4XGOA

Crystal structure of leucine-rich repeat domain of apl1b
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
340
structure length
340
Chain Sequence
YKSMHLTPFTLSALLASFHKVEVLNLNGLQIEEIDTNAFAYAHTIQKLYMRFNVIRYLPPHVFQNVPLLTVLMLDRNDLSSLPPGIFHNTPKLTMMSMSNNNLERIEDDTFQATTALQNLQLSSNRLTHVDLALIPSLFHVNVSYNLLSTLAIPIAVEELDASHNTINVVRGPVNVELTILKLQHNNLTDTAWLLNYPGLVDVDLSYNQLEKITYQHFVKMQRLERLYVSNNRLVALDFYGRPIPTLKVLDLSHNHLMWVEHNQAQFDKLQYLYLDHNSIVTFKLSTSHTLKNLTLSHNDWDCNSLRALFRNVAQPAVHDADQHCKIDYHLEHGLCCKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Anopheles Plasmodium-responsive Leucine-rich repeat protein
publication title Biophysical Analysis of Anopheles gambiae Leucine-Rich Repeat Proteins APL1A1, APLB and APL1C and Their Interaction with LRIM1.
pubmed doi rcsb
source organism Anopheles gambiae
molecule tags Protein binding
total genus 125
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4xgoA00
4IM6A 3SB4A 2P1NB 3WN4A 4PSJA 3ZYOA 3RFSA 2OMXA 2WFHA 1GWBA 4V2CA 1XECA 4KT1A 4M7EA 2R9UA 5AWBA 3W3MA 4KXFB 3GOZA 1O6VA 4OQTA 4BSRA 2OMUA 2UZXA 4ARNA 1OTNA 3RFJA 3CIYA 2ASTB 3ZYJA 4M7EC 4FCGA 4TZHA 2XWTC 4R07A 4NKGA 2V9TB 4LSCA 4AY9X 3KJ4A 3UL9A 4HQ1A 4ECOA 3M19A 1ZIWA 4H09A 3CIGA 3W3KA 4Z61C 4XOSA 4R6AA 4I6JB 4CILA 3UL7A 1IO0A 4PQ8A 3ULUA 5GMFA 4RCAB 2Z62A 1K5DC 4RCWA 1YRGA 2P1OB 3OGKB 4J4LA 2OMVA 3E2JA 5HDHA 5A5CA 3G3BA 1DFJI 3W3LA 1M9LA 2WQVA 3UL8A 4R6GA 1FO1A 5IYXC 3W3JA 4R0AA 2BNHA 3WPGA 4V2DA 4R5DA 5CMPA 2FT3A 4L3FA 5B0TA 2ELLA 4CC4A 3M18A 4R6JA 4ARRA 3VQ1A 3OJAA 1P8TA 1O6SA 5HZLB 2P1QB 2CA6A 3RW7A 4BSUA 4L3AA 5AWCA 3ULAA 4U09A 4CC4C 1DCEA 4UFRA 1FQVA 3O6NA 4WP6A 1QYYA 2Y5QA 2WQXA 5GS2B 3P72A 3RJ0A 4AW4A 2Z7XA 4LI1A 3E6JA 3FXIA 2O6RA 3RIZA 5IJCA 4B8CD 2P1MB 3JB9j 4QXEA 2Z65A 5FTTB 1XWDC 3CVRA 3ZYNA 3O53A 4CNCA 2OMWA 1XEUA 3W3NA 5LFNA 2V70A 4YEBB 1LTXA 4GT6A 4U08A 4P91A 3REZA 4MQWX 3OGMB 1A4YA 4P8SA 2BEXA 2ID5A 4R6FA 1DS9A 3C6PB 3G04C 3WPFA 1G9UA 1OZNA 3ZYIA 4Z64C 5GS0A 4C2AB 4FS7A 4LSAA 1M0ZA 1JL5A 5CMNA 3RW6A 5GQRK 2V9SA 3OGLB 2Z81A 3WPBA 1H6UA 2XOTA 3G39A 