4XFUA

Structure of il-18 ser mutant v
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
156
structure length
149
Chain Sequence
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTNAPRTIFIISMYKDSQRRGMAVTISVACAAASTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRRVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEELGDRSIMFTVQNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-18
publication title Crystallization of interleukin-18 for structure-based inhibitor design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 29
structure length 149
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4xfuA00
1PUUB 1NUNA 1S0DA 2GO2A 5FZZA 3RMYA 1TTUA 2D23A 3Q7XA 1V6WA 4I4YA 5BP5C 4JPZA 4LO0A 2KKIA 4XFTA 3CRIA 4IYBA 4LO3C 4ISRA 1XYFA 1S0GA 1DZDA 4KEKA 1AVWB 1YYNA 3VT0A 2AQZA 2KI4A 3I29B 3O3QA 1BASA 1YXWA 2HW9A 3RSJA 1G9BA 4OWLA 5G00A 3P53A 5FZYA 4I8MA 3WINC 4GOVA 2GZBA 1E0OA 4EB2B 2RG9B 2D22A 3VSZA 3H6RA 1S0EA 2AAIB 1R8OA 4I7IA 3VWCA 1BARA 5JMCA 4LO7C 1BFGA 4QC4A 1PZZA 3JUTA 1QXMA 4I4VA 4JAWA 4X37A 5F8SA 3V0BB 1RMLA 4H9WA 2ESUA 4I6IA 1G9DA 5F8YA 3ZC9A 1W3AA 3CRGA 1PWAA 5FNWA 2RSTA 2Y9GA 3IM5A 4Z8SB 1Z2VA 3OGGA 3EF2A 4ENDA 3WO2A 4A7YA 2K4AB 1ISZA 3PHZA 3OJVA 4AN6A 3FJ9A 1HWNB 1HWPB 4GAIA 5FZUA 3A07A 3MALA 3BTAA 3AZVA 1MC9A 3ZXGA 4GP0A 3IAGC 1BLDA 5BXRA 1AXMA 2ZQNA 1DJSB 4LO0C 3FJAA 4G9NA 2NTDA 1UPSA 3CA0A 3FUQA 4I96A 4I4XA 1M16A 4XFSA 2AXMA 4OEEA 2VUAA 3T8SA 3HALA 3FJIA 2NM1A 1CE7B 4L4HA 3D7WB 3WINA 2VSAA 1SR4A 4JKXB 1FWUA 4QD2B 3H6SE 4D0TA 4I0YA 4ZFUB 3BAHA 4F34A 5B2HA 2DRYA 4DEPA 4L4IA 3VT2A 3BAGA 3FJEA 3NJ5A 4OW4A 1WBCA 4J2KA 2RQ9A 1PUMB 4I4QA 3WO3A 3SNVA 2MLLB 4AN7B 5EC5A 3BAVA 4EFRA 2D44A 41BIA 3CAHA 3AKIA 3N7JA 3OBRA 4I1BA 2F8XC 1BA7A 1QQKA 4HA2A 3S8KA 1DLLA 4ZGRB 1IRAX 2BEAA 1P63A 4I37A 1SZ6B 4ZOTA 4QBVA 4I4SA 3CU1B 4H04A 4IONA 1GGPB 3NBDA 3VT1A 3O4CA 1HKNA 3CA6A 1JT4A 4LO8B 1FQ9A 1EPWA 3HN1A 4HR6C 1HIBA 3NBEA 1TP0A 1AF9A 2Z49A 1DIWA 4WBCA 3QR5A 3V0AB 2BFHA 3AJ5A 2LIQA 3UD9A 1WD4A 1Z4SA 4F83A 2D20A 1SR4C 1ILR1 3O4BA 4ZA3B 4XKIA 1ITBA 5D61A 4IZEA 4OEFA 3I2AA 2NP0A 4FGFA 2UUSA 3CA5A 1YF8B 3N0KA 3V0BA 1CVSA 3BB2A 3K1XA 4G9MA 4KC3A 1IRPA 3N7MA 1XHBA 3FJHA 4G6MA 4P6AA 3O49A 2AFGA 4I4OA 2WBCA 3IM7A 1JY0A 1ABRB 2K43A 2FGFA 3RMXA 1DFCA 5BOWA 3RTJB 4USPA 6I1BA 4FVVA 5BXPA 4DENA 3FJKA 3H6RB 1DQOA 3N7KA 1HCEA 1FV2A 3R4UA 3VUOA 5D62A 3MPPG 1V6UA 3Q7WA 4LO1C 1IILA 4A7ZA 4GP3A 4CJMA 1ISVA 4QALA 4IY8A 3QYDA 4PC4A 1TFMB 2P39A 3UD7A 3WMVA 1F31A 1Q04A 1IJTA 1WD3A 1JT3A 1I1BA 3HOMA 3WO4A 3AZWA 2E4MA 1YTOA 2ERMA 1JT5A 3A21A 8I1BA 2Y9WC 4ZLBB 5BQUC 3F62B 2DS0A 3BA4A 5DZUA 2KH2A 2VLCA 1M2TB 4KEJA 2K8RA 1J0SA 3BAQA 3TC2A 1S0LA 4II0A 1ISXA 1IOBA 2VSEA 1I1EA 1Q1UA 1XG6A 3BRDA 4ZBVB 3I2XA 3Q7YA 2NYYA 4YOLA 1EYLA 1T9FA 3PG0A 3FUOA 1QQLA 4J2XA 1FWVA 3AKGA 1II4A 2D7IA 2FFUA 1W3GA 3W9TA 1YBIA 4I3NA 3UDAA 4J2SA 1FGAA 2Q3NB 3PUBA 3FJBA 1RZOB 4XFUA 1W3FA 2ZQOA 2WRYA 2Y9FA 9ILBA 3ZX7A 1G82A 4JRAA 2F2FA 4Q91A 3S8JA 2BEBA 4D8HA 1AFCA 1RY7A 1BFBA 2VU9A 1RG8A 5I1BA 1BLAA 1DFQA 3HMYA 4LO1A 1S0BA 4I1EA 4I2SA 1TWMA 3JRRA 4KBBA 4I4PA 4LO7B 2YUGA 2FDBM 4EFQA 1MD6A 2NZ9A 2KLLA 4KEIA 1G9AA 2D24A 3OJMA 4G1RA 2E4MC 1ISYA 3ILAA 2M49A 3CRHA 3V79C 3V0AA 1Z0HA 1BFCA 3AKHA 5BQUA 4X39A 3WA1A 1BFFA 4IZXA 1T4QA 3AJ6A 2HWMA 4J2YA 2HZ9A 3LTQA 4P0KA 4QD2C 1ONKB 5JLVA 3FJFA 1JT7A 1S0FA 4OEGA 2X2TA 1S0CA 4Z9WB 5BXTA 4USOA 2D43A 2DREA 4ZFWB 3AH1A 1L2HA 5BVPI 2L5XA 1TIEA 1R8NA 1FMZA 5EG6C 2XOAA 1JLYA 4Q9PA 3H6QA 4IY9A 1G9CA 2LIEA 2J3PA 2Q9XA 1KNMA 3OJ2A 3FJJA 3FJ8A 1WBAA 4P0LA 4GOYA 4OWJA 4JP0A 3R4SA 3O44A 4I4UA 1AVXB 2KI6B 5FNXA 1PC8B 4X38A 4EFPA 3P6JA 4ZFYB 3O5WB 3FFZA 4IHZA 3CA3A 2D7RA 2F2FC 1TOOA 3BAOA 5F90A 3WMUA 1FMMS 1TWEA 3IM6A 3LLPA 3NBCA 3O4DA 1AVAC 3FJCA 1IHKA 3VEQA 3ZC8A 4LO2A 3UJ4A 4D0ZA 4IQPA 2MIBA 2IHOA 2P23A 3F1RA 2HWAA 1FN0A 1K5UA 7I1BA 