4XFUA

Structure of il-18 ser mutant v
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
156
structure length
149
Chain Sequence
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTNAPRTIFIISMYKDSQRRGMAVTISVACAAASTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRRVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEELGDRSIMFTVQNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of interleukin-18 for structure-based inhibitor design.
pubmed doi rcsb
molecule keywords Interleukin-18
molecule tags Cytokine
source organism Homo sapiens
total genus 29
structure length 149
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4xfuA00
1CE7B 2KI4A 3Q7YA 1JLXA 4I0YA 4QKRA 4X3AA 1IRPA 1NUNA 3CA3A 2D23A 1M2TB 2NVHA 3AKGA 3IM7A 4P0KA 1S0DA 1IRAX 1TFMB 4I4SA 4ZGRB 4USPA 1IILA 4H04A 3H6RB 1D0HA 3IIRA 4JQ0A 1BASA 2IHOA 2RSTA 3C9ZA 3O4BA 2QN4A 3V0AB 2WBCA 3FGMA 3KMVA 3AH1A 5DZUA 3ZXGA 3VUOA 1TWEA 31BIA 4FVVA 4ZFYB 1MD6A 1A8DA 5BXRA 1DZCA 1FV3A 4HA2A 1OQLB 4XKIA 2KI6B 3CA5A 2YUGA 4JP0A 3CA6A 2D7IA 3BAOA 5GAQA 4EFQA 3HSMA 3K1XA 3V0BA 1PZZA 3I2AA 4EEEB 4JKXB 2LIQA 2RQ9A 3VT0A 4OUJA 1BFBA 2K8RA 3O4OA 3BA7A 1AVUA 1TP0A 9ILBA 4IZEA 4LO2A 3ZC9A 2MC2A 5EC5A 1FV2A 1RMLA 4I4YA 1HIBA 2NYYA 2Y9GA 3TC2A 1PC8B 1XZZA 4YOLA 2VUAA 3A23A 3H6SE 4ISRA 4LO3C 4R6UB 3WO3A 2NP0A 3B9UA 1M16A 3HMYA 1BLDA 4QALA 1CVSA 4XFUA 3Q7XA 2VU9A 1Z0HA 5FNWA 1Q03A 4EB2B 3ILAA 4QD2B 1ISVA 4EKXB 2D24A 1HWNB 3HOMA 3N7LA 3UD8A 3P53A 3NBEA 1FN0A 4LO7C 4ZFWB 4KBBA 1ISZA 3JUTA 4Z9WB 4I4QA 3ZXDA 4IONA 4G1RA 4LO8B 2MIBA 3A21A 4P0LA 1EPWA 3BA4A 1PUMB 4IZXA 4ZA3B 1BFGA 1HWMB 2DREA 3UD9A 1YTOA 2NTDA 1T4QA 1DJSB 4I1EA 3NBCA 3FJKA 1S0EA 1Q1UA 4JRAA 2HWMA 4OWLA 3BAGA 4J2SA 1ONKB 1YXWA 4Q91A 3FJJA 4G9NA 4Q9PA 1AXMA 4ENDA 3VT1A 1W3AA 1I1EA 3AKHA 1R8OA 3UDAA 3FJCA 1JQZA 1AVWB 2L5XA 3N7JA 1K5UA 4QC4A 4XFSA 3V0BB 2VXTI 5D62A 4KEIA 1WBCA 1I1BA 5BP5C 3WMVA 3AJ5A 1BFCA 3QYDA 1XYFA 3NBDA 3O44A 1TIEA 3FUQA 2E4MC 3FJHA 2K4AB 2HWAA 5BXTA 2GO2A 1DZDA 1XHBA 3AJ6A 1HWOB 4LO1A 2P39A 1DLLA 3VSFA 5BOWA 41BIA 2ZQNA 3LLPA 1VCLA 1RG8A 2UUSA 5I1BA 5BXSA 1K5VA 4J23B 5DVHA 1ISYA 2ZR1B 4GAIA 2X2SA 5FNXA 1V6XA 3O3QA 1G82A 3POKA 4H9WA 4GAFA 4LO1C 4ZBVB 4I4RA 4OW4A 4DEPA 2Q9XA 4AN7B 5F8WA 3FJFA 3JRRA 1FWUA 4G6MA 1BLAA 4P0JA 4LO3A 4QKSA 3HBWA 4WBCA 2HW9A 2Q3NB 3WO4A 3CA4A 1RY7A 4KEJA 6I1BA 4Q9GA 4GP3A 4JKQA 4L4HA 2FFVA 5EHAA 4FGFA 4I96A 4LO7B 3VEQA 1YBIA 3UD7A 3R4SA 5F8YA 1BARA 2AFGA 3RMXA 3R4UA 3O5WB 1IT0A 3EF2A 4D8HA 1AF9A 1HCDA 1GGPB 1HKNA 3N7MA 1Z4SA 2P23A 2D20A 3IM6A 4XFTA 4IHZA 2ESUA 3BRFA 4I4VA 2AAIB 2DRYA 1QQLA 2Z49A 3BAQA 2KKIA 3NBNA 1G9CA 4DENA 5D63A 3FJ8A 3MPPG 2F8XC 1Z2VA 4J2XA 4QBVA 4ZKTB 4JPZA 3AKFA 1QXMA 3BB2A 4IY9A 1AFCA 5BQUC 1AVXB 1S0CA 4A7ZA 1Q04A 1J0SA 1ITBA 2VXRA 3BX1C 1DQGA 2DS0A 4LO0A 3S8JA 3IM5A 2ERMA 1DFCA 2FDBM 3FUOA 1S0GA 3RTJB 1FQ9A 2Y9XE 5E24E 3VT2A 1W3FA 1YF8B 3I29B 4IYBA 3AKIA 3UJ4A 4EFRA 3FJAA 2X2TA 3CA0A 3WA1A 5BP5A 2Y9FA 1TOOA 3D7WB 4D0ZA 2M49A 3T8SA 3OGFA 4IY8A 4ZOTA 3FJEA 3FJIA 2E4MA 3CRIA 4QBCA 21BIA 3I2XA 3AZVA 4LO0C 4KEKA 4OWKA 3CU1B 1E0OA 4KC3A 4X37A 1WBAA 3PG0A 1HWPB 1S0LA 3BRGC 1IJTA 2D44A 4QD2C 5JLVA 5JMCA 2VLCA 4I8MA 1DQOA 3V79C 4I4XA 1JLYA 2FGFA 3O4DA 1JTCA 1FMZA 3BAUA 2D7RA 3W9TA 4OWJA 8I1BA 1T9FA 4F83A 3HALA 3O49A 3CRHA 3P6JA 4CJMA 1EYLA 1UPSA 3BAVA 1S0BA 5FZUA 3FFZA 4A7YA 4JAWA 3FJ9A 2K43A 3FJDA 1SZ6B 3OBRA 4A7KA 2MLLB 1ISWA 1F31A 1JY0A 1JT5A 3ZX7A 2R9KB 3ZC8A 3VWCA 3NJ5A 5BXPA 1PUUB 2XOAA 3OJMA 3AZWA 4ISQA 3AH2A 3BTAA 2RG9B 3BADA 1JT3A 5G00A 4DCKC 1N4KA 1SR4C 4G9MA 1G9AA 2F2FA 3BRDA 4EFPA 1DFQA 2Y9WC 2ET2A 3H6RA 1PWAA 4X39A 3CRGA 3V0AA 1JT7A 2NM1A 3QR5A 3RMYA 3P6IA 2GZBA 1FWVA 3WMUA 2J3PA 2NZ9A 5B2HA 3HN1A 4OEEA 4ZFUB 1V6WA 2VSEA 2Z48A 4P6AA 2FFUA 3SNVA 4D0TA 2F2FC 4Z8SB 3RTIB 5BQUA 3A07A 5BVPI 3O4CA 3N0KA 2D43A 3OJVA 3S8KA 3BA5A 2WRYA 2I1BA 