1NXD1 2B4KA 4W50A 1U5YA 1DZRA 4QGNA 3C2UA 2QDNA 3VBUC 5A1LA 4XVHA 2VZVA 2DUOA 1VAVA 2SBAA 4ZY9A 4NOTA 2LALA 2ZGMA 1H8TA 4XXPA 3U37A 5GALA 4ZXKA 3CIHA 3KV6A 3PUAA 3SH4A 5KHJA 2VW0A 3W5NA 1C5HA 3HPNA 3UGGA 1RUC2 2YC0A 2K0GA 1I9RA 5FKBA 4BPZA 2GC3A 2LRPA 4Q0VA 1QJX1 4P9IA 3WNLA 3OEAA 4K20A 3MF9A 2JKXA 4UW5A 3R4SA 3AL6A 1ALYA 3OUIA 1W04A 5FYSA 2WC2A 1NCQC 1JMUB 1X33A 2XONA 1HX6A 1H2NA 2BWAA 4I02A 3AZWA 5A6ZA 5A3TA 4GB33 1POV1 2P5BA 1HRV1 5L73A 3LFMA 1UQXA 3ZXFA 4GMP3 5F2SA 3UJOA 5ABJC 5IFPA 4YG0A 1JYTA 4PJYA 3ACGA 2YB7A 2X10A 3CQOA 4UW6A 1V9U1 4PI0A 1NLRA 1OOPA 2ETEA 3CEWA 2P6HA 3H0OA 5FZHA 4HVQA 1IQAA 2JKBA 3BPSA 3OPWA 3JQXA 1BK0A 1UIKA 3OY8B 1LHOA 1KFXL 5FKCA 3RZZA 3U75A 2AEYA 1W0PA 1C8M2 4QX0A 3WNOA 4LO8A 2RHPA 4CCJA 3GXUA 5L7OA 1XU1A 5SV5A 1BBT3 5FZ1A 4S2FA 2DCZA 3M3CA 2ES3A 1DZTA 1L7LA 1XRUA 4PDWB 3OPZA 5G04L 3JQWA 4AR2A 2LS6A 1ZZ7A 1AYN2 4XCBA 4D6SA 4EN0A 5AFBA 3MZHA 1C5IA 4CDUA 4IE0A 4IGPA 2XJVA 2WWJA 4YFZA 1D0GA 2VZQA 1GMMA 1U5ZA 2WNVA 3FJSA 2E26A 2QZ3A 4LBMA 3WP6A 4ZZ8A 1E57A 2R071 3CJXA 5FLIA 2XL7A 2XPJA 3C7EA 5FP8A 3EYPA 4DFSA 2YU2A 1VBA1 2ZZQA 2IXJA 3NO8A 1LOGA 4J25A 2PAMA 1RUH1 4I09A 1JN2P 4HK9A 1MS0A 2JDUA 2Q8CA 3JB8A 2B9VA 4XUPA 4BXFA 1AVBA 1R081 4FP3A 5FYZA 2ZGLA 3V0BB 1GZ9A 4N53C 1JUHA 4RGAA 1ZNPA 5DMYA 1LNSA 1OA2A 4A44A 2GP3A 3AK0A 2PHLA 1ZA4A 1RITA 3J8F3 4G4FA 3RZLA 3N9LA 4EN9B 4IETA 2RS31 3WW4A 3V0AA 2WS91 4XABA 1R092 1VBB2 2IC1A 4Q4W2 4E8DA 4NROA 1QJU3 2WO2A 5E88A 1AX0A 1PO21 3ALQA 2ENRA 5A32B 3WDTA 2HWF2 5C4WB 2RM21 3MFAA 2J42A 3VLBB 1BEV3 1PNFA 3WOGA 3VGIA 1W8TA 1F8VA 2YBPA 2WINB 2RS53 1W9YA 5BXXA 5JXHA 4IE5A 1TZOA 4CDWA 4AW7A 2JJ6A 3OGJA 5CFCB 1WCDJ 