1JLXA 1EVTA 3C9ZA 2Y9XE 3BADA 4TLPA 3CA4A 5EHAA 3A22A 1D0HA 4JKQA 3AH4A 3BX1C 1HWOB 3O4AA 1DZCA 5BXSA 1IT0A 3POKA 4JQ0A 1A8DA 4HJJA 3P6IA 5DVHA 2FFVA 3HSMA 5HPZA 3BAUA 1V6XA 4EEEB 3ZXDA 1JTCA 4G6JA 4Q9GA 1HCDA 1OQLB 1AVUA 1EV2A 1XZZA 4I4RA 5E24E 4X3AA 5BP5A 3RTIB 3FGMA 4J23B 3VSFA 3FJDA 4LO3A 2ET2A 2VXTI 2I1BA 2QN4A 4ZKTB 3CQAA 4QKSA 4R6UB 2MC2A 3N7LA 1ISWA 2R9KB 3BA7A 4P0JA 3IIRA 3KMVA 3HBWA 3BRGC 5GAQA 1K5VA 2Z48A 5D63A 3OGFA 4QKRA 4QO3A 3BRFA 1FV3A 4A7KA 3AKFA 2NVHA 5DUYA 4GAFA 4OUJA 1V6VA 5DSSB 1HWMB 4EKXB 31BIA 5F8WA 3O4OA 1NZKA 4LO2C 3E8LC 1VCLA 1DQGA 3NBNA 2X2SA 2DRZA 3OBTA 21BIA 2ZR1B 2FO1A 4ISQA 3A23A 3PMEA 3CA1A 4QBCA 3UD8A 3B9UA 4OWKA 4DCKC 3BA5A 3AH2A 1JQZA 1N4KA 2QYIB 2D1ZA 2IWTB 1Q03A 2VXRA 3UJ0A
chains in the Genus database with same CATH superfamily
1PUUB 1NUNA 1S0DA 2GO2A 5FZZA 3RMYA 1TTUA 2D23A 3Q7XA 1V6WA 4I4YA 5BP5C 4JPZA 4LO0A 2KKIA 4XFTA 3CRIA 4IYBA 4LO3C 4ISRA 1XYFA 1S0GA 1DZDA 4KEKA 1AVWB 1YYNA 3VT0A 2AQZA 2KI4A 3I29B 3O3QA 1BASA 1YXWA 2HW9A 3RSJA 1G9BA 4OWLA 5G00A 3P53A 5FZYA 4I8MA 3WINC 4GOVA 2GZBA 2NS2A 1E0OA 4EB2B 2RG9B 2D22A 3VSZA 3H6RA 1S0EA 2AAIB 1R8OA 4I7IA 3VWCA 1BARA 5JMCA 4LO7C 1BFGA 4QC4A 1PZZA 3JUTA 1QXMA 4I4VA 4JAWA 4X37A 5F8SA 3V0BB 1RMLA 4H9WA 2ESUA 4I6IA 1G9DA 5F8YA 3ZC9A 1W3AA 3CRGA 1PWAA 5FNWA 2RSTA 2Y9GA 3IM5A 4Z8SB 1Z2VA 3OGGA 3EF2A 4ENDA 3WO2A 4A7YA 2K4AB 1ISZA 3PHZA 3OJVA 4AN6A 3FJ9A 1HWNB 1HWPB 4GAIA 5FZUA 3A07A 3MALA 3BTAA 3AZVA 1MC9A 3ZXGA 4GP0A 3IAGC 1BLDA 5BXRA 1AXMA 2ZQNA 1DJSB 4LO0C 3FJAA 4G9NA 2NTDA 1UPSA 3CA0A 3FUQA 4I96A 4I4XA 1M16A 4XFSA 2AXMA 4OEEA 2VUAA 3T8SA 3HALA 3FJIA 2NM1A 1CE7B 4L4HA 3D7WB 3WINA 2VSAA 1SR4A 4JKXB 1FWUA 4QD2B 3H6SE 4D0TA 4I0YA 4ZFUB 3BAHA 4F34A 5B2HA 2DRYA 4DEPA 4L4IA 3VT2A 3BAGA 3FJEA 3NJ5A 4OW4A 1WBCA 4J2KA 2RQ9A 1PUMB 4I4QA 3WO3A 3SNVA 2MLLB 4AN7B 5EC5A 3BAVA 4EFRA 2D44A 41BIA 3CAHA 3AKIA 3N7JA 3OBRA 4I1BA 2F8XC 1BA7A 1QQKA 4HA2A 3S8KA 1DLLA 4ZGRB 1IRAX 2BEAA 1P63A 4I37A 1SZ6B 4ZOTA 4QBVA 4I4SA 3CU1B 4H04A 4IONA 1GGPB 3NBDA 3VT1A 3O4CA 1HKNA 3CA6A 1JT4A 4LO8B 1FQ9A 1EPWA 3HN1A 4HR6C 4MZFB 1HIBA 3NBEA 1TP0A 1AF9A 2Z49A 1DIWA 4WBCA 3QR5A 3V0AB 2BFHA 3AJ5A 2LIQA 3UD9A 1WD4A 1Z4SA 4F83A 2D20A 1SR4C 1ILR1 3O4BA 4ZA3B 4XKIA 1ITBA 5D61A 4IZEA 4OEFA 3I2AA 2NP0A 4FGFA 2UUSA 3CA5A 1YF8B 3N0KA 3V0BA 1CVSA 3BB2A 3K1XA 4G9MA 4KC3A 1IRPA 3N7MA 1XHBA 3FJHA 4G6MA 4P6AA 3O49A 2AFGA 4I4OA 2WBCA 3IM7A 1JY0A 1ABRB 2K43A 2FGFA 3RMXA 1DFCA 5BOWA 3RTJB 4USPA 6I1BA 4FVVA 5BXPA 4DENA 3FJKA 3H6RB 1DQOA 3N7KA 1HCEA 1FV2A 3R4UA 3VUOA 5D62A 3MPPG 1V6UA 3Q7WA 4LO1C 1IILA 4A7ZA 4GP3A 4CJMA 1ISVA 4QALA 4IY8A 3QYDA 4PC4A 1TFMB 2P39A 3UD7A 3WMVA 1F31A 1Q04A 1IJTA 1WD3A 1JT3A 1I1BA 4UY4A 3HOMA 3WO4A 3AZWA 2E4MA 1YTOA 2ERMA 1JT5A 3A21A 8I1BA 2Y9WC 4ZLBB 5BQUC 3F62B 2DS0A 3BA4A 5DZUA 2KH2A 2VLCA 1M2TB 4KEJA 2K8RA 1J0SA 3BAQA 3TC2A 1S0LA 4II0A 1ISXA 1IOBA 2VSEA 1I1EA 1Q1UA 1XG6A 3BRDA 4ZBVB 3I2XA 3Q7YA 2NYYA 4YOLA 1EYLA 1T9FA 3PG0A 3FUOA 1QQLA 4J2XA 1FWVA 3AKGA 1II4A 2D7IA 2FFUA 1W3GA 3W9TA 1YBIA 4I3NA 3UDAA 4J2SA 1FGAA 2Q3NB 3PUBA 3FJBA 1RZOB 4XFUA 1W3FA 2ZQOA 2WRYA 2Y9FA 9ILBA 3ZX7A 1G82A 4JRAA 2F2FA 4Q91A 3S8JA 2BEBA 4D8HA 1AFCA 1RY7A 1BFBA 2VU9A 1RG8A 5I1BA 1BLAA 1DFQA 3HMYA 4LO1A 1S0BA 4I1EA 4I2SA 1TWMA 3JRRA 4KBBA 4I4PA 4LO7B 2YUGA 2FDBM 4EFQA 4MZHA 1MD6A 2NZ9A 2KLLA 4KEIA 1G9AA 2D24A 3OJMA 4G1RA 2E4MC 1ISYA 3ILAA 2M49A 3CRHA 3V79C 3V0AA 1Z0HA 1BFCA 3AKHA 5BQUA 4X39A 3WA1A 1BFFA 4IZXA 1T4QA 3AJ6A 2HWMA 4J2YA 2HZ9A 3LTQA 4P0KA 4QD2C 1ONKB 5JLVA 3FJFA 1JT7A 1S0FA 4OEGA 2X2TA 1S0CA 4Z9WB 5BXTA 4USOA 2D43A 2DREA 4ZFWB 3AH1A 1L2HA 5BVPI 2L5XA 1TIEA 1R8NA 1FMZA 5EG6C 2XOAA 1JLYA 4Q9PA 3H6QA 4IY9A 1G9CA 2LIEA 2J3PA 2Q9XA 1KNMA 3OJ2A 3FJJA 3FJ8A 1WBAA 4P0LA 4GOYA 4OWJA 4JP0A 3R4SA 3O44A 4I4UA 1AVXB 2KI6B 5FNXA 1PC8B 4X38A 4EFPA 3P6JA 4ZFYB 3O5WB 3FFZA 4IHZA 