3C6NB 3RGZA 5AWDA 3VQ2A 1M10B 4PEQB 3A79B 3TSRE 4LI2A 4XSQA 4R5CA 3DZEA 4U06A 1D0BA 4XGOA 2O6SA 4NKHA 2JQDA 1OTMA 1O6TA 4Q3GA 2Z66A 4U7LA 2ASSB 3RGXA 5D3IA 4Y61B 1KOHA 1OOKG 4BSSA 4J0MA 2Z64A 5AZ5A 5IJDA 1KOOA 4FD0A 3G06A 4LXSA 3PMHG 1OGQA 1OTOA 2RA8A 4LXRA 4K17A 1A9NA 4FDWA 1XCDA 1PGVA 2WQUA 3WPDA 3E4GA 5B0NA 4Q62A 3ULVA 3OJAB 1Z7XW 5AWAA 3E3ZA 2P1PB 1FS2A 4GLPA 3BZ5A 2Z63A 3WPCA 2Z82A 2JE1A 4Z94G 4MN8B 5GMHA 1K5GC 2OMYA 4BV4R 4CNMA 1FT8A 3WPIA 3UN9A 2Z7XB 2IFGA 2O6QA 2A0ZA 3WPEA 3C6OB 4WYKA 4C2BB 4ECNA 4EZGA 4R58A 2Q4GW 1P9AG 4Z79A 1H6TA 4FMZA 5IJBA 4QC0A 4V2EA 4PKIG 4FHOA 4Z8GA 4R08A 4LSXA 1W8AA 1P8VA 4CP6A 4PERA 2WQWA 1M9SA 1XKUA 4RWTC 4R09A 4G8AA 4KNGA 5GMGA 4LSXC 4QBZA 2OMTA 1WWLA 1U0ND 2JE0A 5B4PA 3WPHA 2RR6A 2UZYA 4Q3IA 3RFEA 3W3GA 1SQ0B 2OMZA 3G3AA
chains in the Genus database with same CATH superfamily
4IM6A 3SB4A 2P1NB 3WN4A 4PSJA 3ZYOA 3RFSA 2OMXA 2WFHA 1GWBA 4V2CA 1XECA 4KT1A 4M7EA 2R9UA 5AWBA 3W3MA 4KXFB 3GOZA 1O6VA 4OQTA 4BSRA 2OMUA 2UZXA 4ARNA 1OTNA 3RFJA 3CIYA 2ASTB 3ZYJA 4M7EC 4FCGA 4TZHA 2XWTC 4R07A 4NKGA 2V9TB 4LSCA 4NZRM 4AY9X 3KJ4A 3UL9A 4HQ1A 4ECOA 3M19A 1ZIWA 4H09A 3CIGA 3W3KA 4Z61C 4XOSA 4R6AA 4I6JB 4CILA 3UL7A 1IO0A 4PQ8A 3ULUA 5GMFA 4RCAB 2Z62A 1K5DC 4RCWA 1YRGA 2P1OB 3OGKB 4J4LA 2OMVA 3E2JA 5HDHA 5A5CA 3G3BA 1DFJI 3W3LA 1M9LA 2WQVA 3UL8A 4R6GA 4NZTM 1FO1A 5IYXC 3W3JA 4R0AA 2BNHA 3WPGA 4V2DA 4R5DA 5CMPA 2FT3A 4L3FA 5B0TA 2ELLA 4CC4A 3M18A 4R6JA 4ARRA 3VQ1A 3OJAA 1P8TA 1O6SA 5HZLB 2P1QB 2CA6A 3RW7A 4BSUA 4L3AA 5AWCA 3ULAA 4U09A 4CC4C 1DCEA 4UFRA 1FQVA 3O6NA 4WP6A 1QYYA 2Y5QA 2WQXA 5GS2B 3P72A 3RJ0A 4AW4A 2Z7XA 4LI1A 3E6JA 3FXIA 2O6RA 3RIZA 5IJCA 4B8CD 2P1MB 3JB9j 4QXEA 2Z65A 5FTTB 1XWDC 3CVRA 3ZYNA 3O53A 4CNCA 2OMWA 1XEUA 3W3NA 5LFNA 2V70A 4YEBB 1LTXA 4GT6A 4U08A 4P91A 3REZA 4MQWX 3OGMB 1A4YA 4P8SA 2BEXA 2ID5A 4R6FA 1DS9A 3C6PB 3G04C 3WPFA 1G9UA 1OZNA 3ZYIA 4Z64C 5GS0A 4C2AB 4FS7A 4LSAA 1M0ZA 1JL5A 5CMNA 3RW6A 5GQRK 2V9SA 3OGLB 2Z81A 3WPBA 1H6UA 2XOTA 3G39A 3C6NB 3RGZA 5AWDA 3VQ2A 1M10B 4PEQB 3A79B 3TSRE 4LI2A 4XSQA 4R5CA 3DZEA 4U06A 