5BNNC 4Y24A 3OPTA 5IVBA 3IDBB 5HV0A 5FUPA 1K5JA 5JSRA 5BNPA 1LHWA 2OUJA 3VBFA 2WSVA 4QX1A 4XC9A 2HBTA 3TEXA 5JR7B 2Q8DA 5DUUA 2A1XA 1GOGA 3ZFFA 1IOAA 4U36A 5AVAA 3UL2A 4AFMA 1CQ9A 3U1XA 4L0PA 2CDPA 3GBWA 3HQXA 1KJRA 3PJQA 2VOKA 4X8NA 2HBUA 4KBBA 2ZHKA 2LROA 5FZOA 2BYVE 3I3QA 4N9IA 2QQKA 2QNKA 3PNAA 1RUE1 4FPYA 5FY7A 5L36A 1O3SA 3QCWA 1XNBA 3M70A 3KCCA 4M3CA 3POYA 5LATA 2E31A 4JKMA 4EN6B 3BN6A 2VXRA 2VMFA 3ZIXA 3MW4A 1M06G 1AR92 4QKFA 5ABJA 1N3QA 4A3ZA 3H8XA 2EIEA 5I0TA 1WLDA 1UY0A 5EV7A 3E5QA 5FBZA 3LB9A 2A6XA 1LB2A 1QOOA 1FYUA 1N1SA 4O61A 5FPVA 4MGZE 4OZOA 5FY1A 3VKMA 1AXYA 5A3MA 3THPA 1ACCA 2ZEWA 5EYXA 3TNPB 4AGGA 2DF7A 1ST8A 5H9QA 3T2OA 1PZ9A 2JG8B 4LEJA 5IHRA 3NJXA 1ULFA 2X8KA 3OUJA 5JZGB 2CL2A 1MVQA 1TME1 2G4IA 3OD0A 4LBQD 5DPNA 3TN93 3VBSC 4ES8A 5FWJA 3CJIC 2VG9A 3DPRB 2F17A 2ZPXA 1SEFA 4NHMA 4NIAA 3T4HB 1LEMA 5JMCA 2ZMNA 3POJA 2XVLA 3D3AA 3N7KA 1ENXA 3ZN6A 1H9WA 3NMBA 1Y9MA 1AR71 3PUHA 4IEPA 4SBVA 5LWBA 2VQAA 1V00A 3WF0A 4OVEA 1EUTA 3ON7A 4XXAA 2Z69A 2P2KA 2BTVC 2R1DA 4GB32 4GWMA 4LK7A 4QWNA 3APBA 2ADDA 5DAVA 3CBNA 5FPXA 1DLLA 1CAXB 1WKYA 3MYXA 3VL9A 1JYIA 1HXS1 1Q8VA 3HWJA 4QAWA 2XJPA 3FWEA 5F9TA 3NSTA 1H1MA 2DVBA 2IFWA 1YIFA 3WNMA 2F4LA 2ORXA 2ET1A 5IVFA 1ND2C 3Q9OA 1MPXA 3N9NA 3VZKA 1PHMA 4JDOA 5JSOA 1NG0A 2RV9A 2XUEA 2B39A 2BV4A 3JBG1 4HKLA 3WQ7A 3VDDA 4E2SA 1EV11 2YDEA 2ZCWA 2VZOA 3VDAA 4NAMA 5CU1A 2FMDA 1BBT2 3OBRA 4Z07A 2ZXQA 1RIRA 1REFA 1YFXA 3Q8FA 2EIGA 2VOTA 4XYXA 5FLJA 5FK7A 3WV6A 2IFRA 3FFQA 2B8MA 5D8AB 1B35B 2NN8A 3E5XA 1BZWA 5FYHA 1CJPA 1QOSA 3U07A 2C9KA 4GZ9A 5KC5A 5FYYA 1W0NA 5J98B 1PK6B 4LO4B
chains in the Genus database with same CATH topology