3CA3A 2D7RA 2F2FC 1TOOA 3BAOA 5F90A 3WMUA 1FMMS 1TWEA 3IM6A 3LLPA 3NBCA 3O4DA 1AVAC 3FJCA 1IHKA 3VEQA 3ZC8A 4LO2A 3UJ4A 4D0ZA 4IQPA 2MIBA 2IHOA 2P23A 3F1RA 2HWAA 1FN0A 1K5UA 7I1BA 1JLXA 4H75A 1EVTA 4MZGB 3C9ZA 2Y9XE 3BADA 4TLPA 3CA4A 5EHAA 3A22A 1D0HA 4JKQA 3AH4A 3BX1C 1HWOB 3O4AA 1DZCA 5BXSA 1IT0A 3POKA 4JQ0A 1A8DA 4HJJA 3P6IA 5DVHA 2FFVA 3HSMA 5HPZA 3BAUA 1V6XA 4EEEB 3ZXDA 1JTCA 4G6JA 4Q9GA 1HCDA 1OQLB 1AVUA 1EV2A 1XZZA 4I4RA 5E24E 4X3AA 5BP5A 3RTIB 3FGMA 4J23B 3VSFA 3FJDA 4LO3A 2ET2A 2VXTI 2I1BA 2QN4A 4ZKTB 3CQAA 4QKSA 4R6UB 2MC2A 3N7LA 1ISWA 2R9KB 3BA7A 4P0JA 3IIRA 3KMVA 3HBWA 3BRGC 5GAQA 1K5VA 2Z48A 5D63A 3OGFA 4QKRA 4QO3A 3BRFA 1FV3A 4A7KA 3AKFA 2NVHA 5DUYA 4GAFA 4OUJA 1V6VA 5DSSB 1HWMB 4EKXB 31BIA 5F8WA 3O4OA 1NZKA 4LO2C 3E8LC 1VCLA 1DQGA 3NBNA 2X2SA 2DRZA 3OBTA 21BIA 2ZR1B 2FO1A 4ISQA 3A23A 3PMEA 3CA1A 4QBCA 3UD8A 3B9UA 4OWKA 4DCKC 3BA5A 3AH2A 1JQZA 1N4KA 2QYIB 2D1ZA 2IWTB 1Q03A 2VXRA 3UJ0A
chains in the Genus database with same CATH topology
1PUUB 1NUNA 1S0DA 2GO2A 5FZZA 3RMYA 1TTUA 2D23A 3Q7XA 1V6WA 4I4YA 5BP5C 4JPZA 4LO0A 2KKIA 4XFTA 3CRIA 4IYBA 4LO3C 4ISRA 1XYFA 1S0GA 1DZDA 4KEKA 1AVWB 1YYNA 3VT0A 2AQZA 2KI4A 3I29B 3O3QA 1BASA 1YXWA 2HW9A 3RSJA 1G9BA 4OWLA 5G00A 3P53A 5FZYA 4I8MA 3WINC 4GOVA 2GZBA 2NS2A 1E0OA 4EB2B 2RG9B 2D22A 3VSZA 3H6RA 1S0EA 2AAIB 1R8OA 4I7IA 3VWCA 1BARA 5JMCA 4LO7C 1BFGA 4QC4A 1PZZA 3JUTA 1QXMA 4I4VA 4JAWA 4X37A 5F8SA 3V0BB 1RMLA 4H9WA 2ESUA 4I6IA 1G9DA 5F8YA 3ZC9A 1W3AA 3CRGA 1PWAA 5FNWA 2RSTA 2Y9GA 3IM5A 4Z8SB 1Z2VA 3OGGA 3EF2A 4ENDA 3WO2A 4A7YA 2K4AB 1ISZA 3PHZA 3OJVA 4AN6A 3FJ9A 1HWNB 1HWPB 4GAIA 5FZUA 3A07A 3MALA 3BTAA 3AZVA 1MC9A 3ZXGA 4GP0A 3IAGC 1BLDA 5BXRA 1AXMA 2ZQNA 1DJSB 4LO0C 3FJAA 4G9NA 2NTDA 1UPSA 3CA0A 3FUQA 4I96A 4I4XA 1M16A 4XFSA 2AXMA 4OEEA 2VUAA 3T8SA 3HALA 3FJIA 2NM1A 1CE7B 4L4HA 3D7WB 3WINA 2VSAA 1SR4A 4JKXB 1FWUA 4QD2B 3H6SE 4D0TA 4I0YA 4ZFUB 3BAHA 4F34A 5B2HA 2DRYA 4DEPA 4L4IA 3VT2A 3BAGA 3FJEA 3NJ5A 4OW4A 1WBCA 4J2KA 2RQ9A 1PUMB 4I4QA 3WO3A 3SNVA 2MLLB 4AN7B 5EC5A 3BAVA 4EFRA 2D44A 41BIA 3CAHA 3AKIA 3N7JA 3OBRA 4I1BA 2F8XC 1BA7A 1QQKA 4HA2A 3S8KA 1DLLA 4ZGRB 1IRAX 2BEAA 1P63A 4I37A 1SZ6B 4ZOTA 4QBVA 4I4SA 3CU1B 4H04A 4IONA 1GGPB 3NBDA 3VT1A 3O4CA 1HKNA 3CA6A 1JT4A 4LO8B 1FQ9A 1EPWA 3HN1A 4HR6C 4MZFB 1HIBA 3NBEA 1TP0A 1AF9A 2Z49A 1DIWA 4WBCA 3QR5A 3V0AB 2BFHA 3AJ5A 2LIQA 3UD9A 1WD4A 1Z4SA 4F83A 2D20A 1SR4C 1ILR1 3O4BA 4ZA3B 4XKIA 1ITBA 5D61A 4IZEA 4OEFA 3I2AA 2NP0A 4FGFA 2UUSA 3CA5A 1YF8B 3N0KA 3V0BA 1CVSA 3BB2A 3K1XA 4G9MA 4KC3A 1IRPA 3N7MA 1XHBA 3FJHA 4G6MA 4P6AA 3O49A 2AFGA 4I4OA 2WBCA 3IM7A 1JY0A 1ABRB 2K43A 2FGFA 3RMXA 1DFCA 5BOWA 3RTJB 4USPA 6I1BA 4FVVA 5BXPA 4DENA 3FJKA 3H6RB 1DQOA 3N7KA 1HCEA 1FV2A 3R4UA 3VUOA 5D62A 3MPPG 1V6UA 3Q7WA 4LO1C 1IILA 4A7ZA 4GP3A 4CJMA 1ISVA 4QALA 4IY8A 3QYDA 4PC4A 1TFMB 2P39A 3UD7A 3WMVA 1F31A 1Q04A 1IJTA 1WD3A 1JT3A 1I1BA 4UY4A 3HOMA 3WO4A 3AZWA 2E4MA 1YTOA 2ERMA 1JT5A 3A21A 8I1BA 2Y9WC 4ZLBB 5BQUC 3F62B 2DS0A 3BA4A 5DZUA 2KH2A 2VLCA 1M2TB 4KEJA 2K8RA 1J0SA 3BAQA 3TC2A 1S0LA 4II0A 1ISXA 1IOBA 2VSEA 1I1EA 1Q1UA 1XG6A 3BRDA 4ZBVB 3I2XA 3Q7YA 2NYYA 4YOLA 1EYLA 1T9FA 3PG0A 3FUOA 1QQLA 4J2XA 1FWVA 3AKGA 1II4A 2D7IA 2FFUA 1W3GA 3W9TA 1YBIA 4I3NA 3UDAA 4J2SA 1FGAA 2Q3NB 3PUBA 3FJBA 1RZOB 4XFUA 1W3FA 2ZQOA 2WRYA 2Y9FA 9ILBA 3ZX7A 1G82A 4JRAA 2F2FA 4Q91A 3S8JA 2BEBA 4D8HA 1AFCA 1RY7A 1BFBA 2VU9A 1RG8A 5I1BA 1BLAA 1DFQA 3HMYA 4LO1A 1S0BA 4I1EA 4I2SA 1TWMA 3JRRA 4KBBA 4I4PA 4LO7B 2YUGA 2FDBM 4EFQA 4MZHA 1MD6A 2NZ9A 2KLLA 4KEIA 1G9AA 2D24A 3OJMA 4G1RA 2E4MC 1ISYA 3ILAA 2M49A 3CRHA 3V79C 3V0AA 1Z0HA 1BFCA 3AKHA 5BQUA 4X39A 3WA1A 1BFFA 4IZXA 1T4QA 3AJ6A 2HWMA 4J2YA 2HZ9A 3LTQA 4P0KA 4QD2C 1ONKB 5JLVA 3FJFA 1JT7A 1S0FA 4OEGA 2X2TA 1S0CA 4Z9WB 5BXTA 4USOA 2D43A 2DREA 4ZFWB 3AH1A 1L2HA 5BVPI 2L5XA 1TIEA 1R8NA 1FMZA 5EG6C 2XOAA 1JLYA 