1D0BA 4XGOA 2O6SA 4NKHA 2JQDA 1OTMA 1O6TA 4Q3GA 2Z66A 4U7LA 2ASSB 3RGXA 5D3IA 4Y61B 1KOHA 1OOKG 4BSSA 4J0MA 2Z64A 5AZ5A 5IJDA 1KOOA 4FD0A 3G06A 4LXSA 3PMHG 1OGQA 1OTOA 2RA8A 4LXRA 4K17A 1A9NA 4FDWA 1XCDA 1PGVA 2WQUA 3WPDA 3E4GA 5B0NA 4Q62A 3ULVA 3OJAB 1Z7XW 5AWAA 3E3ZA 2P1PB 1FS2A 4GLPA 3BZ5A 2Z63A 3WPCA 2Z82A 2JE1A 4Z94G 4MN8B 5GMHA 1K5GC 2OMYA 4BV4R 4CNMA 1FT8A 3WPIA 3UN9A 2Z7XB 2IFGA 2O6QA 2A0ZA 3WPEA 3C6OB 4WYKA 4C2BB 4ECNA 4EZGA 4R58A 2Q4GW 1P9AG 4Z79A 1H6TA 4FMZA 5IJBA 4QC0A 4V2EA 4PKIG 4FHOA 4Z8GA 4R08A 4LSXA 1W8AA 1P8VA 4CP6A 4PERA 2WQWA 1M9SA 1XKUA 4RWTC 4R09A 4G8AA 4KNGA 5GMGA 4LSXC 4QBZA 2OMTA 1WWLA 1U0ND 2JE0A 5B4PA 3WPHA 2RR6A 2UZYA 4Q3IA 3RFEA 3W3GA 1SQ0B 2OMZA 3G3AA
chains in the Genus database with same CATH topology
4IM6A 3SB4A 2P1NB 3WN4A 4PSJA 3ZYOA 3RFSA 2OMXA 2WFHA 1GWBA 4V2CA 1XECA 4KT1A 4M7EA 2R9UA 5AWBA 3W3MA 4KXFB 3GOZA 1O6VA 4OQTA 4BSRA 2OMUA 2UZXA 4ARNA 1OTNA 3RFJA 3CIYA 2ASTB 3ZYJA 4M7EC 4FCGA 4TZHA 2XWTC 4R07A 4NKGA 2V9TB 4LSCA 4AY9X 3KJ4A 3UL9A 4HQ1A 4ECOA 3M19A 1ZIWA 4H09A 3CIGA 3W3KA 4Z61C 4XOSA 4R6AA 4I6JB 4CILA 3UL7A 1IO0A 4PQ8A 3ULUA 5GMFA 4RCAB 2Z62A 1K5DC 4RCWA 1YRGA 2P1OB 3OGKB 4J4LA 2OMVA 3E2JA 5HDHA 5A5CA 3G3BA 1DFJI 3W3LA 1M9LA 2WQVA 3UL8A 4R6GA 1FO1A 5IYXC 3W3JA 4R0AA 2BNHA 3WPGA 4V2DA 4R5DA 5CMPA 2FT3A 4L3FA 5B0TA 2ELLA 4CC4A 3M18A 4R6JA 4ARRA 3VQ1A 3OJAA 1P8TA 1O6SA 5HZLB 2P1QB 2CA6A 3RW7A 4BSUA 4L3AA 5AWCA 3ULAA 4U09A 4CC4C 1DCEA 4UFRA 1FQVA 3O6NA 4WP6A 1QYYA 2Y5QA 2WQXA 5GS2B 3P72A 3RJ0A 4AW4A 2Z7XA 4LI1A 3E6JA 3FXIA 2O6RA 3RIZA 5IJCA 4B8CD 2P1MB 3JB9j 4QXEA 2Z65A 5FTTB 1XWDC 3CVRA 3ZYNA 3O53A 4CNCA 2OMWA 1XEUA 3W3NA 5LFNA 2V70A 4YEBB 1LTXA 4GT6A 4U08A 4P91A 3REZA 4MQWX 3OGMB 1A4YA 4P8SA 2BEXA 2ID5A 4R6FA 1DS9A 3C6PB 3G04C 3WPFA 1G9UA 1OZNA 3ZYIA 4Z64C 5GS0A 4C2AB 4FS7A 4LSAA 1M0ZA 1JL5A 5CMNA 3RW6A 5GQRK 2V9SA 3OGLB 2Z81A 3WPBA 1H6UA 2XOTA 3G39A 3C6NB 3RGZA 5AWDA 3VQ2A 1M10B 4PEQB 3A79B 3TSRE 4LI2A 4XSQA 4R5CA 3DZEA 4U06A 1D0BA 4XGOA 2O6SA 4NKHA 2JQDA 1OTMA 1O6TA 4Q3GA 2Z66A 4U7LA 2ASSB 3RGXA 5D3IA 4Y61B 1KOHA 