4XFIA

Cysteine dioxygenase variant - y157f at ph 6.2 with homocysteine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfiA00
4I0AA 2OYZA 5JR7B 5K8SA 3NSTA 3RYKA 5F1RA 2PHLA 2GU9A 1XRUA 1EPZA 4ZU4A 5HI0A 1CAUB 2GC1A 2P17A 2CGPA 3NKTA 3FZ3A 4X6RB 4XF9A 4XF3A 3FX3A 4MGZE 3BPZA 1YHFA 2IXJA 4IEUA 3DN7A 1FT9A 4Q0PA 1VR3A 4IEOA 4IETA 3CF6E 1X7NA 3NW4A 5I93A 4NVPA 4MX3A 4BH9A 5KBFA 4JTNA 2BNOA 1ZZ7A 3KGZA 5FQ0B 2PYTA 3GBFA 2B8MA 1RL3A 4PIYA 1G6NA 1CAXA 2K9ZA 3FFQA 2PHDA 2XHKA 4KWKA 2XL9A 1QWRA 1ZRCA 3M70A 3ETQA 4X6QB 4XF1A 3KCCA 3ES4A 4WZCA 2O1QA 5I8SA 1NE6A 2FQPA 3ES1A 1NZCA 1UCXA 1LR5A 2ETEA 3E5XA 3DL3A 4YSFA 2WFPA 4HN0A 2Z2SB 1UD1A 2IXCA 1J1LA 2XLAA 1Y3TA 4LA2A 5CVRA 4ZU7A 3SMHA 4YRDA 3PLQA 4UBGA 4YYOA 2VECA 3RPQA 2XL7A 4FAHA 4AVAA 2UY9A 5I91A 2EAAA 4PIZA 2UYBA 1XE8A 1J3QA 3QOPA 3H1MA 5KHHA 1CAWA 4HMZA 3E5UA 4LTAA 3H9AA 4R52A 2B5HA 5FQ0A 1O5UA 1J58A 5FPXA 3H3UA 4QX5A 2XLGA 1ZRDA 4UXAA 3KMHA 5LEKA 1NE4A 5LRSA 3BU7A 5C8WA 3I59A 3LZZA 3OTFA 3ST7A 4KWJA 2C0ZA 2PFWA 3MPBA 4IEVA 1ZVFA 2PAMA 3CJXA 3PVBB 4UBHA 4F8AA 1OD5A 4FT8A 1LB2A 2KXLA 4CYDA 3L2HA 2EA7A 2ET7A 4Q29A 3ELNA 4EV0A 2Y0OA 4Z82A 1ZZ6A 4IEXA 1XE7A 1X82A 2FMYA 5T3NA 3S7EA 4Q0VA 3UKVA 1EP0A 4FBFA 4O9EA 5JSPA 2Q0AA 1UW8A 3UKNA 3UKTA 1I6XA 2D40A 3ROUA 4IESA 4DINB 4BHPA 4BYYA 1RUNA 1SFNA 4AVCA 3ACLA 1YFXA 2IXHA 1CGPA 4I3PA 3G7DA 3WW2A 4PIXA 5I0RA 3EQEA 4XFBA 3OCPA 2I45A 2B9UA 3U11A 1FI2A 4YNIA 1EYBA 5CU1A 4AQ6A 4KU7A 1NYWA 3LAGA 4XFAA 1CX4A 4QM8A 2N7GA 2CAVA 4MGIE 1RUOA 3KGLA 2O8QA 4QMAA 3NL1A 2Q1ZB 1CAXB 1DZRA 2OA2A 3D0JA 2EVXA 1UPIA 1GQHA 3EJKA 4WVZA 3BCWA 2PA7A 1ZRRA 3FE5A 3H7JA 4L11A 3CEWA 2HJIA 3CLPA 2H6BA 4E2QA 1VP6A 3RYRA 1Q3EA 2Q30A 1O7FA 5C6CA 5BY5A 1J3PA 4Q0UA 3SCGA 3IDBB 4MGYE 1YWKA 3H1YA 4OLLA 4XF4A 3IWZA 2IXKA 4D7TA 2H6CA 4JTOA 1PM7A 1LRHA 2PAEA 1O3QA 4K8FA 5I0SA 3U10A 1IPKA 4O9GA 1L3JA 4D7SA 2F4PA 1UIKA 3LA3A 2BNMA 3E5QA 2IXLA 2WC2A 4HVQA 4LUKA 3NJZA 3EBRA 4I01A 4QGNA 4L2NA 3SCFA 2QNKA 4BIFA 4E2SA 1ZZ9A 1QXRA 3RYPA 2MPFA 5FLJA 5JSOA 1U12A 4HLTA 4EWDA 3IIAA 3MDPA 3EO6A 2PAKA 5FDBA 2ATFA 2D5FA 2GZWA 1DGWA 4IEWA 1RTVA 4Q0SA 5KHGA 4MV2A 1ZREA 1HW5A 2QDRA 4QGLA 3S0MA 2QVSB 1WLTA 4N9IA 1RGSA 3H7YA 3HIFA 3PNAA 4GULA 1FXZA 2OZ6A 3BB6A 1ZZ8A 4HVRA 4XEZA 3N4MA 1SQ4A 4HVOA 3MYXA 3H3ZA 4ONUA 1SEFA 5JSRA 1OI6A 1H1MA 2BEOA 1OMIA 4WBBA 1ZRFA 5I0TA 5BUVA 1O3SA 1YUDA 3TNPB 2D5HA 4N9HA 4LUMA 3FWEA 1O3TA 5KHKA 3O14A 1NXMA 5JCTA 4J1XA 3TNQA 1Q43A 2VQAA 2VPVA 3OGJA 3C3VA 3HT2A 3I7DA 2GAUA 3R6SA 2CV6A 4MH0E 1DGRA 1CAVB 2XGXA 2XLFA 4A2UA 4FAGA 2ZKLA 5KHJA 4AXOA 3CO2A 4XFFA 1X8MA 3FHIB 3SCHA 4MUVA 5FPZA 3QACA 1GQGA 1O3RA 1O5LA 2V09A 5EZWA 3SXWA 2UYAA 5J48A 2QCSB 4F7ZA 4HSJA 4LEJA 2IXIA 3LA7A 4HN1A 2MHFA 5BPXA 1ZX5A 4I09A 2HKXA 4LULA 3MZHA 1IPJA 4AQ2A 1I5ZA 4XETA 4R8HA 3S7IA 2IC1A 1ZNPA 4IEPA 3E6CC 1QY4A 3I59B 4EWAA 2GH2A 4XF0A 2GC3A 1VJ2A 2XKOA 4LLOA 2CAUA 3U0ZA 3WW4A 5EFUA 3SHRA 3BALA 2UY8A 3H8UA 3M3IA 5LRRA 1YLLA 2XKPA 5FLIA 4XFCA 1ZZBA 4I02A 1H1IA 4LA3A 4ORFA 2E9QA 4IEZA 3RZZA 5JAXA 5E1RA 5E16A 4IEQA 1J59A 5KHIA 5LEJA 2OZJA 4EROA 1PMIA 3WW3A 1QXJA 3FJSA 3OD0A 4HBNA 4PJYA 1Q5OA 4IEYA 5BXXA 4P9GA 1CAVA 2BYVE 4KWLA 4YARA 4I2OA 2DCTA 4KL1A 1YFUA 4JV4A 5D1IA 2Q4SA 1EY2A 3LA2A 2H0VA 3I54A 3IDCB 4OFGA 4HZFA 4KU8A 3E6BA 3DKWA 1OFNA 2QJVA 1CAUA 4E2GA 3LOIA 1RC6A 1O4TA 3D0SA 3NVCA 4Z07A 5FLHA 5I8YA 3D82A 4IERA 2Z69A 1JUHA 4B29A 5CADA 4MZUA 2GC2A 2K0GA 3E97A 3RNSA 1YFYA 3HQXA 4XFGA 1ZZCA 3JZVA 3IBMA 1Y9QA 4QXKA 3VHRA 3LWCA 3DV8A 4MGKE 3H1WA 2MNGA 4QM9A 5J3UA 2OPKA 3GYDA 1TQ5A 1WGPA 3H50A 2ZCWA 4XFHA 3ZDSA 5AVPA 4EWEA 4RD7A 3B02A 3CL1A 1V70A 2ET1A 3E6DA 2PTMA 4QGMA 2PQQA 4Q0QA 3HT1A 3WW1A 4I0BA 4META 1X8EA 2GC0A 5I8TA 3OF1A 1YFWA 2BNNA 1DZTA 5I0UA 1WA4A 2BGCA 1J3RA 3EHKA 2D93A 4J1WA 4HSLA 4ZU5A 3RDIA 5J7MA 3USSA 4TLFA 1UIJA 4XFIA 4AVBA 4H7LA 1CAWB 5FCCA 3KSCA 1LKNA 5BV6A 4JVAA
chains in the Genus database with same CATH superfamily
4AQSA 2DCJA 3BIWE 5JR7B 3KF3A 5K8SA 3IM0A 5F1RA 2EIBA 5D2AA 2GU9A 3WD5A 2B7YA 4NR1A 4P5HA 5CFDB 5IVYA 1RUI1 3KLSA 4I3GA 4YVSB 1EPWA 4LO7A 1SACA 1CAUB 3NMBA 2GC1A 4Y1YA 2HWE2 4XMAA 3GALA 3I8TA 3J9SA 2VL4A 4QT6A 5IUQA 2W0XA 3WP4A 2YDEA 1MS9A 2JG9B 4Q4W2 3FX3A 1W2AX 5F9TA 2BJSA 4B3NA 2A71A 4IEUA 1OF4A 4TXWA 1OQEA 1PVXA 2WT2A 3QBQA 2R061 3AMHA 2O8OA 4XZUG 5FZ6A 3CF6E 1PGL2 1KS4A 1X7NA 2P1BA 5C33A 5JVVA 1HB3A 3AYCA 1U5IA 4XJWA 1UYPA 5KC6A 2D3RA 2CDOA 4JTNA 5GZDA 4Y3OA 5BNOB 3POIA 4MXVA 5ABJA 1JN2P 5IAVA 2PYTA 2VZPA 3BN6A 2J1SA 1AJKA 3QH7A 4PIYA 3FUQA 2K9ZA 1AYM3 3EMRA 2XHKA 3FFQA 5C7GA 1NCQB 2F4LA 5L9RA 1JOBA 1RYYA 4P9IA 3WCRA 1Y7BA 3ILFA 3IAQA 2GP5A 2YC0A 5F6LB 2Y8KA 2BOIA 3M70A 5JWPA 2XJQA 4QX3A 4GWMA 1H6XA 4Y5SA 3I3MA 5LCWL 2XJVA 3BTAA 5KC5A 1OA3A 2YMZA 3WHTA 2WIIB 1L7LA 5FP7A 4AI9A 1D7PM 5EIYB 1YIFA 3DL3A 1YXWA 4CDWC 1QJY1 4HN0A 5F5AA 2RS52 1F9KA 4AVSA 1UD1A 2NN8A 2LUWA 4PLNA 3TN93 1AR61 3ZSJA 2VZUA 3SISA 3WQ1A 4BMEA 1J1LA 2VBPA 5LWBA 1Y3TA 4MXWB 4LO4B 4YYOA 5D8AC 4FPYA 3J8F3 2V73A 1SBDA 2AREA 1HDKA 4Y5Z0 1GICA 3OJBA 1S2EA 