3NAPB 5T3NA 2OZ6A 3B02A 3ENRA 5EFUA 5HCAA 2Y38A 1VBC3 4YW4A 4A3XA 5BNNA 4FBFA 2XGXA 1RUNA 1JH5A 2CV6A 4AHZA 3MLKA 5JIAA 1A78A 4Q8LA 3PMEA 4FPEA 1HKDA 2VGDA 4FPLA 1TMF1 2BEOA 1W6OA 4AGVA 3AP6A 3C3VA 3AZXA 1CAWB 3J8F2 3RJRA 3AKRA 1UKRA 1S2BA 4XFFA 2ARXA 3O0WA 5GLUA 1CJDA 4CEYC 4MX3A 4BOWA 1QJU2 4L11A 1N3PA 2ZGNA 4UXAA 2WA3A 3HIFA 3H3UA 2P37A 1BEV2 3RSJA 2BQPA 4W65A 2ZJCA 1XE7A 5T5JA 2RS52 1RUJ1 3B9CA 1RUF3 1MVEA 3QLQA 5CBLA 3MI8A 4YZ4A 5C8CB 1G9CA 5T5PA 3TOJA 1GANA 1SBFA 4Q4V3 5BY5A 2ZS6B 1QNYA 2FHRA 4YLZA 2FZ1A 2RMU3 1OQEA 5LRSA 2WL1A 5BV6A 3V0AB 3SISA 2QUOA 4FTEA 1NCRB 5F1RA 3CJIA 1MQTB 3G7DA 1S55A 4FXGB 1FT9A 5T50A 2BWCA 1J59A 2CWSA 1DGWA 3MIEA 5T54A 4PLOA 2D93A 3WDWA 4YSFA 3BPZA 3IM0A 1UPSA 4I2OA 1YJKA 3WLUA 4JC1A 1MEC3 5AC93 5IK7A 5CIRA 2MEV1 3OTFA 3ELNA 1WUVA 3WDUA 3IWZA 3O12A 4JDMA 1RUD3 5DDJ3 1ND2A 4Q1RA 2OIIA 1Y9QA 2VULA 2PAKA 3VKNA 4DINB 4PQ9A 4ES9A 4QU2A 3GHNA 3S6PA 3TN92 1G6NA 2YGLA 4LBOA 1N1YA 3USSA 1FMD3 1HRI1 1KFUL 4URTA 5GKAC 5L7OB 3PVNA 4LBQB 3AP4A 3G6JB 2UY9A 2ET7A 4R9CA 4WM8C 4XFBA 1AL21 1W2UA 1OSGA 1COV3 4K9SA 2ZX2A 4I0WB 1N47A 1T6GC 4CDUB 4FSJA 2WJSA 4AG4A 2GN7A 5BNOB 5FRAA 1ASJ1 2EF6A 1ZZ9A 4N9HA 3FHIB 5DZGA 4BMBA 1SQ4A 2ZGSA 1RMU3 1V6LA 2C9AA 3IBMA 3GALA 2VPVA 1D4VB 4YVWC 3KD4A 1D2SA 1LOFA 2CAUA 3KT7A 4I0BA 2F6BA 3E5UA 2BPA2 1QKQA 4CEYA 1I3HA 1LKNA 3AXEA 2RE9A 2ZOEB 5KC6A 1H4GA 1BCXA 2WLPA 1VRH2 3PVOA 2WZR1 2D6LX 3J26N 3OY8A 1RUG3 4G9SB 4H7LA 3FX3A 2YYOA 4I30A 1IS5A 4ZU5A 1SCSA 4YARA 1DYPA 3TAYA 1V6OA 3D0SA 3ZFGA 3L9JT 1DQ6A 3U10A 2QVSB 3NJZA 2R16A 1YJLA 1VBC2 4DPNA 4PDWA 1VBE1 1PGW1 2E7TA 2W52A 1AXZA 1NE4A 1HRV3 1VIWB 1UPIA 2NLRA 2Q5TA 2VOXA 5DG1A 5JOZA 