4Q9PA 3H6QA 4IY9A 1G9CA 2LIEA 2J3PA 2Q9XA 1KNMA 3OJ2A 3FJJA 3FJ8A 1WBAA 4P0LA 4GOYA 4OWJA 4JP0A 3R4SA 3O44A 4I4UA 1AVXB 2KI6B 5FNXA 1PC8B 4X38A 4EFPA 3P6JA 4ZFYB 3O5WB 3FFZA 4IHZA 3CA3A 2D7RA 2F2FC 1TOOA 3BAOA 5F90A 3WMUA 1FMMS 1TWEA 3IM6A 3LLPA 3NBCA 3O4DA 1AVAC 3FJCA 1IHKA 3VEQA 3ZC8A 4LO2A 3UJ4A 4D0ZA 4IQPA 2MIBA 2IHOA 2P23A 3F1RA 2HWAA 1FN0A 1K5UA 7I1BA 1JLXA 4H75A 1EVTA 4MZGB 3C9ZA 2Y9XE 3BADA 4TLPA 3CA4A 5EHAA 3A22A 1D0HA 4JKQA 3AH4A 3BX1C 1HWOB 3O4AA 1DZCA 5BXSA 1IT0A 3POKA 4JQ0A 1A8DA 4HJJA 3P6IA 5DVHA 2FFVA 3HSMA 5HPZA 3BAUA 1V6XA 4EEEB 3ZXDA 1JTCA 4G6JA 4Q9GA 1HCDA 1OQLB 1AVUA 1EV2A 1XZZA 4I4RA 5E24E 4X3AA 5BP5A 3RTIB 3FGMA 4J23B 3VSFA 3FJDA 4LO3A 2ET2A 2VXTI 2I1BA 2QN4A 4ZKTB 3CQAA 4QKSA 4R6UB 2MC2A 3N7LA 1ISWA 2R9KB 3BA7A 4P0JA 3IIRA 3KMVA 3HBWA 3BRGC 5GAQA 1K5VA 2Z48A 5D63A 3OGFA 4QKRA 4QO3A 3BRFA 1FV3A 4A7KA 3AKFA 2NVHA 5DUYA 4GAFA 4OUJA 1V6VA 5DSSB 1HWMB 4EKXB 31BIA 5F8WA 3O4OA 1NZKA 4LO2C 3E8LC 1VCLA 1DQGA 3NBNA 2X2SA 2DRZA 3OBTA 21BIA 2ZR1B 2FO1A 4ISQA 3A23A 3PMEA 3CA1A 4QBCA 3UD8A 3B9UA 4OWKA 4DCKC 3BA5A 3AH2A 1JQZA 1N4KA 2QYIB 2D1ZA 2IWTB 1Q03A 2VXRA 3UJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUU B;  1NUN A;  1S0D A;  2GO2 A;  5FZZ A;  3RMY A;  1TTU A;  2D23 A;  3Q7X A;  1V6W A;  4I4Y A;  5BP5 C;  4JPZ A;  4LO0 A;  2KKI A;  4XFT A;  3CRI A;  4IYB A;  4LO3 C;  4ISR A;  1XYF A;  1S0G A;  1DZD A;  4KEK A;  1AVW B;  1YYN A;  3VT0 A;  2AQZ A;  2KI4 A;  3I29 B;  3O3Q A;  1BAS A;  1YXW A;  2HW9 A;  3RSJ A;  1G9B A;  4OWL A;  5G00 A;  3P53 A;  5FZY A;  4I8M A;  3WIN C;  4GOV A;  2GZB A;  1E0O A;  4EB2 B;  2RG9 B;  2D22 A;  3VSZ A;  3H6R A;  1S0E A;  2AAI B;  1R8O A;  4I7I A;  3VWC A;  1BAR A;  5JMC A;  4LO7 C;  1BFG A;  4QC4 A;  1PZZ A;  3JUT A;  1QXM A;  4I4V A;  4JAW A;  4X37 A;  5F8S A;  3V0B B;  1RML A;  4H9W A;  2ESU A;  4I6I A;  1G9D A;  5F8Y A;  3ZC9 A;  1W3A A;  3CRG A;  1PWA A;  5FNW A;  2RST A;  2Y9G A;  3IM5 A;  4Z8S B;  1Z2V A;  3OGG A;  3EF2 A;  4END A;  3WO2 A;  4A7Y A;  2K4A B;  1ISZ A;  3PHZ A;  3OJV A;  4AN6 A;  3FJ9 A;  1HWN B;  1HWP B;  4GAI A;  5FZU A;  3A07 A;  3MAL A;  3BTA A;  3AZV A;  1MC9 A;  3ZXG A;  4GP0 A;  3IAG C;  1BLD A;  5BXR A;  1AXM A;  2ZQN A;  1DJS B;  4LO0 C;  3FJA A;  4G9N A;  2NTD A;  1UPS A;  3CA0 A;  3FUQ A;  4I96 A;  4I4X A;  1M16 A;  4XFS A;  2AXM A;  4OEE A;  2VUA A;  3T8S A;  3HAL A;  3FJI A;  2NM1 A;  1CE7 B;  4L4H A;  3D7W B;  3WIN A;  2VSA A;  1SR4 A;  4JKX B;  1FWU A;  4QD2 B;  3H6S E;  4D0T A;  4I0Y A;  4ZFU B;  3BAH A;  4F34 A;  5B2H A;  2DRY A;  4DEP A;  4L4I A;  3VT2 A;  3BAG A;  3FJE A;  3NJ5 A;  4OW4 A;  1WBC A;  4J2K A;  2RQ9 A;  1PUM B;  4I4Q A;  3WO3 A;  3SNV A;  2MLL B;  4AN7 B;  5EC5 A;  3BAV A;  4EFR A;  2D44 A;  41BI A;  3CAH A;  3AKI A;  3N7J A;  3OBR A;  4I1B A;  2F8X C;  1BA7 A;  1QQK A;  4HA2 A;  3S8K A;  1DLL A;  4ZGR B;  1IRA X;  2BEA A;  1P63 A;  4I37 A;  1SZ6 B;  4ZOT A;  4QBV A;  4I4S A;  3CU1 B;  4H04 A;  4ION A;  1GGP B;  3NBD A;  3VT1 A;  3O4C A;  1HKN A;  3CA6 A;  1JT4 A;  4LO8 B;  1FQ9 A;  1EPW A;  3HN1 A;  4HR6 C;  1HIB A;  3NBE A;  1TP0 A;  1AF9 A;  2Z49 A;  1DIW A;  4WBC A;  3QR5 A;  3V0A B;  2BFH A;  3AJ5 A;  2LIQ A;  3UD9 A;  1WD4 A;  1Z4S A;  4F83 A;  2D20 A;  1SR4 C;  1ILR 1;  3O4B A;  4ZA3 B;  4XKI A;  1ITB A;  5D61 A;  4IZE A;  4OEF A;  3I2A A;  2NP0 A;  4FGF A;  2UUS A;  3CA5 A;  1YF8 B;  3N0K A;  3V0B A;  1CVS A;  3BB2 A;  3K1X A;  4G9M A;  4KC3 A;  1IRP A;  3N7M A;  1XHB A;  3FJH A;  4G6M A;  4P6A A;  3O49 A;  2AFG A;  4I4O A;  2WBC A;  3IM7 A;  1JY0 A;  1ABR B;  2K43 A;  2FGF A;  3RMX A;  1DFC A;  5BOW A;  3RTJ B;  4USP A;  6I1B A;  4FVV A;  5BXP A;  4DEN A;  3FJK A;  3H6R B;  1DQO A;  3N7K A;  1HCE A;  1FV2 A;  3R4U A;  3VUO A;  5D62 A;  3MPP G;  1V6U A;  3Q7W A;  4LO1 C;  1IIL A;  4A7Z A;  4GP3 