2AQZA 3N7KA 3A22A 3F1RA 1II4A 5EG6C 3MALA 4QO3A 1FMMS 3FJBA 2FO1A 4J2KA 4OEGA 2VSAA 3WO2A 3BAHA 1WD4A 1ISXA 1XG6A 4GP0A 3OJ2A 4I37A 5HPZA 1DIWA 3WINA 3IAGC 1P63A 4J2YA 5FZZA 4F34A 4TLPA 4IQPA 1R8NA 3CA1A 1G9DA 4I4UA 4II0A 4G6JA 1JT4A 5F90A 2AXMA 1WD3A 1V6VA 2LIEA 2KH2A 3O4AA 4HR6C 2BEBA 1TTUA 2HZ9A 1ILR1 4LO2C 3CAHA 4USOA 3CQAA 5DSSB 4L4IA 2D22A 1S0FA 1L2HA 2KLLA 5F8SA 1IHKA 2DRZA 3OGGA 1EV2A 4I6IA 3WINC 5FZYA 4GOYA 3VSZA 4AN6A 3PHZA 1G9BA 1V6UA 4HJJA 1W3GA 3PMEA 5DUYA 1TWMA 2BFHA 1HCEA 3OBTA 4I4OA 1YYNA 4I4PA 1MC9A 4X38A 3E8LC 4OEFA 4I2SA 1BA7A 1EVTA 3F62B 2QYIB 4I7IA 3H6QA 3PUBA 1RZOB 3LTQA 4I1BA 3UJ0A 4ZLBB 1SR4A 4PC4A 7I1BA 1QQKA 2BEAA 4GOVA 1ABRB 2IWTB 1KNMA 2D1ZA 2ZQOA 4I3NA 5D61A 1FGAA 3Q7WA 1BFFA 1NZKA 1AVAC 3AH4A 3RSJA 1IOBA
chains in the Genus database with same CATH superfamily
1CE7B 2KI4A 3Q7YA 1JLXA 4I0YA 4QKRA 4X3AA 1IRPA 1NUNA 3CA3A 2D23A 1M2TB 2NVHA 3AKGA 3IM7A 4P0KA 1S0DA 1IRAX 1TFMB 4I4SA 4ZGRB 4USPA 1IILA 4H04A 3H6RB 1D0HA 3IIRA 4JQ0A 1BASA 2IHOA 2RSTA 3C9ZA 3O4BA 2QN4A 3V0AB 2WBCA 3FGMA 3KMVA 3AH1A 5DZUA 3ZXGA 3VUOA 1TWEA 31BIA 4FVVA 4ZFYB 1MD6A 1A8DA 5BXRA 1DZCA 1FV3A 4HA2A 1OQLB 4XKIA 2KI6B 3CA5A 2YUGA 4JP0A 3CA6A 2D7IA 3BAOA 5GAQA 4EFQA 3HSMA 3K1XA 3V0BA 1PZZA 3I2AA 4EEEB 4JKXB 2LIQA 2RQ9A 3VT0A 4OUJA 1BFBA 2K8RA 3O4OA 3BA7A 1AVUA 1TP0A 9ILBA 4IZEA 4MZHA 4LO2A 3ZC9A 2MC2A 5EC5A 1FV2A 1RMLA 4I4YA 1HIBA 2NYYA 2Y9GA 3TC2A 1PC8B 1XZZA 4YOLA 2VUAA 3A23A 3H6SE 4ISRA 4LO3C 4R6UB 3WO3A 2NP0A 3B9UA 1M16A 3HMYA 1BLDA 4QALA 1CVSA 4XFUA 3Q7XA 2VU9A 1Z0HA 5FNWA 1Q03A 4EB2B 3ILAA 4QD2B 1ISVA 4EKXB 2D24A 1HWNB 3HOMA 3N7LA 3UD8A 3P53A 3NBEA 1FN0A 4LO7C 4ZFWB 4KBBA 1ISZA 3JUTA 4Z9WB 4UY4A 4I4QA 3ZXDA 4IONA 4G1RA 4LO8B 2MIBA 3A21A 4P0LA 1EPWA 3BA4A 1PUMB 4IZXA 4ZA3B 1BFGA 1HWMB 2DREA 3UD9A 1YTOA 2NTDA 1T4QA 1DJSB 4I1EA 3NBCA 3FJKA 1S0EA 1Q1UA 4JRAA 2HWMA 4OWLA 3BAGA 4J2SA 1ONKB 1YXWA 4Q91A 3FJJA 4G9NA 4Q9PA 1AXMA 4ENDA 3VT1A 1W3AA 1I1EA 3AKHA 1R8OA 3UDAA 3FJCA 1JQZA 1AVWB 2L5XA 3N7JA 1K5UA 4QC4A 4XFSA 3V0BB 2VXTI 5D62A 4KEIA 1WBCA 1I1BA 5BP5C 3WMVA 3AJ5A 1BFCA 3QYDA 1XYFA 3NBDA 3O44A 1TIEA 3FUQA 2E4MC 3FJHA 2K4AB 2HWAA 5BXTA 2GO2A 1DZDA 1XHBA 3AJ6A 1HWOB 4LO1A 2P39A 1DLLA 3VSFA 5BOWA 41BIA 2ZQNA 3LLPA 1VCLA 1RG8A 2UUSA 5I1BA 5BXSA 1K5VA 4J23B 5DVHA 1ISYA 2ZR1B 4GAIA 2X2SA 5FNXA 1V6XA 3O3QA 1G82A 3POKA 4H9WA 4GAFA 4LO1C 4ZBVB 4I4RA 4OW4A 4DEPA 2Q9XA 4AN7B 5F8WA 3FJFA 3JRRA 1FWUA 4G6MA 1BLAA 4P0JA 4LO3A 4QKSA 3HBWA 4WBCA 2HW9A 2Q3NB 3WO4A 3CA4A 1RY7A 4KEJA 6I1BA 4Q9GA 4GP3A 4JKQA 4L4HA 2FFVA 5EHAA 4FGFA 4I96A 4LO7B 3VEQA 1YBIA 3UD7A 3R4SA 5F8YA 1BARA 2AFGA 3RMXA 3R4UA 3O5WB 1IT0A 3EF2A 4D8HA 1AF9A 1HCDA 1GGPB 1HKNA 3N7MA 1Z4SA 2P23A 2D20A 3IM6A 4XFTA 4IHZA 2ESUA 3BRFA 4I4VA 2AAIB 2DRYA 1QQLA 2Z49A 3BAQA 2KKIA 3NBNA 1G9CA 4DENA 5D63A 3FJ8A 3MPPG 2F8XC 1Z2VA 4J2XA 4QBVA 4ZKTB 4JPZA 3AKFA 1QXMA 3BB2A 4IY9A 1AFCA 5BQUC 1AVXB 1S0CA 4A7ZA 1Q04A 1J0SA 1ITBA 2VXRA 3BX1C 1DQGA 2DS0A 4LO0A 3S8JA 3IM5A 2ERMA 1DFCA 2FDBM 3FUOA 1S0GA 3RTJB 1FQ9A 2Y9XE 5E24E 3VT2A 1W3FA 1YF8B 3I29B 4IYBA 3AKIA 3UJ4A 4EFRA 3FJAA 2X2TA 3CA0A 3WA1A 5BP5A 2Y9FA 1TOOA 3D7WB 4D0ZA 2M49A 3T8SA 3OGFA 4IY8A 4ZOTA 3FJEA 3FJIA 2E4MA 3CRIA 4QBCA 21BIA 3I2XA 3AZVA 4LO0C 4KEKA 4OWKA 3CU1B 4MZFB 2NS2A 1E0OA 4KC3A 4X37A 1WBAA 3PG0A 1HWPB 1S0LA 3BRGC 1IJTA 2D44A 4QD2C 5JLVA 5JMCA 2VLCA 4I8MA 1DQOA 3V79C 4I4XA 1JLYA 2FGFA 3O4DA 1JTCA 1FMZA 3BAUA 2D7RA 3W9TA 4OWJA 8I1BA 1T9FA 4F83A 3HALA 3O49A 3CRHA 3P6JA 4CJMA 1EYLA 1UPSA 3BAVA 1S0BA 5FZUA 3FFZA 4A7YA 4JAWA 3FJ9A 2K43A 3FJDA 1SZ6B 3OBRA 4A7KA 2MLLB 1ISWA 1F31A 1JY0A 1JT5A 3ZX7A 2R9KB 3ZC8A 3VWCA 3NJ5A 5BXPA 1PUUB 2XOAA 3OJMA 3AZWA 4ISQA 3AH2A 3BTAA 2RG9B 3BADA 1JT3A 5G00A 4DCKC 1N4KA 1SR4C 4G9MA 1G9AA 2F2FA 3BRDA 4EFPA 1DFQA 2Y9WC 2ET2A 3H6RA 1PWAA 4X39A 3CRGA 3V0AA 1JT7A 2NM1A 3QR5A 3RMYA 3P6IA 2GZBA 1FWVA 