4CDWB 4FAGA 1ONAA 1OPMA 3JZVA 2WNUC 3NL1A 3NV2A 3RI9A 3GYDA 2Z42A 3LSDA 3VBUB 3WUDA 2HWD3 4AQSA 1V9U3 3B5LB 3VN4A 4AVCA 5BNPB 1S0IA 3VBFB 4E9KA 2WSUA 3QD6A 4X6QB 1AHSA 1PIV1 1AZDA 2BNNA 1H8VA 3AXDA 4AVVA 4XBNA 5JLVA 1M4WA 5KXBA 1UL9A 3PVBB 3ZMNA 1VBD3 2DUQA 3VZOA 4I01A 1NCQB 1RUF2 3VHOA 5GZCA 3JD73 3ILRA 3SMHA 5J09A 3VUOA 5ABJB 3PTYA 4AFAA 3CL1A 2MNGA 3VBRC 2P17A 4HLTA 2B45X 4HVOA 4Q4V2 4YYOA 2R32A 3RMXA 2PTMA 2RMU2 5LEJA 1BMV2 1SLAA 1O5LA 5I0SA 1HQWA 3ETQA 1R083 3ZXAC 4AQTA 5KWRA 4LUKA 1WLTA 1GBGA 1N3OA 3MPBA 2ZTNA 2QQPA 1N1TA 2O8OA 1OD5A 1EPWA 2GC2A 3UJQA 3WQ1A 3ZYGA 3ZN6B 3GF6A 4RHV3 1MEC2 3WVJA 5AC92 1NA1A 2KM2A 3HMYA 3VZLA 1RVF3 4Q26A 3ZN4A 1RUD2 2XLGA 5DDJ2 3MW2A 5B2GB 4D7SA 3V65A 5GJ6A 3VZMA 1FOD1 2UWBA 4LO6B 4FPGA 2ZGUA 2CNAA 2BBVA 1XXNA 2EAKA 4N53B 4ONUA 4Q2FA 4WM7C 4ITCA 3AKQA 2KXLA 4DXZA 5K7PA 3E97A 4RS5C 4Q4Y1 2A7AA 1FMD2 3L2YA 3U0ZA 2IXHA 3THTA 3SCHA 3ZX7A 2JG8A 2Z79A 4Q0UA 2WZPP 4QPIC 1WW5A 5F6KA 4WVMB 4GMP0 1COV2 3SLIA 3PMSA 5CFDC 2DCTA 2H0VA 2XWBB 2D40A 2XJQA 4WZCA 1RUE3 1LU2A 3A4UA 5DG2A 2YMZA 1C8M3 1C1FA 1WCSA 1RMU2 2KA3A 3AMNA 3HBZA 3NV4A 1LECA 5JOWA 3R4UA 5BNNB 3ME2A 4H55A 3ZPYA 1QDCA 1O5UA 5KXCA 1X50A 3R4DB 2HEVF 5FMOL 1JW6A 1RUOA 2BFUS 2NMOA 4CDXC 1LOEA 2GNDA 3AYCA 1TME3 2HEYF 1CN1A 3AX4A 3O0XA 5H9RA 4PIZA 2EALA 2JICA 4A7KA 4B4RA 3AYDA 4HK8A 2G9GA 4MYEA 2B5HA 4M3CF 5JPMB 2GC1A 3UKTA 4NHLA 2C0ZA 2AENA 5D8AA 1AR63 1HRV2 3VBRA 2Q4SA 2VNOA 4RGGA 2XVGA 1HXS3 4IEXA 1O91A 3WG3A 2HWD2 1V9U2 2NQYA 4N7UA 3NW4A 1QF3A 2YV8A 3VBSB 4KG0A 5JVVA 2BNMA 3CJIB 3UKNA 4WBBA 4QQPA 5FDBA 5FPZA 1PVC3 4Y5Z0 4M01A 4N7IA 4LHKA 5FTTC 1CAWA 5CB7A 2LM3A 4R4XA 4GQ7A 3AMHA 2EXIA 