A;  4CJM A;  1ISV A;  4QAL A;  4IY8 A;  3QYD A;  4PC4 A;  1TFM B;  2P39 A;  3UD7 A;  3WMV A;  1F31 A;  1Q04 A;  1IJT A;  1WD3 A;  1JT3 A;  1I1B A;  3HOM A;  3WO4 A;  3AZW A;  2E4M A;  1YTO A;  2ERM A;  1JT5 A;  3A21 A;  8I1B A;  2Y9W C;  4ZLB B;  5BQU C;  3F62 B;  2DS0 A;  3BA4 A;  5DZU A;  2KH2 A;  2VLC A;  1M2T B;  4KEJ A;  2K8R A;  1J0S A;  3BAQ A;  3TC2 A;  1S0L A;  4II0 A;  1ISX A;  1IOB A;  2VSE A;  1I1E A;  1Q1U A;  1XG6 A;  3BRD A;  4ZBV B;  3I2X A;  3Q7Y A;  2NYY A;  4YOL A;  1EYL A;  1T9F A;  3PG0 A;  3FUO A;  1QQL A;  4J2X A;  1FWV A;  3AKG A;  1II4 A;  2D7I A;  2FFU A;  1W3G A;  3W9T A;  1YBI A;  4I3N A;  3UDA A;  4J2S A;  1FGA A;  2Q3N B;  3PUB A;  3FJB A;  1RZO B;  4XFU A;  1W3F A;  2ZQO A;  2WRY A;  2Y9F A;  9ILB A;  3ZX7 A;  1G82 A;  4JRA A;  2F2F A;  4Q91 A;  3S8J A;  2BEB A;  4D8H A;  1AFC A;  1RY7 A;  1BFB A;  2VU9 A;  1RG8 A;  5I1B A;  1BLA A;  1DFQ A;  3HMY A;  4LO1 A;  1S0B A;  4I1E A;  4I2S A;  1TWM A;  3JRR A;  4KBB A;  4I4P A;  4LO7 B;  2YUG A;  2FDB M;  4EFQ A;  1MD6 A;  2NZ9 A;  2KLL A;  4KEI A;  1G9A A;  2D24 A;  3OJM A;  4G1R A;  2E4M C;  1ISY A;  3ILA A;  2M49 A;  3CRH A;  3V79 C;  3V0A A;  1Z0H A;  1BFC A;  3AKH A;  5BQU A;  4X39 A;  3WA1 A;  1BFF A;  4IZX A;  1T4Q A;  3AJ6 A;  2HWM A;  4J2Y A;  2HZ9 A;  3LTQ A;  4P0K A;  4QD2 C;  1ONK B;  5JLV A;  3FJF A;  1JT7 A;  1S0F A;  4OEG A;  2X2T A;  1S0C A;  4Z9W B;  5BXT A;  4USO A;  2D43 A;  2DRE A;  4ZFW B;  3AH1 A;  1L2H A;  5BVP I;  2L5X A;  1TIE A;  1R8N A;  1FMZ A;  5EG6 C;  2XOA A;  1JLY A;  4Q9P A;  3H6Q A;  4IY9 A;  1G9C A;  2LIE A;  2J3P A;  2Q9X A;  1KNM A;  3OJ2 A;  3FJJ A;  3FJ8 A;  1WBA A;  4P0L A;  4GOY A;  4OWJ A;  4JP0 A;  3R4S A;  3O44 A;  4I4U A;  1AVX B;  2KI6 B;  5FNX A;  1PC8 B;  4X38 A;  4EFP A;  3P6J A;  4ZFY B;  3O5W B;  3FFZ A;  4IHZ A;  3CA3 A;  2D7R A;  2F2F C;  1TOO A;  3BAO A;  5F90 A;  3WMU A;  1FMM S;  1TWE A;  3IM6 A;  3LLP A;  3NBC A;  3O4D A;  1AVA C;  3FJC A;  1IHK A;  3VEQ A;  3ZC8 A;  4LO2 A;  3UJ4 A;  4D0Z A;  4IQP A;  2MIB A;  2IHO A;  2P23 A;  3F1R A;  2HWA A;  1FN0 A;  1K5U A;  7I1B A;  1JLX A;  1EVT A;  3C9Z A;  2Y9X E;  3BAD A;  4TLP A;  3CA4 A;  5EHA A;  3A22 A;  1D0H A;  4JKQ A;  3AH4 A;  3BX1 C;  1HWO B;  3O4A A;  1DZC A;  5BXS A;  1IT0 A;  3POK A;  4JQ0 A;  1A8D A;  4HJJ A;  3P6I A;  5DVH A;  2FFV A;  3HSM A;  5HPZ A;  3BAU A;  1V6X A;  4EEE B;  3ZXD A;  1JTC A;  4G6J A;  4Q9G A;  1HCD A;  1OQL B;  1AVU A;  1EV2 A;  1XZZ A;  4I4R A;  5E24 E;  4X3A A;  5BP5 A;  3RTI B;  3FGM A;  4J23 B;  3VSF A;  3FJD A;  4LO3 A;  2ET2 A;  2VXT I;  2I1B A;  2QN4 A;  4ZKT B;  3CQA A;  4QKS A;  4R6U B;  2MC2 A;  3N7L A;  1ISW A;  2R9K B;  3BA7 A;  4P0J A;  3IIR A;  3KMV A;  3HBW A;  3BRG C;  5GAQ A;  1K5V A;  2Z48 A;  5D63 A;  3OGF A;  4QKR A;  4QO3 A;  3BRF A;  1FV3 A;  4A7K A;  3AKF A;  2NVH A;  5DUY A;  4GAF A;  4OUJ A;  1V6V A;  5DSS B;  1HWM B;  4EKX B;  31BI A;  5F8W A;  3O4O A;  1NZK A;  4LO2 C;  3E8L C;  1VCL A;  1DQG A;  3NBN A;  2X2S A;  2DRZ A;  3OBT A;  21BI A;  2ZR1 B;  2FO1 A;  4ISQ A;  3A23 A;  3PME A;  3CA1 A;  4QBC A;  3UD8 A;  3B9U A;  4OWK A;  4DCK C;  3BA5 A;  3AH2 A;  1JQZ A;  1N4K A;  2QYI B;  2D1Z A;  2IWT B;  1Q03 A;  2VXR A;  3UJ0 A; 
#chains in the Genus database with same CATH topology