3WMUA 2J3PA 2NZ9A 5B2HA 3HN1A 4OEEA 4ZFUB 1V6WA 2VSEA 2Z48A 4P6AA 2FFUA 3SNVA 4D0TA 2F2FC 4Z8SB 3RTIB 5BQUA 3A07A 5BVPI 3O4CA 3N0KA 2D43A 3OJVA 3S8KA 3BA5A 2WRYA 2I1BA 2AQZA 3N7KA 3A22A 3F1RA 1II4A 5EG6C 3MALA 4QO3A 1FMMS 3FJBA 2FO1A 4J2KA 4OEGA 2VSAA 3WO2A 3BAHA 1WD4A 1ISXA 1XG6A 4GP0A 3OJ2A 4I37A 5HPZA 1DIWA 3WINA 3IAGC 1P63A 4J2YA 5FZZA 4F34A 4TLPA 4IQPA 1R8NA 3CA1A 1G9DA 4I4UA 4II0A 4G6JA 1JT4A 5F90A 2AXMA 1WD3A 1V6VA 2LIEA 2KH2A 3O4AA 4HR6C 2BEBA 1TTUA 2HZ9A 1ILR1 4LO2C 3CAHA 4USOA 3CQAA 5DSSB 4L4IA 2D22A 1S0FA 1L2HA 2KLLA 5F8SA 1IHKA 2DRZA 3OGGA 1EV2A 4I6IA 3WINC 5FZYA 4GOYA 3VSZA 4AN6A 3PHZA 4MZGB 4H75A 1G9BA 1V6UA 4HJJA 1W3GA 3PMEA 5DUYA 1TWMA 2BFHA 1HCEA 3OBTA 4I4OA 1YYNA 4I4PA 1MC9A 4X38A 3E8LC 4OEFA 4I2SA 1BA7A 1EVTA 3F62B 2QYIB 4I7IA 3H6QA 3PUBA 1RZOB 3LTQA 4I1BA 3UJ0A 4ZLBB 1SR4A 4PC4A 7I1BA 1QQKA 2BEAA 4GOVA 1ABRB 2IWTB 1KNMA 2D1ZA 2ZQOA 4I3NA 5D61A 1FGAA 3Q7WA 1BFFA 1NZKA 1AVAC 3AH4A 3RSJA 1IOBA
chains in the Genus database with same CATH topology
1CE7B 2KI4A 3Q7YA 1JLXA 4I0YA 4QKRA 4X3AA 1IRPA 1NUNA 3CA3A 2D23A 1M2TB 2NVHA 3AKGA 3IM7A 4P0KA 1S0DA 1IRAX 1TFMB 4I4SA 4ZGRB 4USPA 1IILA 4H04A 3H6RB 1D0HA 3IIRA 4JQ0A 1BASA 2IHOA 2RSTA 3C9ZA 3O4BA 2QN4A 3V0AB 2WBCA 3FGMA 3KMVA 3AH1A 5DZUA 3ZXGA 3VUOA 1TWEA 31BIA 4FVVA 4ZFYB 1MD6A 1A8DA 5BXRA 1DZCA 1FV3A 4HA2A 1OQLB 4XKIA 2KI6B 3CA5A 2YUGA 4JP0A 3CA6A 2D7IA 3BAOA 5GAQA 4EFQA 3HSMA 3K1XA 3V0BA 1PZZA 3I2AA 4EEEB 4JKXB 2LIQA 2RQ9A 3VT0A 4OUJA 1BFBA 2K8RA 3O4OA 3BA7A 1AVUA 1TP0A 9ILBA 4IZEA 4MZHA 4LO2A 3ZC9A 2MC2A 5EC5A 1FV2A 1RMLA 4I4YA 1HIBA 2NYYA 2Y9GA 3TC2A 1PC8B 1XZZA 4YOLA 2VUAA 3A23A 3H6SE 4ISRA 4LO3C 4R6UB 3WO3A 2NP0A 3B9UA 1M16A 3HMYA 1BLDA 4QALA 1CVSA 4XFUA 3Q7XA 2VU9A 1Z0HA 5FNWA 1Q03A 4EB2B 3ILAA 4QD2B 1ISVA 4EKXB 2D24A 1HWNB 3HOMA 3N7LA 3UD8A 3P53A 3NBEA 1FN0A 4LO7C 4ZFWB 4KBBA 1ISZA 3JUTA 4Z9WB 4UY4A 4I4QA 3ZXDA 4IONA 4G1RA 4LO8B 2MIBA 3A21A 4P0LA 1EPWA 3BA4A 1PUMB 4IZXA 4ZA3B 1BFGA 1HWMB 2DREA 3UD9A 1YTOA 2NTDA 1T4QA 1DJSB 4I1EA 3NBCA 3FJKA 1S0EA 1Q1UA 4JRAA 2HWMA 4OWLA 3BAGA 4J2SA 1ONKB 1YXWA 4Q91A 3FJJA 4G9NA 4Q9PA 1AXMA 4ENDA 3VT1A 1W3AA 1I1EA 3AKHA 1R8OA 3UDAA 3FJCA 1JQZA 1AVWB 2L5XA 3N7JA 1K5UA 4QC4A 4XFSA 3V0BB 2VXTI 5D62A 4KEIA 1WBCA 1I1BA 5BP5C 3WMVA 3AJ5A 1BFCA 3QYDA 1XYFA 3NBDA 3O44A 1TIEA 3FUQA 2E4MC 3FJHA 2K4AB 2HWAA 5BXTA 2GO2A 1DZDA 1XHBA 3AJ6A 1HWOB 4LO1A 2P39A 1DLLA 3VSFA 5BOWA 41BIA 2ZQNA 3LLPA 1VCLA 1RG8A 2UUSA 5I1BA 5BXSA 1K5VA 4J23B 5DVHA 1ISYA 2ZR1B 4GAIA 2X2SA 5FNXA 1V6XA 3O3QA 1G82A 3POKA 4H9WA 4GAFA 4LO1C 4ZBVB 4I4RA 4OW4A 4DEPA 2Q9XA 4AN7B 5F8WA 3FJFA 3JRRA 1FWUA 4G6MA 1BLAA 4P0JA 4LO3A 4QKSA 3HBWA 4WBCA 2HW9A 2Q3NB 3WO4A 3CA4A 1RY7A 4KEJA 6I1BA 4Q9GA 4GP3A 4JKQA 4L4HA 2FFVA 5EHAA 4FGFA 4I96A 4LO7B 3VEQA 1YBIA 3UD7A 3R4SA 5F8YA 1BARA 2AFGA 3RMXA 3R4UA 3O5WB 1IT0A 3EF2A 4D8HA 1AF9A 1HCDA 1GGPB 1HKNA 3N7MA 1Z4SA 2P23A 2D20A 3IM6A 4XFTA 4IHZA 2ESUA 3BRFA 4I4VA 2AAIB 2DRYA 1QQLA 2Z49A 3BAQA 2KKIA 3NBNA 1G9CA 4DENA 5D63A 3FJ8A 3MPPG 2F8XC 1Z2VA 4J2XA 4QBVA 4ZKTB 4JPZA 3AKFA 1QXMA 3BB2A 4IY9A 1AFCA 5BQUC 1AVXB 1S0CA 4A7ZA 1Q04A 1J0SA 1ITBA 2VXRA 3BX1C 1DQGA 2DS0A 4LO0A 3S8JA 3IM5A 2ERMA 1DFCA 2FDBM 3FUOA 1S0GA 3RTJB 1FQ9A 2Y9XE 5E24E 3VT2A 1W3FA 1YF8B 3I29B 4IYBA 3AKIA 3UJ4A 4EFRA 3FJAA 2X2TA 3CA0A 3WA1A 5BP5A 2Y9FA 1TOOA 3D7WB 4D0ZA 2M49A 3T8SA 3OGFA 4IY8A 4ZOTA 3FJEA 3FJIA 2E4MA 3CRIA 4QBCA 21BIA 3I2XA 3AZVA 4LO0C 4KEKA 4OWKA 3CU1B 4MZFB 2NS2A 1E0OA 4KC3A 4X37A 1WBAA 3PG0A 1HWPB 1S0LA 3BRGC 1IJTA 2D44A 4QD2C 5JLVA 5JMCA 2VLCA 4I8MA 1DQOA 3V79C 4I4XA 1JLYA 2FGFA 3O4DA 1JTCA 1FMZA 3BAUA 2D7RA 3W9TA 4OWJA 8I1BA 1T9FA 4F83A 3HALA 3O49A 3CRHA 3P6JA 4CJMA 1EYLA 1UPSA 3BAVA 1S0BA 5FZUA 3FFZA 4A7YA 4JAWA 3FJ9A 2K43A 3FJDA 1SZ6B 3OBRA 4A7KA 2MLLB 1ISWA 1F31A 1JY0A 1JT5A 3ZX7A 2R9KB 3ZC8A 3VWCA 3NJ5A 5BXPA 1PUUB 2XOAA 3OJMA 