2UYBA 1S2BA 1XSQA 3JCIA 1XE8A 4JQRA 4LR4A 3QOPA 5FMOS 4YW7A 4YVWB 4RS5C 3USUA 3VHNA 4HMZA 3E1F1 2HWF3 1MZ6A 1CX1A 1XNBA 4LBQD 3MIFA 1FMD3 3MLKA 2JG9A 1U5YA 1B35C 4DO0A 5T5PA 5FQ0A 1NX9A 1EAH1 1WCQA 1O5UA 1GQPA 4XTMA 4DS0A 5FPXA 4QX5A 4FQ4A 3ZXDA 5EJ1B 2VZ3A 4XQWA 1ZRDA 2J1TA 3KMHA 3AM2A 4XXAA 5ISLA 1AL0G 2ZAHA 5JLVA 4JAAA 4Y1VA 4LJHA 5FYYA 3WG3A 1AR91 1CIWA 4DY5A 5BNPC 1MS0A 5FZKA 5A7SA 5C8WA 4OULA 2Y6JA 3OTFA 1REDA 4UFIA 1CZSA 1VPHA 3ME2A 2PFWA 2PAMA 1RVF1 1TMF1 5IVCA 3ZFFC 4F8AA 5FYMA 1LHWA 2KXLA 1LB2A 3BOPA 3N9LA 2DVDA 2RDRA 1C28A 1K42A 2DF7A 2VMGA 5L7OC 3CJIA 2B9VA 2VVEA 4N53C 4HFSA 3P3NA 2C9KA 5T3NA 4A3ZA 5C9AB 1E57A 4NOTA 4BA6A 5IK4A 2R7EB 1EP0A 2ZHKA 3WP5A 1UXXX 5JSPA 4YFZA 2Q0AA 2YYOA 1BCXA 2WA3A 4ZONA 4CEYB 3UKNA 3DKQA 2E7AA 1N1SA 3POSA 2E32A 5H9RA 4AQTA 2BBAA 1FPN1 2JD9A 3MV11 4DRVA 2GMEA 1ULDA 4DQAA 4IV3A 4BHPA 4BYYA 4X8PA 2R1BA 4AVCA 4TWTA 3ACLA 4DXZA 1W6MB 3AMMA 3OY8B 3VZNA 4B1LA 1UU5A 3BGAA 1NXD1 3O0XA 4GWNA 5I0RA 1ND3B 1E5SA 2HYXA 4FPKA 4BDVB 1ZRIA 1UYYA 3OCPA 3LKJA 1ULPA 2B9UA 5LBBA 1NCRA 3MF6A 3U11A 2J1UA 3NQHA 1REEA 4Q1RA 4NIHA 4OI0A 3IB3A 2WZEA 2PHRA 2O0OA 4KU7A 1LTEA 4LBJA 2E31A 3AP9A 5IFPA 3RZLA 2ZKNA 2IVJA 4GZ9A 3AJZA 3LAGA 3GZAA 2GN7A 5GM0A 1LEMA 5ANNA 1DDLA 4W4ZA 1RUH2 2YY1A 2CAVA 5JDBA 3ZN5A 2JDYA 2O8QA 3KGLA 4FXKB 4QMAA 3MF9A 4A6OA 4NIAA 1N1TA 2OA2A 4QKDA 2RDNA 4P9XA 1HQWA 1QJU3 1UNBA 5FXXA 4Q4Y3 2WA4A 3SH3A 1TME2 1W0PA 3KT4A 5GLVA 4OCTA 2OXBA 2ZGOA 4IV3C 2PA7A 4LKEA 1QJX2 3FE5A 3H7JA 3CEWA 2AUYA 4XDOA 1F5FA 1UF2C 2E51A 1H6YA 2HJIA 2YV8A 3VBUC 4EN0A 3UJQA 5EYYA 2WAAA 2H6BA 3MEPA 5JIAA 2VZSA 1VP6A 4K40A 1Q3EA 1IKQA 4CRQA 4ET7A 1O7FA 5FUNA 3W59A 2WFF3 3MO4A 5C6CA 1ENQA 2P6HA 4O65A 2A6WA 4OLLA 4GKXA 4TLGA 5A7NA 2A5ZA 4XF4A 1MS1A 2P2KA 2V4VA 4JDOA 2Q8EA 4CXXA 4D7TA 2Y26A 4HPKA 2AENA 4RA0A 2X05A 1Q8PA 5F6KA 2VZVA 1O3QA 4K8FA 3J8F2 4X8NA 3U10A 1IG3A 1GFF2 1OLMA 4O9GA 4D7SA 2F4PA 1W6NB 5L9BA 3LA3A 3RI9A 5F5IA 1VRH2 3VD9A 4FPGA 1KFXL 2HWF2 3E5QA 3VBOC 2WC2A 3AB0A 3K75B 3MI8A 5M0TA 3ZN6B 1W6NA 4GB31 4NHLA 3NJZA 5AC91 2YXSA 1X36A 3KD4A 1FMD2 1WMXA 1GZCA 4ISRA 5J1XA 3GXUA 4C0HA 1KJRA 3WXPA 5B2GB 2QQNA 5CYYA 5FY4A 1C8NA 5LB6A 4YM1A 3AFKA 4P9LA 1QJY2 2KM2A 3FHAA 4N7IA 3OY8A 3ZR6A 4B4RA 3APBA 5E88A 5DZEA 2RS51 2HWC1 5FLJA 1U12A 5H9QA 1ULCA 3AKPA 4HK8A 4IGQA 2JG8C 3MIHA 1SLBA 5FDBA 4TZDA 1C1LA 4UI9L 1DGWA 1VE0A 3OG2A 4XJ9A 3LF7A 4XJZA 4XTPA 4PBOA 3NNGA 1EV13 1HV0A 4BQ3A 4D6SA 3ZXLA 4C90A 3VUOA 2FDKA 4MV2A 2EIGA 1AUYA 2DFCA 1T6GC 1S0FA 1Z7S3 2WO3A 3PUHA 4NIGA 1W3XA 1LOFA 4DUWA 3JXSA 3ZLIA 2IWGB 2VZTA 2QQWA 4XBNA 1HW5A 2BFUS 2W1WA 3I3DA 3K3NA 4LBQA 4S2GA 1IS3A 1FV3A 2JEMA 3GCXA 4XUNA 4M01A 2P5BA 2ARBA 4EYUA 4LBMA 2XPJA 1AR82 3TEXA 1BK0A 3LSEA 4NAOA 3H7YA 5BYNA 1AF9A 1W99A 3PNAA 3RMYA 4AFMA 4Z92B 1WLDA 1I9RA 1FXZA 3U07A 3BB6A 4WZFA 5C4WB 2EXHA 4XEZA 2VXRA 2GNDA 4N43C 1XB9A 4CDWA 1LOCA 3O5SA 5HBAA 1SEFA 1V00A 1OI6A 5HCBA 4ATFA 3LD8A 4FOYA 4WM8B 3ZX7A 2Y64A 1FAYA 3AZYA 4UFLA 3RJ2X 4OUEA 1PK6C 2XWBB 2LALA 1ASJ3 2YBPA 4N9HA 2WNVC 3GZTB 1HB4A 4NWWA 3Q8FA 5EXOA 4QDQA 4OQ8A 5GZGA 1XYPA 4QU1A 5A6QA 2GSYA 1HB2A 1EAH3 4J1XA 1UQXA 2QDNA 4JQTA 3TNQA 3RI8A 3D8CA 2VQAA 5K4LA 3S5AA 1KXGA 1RUG1 4RSUA 3VZKA 1C57A 1DGRA 1QQP1 5JZGB 2DWRA 1RUH3 1SPPB 1UYXA 3ILRA 2BBVA 5FZFA 1UOBA 1SHWB 3K3OA 3OBZA 4JGZB 3CO2A 2Z5WA 5CFDC 3UK9A 3FHIB 4Q4Y2 4KBBA 1KITA 1SMVA 2YU2A 3N7KA 1Q8OA 2ZEXA 4FP3A 3SCHA 5FPZA 1O3RA 1R1A1 2DBNA 2V09A 5FYSA 3T2PA 1PZ9A 2DTWA 3MUY1 1PIV1 1LOGA 4BB3A 4N7UA 3ZKYA 5J37A 2CTVA 2BGOA 2Y60A 3AX4A 1PO22 4FQZA 1R092 4BOWA 2AC1A 1US3A 3PTYA 2VMDA 3TEWA 4QB1A 4I09A 1JHJA 2DFBA 3NNJA 3MZHA 2AH2A 1S0DA 2FCTA 4XW3A 4Y20B 4AQ2A 3O1MA 4LHKA 4QQOA 2VR4A 4BPZA 5DAWA 2ERFA 4OYUA 3VBHB 3KQ4B 2NMOA 2YFZA 3D5OA 4QX2A 2WBKA 1VBA2 1ASJ2 4R8HA 3S7IA 3VKFC 4IGPA 4AHXA 1ND2B 2RR13 4LBNA 3WHUA 4D7YA 1QY4A 4CP0A 4EWAA 1JS9A 3FLRA 2R071 1MPXA 2XKOA 3AYDA 4DIQA 2CAUA 1MS5A 5SV5A 4CDUB 2X5IA 1MVEA 1H2KA 2JE9A 2J42A 3AYEA 4UF0A 1S55A 4AGVA 2DVGA 4HANA 3SHRA 1A34A 1IHMA 2W3JA 2IVIB 4EWDA 2XKPA 3K4AA 4QQ2A 4XFCA 4BU2A 1H1IA 2D6OX 4UOJA 3FFZA 5DAVA 5FTTC 2E9QA 3FHQA 2JWPA 5FP3A 5HV4A 3FL7A 1PMJX 2ZEZA 3LB9A 4N53A 2A7AA 4ARXA 3W9AA 2YUEA 4XMIA 1XNTA 4EN9B 1UMHA 4CEWA 1BMV1 2ILMA 4JGYA 5KHIA 5LEJA 4EROA 2VZOA 3WW3A 4V2WA 2CNAA 3UETA 3OBTA 4MXWA 3VGIA 1S0BA 2QQVA 3ZFEA 4FSJA 1RUC1 4V2VA 3IN9A 3O7OA 1W8ZA 2BERA 2VVDA 3T0AA 3V64A 2YZ4A 1OLRA 4BIOA 4YARA 2W1SA 4KL1A 1ENXA 3USUB 1I5PA 4BQXA 1OD3A 3B69A 1Y9GA 3BPSA 4CEYC 2WINB 4KU8A 4RHV1 1W39A 4C1XA 4CDQB 1YC61 2HH9A 1G9BA 4RS5A 3MBWA 2GNBA 4E2GA 1RUI2 3OPTA 3LOIA 3GZUC 1RC6A 1M4WA 4I30A 4QD2A 5FP9A 1O4TA 3WDWA 3NVCA 4AI3A 4B7KA 2A3WA 3D82A 1QMJA 4IERA 2WLPA 4QKFA 4B29A 1WW6A 1C5HA 4MZUA 5EHDA 1NLQA 1AR62 2CDPA 3VBSB 2K0GA 2MEV1 3E97A 1W8WA 1W9FA 1AR73 2BGPA 2W68A 3HQXA 4XOGA 5B4NA 1ZZCA 3WEZA 4DXSA 5FZ1A 3TB0A 1NCQC 2WT1A 3LSDA 1LODA 3T2OA 2ZHMA 1XNDA 4GH4B 5HCFA 1OA2A 4XZPA 1TQ5A 1W2TA 1WGPA 5F3GA 1BEV3 1QOOA 1WMDA 3ATGA 1LHNA 3VBOA 1C1FA 2YU1A 3JD73 1XQNA 3P5BA 1RXGA 