 1PUU B;  1NUN A;  1S0D A;  2GO2 A;  5FZZ A;  3RMY A;  1TTU A;  2D23 A;  3Q7X A;  1V6W A;  4I4Y A;  5BP5 C;  4JPZ A;  4LO0 A;  2KKI A;  4XFT A;  3CRI A;  4IYB A;  4LO3 C;  4ISR A;  1XYF A;  1S0G A;  1DZD A;  4KEK A;  1AVW B;  1YYN A;  3VT0 A;  2AQZ A;  2KI4 A;  3I29 B;  3O3Q A;  1BAS A;  1YXW A;  2HW9 A;  3RSJ A;  1G9B A;  4OWL A;  5G00 A;  3P53 A;  5FZY A;  4I8M A;  3WIN C;  4GOV A;  2GZB A;  2NS2 A;  1E0O A;  4EB2 B;  2RG9 B;  2D22 A;  3VSZ A;  3H6R A;  1S0E A;  2AAI B;  1R8O A;  4I7I A;  3VWC A;  1BAR A;  5JMC A;  4LO7 C;  1BFG A;  4QC4 A;  1PZZ A;  3JUT A;  1QXM A;  4I4V A;  4JAW A;  4X37 A;  5F8S A;  3V0B B;  1RML A;  4H9W A;  2ESU A;  4I6I A;  1G9D A;  5F8Y A;  3ZC9 A;  1W3A A;  3CRG A;  1PWA A;  5FNW A;  2RST A;  2Y9G A;  3IM5 A;  4Z8S B;  1Z2V A;  3OGG A;  3EF2 A;  4END A;  3WO2 A;  4A7Y A;  2K4A B;  1ISZ A;  3PHZ A;  3OJV A;  4AN6 A;  3FJ9 A;  1HWN B;  1HWP B;  4GAI A;  5FZU A;  3A07 A;  3MAL A;  3BTA A;  3AZV A;  1MC9 A;  3ZXG A;  4GP0 A;  3IAG C;  1BLD A;  5BXR A;  1AXM A;  2ZQN A;  1DJS B;  4LO0 C;  3FJA A;  4G9N A;  2NTD A;  1UPS A;  3CA0 A;  3FUQ A;  4I96 A;  4I4X A;  1M16 A;  4XFS A;  2AXM A;  4OEE A;  2VUA A;  3T8S A;  3HAL A;  3FJI A;  2NM1 A;  1CE7 B;  4L4H A;  3D7W B;  3WIN A;  2VSA A;  1SR4 A;  4JKX B;  1FWU A;  4QD2 B;  3H6S E;  4D0T A;  4I0Y A;  4ZFU B;  3BAH A;  4F34 A;  5B2H A;  2DRY A;  4DEP A;  4L4I A;  3VT2 A;  3BAG A;  3FJE A;  3NJ5 A;  4OW4 A;  1WBC A;  4J2K A;  2RQ9 A;  1PUM B;  4I4Q A;  3WO3 A;  3SNV A;  2MLL B;  4AN7 B;  5EC5 A;  3BAV A;  4EFR A;  2D44 A;  41BI A;  3CAH A;  3AKI A;  3N7J A;  3OBR A;  4I1B A;  2F8X C;  1BA7 A;  1QQK A;  4HA2 A;  3S8K A;  1DLL A;  4ZGR B;  1IRA X;  2BEA A;  1P63 A;  4I37 A;  1SZ6 B;  4ZOT A;  4QBV A;  4I4S A;  3CU1 B;  4H04 A;  4ION A;  1GGP B;  3NBD A;  3VT1 A;  3O4C A;  1HKN A;  3CA6 A;  1JT4 A;  4LO8 B;  1FQ9 A;  1EPW A;  3HN1 A;  4HR6 C;  4MZF B;  1HIB A;  3NBE A;  1TP0 A;  1AF9 A;  2Z49 A;  1DIW A;  4WBC A;  3QR5 A;  3V0A B;  2BFH A;  3AJ5 A;  2LIQ A;  3UD9 A;  1WD4 A;  1Z4S A;  4F83 A;  2D20 A;  1SR4 C;  1ILR 1;  3O4B A;  4ZA3 B;  4XKI A;  1ITB A;  5D61 A;  4IZE A;  4OEF A;  3I2A A;  2NP0 A;  4FGF A;  2UUS A;  3CA5 A;  1YF8 B;  3N0K A;  3V0B A;  1CVS A;  3BB2 A;  3K1X A;  4G9M A;  4KC3 A;  1IRP A;  3N7M A;  1XHB A;  3FJH A;  4G6M A;  4P6A A;  3O49 A;  2AFG A;  4I4O A;  2WBC A;  3IM7 A;  1JY0 A;  1ABR B;  2K43 A;  2FGF A;  3RMX A;  1DFC A;  5BOW A;  3RTJ B;  4USP A;  6I1B A;  4FVV A;  5BXP A;  4DEN A;  3FJK A;  3H6R B;  1DQO A;  3N7K A;  1HCE A;  1FV2 A;  3R4U A;  3VUO A;  5D62 A;  3MPP G;  1V6U A;  3Q7W A;  4LO1 C;  1IIL A;  4A7Z A;  4GP3 A;  4CJM A;  1ISV A;  4QAL A;  4IY8 A;  3QYD A;  4PC4 A;  1TFM B;  2P39 A;  3UD7 A;  3WMV A;  1F31 A;  1Q04 A;  1IJT A;  1WD3 A;  1JT3 A;  1I1B A;  4UY4 A;  3HOM A;  3WO4 A;  3AZW A;  2E4M A;  1YTO A;  2ERM A;  1JT5 A;  3A21 A;  8I1B A;  2Y9W C;  4ZLB B;  5BQU C;  3F62 B;  2DS0 A;  3BA4 A;  5DZU A;  2KH2 A;  2VLC A;  1M2T B;  4KEJ A;  2K8R A;  1J0S A;  3BAQ A;  3TC2 A;  1S0L A;  4II0 A;  1ISX A;  1IOB A;  2VSE A;  1I1E A;  1Q1U A;  1XG6 A;  3BRD A;  4ZBV B;  3I2X A;  3Q7Y A;  2NYY A;  4YOL A;  1EYL A;  1T9F A;  3PG0 A;  3FUO A;  1QQL A;  4J2X A;  1FWV A;  3AKG A;  1II4 A;  2D7I A;  2FFU A;  1W3G A;  3W9T A;  1YBI A;  4I3N A;  3UDA A;  4J2S A;  1FGA A;  2Q3N B;  3PUB A;  3FJB A;  1RZO B;  4XFU A;  1W3F A;  2ZQO A;  2WRY A;  2Y9F A;  9ILB A;  3ZX7 A;  1G82 A;  4JRA A;  2F2F A;  4Q91 A;  3S8J A;  2BEB A;  4D8H A;  1AFC A;  1RY7 A;  1BFB A;  2VU9 A;  1RG8 A;  5I1B A;  1BLA A;  1DFQ A;  3HMY A;  4LO1 A;  1S0B A;  4I1E A;  4I2S A;  1TWM A;  3JRR A;  4KBB A;  4I4P A;  4LO7 B;  2YUG A;  2FDB M;  4EFQ A;  4MZH A;  1MD6 A;  2NZ9 A;  2KLL A;  4KEI A;  1G9A A;  2D24 A;  3OJM A;  4G1R A;  2E4M C;  1ISY A;  3ILA A;  2M49 A;  3CRH A;  3V79 C;  3V0A A;  1Z0H A;  1BFC A;  3AKH A;  5BQU A;  4X39 A;  3WA1 A;  1BFF A;  4IZX A;  1T4Q A;  3AJ6 A;  2HWM A;  4J2Y A;  2HZ9 A;  3LTQ A;  4P0K A;  4QD2 C;  1ONK B;  5JLV A;  3FJF A;  1JT7 A;  1S0F A;  4OEG A;  2X2T A;  1S0C A;  4Z9W B;  5BXT A;  4USO A;  2D43 A;  2DRE A;  4ZFW B;  3AH1 A;  1L2H A;  5BVP I;  2L5X A;  1TIE A;  1R8N A;  1FMZ A;  5EG6 C;  2XOA A;  1JLY A;  4Q9P A;  3H6Q A;  4IY9 A;  1G9C A;  2LIE A;  2J3P A;  2Q9X A;  1KNM A;  3OJ2 A;  3FJJ A;  3FJ8 A;  1WBA