3AZWA 4ISQA 3AH2A 3BTAA 2RG9B 3BADA 1JT3A 5G00A 4DCKC 1N4KA 1SR4C 4G9MA 1G9AA 2F2FA 3BRDA 4EFPA 1DFQA 2Y9WC 2ET2A 3H6RA 1PWAA 4X39A 3CRGA 3V0AA 1JT7A 2NM1A 3QR5A 3RMYA 3P6IA 2GZBA 1FWVA 3WMUA 2J3PA 2NZ9A 5B2HA 3HN1A 4OEEA 4ZFUB 1V6WA 2VSEA 2Z48A 4P6AA 2FFUA 3SNVA 4D0TA 2F2FC 4Z8SB 3RTIB 5BQUA 3A07A 5BVPI 3O4CA 3N0KA 2D43A 3OJVA 3S8KA 3BA5A 2WRYA 2I1BA 2AQZA 3N7KA 3A22A 3F1RA 1II4A 5EG6C 3MALA 4QO3A 1FMMS 3FJBA 2FO1A 4J2KA 4OEGA 2VSAA 3WO2A 3BAHA 1WD4A 1ISXA 1XG6A 4GP0A 3OJ2A 4I37A 5HPZA 1DIWA 3WINA 3IAGC 1P63A 4J2YA 5FZZA 4F34A 4TLPA 4IQPA 1R8NA 3CA1A 1G9DA 4I4UA 4II0A 4G6JA 1JT4A 5F90A 2AXMA 1WD3A 1V6VA 2LIEA 2KH2A 3O4AA 4HR6C 2BEBA 1TTUA 2HZ9A 1ILR1 4LO2C 3CAHA 4USOA 3CQAA 5DSSB 4L4IA 2D22A 1S0FA 1L2HA 2KLLA 5F8SA 1IHKA 2DRZA 3OGGA 1EV2A 4I6IA 3WINC 5FZYA 4GOYA 3VSZA 4AN6A 3PHZA 4MZGB 4H75A 1G9BA 1V6UA 4HJJA 1W3GA 3PMEA 5DUYA 1TWMA 2BFHA 1HCEA 3OBTA 4I4OA 1YYNA 4I4PA 1MC9A 4X38A 3E8LC 4OEFA 4I2SA 1BA7A 1EVTA 3F62B 2QYIB 4I7IA 3H6QA 3PUBA 1RZOB 3LTQA 4I1BA 3UJ0A 4ZLBB 1SR4A 4PC4A 7I1BA 1QQKA 2BEAA 4GOVA 1ABRB 2IWTB 1KNMA 2D1ZA 2ZQOA 4I3NA 5D61A 1FGAA 3Q7WA 1BFFA 1NZKA 1AVAC 3AH4A 3RSJA 1IOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CE7 B;  2KI4 A;  3Q7Y A;  1JLX A;  4I0Y A;  4QKR A;  4X3A A;  1IRP A;  1NUN A;  3CA3 A;  2D23 A;  1M2T B;  2NVH A;  3AKG A;  3IM7 A;  4P0K A;  1S0D A;  1IRA X;  1TFM B;  4I4S A;  4ZGR B;  4USP A;  1IIL A;  4H04 A;  3H6R B;  1D0H A;  3IIR A;  4JQ0 A;  1BAS A;  2IHO A;  2RST A;  3C9Z A;  3O4B A;  2QN4 A;  3V0A B;  2WBC A;  3FGM A;  3KMV A;  3AH1 A;  5DZU A;  3ZXG A;  3VUO A;  1TWE A;  31BI A;  4FVV A;  4ZFY B;  1MD6 A;  1A8D A;  5BXR A;  1DZC A;  1FV3 A;  4HA2 A;  1OQL B;  4XKI A;  2KI6 B;  3CA5 A;  2YUG A;  4JP0 A;  3CA6 A;  2D7I A;  3BAO A;  5GAQ A;  4EFQ A;  3HSM A;  3K1X A;  3V0B A;  1PZZ A;  3I2A A;  4EEE B;  4JKX B;  2LIQ A;  2RQ9 A;  3VT0 A;  4OUJ A;  1BFB A;  2K8R A;  3O4O A;  3BA7 A;  1AVU A;  1TP0 A;  9ILB A;  4IZE A;  4LO2 A;  3ZC9 A;  2MC2 A;  5EC5 A;  1FV2 A;  1RML A;  4I4Y A;  1HIB A;  2NYY A;  2Y9G A;  3TC2 A;  1PC8 B;  1XZZ A;  4YOL A;  2VUA A;  3A23 A;  3H6S E;  4ISR A;  4LO3 C;  4R6U B;  3WO3 A;  2NP0 A;  3B9U A;  1M16 A;  3HMY A;  1BLD A;  4QAL A;  1CVS A;  4XFU A;  3Q7X A;  2VU9 A;  1Z0H A;  5FNW A;  1Q03 A;  4EB2 B;  3ILA A;  4QD2 B;  1ISV A;  4EKX B;  2D24 A;  1HWN B;  3HOM A;  3N7L A;  3UD8 A;  3P53 A;  3NBE A;  1FN0 A;  4LO7 C;  4ZFW B;  4KBB A;  1ISZ A;  3JUT A;  4Z9W B;  4I4Q A;  3ZXD A;  4ION A;  4G1R A;  4LO8 B;  2MIB A;  3A21 A;  4P0L A;  1EPW A;  3BA4 A;  1PUM B;  4IZX A;  4ZA3 B;  1BFG A;  1HWM B;  2DRE A;  3UD9 A;  1YTO A;  2NTD A;  1T4Q A;  1DJS B;  4I1E A;  3NBC A;  3FJK A;  1S0E A;  1Q1U A;  4JRA A;  2HWM A;  4OWL A;  3BAG A;  4J2S A;  1ONK B;  1YXW A;  4Q91 A;  3FJJ A;  4G9N A;  4Q9P A;  1AXM A;  4END A;  3VT1 A;  1W3A A;  1I1E A;  3AKH A;  1R8O A;  3UDA A;  3FJC A;  1JQZ A;  1AVW B;  2L5X A;  3N7J A;  1K5U A;  4QC4 A;  4XFS A;  3V0B B;  2VXT I;  5D62 A;  4KEI A;  1WBC A;  1I1B A;  5BP5 C;  3WMV A;  3AJ5 A;  1BFC A;  3QYD A;  1XYF A;  3NBD A;  3O44 A;  1TIE A;  3FUQ A;  2E4M C;  3FJH A;  2K4A B;  2HWA A;  5BXT A;  2GO2 A;  1DZD A;  1XHB A;  3AJ6 A;  1HWO B;  4LO1 A;  2P39 A;  1DLL A;  3VSF A;  5BOW A;  41BI A;  2ZQN A;  3LLP A;  1VCL A;  1RG8 A;  2UUS A;  5I1B A;  5BXS A;  1K5V A;  4J23 B;  5DVH A;  1ISY A;  2ZR1 B;  4GAI A;  2X2S A;  5FNX A;  1V6X A;  3O3Q A;  1G82 A;  3POK A;  4H9W A;  4GAF A;  4LO1 C;  4ZBV B;  4I4R A;  4OW4 A;  4DEP A;  2Q9X A;  4AN7 B;  5F8W A;  3FJF A;  3JRR A;  1FWU A;  4G6M A;  1BLA A;  4P0J A;  4LO3 A;  4QKS A;  3HBW A;  4WBC A;  2HW9 A;  2Q3N B;  3WO4 A;  3CA4 A;  1RY7 A;  4KEJ A;  6I1B A;  4Q9G A;  4GP3 A;  4JKQ A;  4L4H A;  2FFV A;  5EHA A;  4FGF A;  4I96 A;  4LO7 B;  3VEQ A;  1YBI A;  3UD7 A;  3R4S A;  5F8Y A;  