1POQA 3N9NA 2A75A 2ZCWA 4M4PA 3AP5A 3NV3A 1SDDB 4RD7A 5K0UA 5C8CA 2PLV1 3B02A 1DP0A 3WDTA 5JUVA 3H8XA 2RHPA 1DU3D 3BODA 1MEC2 1XXNA 2BVVA 3JB4C 1GP4A 2HWE1 4Q0QA 4DPNA 3ZDVA 2FD8A 3AL6A 3OEBA 1K3IA 1EV11 1J1TA 2GC0A 4YW4A 4ITCA 1ZA7A 2BNNA 4JC1A 1SBFA 1G9DA 1UY4A 2JB8A 3VZLA 2XQRA 1K5MA 5ABJC 2R042 5H9PA 3TN91 3POWA 5KXEA 2D93A 2XJRA 3VD3A 1N1YA 1S0JA 2ZABA 3USSA 1KQRA 4LBOA 4XFIA 4KGGA 3VL8A 4AVBA 4OI1A 1LHOA 3HPNA 1S0GA 3J7MA 1DBNA 1HXS3 4K1YA 4KG8A 1VMFA 2DVAA 1FMD1 3ZN6A 1DGWX 1RUD3 4DZGA 1NCRC 1BXHA 1YNAA 3AFGA 3CKHA 3P1IA 3MGUA 1B35B 1QF3A 2A3XA 2F17A 5LASA 2VZQA 3RYKA 1YCIA 1SLLA 1BZWA 2PHLA 4H14A 4URTA 3VZOA 5FFOC 3NAPA 1XRUA 3GJBA 4JRLA 4AFCA 1EPZA 4N90A 5C3OA 4LHNA 4ZU4A 5HI0A 2HWD1 3ZIWA 3O0WA 5IVVA 3QLQA 3IPVB 5FXZA 2VBDA 3RZGA 3OYWA 1D2SA 4Y1ZA 5CEHA 1CR7A 4GQ7A 1H2MA 4LIUA 2CGPA 3NKTA 2G9FA 3RVHA 3FZ3A 4YVSC 1R082 1PGW1 3ZXAC 2WJSA 1AL21 5FZHA 1AR93 1LGBA 4P9JA 5GJ6A 1RUF3 3ZPYA 5JR2A 2BPA2 1O8SA 3DN7A 1JYWA 2JDZA 1FOD2 2A6ZA 3OUIA 4Y20A 1IS6A 4NVPA 5FJHA 2VCCA 3LEGA 2J1EA 5KBFA 2RDQA 3S5QA 3VBRC 4YZ4A 2P3IA 1LHUA 1ZZ7A 3KGZA 5CKQA 2ZX3A 2ZOEB 4Y26A 1ZBE2 3ZXJA 1PIV3 5LK7B 2YHJA 3WP3A 5SV8A 1RVF2 1DYOA 2QUOA 4W6WA 1RUD2 2OVUA 1RJ7A 4Q4V1 5IT6A 3FLPA 3ITQA 4XF1A 3IAPA 3N36A 4COYA 4ZHNA 1K45A 3I2OA 1COV2 1F4HA 4IQPA 3RZKA 2YBSA 1NZCA 2ENRA 1SLTA 2FDIA 1UCXA 1LR5A 2HBUA 4OI4A 5FYCA 4YW6A 4MOAA 3F2ZA 2LROA 2WFPA 4XCBA 2EXKA 2ZGKA 3B5LB 3C7FA 4YG3A 2VY0A 1AR92 2D6KA 3IT8A 1RXFA 4Y22A 4CSWA 4D69A 2WNEA 3WT3A 1HXS1 4JGYB 5FY8A 2XLAA 4ASLA 1YJKA 2EF6A 5TSWA 5JMCA 2WFF1 4LA2A 5JZGC 4IUGA 3SMHA 4YVWA 4YRDA 4NAMA 4UBGA 1Y9MA 1FPN2 3RPQA 3CZUA 2B39A 1W2OA 4FAHA 2GH8A 1VRH1 2EAAA 3HOBA 3P3PA 5L7OB 4LBQB 2PHWA 2ZGTA 1J3QA 4XQ4A 3J7HA 1OOPC 1GV9A 2VTXA 5KHHA 3ZYJB 3I2DA 2ID4A 4U36A 4H7MA 1VB2A 2R49A 1VIWB 5FPLA 4LTAA 1DQ2A 2RG4A 2WZ8A 3H9AA 1ENSA 4LO5B 2X5IC 2RM23 4R52A 3DCQA 3IIIA 4NPRA 3WZ1A 3JUUA 2PXJA 4FFHA 4WV8A 4YW3A 1RUC3 1GZ9A 1WUVA 2HWC2 1COV3 3FBMA 4CPBD 3KV4A 4XC9A 2XLGA 3NV2A 3GF6A 4CCDA 5A3OA 4A44A 3OGSA 5LRSA 3BU7A 2GNTA 4BWOA 4OHVA 4Q1PA 1WLWA 4QHOA 2R062 3AXDA 5EYXA 5BNOC 3ILNA 1L7RA 2E63A 3LFIA 5FOBB 1H2LA 2R32A 3ST7A 4ZZ5A 3O1PA 2HBTA 1SLIA 3I2JA 3DPRA 4ZZ8A 1ZVFA 2RMU2 4JDNA 4UBHA 1F5JA 3M8LA 3BYWA 4FT8A 4GB32 5T50A 3VBOB 5AC92 1YQCA 5F39A 3VHOA 3WCSA 2EA7A 1DQ4A 3M4FA 3DPRB 1WLCA 3I2FA 3ELNA 2Z42A 1RHI1 1OQDA 1I3HA 1ZZ6A 4IEXA 4WM7B 5LA1A 1X82A 2PLV2 1AR71 5A70A 1OHFA 4Y1XA 3WV6A 3S7EA 2ES3A 1OUSA 1HIXA 1T2XA 3LPGA 1WD4A 1W03A 3N9PA 2DUQA 4EN8B 3EB7A 3JBG2 2JG8B 3UKTA 4PHZA 2XVKA 4YWAA 2D40A 5DAQA 1VAVA 1FATA 4IESA 4DINB 4WVVA 4AG4A 1IQDC 1V6NA 2CGNA 4RL7A 3WG1A 2VMCA 1CGPA 3FC0A 3G7DA 1F4AA 2RS32 4H3WA 4AF9A 2XR4A 4XFBA 3LPFA 4FTSA 4R4XA 1U0AA 3URFA 4E4SA 3PIGA 1V9U1 4YNIA 4LNVA 3AK0A 1KGYA 3LEKA 4COVA 1RUE3 4QKNA 3RFRA 3K46A 2DBIA 4HKLA 1SPPA 1RITA 2VD7A 4QXHA 2RMU3 2W95A 3LQCA 3UV9A 3POGA 2L9LA 4XFAA 5A7WA 2BRTA 4A7YA 3AKSA 3HEIA 2D3PA 4N43B 1ONAA 1HRI2 4IXLA 1CAXB 1X9PA 1XBFA 3D0JA 3VKMA 1TE1B 2MEV2 2XUEA 2PELA 1JYIA 3BUCA 1UPIA 1FNZA 5I0DA 3EJKA 4WVZA 5IK7A 2R041 3AKTA 4DUVA 1ZRRA 2AZ5A 2R1DA 5BNNB 4L11A 4PF1A 4K6BA 1N47A 3THTA 1AL23 5C71A 2NM1A 4E2QA 1GBGA 2A6YA 4QQPA 1HV1A 2Q30A 4PQQA 1UAIA 1VLNA 4EN7B 3DYMA 4Q0UA 3ZVXA 1LENA 4YZ5A 3T2TA 1PVC1 4YFWA 1OBNA 2JDKA 4AK3A 1JOPA 2GALA 3NJXA 3W5MA 4AHYA 4JGZC 5LA9A 5KXBA 4XACA 4CUCA 1WA6X 5DMYA 1OSGA 4XBQA 4L0PA 2Q8OA 4AOCA 4FPLA 1L3JA 2AR6A 3SKVA 3ZYIB 3S57A 5FY5A 5FZDA 4XE9A 2WSVA 3TWIA 2ZGMA 3DECA 2VE1A 3W58A 2IXLA 1QQP2 5L73A 3HBZA 2BV4A 3EBRA 4I01A 4RS5B 4BJ0A 5C4WC 3MLLA 5BNQA 1Q56A 2BUKA 4CEWC 2ZZQA 3I2IA 5A7PA 5GZFA 3RWNA 3T3YA 4QQHA 2VU9A 2DU1A 1C8M3 1IZ3A 4DMIA 1XNAA 3VZMA 1QXRA 3RYPA 5DAPA 2A73B 1ZBA2 2RR11 2D3SA 1UU4A 3LDBA 1PK6B 1QJU2 3DGTA 4HLTA 1ND2C 4YGBA 5FYIA 3SQOA 3GZEA 3EO6A 3MDPA 4Q4V3 4QPYA 1G9FA 1GANA 2ZMNA 4XJAA 2XBO3 1Y4WA 2GZWA 1VBC3 2R30A 1RTVA 2AEZA 2CY6A 4Q0SA 3KWVA 1TVGA 4QPGB 2QE3A 5CZKA 2V5DA 3OPZA 1W8HA 3RQ0A 1RUD1 5J09A 2ZX2A 3MIEA 4Y33A 5A7WB 3C8XA 3LDRA 4RHV2 2K2SA 2PN5A 3S0MA 4NIIA 4QX0A 1W8TA 3A23A 5C4WA 5F7UA 5FP4A 2NLRA 1WW5A 3CNAA 3D6EA 1WMEA 3NWKA 3TYJA 3ZYRA 1POV1 4BQ1A 4GIQA 1JU3A 3VD7A 5IVJA 1LOFC 3VBUB 1UYZA 2K46A 2OZ6A 5FV3A 4ASKA 5C9AC 1ZZ8A 1XPWA 1WMFA 4RFRB 1HKDA 2VOWA 3GHNA 4FFFA 1SQ4A 2BU9A 3VDDC 3TOJA 2ZGNA 3MYXA 4HT1T 1VBE2 2A70A 1JZ2A 3KS7A 4E8DA 2RJLA 1H1MA 1OMIA 2W39A 5ABJB 1UZ0A 1ZRFA 5I0TA 4R9AA 5HPOA 1UPSA 2WFF2 3TRSB 1ODMA 3BKZA 1LULA 1YUDA 3R4UA 4NIDA 3TNPB 1ZM1A 1D2QA 2VW0A 1GWKA 2W1UA 3FWEA 2O14A 4DEVA 1O3TA 3ETPA 2WWSA 1UO9A 5KHKA 3O14A 1I1EA 5FKCA 4JKMA 5JXIA 2WT0A 3VKNA 4XJUA 1A8MA 2JX9A 4XHBA 3ZFGC 1GZWB 3AJYA 5EQUA 2YROA 2VPVA 2UWBA 2W1QA 3C3VA 1LAJA 2GAUA 2Z4FA 4MH0E 2RS53 4FCAA 3ZR5A 5F2SA 3VDCA 1O59A 1MS8A 4LO6B 4LKSA 5KHJA 1HRI3 1MS3A 4GJYA 4XFFA 1UX7A 3KM5A 2HWD2 1JZ8A 1W05A 2MEV3 4V1PA 1O6UA 4RQPC 1V9U2 3N9OA 5GLZA 1AX0A 1LGCA 3IMNA 1O5LA 4L97A 1D4VB 4UW3A 4YG0A 1OVPA 2WS91 2QCSB 4F7ZA 1GLHA 3Q8CA 4MO3M 4K3UA 3ZFFA 4D3WA 1AL22 4HETA 3ACHA 