1OOKG 4BSSA 4J0MA 2Z64A 5AZ5A 5IJDA 1KOOA 4FD0A 3G06A 4LXSA 3PMHG 1OGQA 1OTOA 2RA8A 4LXRA 4K17A 1A9NA 4FDWA 1XCDA 1PGVA 2WQUA 3WPDA 3E4GA 5B0NA 4Q62A 3ULVA 3OJAB 1Z7XW 5AWAA 3E3ZA 2P1PB 1FS2A 4GLPA 3BZ5A 2Z63A 3WPCA 2Z82A 2JE1A 4Z94G 4MN8B 5GMHA 1K5GC 2OMYA 4BV4R 4CNMA 1FT8A 3WPIA 3UN9A 2Z7XB 2IFGA 2O6QA 2A0ZA 3WPEA 3C6OB 4WYKA 4C2BB 4ECNA 4EZGA 4R58A 2Q4GW 1P9AG 4Z79A 1H6TA 4FMZA 5IJBA 4QC0A 4V2EA 4PKIG 4FHOA 4Z8GA 4R08A 4LSXA 1W8AA 1P8VA 4CP6A 4PERA 2WQWA 1M9SA 1XKUA 4RWTC 4R09A 4G8AA 4KNGA 5GMGA 4LSXC 4QBZA 2OMTA 1WWLA 1U0ND 2JE0A 5B4PA 3WPHA 2RR6A 2UZYA 4Q3IA 3RFEA 3W3GA 1SQ0B 2OMZA 3G3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IM6 A;  3SB4 A;  2P1N B;  3WN4 A;  4PSJ A;  3ZYO A;  3RFS A;  2OMX A;  2WFH A;  1GWB A;  4V2C A;  1XEC A;  4KT1 A;  4M7E A;  2R9U A;  5AWB A;  3W3M A;  4KXF B;  3GOZ A;  1O6V A;  4OQT A;  4BSR A;  2OMU A;  2UZX A;  4ARN A;  1OTN A;  3RFJ A;  3CIY A;  2AST B;  3ZYJ A;  4M7E C;  4FCG A;  4TZH A;  2XWT C;  4R07 A;  4NKG A;  2V9T B;  4LSC A;  4AY9 X;  3KJ4 A;  3UL9 A;  4HQ1 A;  4ECO A;  3M19 A;  1ZIW A;  4H09 A;  3CIG A;  3W3K A;  4Z61 C;  4XOS A;  4R6A A;  4I6J B;  4CIL A;  3UL7 A;  1IO0 A;  4PQ8 A;  3ULU A;  5GMF A;  4RCA B;  2Z62 A;  1K5D C;  4RCW A;  1YRG A;  2P1O B;  3OGK B;  4J4L A;  2OMV A;  3E2J A;  5HDH A;  5A5C A;  3G3B A;  1DFJ I;  3W3L A;  1M9L A;  2WQV A;  3UL8 A;  4R6G A;  1FO1 A;  5IYX C;  3W3J A;  4R0A A;  2BNH A;  3WPG A;  4V2D A;  4R5D A;  5CMP A;  2FT3 A;  4L3F A;  5B0T A;  2ELL A;  4CC4 A;  3M18 A;  4R6J A;  4ARR A;  3VQ1 A;  3OJA A;  1P8T A;  1O6S A;  5HZL B;  2P1Q B;  2CA6 A;  3RW7 A;  4BSU A;  4L3A A;  5AWC A;  3ULA A;  4U09 A;  4CC4 C;  1DCE A;  4UFR A;  1FQV A;  3O6N A;  4WP6 A;  1QYY A;  2Y5Q A;  2WQX A;  5GS2 B;  3P72 A;  3RJ0 A;  4AW4 A;  2Z7X A;  4LI1 A;  3E6J A;  3FXI A;  2O6R A;  3RIZ A;  5IJC A;  4B8C D;  2P1M B;  3JB9 j;  4QXE A;  2Z65 A;  5FTT B;  1XWD C;  3CVR A;  3ZYN A;  3O53 A;  4CNC A;  2OMW A;  1XEU A;  3W3N A;  5LFN A;  2V70 A;  4YEB B;  1LTX A;  4GT6 A;  4U08 A;  4P91 A;  3REZ A;  4MQW