3JD72 1GLHA 4YVSB 2E51A 2FQPA 3SNMA 2Q0AA 2I2SA 1H30A 2W68A 1DQ1A 1OKQA 1CIWA 1RUI3 5J7MA 4LUMA 4QMAA 1ND2B 4QPGC 4GH4C 1QQP1 3LSEA 1U0AA 5I0UA 2DFCA 5C8CA 1B09A 1NYWA 1R082 1KDKA 4RS5A 1AR93 1JTZX 3GBGA 2DCYA 2OVUA 4QHBA 1A8MA 1RHI1 4D7TA 5H9PA 2D6OX 2X5IC 3AZZA 4QPIA 2PA7A 2Q30A 4AEMA 3K51A 2OPKA 5CFDA 4RHV2 4ASLA 2VH9A 1NCRA 4TWTA 3WCRA 2G9FA 1RVF2 1MQTA 1Q8QA 2PLV1 2CWMA 2PAEA 1PGL2 3WINE 1W6PB 1CAVA 3H50A 5KHGA 1AYM3 2GAUA 3WG2A 4ZU7A 3AMMA 5E1RA 4S2GA 3BTAA 1D0HA 5E8AA 2ZHMA 5JI9A 2AR6A 5DXDA 5C8WA 3BU7A 1HW5A 3I8TA 1NQJA 4ZU4A 5IK8A 1MZ6A 2A6ZA 3ZYJB 3J4UH 4JCKA 1W6NA 4M0HA 1J3QA 4CDXA 1PNGA 2JG9A 4LE4A 4S2DA 4P9LA 4EV0A 4MH0E 5BNQA 2A71A 3KMHA 1GICA 4P5HA 1EYBA 4PF5A 4Z1VA 2GH8A 2A6WA 2D43A 4CEYB 2XH6A 2E9QA 3MDPA 4WVZA 1BVVA 4C1XA 1A6CA 3I7DA 1RUE2 3RYRA 1PM7A 1YHFA 4YGBA 3VV1A 5E16A 4HKWA 3ZFGB 4MSVA 4LBQA 4FO9A 1JBCA 1LCLA 1R1A1 4Z92B 2DTYA 3I59A 3K48A 1WLCA 3SCGA 2EXJA 3HD8B 1VAKA 1YIPA 3RYKA 1U5XA 2VUJA 2GNMA 3DUIA 5GLVA 4RR3C 2P3KA 3IMNA 1AUYA 2A6VA 4JRAA 4COUA 2HWB1 4XQWA 4Q29A 5BNOA 1UW8A 5C9AC 1XQNA 3VBOC 4WV8A 1S0JA 3ZFEC 2DU1A 2BUKA 2VW2A 1DBNA 1TME2 4YM2A 2WLQA 3DGTA 3IDCB 5HCFA 2ZAHA 5CNAA 1V6JA 1J3RA 2R0HA 3RYPA 5EJ3A 1MS3A 4RFT0 4OULA 4AQ2A 1HV1A 2GMMA 4K40A 4Q4X1 1PO13 4OHXA 5KHKA 4HFSA 4Z82A 3EO6A 4XF0A 4AEKA 1CR7A 4JVAA 5J3UA 4FP2A 4OI2A 4TZDA 1WBFA 2GC0A 3N4MA 1H1AA 4FVVA 1AR62 4Y1XA 4RSUA 5BUVA 3O14A 1HXS2 2XKPA 3MIDA 3R6SA 4RD7A 4LT5A 1OPOA 4JAAA 1ASJ3 1OFNA 3GZUC 2A73B 3H7YA 4BZ4A 1ZZ8A 2GMEA 4XTMA 4BQ1A 4OUMA 2ZKNA 2RS11 3OYWA 3EBRA 3RMYA 3WDYA 1GSLA 2XJSA 4C0BA 2PN5A 4Q27A 2ZMKA 3ZYIB 3JBG2 5ACA3 1PVC2 2RR11 2ZHNA 1EV12 4TYSA 1DQ5A 1C1LA 