3WUDA 1AYM2 4LEJA 3AC0A 1OFSA 3NO8A 4M4RA 5FPUA 2P4EA 1C4RA 3K2OA 1G7YA 2IFRA 3KCXA 1N1VA 3WP6A 1I5ZA 4D6QA 5A3NA 3VKLA 3OBAA 2VG9A 1UX6A 3OPWA 4XETA 2Z79A 4LOSA 2VNVA 4AVTA 1XE0A 4LOTA 3KF5A 1V6LA 4IE6A 5FYHA 4UF0B 3E6CC 3I59B 4E4HA 2NP0A 2WLQA 3LDKA 4MVTA 5C70A 4XF0A 3V0BA 1RMU1 4NHYA 4LLOA 5FY7A 4WVWA 3GBGA 4WVMB 5AFBA 3LIHA 3ASIA 4K8RB 4CDQC 4PBPA 4GA9A 3ZXEA 3JB8A 4UFJA 3BALA 2FBEA 3S6PA 2XJSA 3H8UA 3SEEA 3D3AA 3WF4A 2R6QA 3MUZ1 5FLIA 3RMXA 1JOJA 2I07B 1ZZBA 2NYYA 5HCHA 2LW8A 2HWD3 2QTWB 4JX0A 2JIGA 2QBXA 4OMDA 3PHMA 4GWJA 4LA3A 2Y33A 4ORFA 1SG3A 4WM8C 4AEKA 1C8M2 1OURA 2C6SA 2TBVA 3JQXA 4IEZA 4ZS2A 3C7OA 2Y38A 1BLZA 1CIYA 4LPLA 5JPNB 2WDBA 2AEYA 2HEWF 4AI1A 5E16A 5FPAA 1H8TC 2JKBA 4NROA 4RR3B 2A6VA 5FOJB 4CDXC 1NAEA 2OZJA 5BNOA 1PMIA 2JXAA 2VOXA 1YQ6A 1NA1C 3KZ4C 5JPMB 4JGYC 3DPRC 2AGSA 3B00A 1EAH2 1XJAA 3WG2A 1Q5OA 1RUF1 1UWWA 1ZYBA 2Q1FA 2GN3A 3P6BA 1YO8A 3X29B 5C5TA 1HRI1 1Q8QA 1QJZA 2EIEA 2YPDA 2ZGRA 4KWLA 1GP5A 2DCTA 3MHZA 1YFUA 4JV4A 4UW4A 2VUAA 5D1IA 3LA2A 2H0VA 2WZR2 3IDCB 4UAPA 4AR2A 4HZFA 4B4QA 2VZRA 2JDNA 4LITA 3DKWA 4QQLA 2OX0A 2VTFA 1CPNA 1WZXA 4NHKA 1OOPA 2C4XA 5FWJA 4YZ3A 5FLHA 2QQMA 1ND3A 2Y6FA 1W6PA 4Z07A 5IFTA 2RS12 5CG9A 5KXDA 3INAA 4HKWA 2R073 4KMQA 5A6ZA 3T4VA 1JODA 4ES9A 4Y22B 1T6BX 5A32B 1FOD3 1W8NA 3AP4A 3RNSA 2WQ4A 1OA4A 1LU1A 1UZVA 1C5IA 5BNPA 1HRV2 3UL2A 3UGGA 3VHRA 1WW4A 3LWCA 3DV8A 3IZOA 4MGKE 2WNOA 5APAA 1S1AA 1TME3 2VC9A 2OPKA 2ZS6B 4QM9A 5FK8A 5FYUA 3B94A 3GYDA 3I3EA 5C3SA 3CDZB 4MHRA 1H2NA 2XB6C 3J7NA 3AZVA 4PF5A 2UU8A 3T4HB 1GR3A 4CZSA 1KDMA 4NPLA 3ZDSA 2WNUA 1NY71 1MQTC 4OHXA 4AEJA 4AFAA 1MR5A 4EZ4A 1D0HA 2Y0IA 4P08A 1SZBA 5FWEA 2ET1A 5BNNC 2ZEWA 2WWJA 5JOWA 5JOXA 4P14A 2WN3A 3KCYA 4QGMA 2JICA 3HT1A 3WW1A 4I0BA 4META 1AXYA 1X8EA 5IWFA 3GBWA 5LK5A 4OVEA 3SEPA 1JYCA 1DLCA 3OF1A 4N53B 3WF2A 4QAWA 3TEZA 3WR0A 1RUG3 1WA4A 4CCEA 2BGCA 3MPPG 4G4FA 4NRMA 1BVVA 3SLIA 3H8RA 4J1WA 1SCRA 4HSLA 2OS2A 1VRH3 5LATA 3CJIC 5L7OA 2FDFA 3I97A 3BVCA 4TN7A 1N3OA 1QOTA 1UIJA 2D98A 2ZBJA 3LOBA 3AVRA 3I4IA 4S2FA 3ABZA 3ACFA 1COV1 5FCCA 4LMFA 3A7QA 4XABA 5BV6A 3WQ0A 3WNNA 1HJFA 4I0AA 1IOAA 4CU6A 3CZJA 2GNMA 2JDHA 1AR72 1TEIA 5IATA 3NSTA 4PDWA 1UY1A 1AYN3 1Q8VA 1PO13 4N43A 5DN2A 3C7GA 1KFUL 1YIPA 4YM3A 2VXJA 5HCAA 2VGDA 5A33A 2WUHA 3NAPC 1MZFA 2ZX4A 4R4ZA 3RJRA 2RJKA 2P17A 1DF0A 1CN1A 1HN1A 3H3LA 3MW2A 5LY1A 3HJRA 3MLJA 5LZ6A 4X6RB 2E7QA 3B9CA 4XF9A 1JU4A 4XF3A 5DUXA 3R05A 5FMCA 3ZMNA 5A3MA 2RS31 3BPZA 1YHFA 2IXJA 1HB1A 2DCYA 1AYM1 1OKQA 1GOGA 1FT9A 1UOGA 3H0OA 4Q0PA 2ZA9A 1VR3A 4IETA 2D44A 1UMZA 4XIOA 4AI8A 2OIIA 4DOUA 5DDJ1 1P8JA 1XNKA 1YRZA 4QB6A 3K51A 4S2DA 5FQ0B 2WN2A 4OHWA 4AW7A 1DHKB 1NG0A 4EJRA 3B7MA 1RL3A 4LLFA 1JYTA 2WYSA 1GZTA 1K5MB 4HL0A 5ACA1 4OHYA 3M1HA 3JBG1 5DUWA 1CAXA 1QJY3 4MGTA 3FMGA 3OGVA 1QNYA 3VBRB 4BLJA 5KR7A 2BWCA 1DQ5A 5IYYA 2PHFA 2XL9A 3T0BA 3W5NA 5C8CC 5EWSA 5CISA 3VV1A 1ZRCA 3R4DB 3KCCA 2PMWB 3VHPA 1RHI2 1PX3A 3WNKA 3RSJA 4URAA 4WZCA 5I8SA 1NE6A 2XJPA 1VMJA 2EXIA 1QH6A 2A1XA 1O8PA 2YB7A 3E5XA 4YSFA 3AMQA 4Z1VA 4G3YC 1JZ6A 1AZDA 2C9AA 2R043 1AX2A 3LEIA 1JMUB 2VCBA 5T52A 1AJOA 3F95A 1WCUA 4M0NA 4AEDB 3I2KA 3SNMA 3ZYFA 1RUE1 4CU7A 2Q8DA 2Y6LA 5FYZA 3NRUA 4JRAA 2LM3A 4QX7A 5CVRA 3I3QA 1UU6A 2VECA 1H8VA 4FOVA 1QIQA 1PVC3 2XL7A 4AVAA 5I91A 4GH4C 3OD4A 4PIZA 4BQWA 3H8OA 4LHLA 3ALQA 1BQPA 4GMP3 2LS6A 3FUOA 3H1MA 1CAWA 5LBCA 2HLEA 1N3QA 3CIHA 2EAKA 1QDCA 3OYWB 5HV0A 3PUAA 3B9IA 5F3CA 2VVFA 3TEYA 4FPJA 2VO5A 4IV1C 1UY2A 2Y6GA 3RG0A 4QPIC 4QXCA 2WS93 4W6XA 1R081 1R64A 2RR12 3H3UA 2ZAAA 4LBLA 4A7KA 3IKWA 3BU0A 1RB8G 4HPKB 1RUG2 2X10A 1UMIA 2JD4A 1W8FA 1UY3A 4NMIA 4NO4A 3WDXA 3J26N 3C7HA 4Y1UA 2SBAA 3LZZA 4OZOA 4BE3A 1KDKA 3OGRA 3HQRA 1SBEA 4QHBA 1TME1 4FPCA 3PVBB 4LE3A 2E33A 1OD5A 1IKPA 1GZWA 2A6XA 2QQKA 1QJX1 2JDAA 2V5YA 2BP6A 1JYXA 4QDRA 3L2HA 2WZR1 4Z2WA 1W28A 2ET7A 2NPIA 4Q29A 5K0UC 1VBC1 1C8M1 4CCLA 3DEMA 4CCNA 2Y6KA 3VLBB 4H55A 5IVBA 4UYBA 4GKYA 2W92A 3NNMA 1WD3A 4YM2A 5IW0A 4IGOA 3VB9A 4YVSA 1M06G 3AKQA 1ASJ1 1UW8A 4JZRA 4Y24A 4NWVA 3ROUA 2E6VA 4QPWA 1W6QB 3THCA 3PU8A 1RUNA 2XQXA 4NHMA 4A41A 3WF0A 4CDXA 4GAZA 2IXHA 5FPBA 2IUWA 4I3PA 4CPBA 4K9SA 1LOBA 2ZXQA 4PIXA 4IE4A 5FMDA 4AI2A 4YPJA 1O4YA 4YLZA 1MQTA 5FZ0A 4C91A 2I45A 2VMHA 2RM21 5A3WA 3T2QA 1PM4A 3OGGA 1FI2A 4AQ6A 1EYBA 2JE8A 5CU1A 1OT5A 4ZXKA 3ZMOA 2ORZA 4Z8BA 2VOVA 1POV3 1S4CA 1FPN3 2VTXJ 2W46A 2ZTNA 1NYWA 2W5FA 4KBZA 4RGAA 2ZACA 3Q8AA 2WNUC 4JGZA 4QM8A 5F32A 4OZXA 4CCJA 2N7GA 3M2MA 2ZPXA 1J83A 2P34A 4Y4YA 3VBHC 2XVLA 1RUOA 1VBB3 3NL1A 4QPIA 5DAXA 1GOHA 4P5YA 4A4AA 3O1UA 5DPNA 4XPVA 3VDBA 4COUA 3KVAA 1BJQA 1BVP1 2D6PA 2QZ2A 3UT0A 1V6IA 3BCWA 5FY1A 1RUC2 1W2UA 2V4AA 4K21A 5CIRA 3CU7A 3CLPA 2XVGA 2HYKA 2WZPP 4GH4A 1KS5A 4K1ZA 4C0BA 5A1FA 2P3YA 1TNRA 2DV9A 3RYRA 3UYJA 1GWMA 4M3CE 1DCSA 2DYCA 4LIVA 2IFWA 3NJYA 2WAOA 2QQLA 2G9GA 1QJX3 1ND2A 3IDBB 1YWKA 4YZ1A 1PGL1 3U4SA 3ZXFA 5FZLA 2H6CA 3WUCA 4JTOA 2X09A 3POYA 1PM7A 3FLTA 5GZEA 5FREA 4EE2A 4COWA 4Q4W3 4CP9A 5F2WA 4Q4X2 1LNSA 4WM7C 4XILA 1IPKA 1XYOA 