X;  3OGM B;  1A4Y A;  4P8S A;  2BEX A;  2ID5 A;  4R6F A;  1DS9 A;  3C6P B;  3G04 C;  3WPF A;  1G9U A;  1OZN A;  3ZYI A;  4Z64 C;  5GS0 A;  4C2A B;  4FS7 A;  4LSA A;  1M0Z A;  1JL5 A;  5CMN A;  3RW6 A;  5GQR K;  2V9S A;  3OGL B;  2Z81 A;  3WPB A;  1H6U A;  2XOT A;  3G39 A;  3C6N B;  3RGZ A;  5AWD A;  3VQ2 A;  1M10 B;  4PEQ B;  3A79 B;  3TSR E;  4LI2 A;  4XSQ A;  4R5C A;  3DZE A;  4U06 A;  1D0B A;  4XGO A;  2O6S A;  4NKH A;  2JQD A;  1OTM A;  1O6T A;  4Q3G A;  2Z66 A;  4U7L A;  2ASS B;  3RGX A;  5D3I A;  4Y61 B;  1KOH A;  1OOK G;  4BSS A;  4J0M A;  2Z64 A;  5AZ5 A;  5IJD A;  1KOO A;  4FD0 A;  3G06 A;  4LXS A;  3PMH G;  1OGQ A;  1OTO A;  2RA8 A;  4LXR A;  4K17 A;  1A9N A;  4FDW A;  1XCD A;  1PGV A;  2WQU A;  3WPD A;  3E4G A;  5B0N A;  4Q62 A;  3ULV A;  3OJA B;  1Z7X W;  5AWA A;  3E3Z A;  2P1P B;  1FS2 A;  4GLP A;  3BZ5 A;  2Z63 A;  3WPC A;  2Z82 A;  2JE1 A;  4Z94 G;  4MN8 B;  5GMH A;  1K5G C;  2OMY A;  4BV4 R;  4CNM A;  1FT8 A;  3WPI A;  3UN9 A;  2Z7X B;  2IFG A;  2O6Q A;  2A0Z A;  3WPE A;  3C6O B;  4WYK A;  4C2B B;  4ECN A;  4EZG A;  4R58 A;  2Q4G W;  1P9A G;  4Z79 A;  1H6T A;  4FMZ A;  5IJB A;  4QC0 A;  4V2E A;  4PKI G;  4FHO A;  4Z8G A;  4R08 A;  4LSX A;  1W8A A;  1P8V A;  4CP6 A;  4PER A;  2WQW A;  1M9S A;  1XKU A;  4RWT C;  4R09 A;  4G8A A;  4KNG A;  5GMG A;  4LSX C;  4QBZ A;  2OMT A;  1WWL A;  1U0N D;  2JE0 A;  5B4P A;  3WPH A;  2RR6 A;  2UZY A;  4Q3I A;  3RFE A;  3W3G A;  1SQ0 B;  2OMZ A;  3G3A A; 
#chains in the Genus database with same CATH topology
 4IM6 A;  3SB4 A;  2P1N B;  3WN4 A;  4PSJ A;  3ZYO A;  3RFS A;  2OMX A;  2WFH A;  1GWB A;  4V2C A;  1XEC A;  4KT1 A;  4M7E A;  2R9U A;  5AWB A;  3W3M A;  4KXF B;  3GOZ A;  1O6V A;  4OQT A;  4BSR A;  2OMU A;  2UZX A;  4ARN A;  1OTN A;  3RFJ A;  3CIY A;  2AST B;  3ZYJ A;  4M7E C;  4FCG A;  4TZH A;  2XWT C;  4R07 A;  4NKG A;  2V9T B;  4LSC A;  4NZR M;  4AY9 X;  3KJ4 A;  3UL9 A;  4HQ1 A;  4ECO A;  3M19 A;  1ZIW A;  4H09 A;  3CIG A;  3W3K A;  4Z61 C;  4XOS A;  4R6A A;  4I6J B;  4CIL A;  3UL7 A;  1IO0 A;  4PQ8 