1BAR A;  2AFG A;  3RMX A;  3R4U A;  3O5W B;  1IT0 A;  3EF2 A;  4D8H A;  1AF9 A;  1HCD A;  1GGP B;  1HKN A;  3N7M A;  1Z4S A;  2P23 A;  2D20 A;  3IM6 A;  4XFT A;  4IHZ A;  2ESU A;  3BRF A;  4I4V A;  2AAI B;  2DRY A;  1QQL A;  2Z49 A;  3BAQ A;  2KKI A;  3NBN A;  1G9C A;  4DEN A;  5D63 A;  3FJ8 A;  3MPP G;  2F8X C;  1Z2V A;  4J2X A;  4QBV A;  4ZKT B;  4JPZ A;  3AKF A;  1QXM A;  3BB2 A;  4IY9 A;  1AFC A;  5BQU C;  1AVX B;  1S0C A;  4A7Z A;  1Q04 A;  1J0S A;  1ITB A;  2VXR A;  3BX1 C;  1DQG A;  2DS0 A;  4LO0 A;  3S8J A;  3IM5 A;  2ERM A;  1DFC A;  2FDB M;  3FUO A;  1S0G A;  3RTJ B;  1FQ9 A;  2Y9X E;  5E24 E;  3VT2 A;  1W3F A;  1YF8 B;  3I29 B;  4IYB A;  3AKI A;  3UJ4 A;  4EFR A;  3FJA A;  2X2T A;  3CA0 A;  3WA1 A;  5BP5 A;  2Y9F A;  1TOO A;  3D7W B;  4D0Z A;  2M49 A;  3T8S A;  3OGF A;  4IY8 A;  4ZOT A;  3FJE A;  3FJI A;  2E4M A;  3CRI A;  4QBC A;  21BI A;  3I2X A;  3AZV A;  4LO0 C;  4KEK A;  4OWK A;  3CU1 B;  1E0O A;  4KC3 A;  4X37 A;  1WBA A;  3PG0 A;  1HWP B;  1S0L A;  3BRG C;  1IJT A;  2D44 A;  4QD2 C;  5JLV A;  5JMC A;  2VLC A;  4I8M A;  1DQO A;  3V79 C;  4I4X A;  1JLY A;  2FGF A;  3O4D A;  1JTC A;  1FMZ A;  3BAU A;  2D7R A;  3W9T A;  4OWJ A;  8I1B A;  1T9F A;  4F83 A;  3HAL A;  3O49 A;  3CRH A;  3P6J A;  4CJM A;  1EYL A;  1UPS A;  3BAV A;  1S0B A;  5FZU A;  3FFZ A;  4A7Y A;  4JAW A;  3FJ9 A;  2K43 A;  3FJD A;  1SZ6 B;  3OBR A;  4A7K A;  2MLL B;  1ISW A;  1F31 A;  1JY0 A;  1JT5 A;  3ZX7 A;  2R9K B;  3ZC8 A;  3VWC A;  3NJ5 A;  5BXP A;  1PUU B;  2XOA A;  3OJM A;  3AZW A;  4ISQ A;  3AH2 A;  3BTA A;  2RG9 B;  3BAD A;  1JT3 A;  5G00 A;  4DCK C;  1N4K A;  1SR4 C;  4G9M A;  1G9A A;  2F2F A;  3BRD A;  4EFP A;  1DFQ A;  2Y9W C;  2ET2 A;  3H6R A;  1PWA A;  4X39 A;  3CRG A;  3V0A A;  1JT7 A;  2NM1 A;  3QR5 A;  3RMY A;  3P6I A;  2GZB A;  1FWV A;  3WMU A;  2J3P A;  2NZ9 A;  5B2H A;  3HN1 A;  4OEE A;  4ZFU B;  1V6W A;  2VSE A;  2Z48 A;  4P6A A;  2FFU A;  3SNV A;  4D0T A;  2F2F C;  4Z8S B;  3RTI B;  5BQU A;  3A07 A;  5BVP I;  3O4C A;  3N0K A;  2D43 A;  3OJV A;  3S8K A;  3BA5 A;  2WRY A;  2I1B A;  2AQZ A;  3N7K A;  3A22 A;  3F1R A;  1II4 A;  5EG6 C;  3MAL A;  4QO3 A;  1FMM S;  3FJB A;  2FO1 A;  4J2K A;  4OEG A;  2VSA A;  3WO2 A;  3BAH A;  1WD4 A;  1ISX A;  1XG6 A;  4GP0 A;  3OJ2 A;  4I37 A;  5HPZ A;  1DIW A;  3WIN A;  3IAG C;  1P63 A;  4J2Y A;  5FZZ A;  4F34 A;  4TLP A;  4IQP A;  1R8N A;  3CA1 A;  1G9D A;  4I4U A;  4II0 A;  4G6J A;  1JT4 A;  5F90 A;  2AXM A;  1WD3 A;  1V6V A;  2LIE A;  2KH2 A;  3O4A A;  4HR6 C;  2BEB A;  1TTU A;  2HZ9 A;  1ILR 1;  4LO2 C;  3CAH A;  4USO A;  3CQA A;  5DSS B;  4L4I A;  2D22 A;  1S0F A;  1L2H A;  2KLL A;  5F8S A;  1IHK A;  2DRZ A;  3OGG A;  1EV2 A;  4I6I A;  3WIN C;  5FZY A;  4GOY A;  3VSZ A;  4AN6 A;  3PHZ A;  1G9B A;  1V6U A;  4HJJ A;  1W3G A;  3PME A;  5DUY A;  1TWM A;  2BFH A;  1HCE A;  3OBT A;  4I4O A;  1YYN A;  4I4P A;  1MC9 A;  4X38 A;  3E8L C;  4OEF A;  4I2S A;  1BA7 A;  1EVT A;  3F62 B;  2QYI B;  4I7I A;  3H6Q A;  3PUB A;  1RZO B;  3LTQ A;  4I1B A;  3UJ0 A;  4ZLB B;  1SR4 A;  4PC4 A;  7I1B A;  1QQK A;  2BEA A;  4GOV A;  1ABR B;  2IWT B;  1KNM A;  2D1Z A;  2ZQO A;  4I3N A;  5D61 A;  1FGA A;  3Q7W A;  1BFF A;  1NZK A;  1AVA C;  3AH4 A;  3RSJ A;  1IOB A; 
#chains in the Genus database with same CATH topology