4P02B 1VBD1 1UIKA 2DCKA 1AR63 3G6JB 4Q8LA 2RS33 4BLIA 1JZ5A 3J8F1 5FZCA 3VKOA 1GNZA 4CUBA 4AYUA 3WF3A 4A7ZA 1DIWA 3OUJA 4BK5A 1UOJA 2E53A 2KD7A 1OF3A 1OOPB 1VMHA 3GHMA 4LUKA 4FOQA 4QGNA 5EJZB 5GLTA 3WY6A 4INDA 3LIGA 3SCFA 2X53S 1IQAA 1FNYA 3OB8A 2TEPA 3KQRA 5A80A 3U14A 3VDDB 4BIFA 5GZCA 5DUVA 3DUIA 1UKRA 3N7JA 3CJIB 4H2AA 1ST8A 1ZZ9A 2OW4A 4CP2A 4LKFA 5L19A 5ACA3 1N3PA 2WSUA 4RR3A 2LRPA 3K48A 3AZZA 1Z7S2 2XXZA 1GNYA 3PVEA 3IIAA 3I3BA 4XUPA 5ERLA 1GWLA 3V0BB 1GYKA 2D5FA 2JENA 4YZ2A 1RIRA 3V0AB 3H42B 1JZ3A 1WCKA 4IE7A 4AHZA 1REFA 4M3CF 3HN3A 1APNA 5F5CA 3N3HA 3MV01 1UL9A 2QDRA 4QGLA 3ECQA 1LCLA 2FZ1A 1DQ6A 2QVSB 2UWCA 2WR9A 3NV4A 2ZGLA 4OI2A 4W65A 5L9VA 2Y6HA 1CWPA 2WQ8A 2WWUA 3L2YA 4XCAA 5FZBA 3KHCA 3PJQA 4MGSA 2FDGA 1NUKA 4GULA 4CA9A 2WABA 4XUTA 3VD4A 1DG6A 1ULGA 1A6CA 1XU1A 1ZBE3 1W8UA 4HVOA 1RUJ3 3ACIA 4GD4A 1HRV1 2BEOA 2TUNA 3WDYA 3AXEA 3IMMA 3V56A 1VB4A 3VZJA 5BUVA 5JXGA 3GDBA 1VAKA 1O3SA 3MW3A 5EP9A 4WM7A 1QOSA 1LHVA 2D5HA 1KRIA 2VMFA 2JDUA 5JXJA 5JCTA 1NXMA 3ZSEA 4PLMA 3RRDA 3ORJA 3PMSA 3KT1A 1W9SA 4SBVA 2UURA 3I7DA 5FZOB 5C8CB 2R0FA 1UXZA 3R6SA 2CV6A 1QH7A 2YPJA 4PDWB 1CAVB 4MSVA 2XGXA 2JIJA 1VBC2 4LKDA 1OPMA 1S0EA 2D6LX 5KXCA 2E26A 2XJTA 3A4UA 4XXPA 4AXOA 2CYFA 4HOOA 2BWAA 3DXTA 4AI0A 4CEWB 3ZFGA 4CCCA 1X8MA 2FMDA 2OQ6A 3AVSA 3J4UH 1W2NA 4LBKA 4MUVA 1TMF2 1W8OA 2R072 4EQVA 1IS4A 1MACA 5FPVA 3SXWA 1Z78A 2P3KA 2CWSA 3ZKUA 5EPAA 4AEDC 5FK7A 2XMLA 4RQPB 5CFDA 3LA7A 1RUJ2 1ZX5A 4RR3C 2VCMA 4CDXB 1FYUA 3WQ7A 3HD8B 5FZEA 2G4IA 2HKXA 1DLLA 4LULA 1BK1A 1PO21 4QPGC 2B46X 5A3UA 5A1LA 1NA1B 5JMOA 1MQTB 1G86A 5JI9A 3QH6A 2RM22 3MIGA 5FXWA 4DXTA 3NJVA 3IDAA 2ARCA 1SFYA 4IE0A 4JHTA 1W9YA 5FZIA 3K77A 1O4ZA 2GC3A 1VJ2A 2Y34A 3WNMA 2C24A 1TG7A 3WW4A 2JKXA 5B4XA 3PUIA 4B1MA 3VBSA 1YQ8A 2OT7A 5EFUA 4QPIB 3RGBA 1W90A 5FO7B 3HAGA 3EYPA 1E5RA 1QEXA 1ZBE1 2OQ7A 3AKRA 2OPWA 1YLLA 2CGOA 1GU3A 2VUCA 2W87A 5A3PA 1H4GA 3RWKX 3VDAA 4UW5A 5T54A 3ZN4A 4CCKA 1W0NA 4MGQA 4CXYA 2FDHA 1WCSA 4F83A 3J7LA 4LK7A 3GNEA 2J7MA 3W20A 4LT5A 1HQNA 3RZZA 1CONA 5E1RA 3ZPOA 3O1TA 3Q8EA 3PJYA 3LFMA 1Z0HA 1QNWA 1J59A 4SLIA 1AYN1 1QXJA 2PHUA 3B3QE 5FUPA 3UJOA 5IK5A 5FZMA 1BHGA 1WKYA 1D4M3 2DDUA 1JBCA 2CSGA 4HBNA 5FZ8A 5A33B 1UN1A 4LK6A 5A7QA 3AP6A 3IPVA 4P9GA 3VBFC 2BYVE 3UGFA 4RGGA 5FBJA 3EXUA 1W9TA 2F6BA 4OUMA 3GM8A 4ARYA 2CWMA 2XH6A 1EY2A 2G9ZA 5FYTA 2LTNA 3E6BA 1XC6A 1OFNA 2W9XA 2VW1A 2X8KA 2ZGSA 4MG2A 5FRAA 3WG4A 4QKBA 1SFPA 2HWE3 3HBKA 5FY0A 3PURA 4XUOA 4BQ2A 5FR3A 3U4XA 3A0KA 3KT7A 5CFCC 5FZ7A 4K20A 5CKMA 5I8YA 2BZDA 4HKOA 5CADA 5FZ4A 3DF0A 2BDRA 5K9YA 1SLAA 1BEV2 2GC2A 2X5IB 1LOEA 3MICA 2B42B 4FPFA 4CU9A 3JZVA 2PLV3 4BQ5A 1RUI3 1Y9QA 4ZPIA 1S0CA 3WDUA 2VJXA 2VUJA 3H1WA 5LBFA 1IPSA 2MNGA 2WNUB 2J1RA 5J3UA 4XBLA 2AYHA 1ACCA 4BK4A 1NZIA 1KJLA 3AYAA 3N7MA 4P00B 3H50A 3HQUA 3KVBA 4LHSA 4XFHA 1H9WA 4L92A 1RMU3 4QHZA 4YW5A 5AVPA 4EWEA 4AL9A 3HNBM 1V0AA 5F3EA 1BBT3 1U5XA 2VNGA 2EIDA 1NCQA 3CL1A 3W21A 4B4PA 1H8TA 3MIBA 4BXFA 2YFUA 2VM9A 4D94A 5E89A 1E5IA 2C26A 4PI0A 1GKBA 2FCUA 3N35A 1RUE2 5I8TA 3ON7A 2WQZC 2HWB1 5JI7A 4DUXA 2Q8CA 4DEQA 1YI7A 4ZXEA 1A78A 3EHKA 3M7AA 3C2UA 1S2KA 5DUUA 4KNCA 3RDIA 4F3JA 4W50A 1AR83 3TN92 4TLFA 4YW1A 4JKKA 1G9CA 4GMP1 3BTXA 4AAXA 4ASMB 4GALA 1PGW2 1CAWB 2CU5A 4MADA 2JG8A 2W08A 3KSCA 2FCVA 2RS13 1LKNA 4E8CA 2AACA 1K5MC 3WNOA 3I49A 3JD71 5J98B 4NJ4A 2OYZA 3VBHA 3POEA 5FZOA 4GMP0 4I0WB 1AX1A 4AZZA 3ZFEC 1R083 2NMNA 3OOXA 3VDDA 1V6KA 4Q2FA 3CHXA 2WZR3 4AVVA 3HMYA 4A45A 5C5UA 3RS6A 3WNLA 4TTGA 2TNFA 2B4KA 2HEYF 2I74A 2ZGQA 3OSDA 4M3CA 2YC4A 1W06A 3Q8BA 3FBYA 5DQ0A 4EZHA 3M3QA 4OMCA 4MGZE 3WLUA 4AGGA 2EXJA 1E5HA 1FOD1 5J36A 1JYVA 1QJFA 1SCSA 1V6JA 3WVJA 1IG0A 5ANQA 1V6OA 3T1LA 4IEOA 1YJLA 5FZAA 3ZSLA 1ULFA 1GNHA 2KR2A 3AL5A 5DG1A 3NW4A 4L99A 4Q4Y1 5I93A 4MX3A 3A22A 5JXHA 5A3TA 4BH9A 4CDUC 4IW3A 2W2IA 3T08A 2BNOA 2YGLA 3KHBA 1DFQA 3POJA 3T1MA 3A0NA 1JUIA 1GSLA 1LESA 1WWYA 3GBFA 2B8MA 3KV9A 3SC7X 4Q8KA 1CZVA 1PGSA 4Q4X1 1G6NA 4KWKA 1VALA 3VBUA 1R093 2PHDA 1PNFA 3FN9A 1W6QA 4KG0A 1F35A 5AFEA 1QWRA 4NHXA 1H9PA 3ETQA 4X6QB 2XBO2 5FMOL 3ES4A 5BNNA 3ZIXA 2SLIA 1MS4A 2XOMA 1R1ZA 3K4ZA 3MFAA 3SKJE 1VBA1 2O1QA 5C3RA 2FQPA 5JZGA 3ES1A 3O0VA 2ZHNA 1FX5A 2ETEA 4A6SA 4FTEA 3O12A 1RUJ1 4JHZA 4AEDA 4RFT0 4S2HA 4CEYA 1PO12 1VBB1 2JG9C 5E6HA 3HNMA 5A7OA 1OH4A 4RHV3 4NPMA 1JH5A 1SLCA 5A6YA 3ZYBA 2Z2SB 5IK8A 1ENRA 3UESA 4ZKTB 5H9SA 2IXCA 4YG6A 1QGLA 5D8AB 4C1WA 1LECA 3N9QA 2D7FA 3VN4A 3SITA 5A3LA 1MZ5A 1W04A 2GMPA 5A1AA 3HVDA 4KQ7A 1WCDJ 1GOFA 1ND3C 1PX4A 1UOFA 4ZU7A 1ZBA1 3PLQA 1CPMA 1LOAA 4Q5OA 3WSOA 3R4SA 2UY9A 1TNFA 4LQRA 2XDVA 3AZWA 1CVNA 1BEV1 4KH9A 3UNPA 1XYNA 1UZWA 5HXMA 1KD7A 1AXZA 3B93A 4YGCA 2VMEA 1V6MA 3E5UA 4AAPA 3RZMA 1PHMA 4FFIA 5FO8B 3VBSC 4BISA 2B5HA 4XYXA 1XSRA 4OUSA 4CDUA 4RYDA 1ODNA 1J58A 2Q5TA 3HR9A 5FXVA 5G04L 1A8DA 1Z7S1 4FXGB 1NA1A 4TYSA 4XVHA 3QD6A 4GXLA 4J6GA 4UXAA 5LEKA 4QX8A 1NE4A 2DVFA 2JB4A 3N7LA 4IV1B 4PQ9A 1XNCA 3PU3A 5T5JA 3O1SA 1JW6A 3U37A 3I59A 4R9DA 3ZYGA 4QPGA 4QWNA 2BOJA 4Q4W1 4KWJA 