A;  3ULU A;  5GMF A;  4RCA B;  2Z62 A;  1K5D C;  4RCW A;  1YRG A;  2P1O B;  3OGK B;  4J4L A;  2OMV A;  3E2J A;  5HDH A;  5A5C A;  3G3B A;  1DFJ I;  3W3L A;  1M9L A;  2WQV A;  3UL8 A;  4R6G A;  4NZT M;  1FO1 A;  5IYX C;  3W3J A;  4R0A A;  2BNH A;  3WPG A;  4V2D A;  4R5D A;  5CMP A;  2FT3 A;  4L3F A;  5B0T A;  2ELL A;  4CC4 A;  3M18 A;  4R6J A;  4ARR A;  3VQ1 A;  3OJA A;  1P8T A;  1O6S A;  5HZL B;  2P1Q B;  2CA6 A;  3RW7 A;  4BSU A;  4L3A A;  5AWC A;  3ULA A;  4U09 A;  4CC4 C;  1DCE A;  4UFR A;  1FQV A;  3O6N A;  4WP6 A;  1QYY A;  2Y5Q A;  2WQX A;  5GS2 B;  3P72 A;  3RJ0 A;  4AW4 A;  2Z7X A;  4LI1 A;  3E6J A;  3FXI A;  2O6R A;  3RIZ A;  5IJC A;  4B8C D;  2P1M B;  3JB9 j;  4QXE A;  2Z65 A;  5FTT B;  1XWD C;  3CVR A;  3ZYN A;  3O53 A;  4CNC A;  2OMW A;  1XEU A;  3W3N A;  5LFN A;  2V70 A;  4YEB B;  1LTX A;  4GT6 A;  4U08 A;  4P91 A;  3REZ A;  4MQW X;  3OGM B;  1A4Y A;  4P8S A;  2BEX A;  2ID5 A;  4R6F A;  1DS9 A;  3C6P B;  3G04 C;  3WPF A;  1G9U A;  1OZN A;  3ZYI A;  4Z64 C;  5GS0 A;  4C2A B;  4FS7 A;  4LSA A;  1M0Z A;  1JL5 A;  5CMN A;  3RW6 A;  5GQR K;  2V9S A;  3OGL B;  2Z81 A;  3WPB A;  1H6U A;  2XOT A;  3G39 A;  3C6N B;  3RGZ A;  5AWD A;  3VQ2 A;  1M10 B;  4PEQ B;  3A79 B;  3TSR E;  4LI2 A;  4XSQ A;  4R5C A;  3DZE A;  4U06 A;  1D0B A;  4XGO A;  2O6S A;  4NKH A;  2JQD A;  1OTM A;  1O6T A;  4Q3G A;  2Z66 A;  4U7L A;  2ASS B;  3RGX A;  5D3I A;  4Y61 B;  1KOH A;  1OOK G;  4BSS A;  4J0M A;  2Z64 A;  5AZ5 A;  5IJD A;  1KOO A;  4FD0 A;  3G06 A;  4LXS A;  3PMH G;  1OGQ A;  1OTO A;  2RA8 A;  4LXR A;  4K17 A;  1A9N A;  4FDW A;  1XCD A;  1PGV A;  2WQU A;  3WPD A;  3E4G A;  5B0N A;  4Q62 A;  3ULV A;  3OJA B;  1Z7X W;  5AWA A;  3E3Z A;  2P1P B;  1FS2 A;  4GLP A;  3BZ5 A;  2Z63 A;  3WPC A;  2Z82 A;  2JE1 A;  4Z94 G;  4MN8 B;  5GMH A;  1K5G C;  2OMY A;  4BV4 R;  4CNM A;  1FT8 A;  3WPI A;  3UN9 A;  2Z7X B;  2IFG A;  2O6Q A;  2A0Z A;  3WPE A;  3C6O B;  4WYK A;  4C2B B;  4ECN A;  4EZG A;  4R58 A;  2Q4G W;  1P9A G;  4Z79 A;  1H6T A;  4FMZ A;  5IJB A;  4QC0 A;  4V2E A;  4PKI G;  4FHO A;  4Z8G A;  4R08 A;  4LSX A;  1W8A A;  1P8V A;  4CP6 A;  4PER A;  2WQW A;  1M9S A;  1XKU A;  4RWT C;  4R09 A;  4G8A A;  4KNG A;  5GMG A;  4LSX C;  4QBZ A;  2OMT A;  1WWL A;  1U0N D;  2JE0 A;  5B4P A;  3WPH A;  2RR6 A;  2UZY A;  4Q3I A;  3RFE A;  3W3G A;  1SQ0 B;  2OMZ A;  3G3A A; 