 1CE7 B;  2KI4 A;  3Q7Y A;  1JLX A;  4I0Y A;  4QKR A;  4X3A A;  1IRP A;  1NUN A;  3CA3 A;  2D23 A;  1M2T B;  2NVH A;  3AKG A;  3IM7 A;  4P0K A;  1S0D A;  1IRA X;  1TFM B;  4I4S A;  4ZGR B;  4USP A;  1IIL A;  4H04 A;  3H6R B;  1D0H A;  3IIR A;  4JQ0 A;  1BAS A;  2IHO A;  2RST A;  3C9Z A;  3O4B A;  2QN4 A;  3V0A B;  2WBC A;  3FGM A;  3KMV A;  3AH1 A;  5DZU A;  3ZXG A;  3VUO A;  1TWE A;  31BI A;  4FVV A;  4ZFY B;  1MD6 A;  1A8D A;  5BXR A;  1DZC A;  1FV3 A;  4HA2 A;  1OQL B;  4XKI A;  2KI6 B;  3CA5 A;  2YUG A;  4JP0 A;  3CA6 A;  2D7I A;  3BAO A;  5GAQ A;  4EFQ A;  3HSM A;  3K1X A;  3V0B A;  1PZZ A;  3I2A A;  4EEE B;  4JKX B;  2LIQ A;  2RQ9 A;  3VT0 A;  4OUJ A;  1BFB A;  2K8R A;  3O4O A;  3BA7 A;  1AVU A;  1TP0 A;  9ILB A;  4IZE A;  4MZH A;  4LO2 A;  3ZC9 A;  2MC2 A;  5EC5 A;  1FV2 A;  1RML A;  4I4Y A;  1HIB A;  2NYY A;  2Y9G A;  3TC2 A;  1PC8 B;  1XZZ A;  4YOL A;  2VUA A;  3A23 A;  3H6S E;  4ISR A;  4LO3 C;  4R6U B;  3WO3 A;  2NP0 A;  3B9U A;  1M16 A;  3HMY A;  1BLD A;  4QAL A;  1CVS A;  4XFU A;  3Q7X A;  2VU9 A;  1Z0H A;  5FNW A;  1Q03 A;  4EB2 B;  3ILA A;  4QD2 B;  1ISV A;  4EKX B;  2D24 A;  1HWN B;  3HOM A;  3N7L A;  3UD8 A;  3P53 A;  3NBE A;  1FN0 A;  4LO7 C;  4ZFW B;  4KBB A;  1ISZ A;  3JUT A;  4Z9W B;  4UY4 A;  4I4Q A;  3ZXD A;  4ION A;  4G1R A;  4LO8 B;  2MIB A;  3A21 A;  4P0L A;  1EPW A;  3BA4 A;  1PUM B;  4IZX A;  4ZA3 B;  1BFG A;  1HWM B;  2DRE A;  3UD9 A;  1YTO A;  2NTD A;  1T4Q A;  1DJS B;  4I1E A;  3NBC A;  3FJK A;  1S0E A;  1Q1U A;  4JRA A;  2HWM A;  4OWL A;  3BAG A;  4J2S A;  1ONK B;  1YXW A;  4Q91 A;  3FJJ A;  4G9N A;  4Q9P A;  1AXM A;  4END A;  3VT1 A;  1W3A A;  1I1E A;  3AKH A;  1R8O A;  3UDA A;  3FJC A;  1JQZ A;  1AVW B;  2L5X A;  3N7J A;  1K5U A;  4QC4 A;  4XFS A;  3V0B B;  2VXT I;  5D62 A;  4KEI A;  1WBC A;  1I1B A;  5BP5 C;  3WMV A;  3AJ5 A;  1BFC A;  3QYD A;  1XYF A;  3NBD A;  3O44 A;  1TIE A;  3FUQ A;  2E4M C;  3FJH A;  2K4A B;  2HWA A;  5BXT A;  2GO2 A;  1DZD A;  1XHB A;  3AJ6 A;  1HWO B;  4LO1 A;  2P39 A;  1DLL A;  3VSF A;  5BOW A;  41BI A;  2ZQN A;  3LLP A;  1VCL A;  1RG8 A;  2UUS A;  5I1B A;  5BXS A;  1K5V A;  4J23 B;  5DVH A;  1ISY A;  2ZR1 B;  4GAI A;  2X2S A;  5FNX A;  1V6X A;  3O3Q A;  1G82 A;  3POK A;  4H9W A;  4GAF A;  4LO1 C;  4ZBV B;  4I4R A;  4OW4 A;  4DEP A;  2Q9X A;  4AN7 B;  5F8W A;  3FJF A;  3JRR A;  1FWU A;  4G6M A;  1BLA A;  4P0J A;  4LO3 A;  4QKS A;  3HBW A;  4WBC A;  2HW9 A;  2Q3N B;  3WO4 A;  3CA4 A;  1RY7 A;  4KEJ A;  6I1B A;  4Q9G A;  4GP3 A;  4JKQ A;  4L4H A;  2FFV A;  5EHA A;  4FGF A;  4I96 A;  4LO7 B;  3VEQ A;  1YBI A;  3UD7 A;  3R4S A;  5F8Y A;  1BAR A;  2AFG A;  3RMX A;  3R4U A;  3O5W B;  1IT0 A;  3EF2 A;  4D8H A;  1AF9 A;  1HCD A;  1GGP B;  1HKN A;  3N7M A;  1Z4S A;  2P23 A;  2D20 A;  3IM6 A;  4XFT A;  4IHZ A;  2ESU A;  3BRF A;  4I4V A;  2AAI B;  2DRY A;  1QQL A;  2Z49 A;  3BAQ A;  2KKI A;  3NBN A;  1G9C A;  4DEN A;  5D63 A;  3FJ8 A;  3MPP G;  2F8X C;  1Z2V A;  4J2X A;  4QBV A;  4ZKT B;  4JPZ A;  3AKF A;  1QXM A;  3BB2 A;  4IY9 A;  1AFC A;  5BQU C;  1AVX B;  1S0C A;  4A7Z A;  1Q04 A;  1J0S A;  1ITB A;  2VXR A;  3BX1 C;  1DQG A;  2DS0 A;  4LO0 A;  3S8J A;  3IM5 A;  2ERM A;  1DFC A;  2FDB M;  3FUO A;  1S0G A;  3RTJ B;  1FQ9 A;  2Y9X E;  5E24 E;  3VT2 A;  1W3F A;  1YF8 B;  3I29 B;  4IYB A;  3AKI A;  3UJ4 A;  4EFR A;  3FJA A;  2X2T A;  3CA0 A;  3WA1 A;  5BP5 A;  2Y9F A;  1TOO A;  3D7W B;  4D0Z A;  2M49 A;  3T8S A;  3OGF A;  4IY8 A;  4ZOT A;  3FJE A;  3FJI A;  2E4M A;  3CRI A;  4QBC A;  21BI A;  3I2X A;  3AZV A;  4LO0 C;  4KEK A;  4OWK A;  3CU1 B;  4MZF B;  2NS2 A;  1E0O A;  4KC3 A;  4X37 A;  1WBA A;  3PG0 A;  1HWP B;  1S0L A;  3BRG C;  1IJT A;  2D44 A;  4QD2 C;  5JLV A;  5JMC A;  2VLC A;  4I8M A;  1DQO A;  3V79 C;  4I4X A;  1JLY A;  2FGF A;  3O4D A;  1JTC A;  1FMZ A;  3BAU A;  2D7R A;  3W9T A;  4OWJ A;  8I1B A;  1T9F A;  4F83 A;  3HAL A;  3O49 A;  3CRH A;  3P6J A;  4CJM A;  1EYL A;  1UPS A;  3BAV A;  1S0B A;  5FZU A;  3FFZ A;  4A7Y A;  4JAW A;  3FJ9 A;  2K43 A;  3FJD A;  1SZ6 B;  3OBR A;  4A7K A;  2MLL B;  1ISW A;  1F31 A;  1JY0 A;  1JT5 A;  3ZX7 A;  2R9K B;  3ZC8 A;  3VWC A;  3NJ5 A;  5BXP A;  1PUU B;  2XOA A;  3OJM A;  3AZW A;  4ISQ A;  3AH2 A;  3BTA A;  2RG9 B;  3BAD A;  1JT3 A;  5G00 A;  4DCK C;  1N4K A;  1SR4 C;  4G9M A;  1G9A A;  2F2F