1Y3TA 2JEMA 3VBUA 1G9FA 1LESA 2D6KA 3KSCA 4S2HA 1V6IA 3LZZA 2WFPA 4LULA 1FI2A 1RUC1 2WZR3 1FNZA 1LGNA 1QJY1 2E6VA 4XJWA 1NA1B 3I2DA 2K2SA 4KG8A 5LEKA 3ECQA 4GALA 1RUI2 4XJ9A 5CADA 4HN1A 3ZSJA 4LO7A 1NCQA 2HWE1 4Y1YA 4DZGA 3V64A 3W59A 1TNRA 4PIYA 4YVWB 1AR83 3ST7A 4DY3A 5KHIA 1YFUA 4R4ZA 4BIFA 4A7YA 3D8CA 2Y26A 3CNAA 4XFIA 1TMF2 5FO8B 1DQ0A 1RTVA 2GNBA 2JE9A 3AFGA 1KD7A 3IN9A 1PIV3 2VW1A 1QXPA 2WT0A 4RA0A 3FUOA 4FTBA 1S0BA 2XLFA 3VHNA 1Y7BA 3IT8A 3P3NA 4G3YC 4AQ6A 4NN0A 1PZ7A 1AYM2 4QQLA 2BVVA 3WX5A 5FREA 2D97A 5LK5A 1N1VA 1W6QB 1AYN1 2R043 3LAGA 4N43C 1C28A 2QCSB 1PVXA 2AGSA 5JOXA 1LENA 4RR3A 5KHHA 4JV4A 4DY5A 2WNUB 5C9AA 1Z78A 4XMIA 4ATFA 2CGPA 3BIWE 1SFNA 3ZIWA 5EYYA 5DUWA 4M3CE 2UURA 5DZFA 1ZBA3 3FUQA 4IQPA 1SDWA 4N53A 2GSYA 1DFQA 1LODA 2IXKA 4OI4A 4QQ2A 2XJTA 3TWIA 2SLIA 2YPJA 1UKGA 1HDKA 1R091 1VBB1 1C57A 5LK7B 3M3OA 4WVMA 1IGOA 3POSA 1QGLA 1VRH3 2HWF1 2UYAA 4IXLA 3SH5A 3VBRB 3TB0A 2XKOA 3EHKA 4LA3A 4MZUA 3RPQA 3J9SA 3QH7A 3TYJA 5AFEA 4BIOA 4OZXA 3CLPA 4P9GA 5HCBA 2I07B 1NY71 2OA2A 5K8SA 3WXPA 4NHKA 1I5ZA 4PBPA 3JU9A 4FOQA 4JTOA 1Q43A 1PO12 4JGYC 4WVWA 1URXA 5JCTA 2UWAA 4OHWA 2B42B 4FPJA 1QH6A 5I93A 4YW5A 2XWJB 1POV0 1G9AA 4COWA 3QACA 2ILMA 4LNVA 3URFA 3NKGA 2PHWA 3KLSA 3AJZA 2A3WA 4XF3A 4LBJA 1ASJ2 1XE8A 3O7OA 5C6CA 3ZN5A 2RJKA 3D5OA 4K7JA 3WG4A 1ENQA 1S0GA 2HYKA 4UW3A 1DG6A 4WM7B 5ACA2 1VAMA 4RS5B 1JHNA 1TQ5A 1J58A 2TEPA 3MF6A 4KH9A 3D82A 4H3WA 2VQ0A 4FTSA 2WFF3 3SITA 4QPIB 4B8EA 2VMIA 2C5DA 2WZR2 5CFDB 3HT2A 3B3QE 3M7AA 3VBSA 1QY4A 3AP9A 1ZBE1 4ASMB 5HI0A 1EY2A 4YGDA 3T1LA 1GQGA 3E6BA 4DRVA 1H2MA 4BA6A 4BMEA 1FV3A 1CAVB 4N43A 4DNYA 3QH6A 1PGW2 4GB31 1MZ5A 1O3RA 