1TZOA 5FZ9A 2WRAA 1NOVA 1HQLA 2C0ZA 3MPBA 4IEVA 4IE5A 3HNYM 3CJXA 4N8MA 5DZGA 3I2HA 3TAYA 1VBD3 4TSVA 4GJZA 1O91A 2JDPA 5JOZA 4CYDA 3NNLA 3JBG3 3SH5A 2QZ3A 2R063 4DFSA 4G9SB 4FFGA 4EV0A 2Y0OA 4Z82A 1BBT1 1MZEA 1XE7A 2P6CA 4RN5A 2FMYA 3ACGA 1CJDA 2DURA 1B35A 2QKDA 3RZJA 2CHHA 5FKBA 2W91A 3ZFGB 2G19A 2W94A 4Q0VA 3PVNA 3TBDA 1W6OB 3UKVA 4FBFA 4O9EA 2VW2A 4FVVA 1PVC2 4AHWA 5T5OA 2ZX1A 1I6XA 3NNFA 3PDQA 4Q26A 4UWDA 5F5QA 4D0QA 1W6OA 1YI9A 3WDVA 5F37A 4CDQA 4B7EA 3CQOA 1SFNA 1STMA 3AZXA 4XDPA 1EUTA 4MYEA 1YFXA 4JDMA 5D8AA 1URXA 1AVBA 1Y43B 2WNVB 1DQ1A 4YM0A 3BI3A 4HG6B 3WW2A 4ISQA 3WQBA 1MEC3 3EQEA 5FZGA 3T30A 4YGDA 1KEXA 2VZ1A 2PHTA 4XAAA 1EV12 5DG2A 4CTEA 2ORXA 2GP3A 1VRBA 5IVFA 5LBEA 3ENRA 4R9BA 5DABA 1X50A 2PQSA 2YC2A 1W3VA 3PMEA 1VBD2 1CX4A 3OBRA 2EALA 1VAMA 4FPEA 3ZFEB 4MGIE 3V0AA 4XIKA 4YW2A 2VOTA 2Q1ZB 5CFCB 1DZRA 4U2AA 1X33A 2EVXA 3POBA 5A32A 4PT6A 3IDEA 3S30A 1GQHA 4BQYA 2VMIA 3AP7A 1QKQA 1BYHA 3DYOA 2RDSA 4RQPA 4A3XA 5CFCA 1CQ9A 5LW9A 3GJAA 5C3PA 1QHDA 2H0BA 2ZMLA 5GKAC 4BCUA 5GALA 3THPA 2VQUA 1OPOA 2VH9A 4E4DX 3LE0A 4CP9B 5LY2A 4WM8A 3SH4A 5BY5A 1J3PA 2XBO1 3SCGA 4MGYE 3H1YA 1ALYA 1X9TA 2QQUA 1K5JA 2IXKA 3IWZA 3KV6A 1ZA4A 4KGQA 4XHXA 4Y5TA 4CP1A 4DXRA 5CNAA 1LRHA 4LXLA 2PAEA 2PHXA 1J84A 1JHNA 1WW7A 2ZMKA 5GLWA 1H8TB 2KA3A 5I0SA 2I2SA 2JE7A 1LGNA 4PI2A 2ADEA 1QU0A 2YBKA 4AFDA 4JKLA 1VBE1 4QX1A 4OQ9A 3WINE 1F31A 4UFHA 1RUH1 3ZSMA 3GCWA 2BNMA 3A21A 2DUOA 3OEAA 1G9AA 3ZFFB 2D6MA 1YYNA 5IVEA 1H4HA 4HVQA 4E4ZA 4KWUA 4CUAA 1S0IA 5CB7A 3CMGA 4L2NA 3JU9A 4OHZA 2QNKA 5CAZA 2Q1MA 3NV1A 4IDZA 4E2SA 1HXS2 3PUSA 4GWIA 4C8DA 4XUQA 1US2A 4FO9A 1RVF3 1LJ7A 1OH3A 2MPFA 2RV9A 2WNVA 1PO23 3OUHA 1QQP3 1AYN2 3N9MA 4W6YA 1DYPA 2PAKA 3QCWA 1U5ZA 2XHNA 2VULA 2VQ0A 3M3CA 2ATFA 4IEWA 2R16A 2RS11 1HJGA 2W52A 4E27A 2FHRA 1W6PB 3WX5A 2ZZJA 4Q27A 4RGKA 3T09A 3PTRB 5KHGA 2E7TA 1QXPA 1R1A3 1H0BA 1POV0 1W6MA 5LA2A 1LU2A 3DXUA 5A6XA 1UZZA 4YVWC 4B8EA 4P9WA 2XUMA 1ZREA 1F15A 4FOWA 4ES8A 2ARXA 3WNPA 3U75A 1WBLA 4UFKA 1YQ2A 2D43A 5JIUA 4FP2A 1WLTA 4N9IA 1D4M1 2P37A 5CG8A 1RGSA 4L9BA 5K7PA 3NKGA 3HIFA 1YQ5A 3O1RA 3T0DA 2XJUA 2WL1A 4KI5M 3O1OA 3RZHA 2QQIA 3KB5A 4XURA 2NQYA 3LCPA 1FV2A 1NY72 4HVRA 2VUDA 1SDWA 2QQPA 1F8VA 3N4MA 1NKGA 2WO2A 5G05L 3ZM8A 4R9CA 2HWB2 2VCAA 2DTYA 3H3ZA 4M00A 1EUUA 4ONUA 3ZSKA 5BNPB 5JSRA 4QB2A 5C3QA 3LGRA 4IV1A 4WBBA 1OXCA 3JQWA 4LORA 1DGLA 4CDWB 4IV3B 5AVAA 3VBFB 1NQDA 3O1VA 1BMV2 3VL9A 4A42A 2VBBA 2D6NA 4O7XA 2QQOA 1RHI3 2WKKA 4LUMA 1JZ7A 4Y4RA 3HN1A 1PMHX 4XDQA 1VBE3 2VAUA 4BZ4A 5CKNA 1WBFA 1Q43A 2P3JA 3PIJA 3HWJA 4J25A 4Q4X3 1V9U3 3HT2A 3OGJA 3BTYA 3PL0A 1XU2A 2BW8A 5FP8A 2FDJA 2OKXA 4AEMA 3BIEA 1CJPA 1PK6A 2B45X 2QQJA 4XAEA 2BVBA 2DVBA 2XLFA 1UY0A 2XONA 4A2UA 2ZKLA 3KV5A 4FAGA 4P9YA 3AMNA 5IAXA 1CESA 5FYVA 2A3YA 3QACA 2RMU1 1GQGA 2OUHA 3AMPA 5DDJ2 5EZWA 4ATEA 4GB33 5AC93 2UYAA 1HLCA 1CZTA 1L7QA 2C1FA 2ZHLA 4JCKA 5IJRA 2FZ2A 1JTZX 3M3EA 5J48A 2JDMA 4IL7A 5ACA2 3MIDA 4HSJA 5FO9B 2OUJA 3NAPB 1JZ4A 5F3IA 2IXIA 4HN1A 1RJ8A 2MHFA 5BPXA 2HWB3 2WYFA 3DYPA 2XWJB 3Q9OA 1IPJA 1GP6A 2NZ9A 2VNOA 4EN6B 5FMBA 2J1VA 1YEWA 2ARAA 1IGOA 1OKOA 1ULEA 5EV7A 1F2NA 2JECA 1PZ7A 1RINA 1MVQA 4NE9A 3C7EA 2DU0A 1NCRB 4NUBA 3ZOIA 1B09A 2G1MA 4D6RA 2IC1A 1RMU2 1ZNPA 4IEPA 1NLSA 2HWC3 3CBNA 4FPOB 4BXSV 4CCMA 1BBT2 2GH2A 2R0HA 4QXBA 4ZS3A 1AR81 1JYNA 5FAXA 3UGHA 5KWRA 2DCZA 5CBLA 3U0ZA 2X29A 4AFBA 5JSOA 2RVAA 2RJ2A 5T55A 4COZA 5FJKA 1DQ0A 5FY9A 4DB5A 2GDFA 2UY8A 1MEC1 4O61A 3M3IA 1C3HA 5LRRA 5IHRA 1W0OA 4I02A 1XOYA 5J96B 3WNXA 5FUIA 2VOKA 3WF1A 4DY3A 5L36A 5DDJ3 2J1AA 2IZWA 4HK9A 2ZGPA 2VQTA 2BFUL 3K4DA 3ZYHA 5JOYA 2V72A 4D8MA 5E8AA 3ZO0B 3JD72 4UT5A 3VBFA 4CXWA 5JAXA 3MFCA 4QDSA 4CU8A 4IEQA 2YGMA 4XQDA 2YG0A 2JJ6A 2ZX0A 1UZYA 4LO8A 4LE4A 2EICA 2WO7A 3FJSA 1PNGA 3V65A 4BM8A 5LA0A 3OD0A 1QJEA 1AXKA 4PDWC 5FZ3A 1CD3G 2W47A 4PJYA 5DXDA 1R1A2 5F8PA 4IEYA 2WS92 1W9WA 1NT0A 2WO1A 1DZQA 3L9JT 5BXXA 1CAVA 3LEMA 4UW6A 4YGEA 2C5DA 4L8QA 4M3CB 4UFMA 4I2OA 2UWAA 4PCRA 5EJ3A 3B01A 2Q4SA 5FYBA 2ZEYA 2HWF1 4OFGA 3I54A 1D0GA 2RE9A 4FTBA 3THDA 3D4KA 2D97A 1BKZA 1LEDA 1OLME 2QJVA 1QJU1 4HXCA 5FIXA 3BTZA 1OC1A 5D21A 1TMF3 1CAUA 3ZXGA 1R091 4NN0A 3D0SA 3MW4A 1JXNA 2HEVF 4DNYA 2BQPA 2J22A 1PZ8A 3I2GA 2Z69A 1JUHA 3ZYPA 2CL2A 4CCOA 1RUF2 2XG3A 4WVMA 2GMMA 2VNRA 1YFYA 4XFGA 5CA6A 3IBMA 3PVOA 4QXKA 3VD5A 1ULOA 4CE8A 4DRRA 1H30A 1Q8SA 5FBZA 5T5LA 1OLQA 4BMBA 1NLRA 2BTVC 1UKGA 4W8JA 1DYKA 1IS5A 1VBA3 1NQJA 1ZBA3 1G8WA 1GUIA 1HRV3 4AWDA 1AHSA 4MLOA 4FI9A 4Q4V2 1A3KA 1V70A 2DUPA 3M3OA 5C9AA 2ZGUA 3R0RA 3E6DA 1D4M2 2PTMA 2PQQA 4CVUA 3GGLA 4MHUA 1K12A 4AGRA 5K0UB 1QDOA 4HONA 4NRQA 4CUGA 4M0HA 4AE2A 4QU2A 1OUXA 1YFWA 4E9KA 1DZTA 5I0UA 3PUQA 4XJ8A 1J3RA 2ADDA 1PIV2 3U1XA 3VBRA 1GMMA 5DZFA 3WOGA 1JI6A 4ZU5A 5J7MA 3BOWA 1DGRN 1H1AA 1PO11 1VBB2 1HN0A 2ZJCA 1OQ1A 3POFA 5HXVA 4K7JA 3ZXKA 4H7LA 1OVSA 4BQ4A 5GLUA 4Z2AA 4FPHA 1HX6A 2QFEA 4ZY9A 3U78A 4NRPA 4JVAA 4PLOA
chains in the Genus database with same CATH topology