A;  3BRD A;  4EFP A;  1DFQ A;  2Y9W C;  2ET2 A;  3H6R A;  1PWA A;  4X39 A;  3CRG A;  3V0A A;  1JT7 A;  2NM1 A;  3QR5 A;  3RMY A;  3P6I A;  2GZB A;  1FWV A;  3WMU A;  2J3P A;  2NZ9 A;  5B2H A;  3HN1 A;  4OEE A;  4ZFU B;  1V6W A;  2VSE A;  2Z48 A;  4P6A A;  2FFU A;  3SNV A;  4D0T A;  2F2F C;  4Z8S B;  3RTI B;  5BQU A;  3A07 A;  5BVP I;  3O4C A;  3N0K A;  2D43 A;  3OJV A;  3S8K A;  3BA5 A;  2WRY A;  2I1B A;  2AQZ A;  3N7K A;  3A22 A;  3F1R A;  1II4 A;  5EG6 C;  3MAL A;  4QO3 A;  1FMM S;  3FJB A;  2FO1 A;  4J2K A;  4OEG A;  2VSA A;  3WO2 A;  3BAH A;  1WD4 A;  1ISX A;  1XG6 A;  4GP0 A;  3OJ2 A;  4I37 A;  5HPZ A;  1DIW A;  3WIN A;  3IAG C;  1P63 A;  4J2Y A;  5FZZ A;  4F34 A;  4TLP A;  4IQP A;  1R8N A;  3CA1 A;  1G9D A;  4I4U A;  4II0 A;  4G6J A;  1JT4 A;  5F90 A;  2AXM A;  1WD3 A;  1V6V A;  2LIE A;  2KH2 A;  3O4A A;  4HR6 C;  2BEB A;  1TTU A;  2HZ9 A;  1ILR 1;  4LO2 C;  3CAH A;  4USO A;  3CQA A;  5DSS B;  4L4I A;  2D22 A;  1S0F A;  1L2H A;  2KLL A;  5F8S A;  1IHK A;  2DRZ A;  3OGG A;  1EV2 A;  4I6I A;  3WIN C;  5FZY A;  4GOY A;  3VSZ A;  4AN6 A;  3PHZ A;  4MZG B;  4H75 A;  1G9B A;  1V6U A;  4HJJ A;  1W3G A;  3PME A;  5DUY A;  1TWM A;  2BFH A;  1HCE A;  3OBT A;  4I4O A;  1YYN A;  4I4P A;  1MC9 A;  4X38 A;  3E8L C;  4OEF A;  4I2S A;  1BA7 A;  1EVT A;  3F62 B;  2QYI B;  4I7I A;  3H6Q A;  3PUB A;  1RZO B;  3LTQ A;  4I1B A;  3UJ0 A;  4ZLB B;  1SR4 A;  4PC4 A;  7I1B A;  1QQK A;  2BEA A;  4GOV A;  1ABR B;  2IWT B;  1KNM A;  2D1Z A;  2ZQO A;  4I3N A;  5D61 A;  1FGA A;  3Q7W A;  1BFF A;  1NZK A;  1AVA C;  3AH4 A;  3RSJ A;  1IOB A; 
#chains in the Genus database with same CATH homology
 1CE7 B;  2KI4 A;  3Q7Y A;  1JLX A;  4I0Y A;  4QKR A;  4X3A A;  1IRP A;  1NUN A;  3CA3 A;  2D23 A;  1M2T B;  2NVH A;  3AKG A;  3IM7 A;  4P0K A;  1S0D A;  1IRA X;  1TFM B;  4I4S A;  4ZGR B;  4USP A;  1IIL A;  4H04 A;  3H6R B;  1D0H A;  3IIR A;  4JQ0 A;  1BAS A;  2IHO A;  2RST A;  3C9Z A;  3O4B A;  2QN4 A;  3V0A B;  2WBC A;  3FGM A;  3KMV A;  3AH1 A;  5DZU A;  3ZXG A;  3VUO A;  1TWE A;  31BI A;  4FVV A;  4ZFY B;  1MD6 A;  1A8D A;  5BXR A;  1DZC A;  1FV3 A;  4HA2 A;  1OQL B;  4XKI A;  2KI6 B;  3CA5 A;  2YUG A;  4JP0 A;  3CA6 A;  2D7I A;  3BAO A;  5GAQ A;  4EFQ A;  3HSM A;  3K1X A;  3V0B A;  1PZZ A;  3I2A A;  4EEE B;  4JKX B;  2LIQ A;  2RQ9 A;  3VT0 A;  4OUJ A;  1BFB A;  2K8R A;  3O4O A;  3BA7 A;  1AVU A;  1TP0 A;  9ILB A;  4IZE A;  4MZH A;  4LO2 A;  3ZC9 A;  2MC2 A;  5EC5 A;  1FV2 A;  1RML A;  4I4Y A;  1HIB A;  2NYY A;  2Y9G A;  3TC2 A;  1PC8 B;  1XZZ A;  4YOL A;  2VUA A;  3A23 A;  3H6S E;  4ISR A;  4LO3 C;  4R6U B;  3WO3 A;  2NP0 A;  3B9U A;  1M16 A;  3HMY A;  1BLD A;  4QAL A;  1CVS A;  4XFU A;  3Q7X A;  2VU9 A;  1Z0H A;  5FNW A;  1Q03 A;  4EB2 B;  3ILA A;  4QD2 B;  1ISV A;  4EKX B;  2D24 A;  1HWN B;  3HOM A;  3N7L A;  3UD8 A;  3P53 A;  3NBE A;  1FN0 A;  4LO7 C;  4ZFW B;  4KBB A;  1ISZ A;  3JUT A;  4Z9W B;  4UY4 A;  4I4Q A;  3ZXD A;  4ION A;  4G1R A;  4LO8 B;  2MIB A;  3A21 A;  4P0L A;  1EPW A;  3BA4 A;  1PUM B;  4IZX A;  4ZA3 B;  1BFG A;  1HWM B;  2DRE A;  3UD9 A;  1YTO A;  2NTD A;  1T4Q A;  1DJS B;  4I1E A;  3NBC A;  3FJK A;  1S0E A;  1Q1U A;  4JRA A;  2HWM A;  4OWL A;  3BAG A;  4J2S A;  1ONK B;  1YXW A;  4Q91 A;  3FJJ A;  4G9N A;  4Q9P A;  1AXM A;  4END A;  3VT1 A;  1W3A A;  1I1E A;  3AKH A;  1R8O A;  3UDA A;  3FJC A;  1JQZ A;  1AVW B;  2L5X A;  3N7J A;  1K5U A;  4QC4 A;  4XFS A;  3V0B B;  2VXT I;  5D62 A;  4KEI A;  1WBC A;  1I1B A;  5BP5 C;  3WMV A;  3AJ5 A;  1BFC A;  3QYD A;  1XYF A;  3NBD A;  3O44 A;  1TIE A;  3FUQ A;  2E4M C;  3FJH A;  2K4A B;  2HWA A;  5BXT A;  2GO2 A;  1DZD A;  1XHB A;  3AJ6 A;  1HWO B;  4LO1 A;  2P39 A;  1DLL A;  3VSF A;  5BOW A;  41BI A;  2ZQN A;  3LLP A;  1VCL A;  1RG8 A;  2UUS A;  5I1B A;  5BXS A;  1K5V A;  4J23 B;  