A;  4P0L A;  4GOY A;  4OWJ A;  4JP0 A;  3R4S A;  3O44 A;  4I4U A;  1AVX B;  2KI6 B;  5FNX A;  1PC8 B;  4X38 A;  4EFP A;  3P6J A;  4ZFY B;  3O5W B;  3FFZ A;  4IHZ A;  3CA3 A;  2D7R A;  2F2F C;  1TOO A;  3BAO A;  5F90 A;  3WMU A;  1FMM S;  1TWE A;  3IM6 A;  3LLP A;  3NBC A;  3O4D A;  1AVA C;  3FJC A;  1IHK A;  3VEQ A;  3ZC8 A;  4LO2 A;  3UJ4 A;  4D0Z A;  4IQP A;  2MIB A;  2IHO A;  2P23 A;  3F1R A;  2HWA A;  1FN0 A;  1K5U A;  7I1B A;  1JLX A;  4H75 A;  1EVT A;  4MZG B;  3C9Z A;  2Y9X E;  3BAD A;  4TLP A;  3CA4 A;  5EHA A;  3A22 A;  1D0H A;  4JKQ A;  3AH4 A;  3BX1 C;  1HWO B;  3O4A A;  1DZC A;  5BXS A;  1IT0 A;  3POK A;  4JQ0 A;  1A8D A;  4HJJ A;  3P6I A;  5DVH A;  2FFV A;  3HSM A;  5HPZ A;  3BAU A;  1V6X A;  4EEE B;  3ZXD A;  1JTC A;  4G6J A;  4Q9G A;  1HCD A;  1OQL B;  1AVU A;  1EV2 A;  1XZZ A;  4I4R A;  5E24 E;  4X3A A;  5BP5 A;  3RTI B;  3FGM A;  4J23 B;  3VSF A;  3FJD A;  4LO3 A;  2ET2 A;  2VXT I;  2I1B A;  2QN4 A;  4ZKT B;  3CQA A;  4QKS A;  4R6U B;  2MC2 A;  3N7L A;  1ISW A;  2R9K B;  3BA7 A;  4P0J A;  3IIR A;  3KMV A;  3HBW A;  3BRG C;  5GAQ A;  1K5V A;  2Z48 A;  5D63 A;  3OGF A;  4QKR A;  4QO3 A;  3BRF A;  1FV3 A;  4A7K A;  3AKF A;  2NVH A;  5DUY A;  4GAF A;  4OUJ A;  1V6V A;  5DSS B;  1HWM B;  4EKX B;  31BI A;  5F8W A;  3O4O A;  1NZK A;  4LO2 C;  3E8L C;  1VCL A;  1DQG A;  3NBN A;  2X2S A;  2DRZ A;  3OBT A;  21BI A;  2ZR1 B;  2FO1 A;  4ISQ A;  3A23 A;  3PME A;  3CA1 A;  4QBC A;  3UD8 A;  3B9U A;  4OWK A;  4DCK C;  3BA5 A;  3AH2 A;  1JQZ A;  1N4K A;  2QYI B;  2D1Z A;  2IWT B;  1Q03 A;  2VXR A;  3UJ0 A; 
#chains in the Genus database with same CATH homology
 1PUU B;  1NUN A;  1S0D A;  2GO2 A;  5FZZ A;  3RMY A;  1TTU A;  2D23 A;  3Q7X A;  1V6W A;  4I4Y A;  5BP5 C;  4JPZ A;  4LO0 A;  2KKI A;  4XFT A;  3CRI A;  4IYB A;  4LO3 C;  4ISR A;  1XYF A;  1S0G A;  1DZD A;  4KEK A;  1AVW B;  1YYN A;  3VT0 A;  2AQZ A;  2KI4 A;  3I29 B;  3O3Q A;  1BAS A;  1YXW A;  2HW9 A;  3RSJ A;  1G9B A;  4OWL A;  5G00 A;  3P53 A;  5FZY A;  4I8M A;  3WIN C;  4GOV A;  2GZB A;  2NS2 A;  1E0O A;  4EB2 B;  2RG9 B;  2D22 A;  3VSZ A;  3H6R A;  1S0E A;  2AAI B;  1R8O A;  4I7I A;  3VWC A;  1BAR A;  5JMC A;  4LO7 C;  1BFG A;  4QC4 A;  1PZZ A;  3JUT A;  1QXM A;  4I4V A;  4JAW A;  4X37 A;  5F8S A;  3V0B B;  1RML A;  4H9W A;  2ESU A;  4I6I A;  1G9D A;  5F8Y A;  3ZC9 A;  1W3A A;  3CRG A;  1PWA A;  5FNW A;  2RST A;  2Y9G A;  3IM5 A;  4Z8S B;  1Z2V A;  3OGG A;  3EF2 A;  4END A;  3WO2 A;  4A7Y A;  2K4A B;  1ISZ A;  3PHZ A;  3OJV A;  4AN6 A;  3FJ9 A;  1HWN B;  1HWP B;  4GAI A;  5FZU A;  3A07 A;  3MAL A;  3BTA A;  3AZV A;  1MC9 A;  3ZXG A;  4GP0 A;  3IAG C;  1BLD A;  5BXR A;  1AXM A;  2ZQN A;  1DJS B;  4LO0 C;  3FJA A;  4G9N A;  2NTD A;  1UPS A;  3CA0 A;  3FUQ A;  4I96 A;  4I4X A;  1M16 A;  4XFS A;  2AXM A;  4OEE A;  2VUA A;  3T8S A;  3HAL A;  3FJI A;  2NM1 A;  1CE7 B;  4L4H A;  3D7W B;  3WIN A;  2VSA A;  1SR4 A;  4JKX B;  1FWU A;  4QD2 B;  3H6S E;  4D0T A;  4I0Y A;  4ZFU B;  3BAH A;  4F34 A;  5B2H A;  2DRY A;  4DEP A;  4L4I A;  3VT2 A;  3BAG A;  3FJE A;  3NJ5 A;  4OW4 A;  1WBC A;  4J2K A;  2RQ9 A;  1PUM B;  4I4Q A;  3WO3 A;  3SNV A;  2MLL B;  4AN7 B;  5EC5 A;  3BAV A;  4EFR A;  2D44 A;  41BI A;  3CAH A;  3AKI A;  3N7J A;  3OBR A;  4I1B A;  2F8X C;  1BA7 A;  1QQK A;  4HA2 A;  3S8K A;  1DLL A;  4ZGR B;  1IRA X;  2BEA A;  1P63 A;  4I37 A;  1SZ6 B;  4ZOT A;  4QBV A;  4I4S A;  3CU1 B;  4H04 A;  4ION A;  1GGP B;  3NBD A;  3VT1 A;  3O4C A;  1HKN A;  3CA6 A;  1JT4 A;  4LO8 B;  1FQ9 A;  1EPW A;  3HN1 A;  4HR6 C;  4MZF B;  1HIB A;  3NBE A;  1TP0 A;  1AF9 A;  2Z49 A;  1DIW A;  4WBC A;  3QR5 A;  3V0A B;  2BFH A;  3AJ5 A;  2LIQ A;  3UD9 A;  1WD4 A;  1Z4S A;  4F83 A;  2D20 A;  1SR4 C;  1ILR 1;  3O4B A;  4ZA3 B;  4XKI A;  1ITB A;  5D61 A;  4IZE A;  4OEF A;  3I2A