4AQSA 2DCJA 3BIWE 5JR7B 5K8SA 3IM0A 5F1RA 2GU9A 3WD5A 2B7YA 4NR1A 4P5HA 5CFDB 1RUI1 3KLSA 4I3GA 4YVSB 1EPWA 4LO7A 1SACA 1CAUB 2GC1A 4Y1YA 2HWE2 4XMAA 3GALA 3I8TA 3J9SA 4QT6A 5IUQA 2W0XA 3WP4A 2YDEA 1MS9A 2JG9B 4Q4W2 3FX3A 5F9TA 4B3NA 2A71A 4IEUA 1OQEA 1PVXA 2WT2A 3QBQA 2R061 3AMHA 2O8OA 1PGL2 3CF6E 1KS4A 1X7NA 5C33A 5JVVA 3AYCA 1U5IA 4XJWA 5KC6A 2D3RA 4JTNA 5GZDA 5BNOB 4MXVA 5ABJA 1JN2P 2PYTA 1AJKA 3QH7A 4PIYA 3FUQA 2K9ZA 1AYM3 3FFQA 2XHKA 1NCQB 4P9IA 3WCRA 1Y7BA 3ILFA 2YC0A 5F6LB 3M70A 5JWPA 2XJQA 4GWMA 2XJVA 3BTAA 5KC5A 1OA3A 2YMZA 3WHTA 2WIIB 1YIFA 3DL3A 1YXWA 4CDWC 1QJY1 4HN0A 2RS52 1F9KA 4AVSA 1UD1A 2NN8A 2LUWA 4PLNA 3TN93 1AR61 3ZSJA 3SISA 3WQ1A 4BMEA 1J1LA 1Y3TA 4MXWB 4LO4B 4YYOA 5D8AC 4FPYA 3J8F3 2V73A 1SBDA 2AREA 1HDKA 4Y5Z0 1GICA 3OJBA 2UYBA 1S2BA 3JCIA 1XE8A 4JQRA 4LR4A 3QOPA 5FMOS 4YVWB 4RS5C 3USUA 3VHNA 4HMZA 2HWF3 1MZ6A 1XNBA 4LBQD 3MIFA 1FMD3 3MLKA 2JG9A 1U5YA 1B35C 5T5PA 5FQ0A 1EAH1 1O5UA 4XTMA 4DS0A 5FPXA 4QX5A 4FQ4A 3ZXDA 4XQWA 1ZRDA 3KMHA 3AM2A 4XXAA 1AL0G 2ZAHA 5JLVA 4JAAA 4Y1VA 3WG3A 4DY5A 5BNPC 1AR91 1CIWA 5C8WA 1MS0A 4OULA 3OTFA 1REDA 3ME2A 2PFWA 2PAMA 1RVF1 1TMF1 3ZFFC 4F8AA 1LHWA 2KXLA 1LB2A 3BOPA 2DVDA 1C28A 2DF7A 2VMGA 5L7OC 3CJIA 2VVEA 4N53C 4HFSA 3P3NA 5T3NA 5C9AB 1E57A 4NOTA 4BA6A 5IK4A 1EP0A 2ZHKA 3WP5A 5JSPA 4YFZA 2Q0AA 2YYOA 1BCXA 2WA3A 4CEYB 3UKNA 3POSA 2E7AA 1N1SA 5H9RA 4AQTA 1FPN1 4DRVA 2GMEA 1ULDA 4DQAA 4IV3A 4BHPA 4BYYA 4X8PA 2R1BA 4AVCA 4TWTA 3ACLA 4DXZA 1W6MB 3AMMA 3OY8B 3VZNA 1UU5A 3O0XA 1NXD1 4GWNA 5I0RA 1ND3B 4FPKA 3OCPA 3LKJA 2B9UA 3U11A 1NCRA 3MF6A 4Q1RA 1REEA 4OI0A 2PHRA 2O0OA 4KU7A 1LTEA 4LBJA 3AP9A 2ZKNA 3AJZA 3LAGA 3GZAA 2GN7A 5GM0A 1LEMA 1DDLA 1RUH2 2YY1A 2CAVA 5JDBA 3ZN5A 3KGLA 2O8QA 4FXKB 4QMAA 3MF9A 1N1TA 2OA2A 4P9XA 1HQWA 1QJU3 4Q4Y3 2WA4A 3SH3A 1TME2 1W0PA 3KT4A 5GLVA 2ZGOA 4IV3C 2PA7A 1QJX2 3FE5A 3H7JA 3CEWA 2AUYA 1F5FA 1UF2C 2E51A 2HJIA 2YV8A 3VBUC 4EN0A 3UJQA 5EYYA 2H6BA 3MEPA 5JIAA 1VP6A 4K40A 1Q3EA 1IKQA 4CRQA 1O7FA 3W59A 2WFF3 5C6CA 1ENQA 2A6WA 4OLLA 4GKXA 2A5ZA 4XF4A 1MS1A 2P2KA 4JDOA 4D7TA 2Y26A 4HPKA 2AENA 4RA0A 1O3QA 1Q8PA 5F6KA 4K8FA 3J8F2 4X8NA 3U10A 1GFF2 4O9GA 4D7SA 2F4PA 1W6NB 3LA3A 3RI9A 1VRH2 4FPGA 1KFXL 2HWF2 3E5QA 3VBOC 2WC2A 3AB0A 3MI8A 3ZN6B 1W6NA 4GB31 4NHLA 3NJZA 5AC91 2YXSA 1X36A 3KD4A 1FMD2 1GZCA 4ISRA 4C0HA 1KJRA 3WXPA 5B2GB 1C8NA 4YM1A 3AFKA 4P9LA 1QJY2 2KM2A 4N7IA 3OY8A 4B4RA 3APBA 5E88A 5DZEA 2RS51 2HWC1 5FLJA 1U12A 5H9QA 1ULCA 3AKPA 4HK8A 2JG8C 3MIHA 1SLBA 5FDBA 4TZDA 1C1LA 1DGWA 4XJ9A 4XJZA 4XTPA 4PBOA 1EV13 1HV0A 3VUOA 3ZXLA 4C90A 4MV2A 2EIGA 1AUYA 2DFCA 1T6GC 1S0FA 1Z7S3 1LOFA 2IWGB 4XBNA 1HW5A 2BFUS 4S2GA 4LBQA 1IS3A 1FV3A 2JEMA 4M01A 2ARBA 4LBMA 2XPJA 1AR82 3LSEA 3H7YA 5BYNA 1AF9A 3PNAA 3RMYA 4AFMA 4Z92B 1WLDA 1I9RA 1FXZA 3U07A 3BB6A 4WZFA 5C4WB 2EXHA 4XEZA 2VXRA 2GNDA 4N43C 4CDWA 1LOCA 3O5SA 5HBAA 1SEFA 1V00A 1OI6A 5HCBA 4ATFA 4FOYA 4WM8B 3ZX7A 1FAYA 3AZYA 3RJ2X 1PK6C 2XWBB 2LALA 1ASJ3 4N9HA 2WNVC 3GZTB 4NWWA 5EXOA 5GZGA 1XYPA 2GSYA 1EAH3 4J1XA 2QDNA 3TNQA 3RI8A 3D8CA 2VQAA 1KXGA 1RUG1 4RSUA 3VZKA 1C57A 1DGRA 1QQP1 5JZGB 2DWRA 1RUH3 3ILRA 2BBVA 4JGZB 3CO2A 2Z5WA 5CFDC 3UK9A 3FHIB 4Q4Y2 4KBBA 1KITA 1SMVA 3N7KA 3SCHA 1Q8OA 4FP3A 5AFEA 5FPZA 1O3RA 1R1A1 2V09A 1PZ9A 2DTWA 1PIV1 1LOGA 4N7UA 5J37A 2CTVA 3AX4A 1PO22 4FQZA 1R092 4BOWA 3PTYA 4I09A 2DFBA 3MZHA 2AH2A 1S0DA 4XW3A 4Y20B 4AQ2A 4LHKA 4QQOA 4BPZA 2ERFA 3VBHB 2NMOA 3D5OA 3VKFC 4R8HA 1VBA2 1ASJ2 3S7IA 4AHXA 1ND2B 2RR13 4LBNA 3WHUA 4D7YA 1QY4A 4CP0A 4EWAA 3FLRA 2R071 2XKOA 3AYDA 2CAUA 1MS5A 5SV5A 4CDUB 2X5IA 1MVEA 1H2KA 2JE9A 3AYEA 4AGVA 1S55A 2DVGA 4HANA 3SHRA 1IHMA 2XKPA 4QQ2A 4XFCA 1H1IA 2D6OX 3FFZA 5FTTC 2E9QA 3LB9A 4N53A 2A7AA 3W9AA 2YUEA 4XMIA 4EN9B 4CEWA 1BMV1 2ILMA 4JGYA 5KHIA 5LEJA 4EROA 3WW3A 2CNAA 3OBTA 4MXWA 3VGIA 1S0BA 4FSJA 3ZFEA 1RUC1 3IN9A 3O7OA 2VVDA 3V64A 2YZ4A 1OLRA 4BIOA 4YARA 4KL1A 1ENXA 3USUB 3B69A 4CEYC 2WINB 4KU8A 4RHV1 1W39A 4C1XA 4CDQB 1G9BA 4RS5A 2GNBA 4E2GA 1RUI2 3WDWA 3LOIA 3GZUC 1RC6A 1M4WA 4I30A 4QD2A 4AI3A 1O4TA 4B7KA 3NVCA 2A3WA 3D82A 1QMJA 4IERA 2WLPA 4B29A 1WW6A 1C5HA 4MZUA 1AR62 3VBSB 2K0GA 2MEV1 3E97A 2W68A 1AR73 3HQXA 4XOGA 1ZZCA 3TB0A 1NCQC 2WT1A 3LSDA 1LODA 2ZHMA 1XNDA 4GH4B 5HCFA 1OA2A 4XZPA 1TQ5A 1WGPA 3VBOA 3V0AB 1BEV3 1QOOA 1WMDA 3ATGA 1LHNA 1C1FA 3JD73 1XQNA 2A75A 2ZCWA 3AP5A 3NV3A 4RD7A 5K0UA 5C8CA 2PLV1 3B02A 3WDTA 2RHPA 1DU3D 3BODA 1MEC2 1XXNA 2BVVA 3JB4C 2HWE1 4Q0QA 4DPNA 1EV11 1J1TA 2GC0A 4YW4A 4ITCA 4JC1A 2BNNA 1SBFA 1G9DA 3VZLA 1K5MA 5ABJC 2R042 5H9PA 3TN91 3POWA 5KXEA 2D93A 2XJRA 1N1YA 1S0JA 2ZABA 3USSA 1KQRA 4LBOA 4XFIA 4KGGA 3VL8A 4AVBA 4OI1A 1LHOA 1S0GA 1DBNA 1HXS3 4K1YA 4KG8A 2DVAA 1FMD1 3ZN6A 1DGWX 1RUD3 4DZGA 1NCRC 1BXHA 1YNAA 3AFGA 3MGUA 1B35B 1QF3A 2A3XA 3RYKA 1YCIA 1SLLA 1BZWA 2PHLA 4H14A 4URTA 3VZOA 5FFOC 3NAPA 1XRUA 4JRLA 4AFCA 1EPZA 4N90A 4LHNA 4ZU4A 5HI0A 2HWD1 3ZIWA 3O0WA 3QLQA 3IPVB 3OYWA 1D2SA 4Y1ZA 1CR7A 4GQ7A 1H2MA 2CGPA 3NKTA 2G9FA 3FZ3A 4YVSC 1R082 1PGW1 3ZXAC 2WJSA 1AL21 1AR93 1LGBA 4P9JA 5GJ6A 1RUF3 3ZPYA 2BPA2 