5DVH A;  1ISY A;  2ZR1 B;  4GAI A;  2X2S A;  5FNX A;  1V6X A;  3O3Q A;  1G82 A;  3POK A;  4H9W A;  4GAF A;  4LO1 C;  4ZBV B;  4I4R A;  4OW4 A;  4DEP A;  2Q9X A;  4AN7 B;  5F8W A;  3FJF A;  3JRR A;  1FWU A;  4G6M A;  1BLA A;  4P0J A;  4LO3 A;  4QKS A;  3HBW A;  4WBC A;  2HW9 A;  2Q3N B;  3WO4 A;  3CA4 A;  1RY7 A;  4KEJ A;  6I1B A;  4Q9G A;  4GP3 A;  4JKQ A;  4L4H A;  2FFV A;  5EHA A;  4FGF A;  4I96 A;  4LO7 B;  3VEQ A;  1YBI A;  3UD7 A;  3R4S A;  5F8Y A;  1BAR A;  2AFG A;  3RMX A;  3R4U A;  3O5W B;  1IT0 A;  3EF2 A;  4D8H A;  1AF9 A;  1HCD A;  1GGP B;  1HKN A;  3N7M A;  1Z4S A;  2P23 A;  2D20 A;  3IM6 A;  4XFT A;  4IHZ A;  2ESU A;  3BRF A;  4I4V A;  2AAI B;  2DRY A;  1QQL A;  2Z49 A;  3BAQ A;  2KKI A;  3NBN A;  1G9C A;  4DEN A;  5D63 A;  3FJ8 A;  3MPP G;  2F8X C;  1Z2V A;  4J2X A;  4QBV A;  4ZKT B;  4JPZ A;  3AKF A;  1QXM A;  3BB2 A;  4IY9 A;  1AFC A;  5BQU C;  1AVX B;  1S0C A;  4A7Z A;  1Q04 A;  1J0S A;  1ITB A;  2VXR A;  3BX1 C;  1DQG A;  2DS0 A;  4LO0 A;  3S8J A;  3IM5 A;  2ERM A;  1DFC A;  2FDB M;  3FUO A;  1S0G A;  3RTJ B;  1FQ9 A;  2Y9X E;  5E24 E;  3VT2 A;  1W3F A;  1YF8 B;  3I29 B;  4IYB A;  3AKI A;  3UJ4 A;  4EFR A;  3FJA A;  2X2T A;  3CA0 A;  3WA1 A;  5BP5 A;  2Y9F A;  1TOO A;  3D7W B;  4D0Z A;  2M49 A;  3T8S A;  3OGF A;  4IY8 A;  4ZOT A;  3FJE A;  3FJI A;  2E4M A;  3CRI A;  4QBC A;  21BI A;  3I2X A;  3AZV A;  4LO0 C;  4KEK A;  4OWK A;  3CU1 B;  4MZF B;  2NS2 A;  1E0O A;  4KC3 A;  4X37 A;  1WBA A;  3PG0 A;  1HWP B;  1S0L A;  3BRG C;  1IJT A;  2D44 A;  4QD2 C;  5JLV A;  5JMC A;  2VLC A;  4I8M A;  1DQO A;  3V79 C;  4I4X A;  1JLY A;  2FGF A;  3O4D A;  1JTC A;  1FMZ A;  3BAU A;  2D7R A;  3W9T A;  4OWJ A;  8I1B A;  1T9F A;  4F83 A;  3HAL A;  3O49 A;  3CRH A;  3P6J A;  4CJM A;  1EYL A;  1UPS A;  3BAV A;  1S0B A;  5FZU A;  3FFZ A;  4A7Y A;  4JAW A;  3FJ9 A;  2K43 A;  3FJD A;  1SZ6 B;  3OBR A;  4A7K A;  2MLL B;  1ISW A;  1F31 A;  1JY0 A;  1JT5 A;  3ZX7 A;  2R9K B;  3ZC8 A;  3VWC A;  3NJ5 A;  5BXP A;  1PUU B;  2XOA A;  3OJM A;  3AZW A;  4ISQ A;  3AH2 A;  3BTA A;  2RG9 B;  3BAD A;  1JT3 A;  5G00 A;  4DCK C;  1N4K A;  1SR4 C;  4G9M A;  1G9A A;  2F2F A;  3BRD A;  4EFP A;  1DFQ A;  2Y9W C;  2ET2 A;  3H6R A;  1PWA A;  4X39 A;  3CRG A;  3V0A A;  1JT7 A;  2NM1 A;  3QR5 A;  3RMY A;  3P6I A;  2GZB A;  1FWV A;  3WMU A;  2J3P A;  2NZ9 A;  5B2H A;  3HN1 A;  4OEE A;  4ZFU B;  1V6W A;  2VSE A;  2Z48 A;  4P6A A;  2FFU A;  3SNV A;  4D0T A;  2F2F C;  4Z8S B;  3RTI B;  5BQU A;  3A07 A;  5BVP I;  3O4C A;  3N0K A;  2D43 A;  3OJV A;  3S8K A;  3BA5 A;  2WRY A;  2I1B A;  2AQZ A;  3N7K A;  3A22 A;  3F1R A;  1II4 A;  5EG6 C;  3MAL A;  4QO3 A;  1FMM S;  3FJB A;  2FO1 A;  4J2K A;  4OEG A;  2VSA A;  3WO2 A;  3BAH A;  1WD4 A;  1ISX A;  1XG6 A;  4GP0 A;  3OJ2 A;  4I37 A;  5HPZ A;  1DIW A;  3WIN A;  3IAG C;  1P63 A;  4J2Y A;  5FZZ A;  4F34 A;  4TLP A;  4IQP A;  1R8N A;  3CA1 A;  1G9D A;  4I4U A;  4II0 A;  4G6J A;  1JT4 A;  5F90 A;  2AXM A;  1WD3 A;  1V6V A;  2LIE A;  2KH2 A;  3O4A A;  4HR6 C;  2BEB A;  1TTU A;  2HZ9 A;  1ILR 1;  4LO2 C;  3CAH A;  4USO A;  3CQA A;  5DSS B;  4L4I A;  2D22 A;  1S0F A;  1L2H A;  2KLL A;  5F8S A;  1IHK A;  2DRZ A;  3OGG A;  1EV2 A;  4I6I A;  3WIN C;  5FZY A;  4GOY A;  3VSZ A;  4AN6 A;  3PHZ A;  4MZG B;  4H75 A;  1G9B A;  1V6U A;  4HJJ A;  1W3G A;  3PME A;  5DUY A;  1TWM A;  2BFH A;  1HCE A;  3OBT A;  4I4O A;  1YYN A;  4I4P A;  1MC9 A;  4X38 A;  3E8L C;  4OEF A;  4I2S A;  1BA7 A;  1EVT A;  3F62 B;  2QYI B;  4I7I A;  3H6Q A;  3PUB A;  1RZO B;  3LTQ A;  4I1B A;  3UJ0 A;  4ZLB B;  1SR4 A;  4PC4 A;  7I1B A;  1QQK A;  2BEA A;  4GOV A;  1ABR B;  2IWT B;  1KNM A;  2D1Z A;  2ZQO A;  4I3N A;  5D61 A;  1FGA A;  3Q7W A;  1BFF A;  1NZK A;  1AVA C;  3AH4 A;  3RSJ A;  1IOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...