4YVSA 3S0MA 2YZ4A 4C0HA 1AR82 2FBEA 4LBKA 2OYZA 1IZ3A 1S0DA 4ISQA 1EAH1 1W6NB 4CDXB 1ND3C 1Z7S3 2V09A 1G7YA 1LHNA 1YWKA 2JG9B 2PHTA 1PIV2 3BALA 4IV3C 3O5SA 1QXRA 2DU0A 3N7MA 4D94A 4YW1A 5GZGA 4XZPA 2QE3A 1JYCA 1CVNA 1OI6A 1LULA 1BBT1 3N35A 4BLIA 2JENA 4AI2A 1G9DA 4XFAA 2R042 2DUPA 4XF1A 4XIKA 2I45A 3PLQA 3I59B 2DCKA 4EWDA 5J96B 1AF9A 5C4WC 2R063 4P9WA 1W6PA 2LUWA 3D0JA 4CDQC 5FQ0A 4AVAA 1QQP3 3AYAA 1VLNA 5CFCC 1ZBA2 1MZFA 4XETA 4Y1VA 2WA4A 4BE3A 4JGYA 1DGWX 4GWNA 2ZGKA 1X8MA 3J8F1 3M2MA 2DVGA 2ZGTA 3VKFC 5K0UC 2PFWA 2VU9A 1QJU1 2W08A 1F5JA 4KWJA 4TLFA 3EQEA 4E4ZA 3KS7A 1CAUA 1BEV1 2D6PA 3M3IA 1CPNA 3H1YA 2VVEA 2PELA 1QJX3 2RS51 4B7EA 4E2GA 3LGRA 4GH4B 2NMNA 4QPGB 1CESA 1LU1A 1IKPA 2MPFA 3DN7A 3AFKA 3OYWB 4R8HA 1UN1A 2ZHLA 5EXOA 4W6WA 4PLNA 4COYA 1C3HA 1POV3 4EN7B 4HVRA 4Q8KA 3OJBA 2X5IB 1K5MC 2UWCA 3WP3A 4FPHA 5JIUA 5JZGC 3WDXA 1UZYA 2GDFA 1BKZA 3CU7A 4GIQA 2CY6A 4XE9A 4XBLA 5AVPA 2GMPA 3OCPA 5I91A 2W39A 2UYBA 3FMGA 4X8PA 4AE2A 2DVDA 2YGMA 2XB6C 4QT6A 1MZEA 3NVCA 4P9YA 2CGOA 1R1A3 4XPVA 3M1HA 4A2UA 4XJZA 1V6MA 4I3PA 4Y22A 4H14A 1WMFA 1ND3A 4RL7A 1NQDA 2Q8OA 1ZRRA 4JGZC 3S7IA 2R073 2ZX1A 2WFF2 1YUDA 1DZQA 1F31A 3AP5A 4YZ3A 1O3QA 3TNQA 1UU5A 1VBA3 1YLLA 3TN91 4LHLA 4HL0A 1RUH3 4Y26A 4YM0A 1SFYA 3VKLA 1JOJA 4Q0SA 1BYHA 1D4M1 2XVKA 3ZXLA 5JOYA 2I74A 4AHWA 4WM8A 4AI0A 4IESA 3ASIA 1PMIA 2HKXA 5D1IA 2RS33 2WS93 1Z0HA 3AZYA 3AM2A 2NYYA 3DF0A 2VMHA 1FX5A 4RR3B 3AYEA 3GHMA 1PK6C 3B7MA 1PZ8A 3FZ3A 1PO23 4IV1C 5IUQA 5C9AB 1O7FA 2RM23 1KRIA 4GXLA 1Z7S2 1CD3G 4B3NA 2TUNA 4BHPA 1RINA 1ZM1A 1CPMA 4GA9A 4YVWA 5BPXA 4YNIA 2RR13 3X29B 4XF4A 4IEUA 3IKWA 2QJVA 2W0XA 2V73A 4AVSA 3WW3A 1UZZA 1UF2C 