A;  2NP0 A;  4FGF A;  2UUS A;  3CA5 A;  1YF8 B;  3N0K A;  3V0B A;  1CVS A;  3BB2 A;  3K1X A;  4G9M A;  4KC3 A;  1IRP A;  3N7M A;  1XHB A;  3FJH A;  4G6M A;  4P6A A;  3O49 A;  2AFG A;  4I4O A;  2WBC A;  3IM7 A;  1JY0 A;  1ABR B;  2K43 A;  2FGF A;  3RMX A;  1DFC A;  5BOW A;  3RTJ B;  4USP A;  6I1B A;  4FVV A;  5BXP A;  4DEN A;  3FJK A;  3H6R B;  1DQO A;  3N7K A;  1HCE A;  1FV2 A;  3R4U A;  3VUO A;  5D62 A;  3MPP G;  1V6U A;  3Q7W A;  4LO1 C;  1IIL A;  4A7Z A;  4GP3 A;  4CJM A;  1ISV A;  4QAL A;  4IY8 A;  3QYD A;  4PC4 A;  1TFM B;  2P39 A;  3UD7 A;  3WMV A;  1F31 A;  1Q04 A;  1IJT A;  1WD3 A;  1JT3 A;  1I1B A;  4UY4 A;  3HOM A;  3WO4 A;  3AZW A;  2E4M A;  1YTO A;  2ERM A;  1JT5 A;  3A21 A;  8I1B A;  2Y9W C;  4ZLB B;  5BQU C;  3F62 B;  2DS0 A;  3BA4 A;  5DZU A;  2KH2 A;  2VLC A;  1M2T B;  4KEJ A;  2K8R A;  1J0S A;  3BAQ A;  3TC2 A;  1S0L A;  4II0 A;  1ISX A;  1IOB A;  2VSE A;  1I1E A;  1Q1U A;  1XG6 A;  3BRD A;  4ZBV B;  3I2X A;  3Q7Y A;  2NYY A;  4YOL A;  1EYL A;  1T9F A;  3PG0 A;  3FUO A;  1QQL A;  4J2X A;  1FWV A;  3AKG A;  1II4 A;  2D7I A;  2FFU A;  1W3G A;  3W9T A;  1YBI A;  4I3N A;  3UDA A;  4J2S A;  1FGA A;  2Q3N B;  3PUB A;  3FJB A;  1RZO B;  4XFU A;  1W3F A;  2ZQO A;  2WRY A;  2Y9F A;  9ILB A;  3ZX7 A;  1G82 A;  4JRA A;  2F2F A;  4Q91 A;  3S8J A;  2BEB A;  4D8H A;  1AFC A;  1RY7 A;  1BFB A;  2VU9 A;  1RG8 A;  5I1B A;  1BLA A;  1DFQ A;  3HMY A;  4LO1 A;  1S0B A;  4I1E A;  4I2S A;  1TWM A;  3JRR A;  4KBB A;  4I4P A;  4LO7 B;  2YUG A;  2FDB M;  4EFQ A;  4MZH A;  1MD6 A;  2NZ9 A;  2KLL A;  4KEI A;  1G9A A;  2D24 A;  3OJM A;  4G1R A;  2E4M C;  1ISY A;  3ILA A;  2M49 A;  3CRH A;  3V79 C;  3V0A A;  1Z0H A;  1BFC A;  3AKH A;  5BQU A;  4X39 A;  3WA1 A;  1BFF A;  4IZX A;  1T4Q A;  3AJ6 A;  2HWM A;  4J2Y A;  2HZ9 A;  3LTQ A;  4P0K A;  4QD2 C;  1ONK B;  5JLV A;  3FJF A;  1JT7 A;  1S0F A;  4OEG A;  2X2T A;  1S0C A;  4Z9W B;  5BXT A;  4USO A;  2D43 A;  2DRE A;  4ZFW B;  3AH1 A;  1L2H A;  5BVP I;  2L5X A;  1TIE A;  1R8N A;  1FMZ A;  5EG6 C;  2XOA A;  1JLY A;  4Q9P A;  3H6Q A;  4IY9 A;  1G9C A;  2LIE A;  2J3P A;  2Q9X A;  1KNM A;  3OJ2 A;  3FJJ A;  3FJ8 A;  1WBA A;  4P0L A;  4GOY A;  4OWJ A;  4JP0 A;  3R4S A;  3O44 A;  4I4U A;  1AVX B;  2KI6 B;  5FNX A;  1PC8 B;  4X38 A;  4EFP A;  3P6J A;  4ZFY B;  3O5W B;  3FFZ A;  4IHZ A;  3CA3 A;  2D7R A;  2F2F C;  1TOO A;  3BAO A;  5F90 A;  3WMU A;  1FMM S;  1TWE A;  3IM6 A;  3LLP A;  3NBC A;  3O4D A;  1AVA C;  3FJC A;  1IHK A;  3VEQ A;  3ZC8 A;  4LO2 A;  3UJ4 A;  4D0Z A;  4IQP A;  2MIB A;  2IHO A;  2P23 A;  3F1R A;  2HWA A;  1FN0 A;  1K5U A;  7I1B A;  1JLX A;  4H75 A;  1EVT A;  4MZG B;  3C9Z A;  2Y9X E;  3BAD A;  4TLP A;  3CA4 A;  5EHA A;  3A22 A;  1D0H A;  4JKQ A;  3AH4 A;  3BX1 C;  1HWO B;  3O4A A;  1DZC A;  5BXS A;  1IT0 A;  3POK A;  4JQ0 A;  1A8D A;  4HJJ A;  3P6I A;  5DVH A;  2FFV A;  3HSM A;  5HPZ A;  3BAU A;  1V6X A;  4EEE B;  3ZXD A;  1JTC A;  4G6J A;  4Q9G A;  1HCD A;  1OQL B;  1AVU A;  1EV2 A;  1XZZ A;  4I4R A;  5E24 E;  4X3A A;  5BP5 A;  3RTI B;  3FGM A;  4J23 B;  3VSF A;  3FJD A;  4LO3 A;  2ET2 A;  2VXT I;  2I1B A;  2QN4 A;  4ZKT B;  3CQA A;  4QKS A;  4R6U B;  2MC2 A;  3N7L A;  1ISW A;  2R9K B;  3BA7 A;  4P0J A;  3IIR A;  3KMV A;  3HBW A;  3BRG C;  5GAQ A;  1K5V A;  2Z48 A;  5D63 A;  3OGF A;  4QKR A;  4QO3 A;  3BRF A;  1FV3 A;  4A7K A;  3AKF A;  2NVH A;  5DUY A;  4GAF A;  4OUJ A;  1V6V A;  5DSS B;  1HWM B;  4EKX B;  31BI A;  5F8W A;  3O4O A;  1NZK A;  4LO2 C;  3E8L C;  1VCL A;  1DQG A;  3NBN A;  2X2S A;  2DRZ A;  3OBT A;  21BI A;  2ZR1 B;  2FO1 A;  4ISQ A;  3A23 A;  3PME A;  3CA1 A;  4QBC A;  3UD8 A;  3B9U A;  4OWK A;  4DCK C;  3BA5 A;  3AH2 A;  1JQZ A;  1N4K A;  2QYI B;  2D1Z A;  2IWT B;  1Q03 A;  2VXR A;  3UJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...