3DN7A 2JDZA 1FOD2 2A6ZA 4Y20A 1IS6A 4NVPA 5KBFA 3VBRC 4YZ4A 2P3IA 1LHUA 1ZZ7A 3KGZA 2ZX3A 2ZOEB 4Y26A 1ZBE2 3ZXJA 1PIV3 5LK7B 2YHJA 3WP3A 5SV8A 1RVF2 2QUOA 4W6WA 1RUD2 2OVUA 1RJ7A 4Q4V1 5IT6A 3FLPA 4XF1A 3N36A 4COYA 1COV2 4IQPA 1NZCA 2ENRA 1SLTA 1UCXA 1LR5A 4OI4A 2WFPA 2EXKA 2ZGKA 3B5LB 4YG3A 2VY0A 1AR92 2D6KA 3IT8A 4D69A 4Y22A 2WNEA 3WT3A 1HXS1 4JGYB 2XLAA 4ASLA 1YJKA 2EF6A 5TSWA 5JMCA 2WFF1 4LA2A 5JZGC 3SMHA 4YVWA 4YRDA 4UBGA 1FPN2 3RPQA 2B39A 4FAHA 2GH8A 1VRH1 2EAAA 3P3PA 5L7OB 4LBQB 2PHWA 2ZGTA 1J3QA 4XQ4A 1OOPC 1GV9A 5KHHA 3ZYJB 3I2DA 4U36A 4H7MA 1VB2A 2R49A 1VIWB 4LTAA 1DQ2A 3H9AA 1ENSA 4LO5B 2X5IC 2RM23 4R52A 4NPRA 3WZ1A 3JUUA 4WV8A 4YW3A 1RUC3 1GZ9A 1WUVA 2HWC2 1COV3 3FBMA 2XLGA 3NV2A 3GF6A 5LRSA 3BU7A 2GNTA 4BWOA 4OHVA 4Q1PA 1WLWA 2R062 3AXDA 5EYXA 5BNOC 3ILNA 2E63A 5FOBB 1H2LA 2R32A 3ST7A 1SLIA 3DPRA 1ZVFA 2RMU2 4JDNA 4UBHA 1F5JA 3M8LA 4FT8A 4GB32 3VBOB 5T50A 5AC92 3WCSA 3VHOA 2EA7A 1DQ4A 3M4FA 3DPRB 1WLCA 3ELNA 2Z42A 1RHI1 1OQDA 1I3HA 1ZZ6A 4IEXA 4WM7B 1X82A 2PLV2 1AR71 1OHFA 4Y1XA 3WV6A 3S7EA 2ES3A 1HIXA 1WD4A 2DUQA 4EN8B 3JBG2 2JG8B 3UKTA 2XVKA 2D40A 1VAVA 1FATA 4IESA 4DINB 4WVVA 4AG4A 1V6NA 2CGNA 4RL7A 3WG1A 1CGPA 3FC0A 3G7DA 2RS32 4H3WA 4AF9A 4XFBA 4FTSA 4R4XA 1U0AA 3URFA 4E4SA 1V9U1 4YNIA 4LNVA 3AK0A 4COVA 1RUE3 4HKLA 1RITA 2RMU3 3UV9A 4XFAA 4A7YA 3AKSA 2D3PA 4N43B 1ONAA 1HRI2 4IXLA 1CAXB 3D0JA 3VKMA 1TE1B 2MEV2 2PELA 1JYIA 1UPIA 1FNZA 5IK7A 3EJKA 4WVZA 3AKTA 2R041 1ZRRA 2AZ5A 2R1DA 5BNNB 4L11A 4K6BA 1N47A 3THTA 1AL23 2NM1A 4E2QA 1GBGA 2A6YA 4QQPA 1HV1A 2Q30A 1UAIA 1VLNA 4EN7B 4Q0UA 3ZVXA 1LENA 4YZ5A 3T2TA 1PVC1 4YFWA 4AK3A 2GALA 4AHYA 4JGZC 5KXBA 1OSGA 4XBQA 2Q8OA 4FPLA 1L3JA 2AR6A 3ZYIB 4XE9A 2WSVA 3TWIA 2ZGMA 3W58A 2IXLA 1QQP2 5L73A 3HBZA 3EBRA 4I01A 4RS5B 5C4WC 3MLLA 5BNQA 1Q56A 2BUKA 4CEWC 2ZZQA 5GZFA 3RWNA 4QQHA 2VU9A 2DU1A 1C8M3 1IZ3A 4DMIA 3VZMA 1QXRA 3RYPA 2A73B 1ZBA2 2RR11 2D3SA 1UU4A 5JSOA 1PK6B 1QJU2 3DGTA 4HLTA 1ND2C 4YGBA 4EWDA 3MDPA 3EO6A 4Q4V3 4QPYA 4XJAA 1G9FA 1GANA 2ZMNA 2XBO3 2GZWA 1VBC3 2R30A 1RTVA 2CY6A 4Q0SA 4QPGB 2QE3A 3OPZA 3RQ0A 1RUD1 5J09A 2ZX2A 3MIEA 4RHV2 2K2SA 2PN5A 3S0MA 5C4WA 2NLRA 1WW5A 3CNAA 3D6EA 1WMEA 3NWKA 3TYJA 3ZYRA 1POV1 4BQ1A 4GIQA 1LOFC 3VBUB 2OZ6A 5C9AC 1ZZ8A 1WMFA 1HKDA 2VOWA 3GHNA 1SQ4A 3VDDC 3TOJA 2ZGNA 3MYXA 4HT1T 1VBE2 2A70A 3KS7A 2RJLA 1H1MA 1OMIA 2W39A 5ABJB 1ZRFA 5I0TA 4R9AA 1UPSA 2WFF2 3TRSB 1LULA 1YUDA 3R4UA 3TNPB 1ZM1A 1D2QA 2VW0A 3FWEA 1O3TA 2WWSA 5KHKA 1I1EA 3O14A 2WT0A 3VKNA 4XJUA 1A8MA 2JX9A 4XHBA 3ZFGC 1GZWB 3AJYA 2YROA 2VPVA 2UWBA 3C3VA 2GAUA 4MH0E 2RS53 4FCAA 1MS8A 4LO6B 5KHJA 1HRI3 1MS3A 4XFFA 3KM5A 2HWD2 2MEV3 4V1PA 4RQPC 5GLZA 1V9U2 1AX0A 1LGCA 3IMNA 1O5LA 4L97A 1D4VB 4UW3A 4YG0A 2WS91 2QCSB 4F7ZA 1GLHA 4K3UA 3ZFFA 4D3WA 1AL22 4HETA 3WUDA 1AYM2 4LEJA 1OFSA 3NO8A 1C4RA 1G7YA 2IFRA 3KCXA 1N1VA 3WP6A 1I5ZA 3VKLA 2VG9A 1UX6A 4XETA 4AVTA 2Z79A 1V6LA 3E6CC 3I59B 2NP0A 2WLQA 4MVTA 4XF0A 3V0BA 1RMU1 4LLOA 4WVWA 3GBGA 4WVMB 5AFBA 3ASIA 4CDQC 4PBPA 4GA9A 3ZXEA 3JB8A 3BALA 2FBEA 3S6PA 2XJSA 3H8UA 2R6QA 5FLIA 3RMXA 1JOJA 2I07B 1ZZBA 2NYYA 2HWD3 3PHMA 4LA3A 4ORFA 4WM8C 4AEKA 1C8M2 2TBVA 3JQXA 4IEZA 2Y38A 5JPNB 4AI1A 2HEWF 5E16A 1H8TC 2JKBA 4RR3B 2A6VA 5FOJB 4CDXC 5BNOA 2OZJA 1PMIA 2JXAA 2VOXA 1NA1C 3KZ4C 5JPMB 4JGYC 3DPRC 2AGSA 3B00A 1EAH2 3WG2A 1Q5OA 1RUF1 1ZYBA 2GN3A 1YO8A 3X29B 1HRI1 1Q8QA 1QJZA 2ZGRA 4KWLA 2DCTA 1YFUA 4JV4A 4UW4A 2VUAA 5D1IA 3LA2A 2H0VA 2WZR2 3IDCB 4B4QA 4HZFA 3DKWA 4QQLA 4NHKA 1CPNA 1OOPA 4YZ3A 5FLHA 1ND3A 4Z07A 1W6PA 2RS12 5CG9A 5KXDA 3INAA 4HKWA 2R073 4ES9A 4Y22B 5A32B 1FOD3 3AP4A 3RNSA 2WQ4A 1OA4A 1LU1A 1C5IA 5BNPA 1HRV2 3UL2A 3VHRA 1WW4A 3LWCA 3DV8A 4MGKE 1S1AA 1TME3 4QM9A 2OPKA 2ZS6B 3B94A 3GYDA 1H2NA 2XB6C 4PF5A 3AZVA 2UU8A 1GR3A 4CZSA 1KDMA 3ZDSA 2WNUA 1NY71 1MQTC 4OHXA 4AEJA 4AFAA 1MR5A 1D0HA 2Y0IA 2ET1A 5BNNC 5JOWA 5JOXA 4P14A 4QGMA 3KCYA 2JICA 3HT1A 3WW1A 4I0BA 4META 1AXYA 1X8EA 5LK5A 3GBWA 4OVEA 1JYCA 3OF1A 4N53B 3WR0A 1RUG3 1WA4A 2BGCA 3MPPG 4G4FA 1BVVA 3SLIA 4J1WA 1SCRA 4HSLA 1VRH3 3CJIC 5L7OA 3LOBA 1N3OA 1QOTA 1UIJA 2D98A 2ZBJA 3I4IA 4S2FA 1COV1 5FCCA 5BV6A 3WQ0A 4I0AA 1IOAA 2GNMA 1AR72 1TEIA 3NSTA 4PDWA 1AYN3 1Q8VA 1PO13 4N43A 4YM3A 1KFUL 1YIPA 5HCAA 2VGDA 5A33A 3NAPC 1MZFA 2ZX4A 4R4ZA 3RJRA 2RJKA 2P17A 1DF0A 1CN1A 3MW2A 3MLJA 4X6RB 2E7QA 3B9CA 4XF9A 4XF3A 5DUXA 3R05A 3ZMNA 5A3MA 2RS31 3BPZA 1YHFA 2IXJA 2DCYA 1AYM1 1OKQA 1FT9A 3H0OA 4Q0PA 2ZA9A 1VR3A 4IETA 2D44A 1UMZA 4XIOA 4AI8A 2OIIA 4DOUA 5DDJ1 1XNKA 1YRZA 3K51A 4S2DA 5FQ0B 4AW7A 4OHWA 4EJRA 1DHKB 1NG0A 3B7MA 1RL3A 4LLFA 4HL0A 1K5MB 4OHYA 5ACA1 3M1HA 3JBG1 5DUWA 1CAXA 1QJY3 3FMGA 3VBRB 1QNYA 4BLJA 2BWCA 1DQ5A 2PHFA 2XL9A 5C8CC 5EWSA 1ZRCA 3VV1A 3R4DB 3KCCA 3VHPA 1RHI2 3RSJA 4WZCA 5I8SA 1NE6A 2XJPA 2EXIA 1QH6A 3E5XA 4YSFA 3AMQA 4Z1VA 4G3YC 1AZDA 2C9AA 2R043 1AX2A 5T52A 1AJOA 4M0NA 4AEDB 3SNMA 1RUE1 4JRAA 2LM3A 5CVRA 1UU6A 2VECA 1H8VA 4FOVA 1PVC3 2XL7A 4AVAA 5I91A 4GH4C 3OD4A 4PIZA 4LHLA 3ALQA 1BQPA 4GMP3 3FUOA 3H1MA 1CAWA 1N3QA 2EAKA