4OHYA 4AFDA 3R0RA 2DVAA 3WHTA 1ZZBA 2R062 5GZFA 4KWKA 2B9UA 3ATGA 1OFSA 5DUXA 1VBC1 1QQP2 4I3GA 2GN3A 4CEWC 3RQ0A 3ZXKA 2PQQA 1W6QA 1H1IA 3MIFA 4OUSA 2OW4A 1SBEA 2DWRA 5EWSA 3VBHC 1H2KA 2WNUA 3KT4A 2HWC1 2QFEA 1GNHA 3WW2A 4K21A 1RB8G 1GKBA 1R1ZA 4E4DX 1H8TC 1KXGA 4OHVA 3RJ2X 4HN0A 4F7ZA 1O4ZA 5GZEA 3DL3A 3MW3A 4W6YA 1XNDA 2VNRA 3B94A 4BM8A 2VNGA 2XHKA 4XJAA 1QJX2 1RUF1 1CGPA 4AHYA 5KXDA 1IS6A 1X36A 1AR73 4AK3A 4WZFA 4QM9A 4JGZA 1G86A 3HR9A 2ZX0A 2ZKLA 4Q4V1 2WIIB 4ORFA 4PLMA 3FBYA 2YY1A 4YZ2A 1FXZA 2N7GA 1OOPC 1OMIA 1OQDA 3PVEA 4AXOA 2YUEA 1Q56A 4YFWA 4EROA 1BVP1 1D2QA 2CAVA 2DYCA 4QQHA 4C1WA 2A3XA 3KCYA 4M00A 3VZJA 2ZX3A 3HN1A 3JBG3 5T55A 5SV8A 1EV13 5L7OC 2XBO1 1H2LA 1R1A2 1MEC1 4N43B 5AC91 1G8WA 1GQHA 1KDMA 1O4YA 4K6BA 4QPYA 3WUCA 4F83A 4LO5B 1WD4A 4AWDA 4IV1A 4K1YA 2EAAA 4YG3A 4BYYA 3KGLA 4V1PA 1RUD1 2WNVC 3WHUA 5DDJ1 3N7JA 1BXHA 2R072 1GR3A 1SMVA 4KU8A 1KITA 2XJRA 1ZRCA 2BGCA 1HLCA 3AMPA 1VBA2 3H9AA 3ZMOA 2CGNA 1RUH2 2P3JA 4FPKA 1V70A 4WM7A 5GM0A 4Y1UA 4HSJA 1QHDA 4Q4X2 1UX6A 3ES4A 1AX2A 1J1TA 1TMF3 5FCCA 3POWA 1LHVA 1DYKA 2ZACA 2D98A 3ZYPA 3ZSEA 4JDNA 3JCIA 2H6CA 2RS32 2WS92 1XYNA 2ZX4A 4COZA 1PO22 2ERFA 5F5QA 5E89A 3WP5A 4CEWA 2RM22 3V56A 4AEDC 1AX1A 2EXKA 4IEYA 1RMU1 4XDQA 5FQ0B 1RUJ3 1IHMA 1HQLA 3RRDA 3IPVA 1Y43B 4CDWC 4HSLA 5FO9B 2RR12 3ZSLA 4AYUA 2FMYA 4JGYB 2MHFA 2WT1A 5BNPC 5CA6A 4PBOA 3VBFC 2IXIA 4XTPA 1Q8OA 3KT1A 1FPN1 3S30A 3ZFFC 3HT1A 1QJY2 1Q8SA 3EJKA 1RUG1 1ZRFA 1DDLA 2A5ZA 3D4KA 1ZBE3 4XEZA 4MV2A 3WCSA 2DFBA 2IXCA 1CAUB 4J6GA 2QDRA 5CVRA 4JQRA 5FLHA 1MS1A 4CP1A 2HWE2 4UBHA 5FOBB 4HPKB 4LE3A 4IL7A 3USUA 3WY6A 3W9AA 3ZXDA 3RWNA 3M3EA 1DQ4A 1YI7A 4AFCA