#chains in the Genus database with same CATH homology
 4IM6 A;  3SB4 A;  2P1N B;  3WN4 A;  4PSJ A;  3ZYO A;  3RFS A;  2OMX A;  2WFH A;  1GWB A;  4V2C A;  1XEC A;  4KT1 A;  4M7E A;  2R9U A;  5AWB A;  3W3M A;  4KXF B;  3GOZ A;  1O6V A;  4OQT A;  4BSR A;  2OMU A;  2UZX A;  4ARN A;  1OTN A;  3RFJ A;  3CIY A;  2AST B;  3ZYJ A;  4M7E C;  4FCG A;  4TZH A;  2XWT C;  4R07 A;  4NKG A;  2V9T B;  4LSC A;  4AY9 X;  3KJ4 A;  3UL9 A;  4HQ1 A;  4ECO A;  3M19 A;  1ZIW A;  4H09 A;  3CIG A;  3W3K A;  4Z61 C;  4XOS A;  4R6A A;  4I6J B;  4CIL A;  3UL7 A;  1IO0 A;  4PQ8 A;  3ULU A;  5GMF A;  4RCA B;  2Z62 A;  1K5D C;  4RCW A;  1YRG A;  2P1O B;  3OGK B;  4J4L A;  2OMV A;  3E2J A;  5HDH A;  5A5C A;  3G3B A;  1DFJ I;  3W3L A;  1M9L A;  2WQV A;  3UL8 A;  4R6G A;  1FO1 A;  5IYX C;  3W3J A;  4R0A A;  2BNH A;  3WPG A;  4V2D A;  4R5D A;  5CMP A;  2FT3 A;  4L3F A;  5B0T A;  2ELL A;  4CC4 A;  3M18 A;  4R6J A;  4ARR A;  3VQ1 A;  3OJA A;  1P8T A;  1O6S A;  5HZL B;  2P1Q B;  2CA6 A;  3RW7 A;  4BSU A;  4L3A A;  5AWC A;  3ULA A;  4U09 A;  4CC4 C;  1DCE A;  4UFR A;  1FQV A;  3O6N A;  4WP6 A;  1QYY A;  2Y5Q A;  2WQX A;  5GS2 B;  3P72 A;  3RJ0 A;  4AW4 A;  2Z7X A;  4LI1 A;  3E6J A;  3FXI A;  2O6R A;  3RIZ A;  5IJC A;  4B8C D;  2P1M B;  3JB9 j;  4QXE A;  2Z65 A;  5FTT B;  1XWD C;  3CVR A;  3ZYN A;  3O53 A;  4CNC A;  2OMW A;  1XEU A;  3W3N A;  5LFN A;  2V70 A;  4YEB B;  1LTX A;  4GT6 A;  4U08 A;  4P91 A;  3REZ A;  4MQW X;  3OGM B;  1A4Y A;  4P8S A;  2BEX A;  2ID5 A;  4R6F A;  1DS9 A;  3C6P B;  3G04 C;  3WPF A;  1G9U A;  1OZN A;  3ZYI A;  4Z64 C;  5GS0 A;  4C2A B;  4FS7 A;  4LSA A;  1M0Z A;  1JL5 A;  5CMN A;  3RW6 A;  5GQR K;  2V9S A;  3OGL B;  2Z81 A;  3WPB A;  1H6U A;  2XOT A;  3G39 A;  3C6N B;  3RGZ A;  5AWD A;  3VQ2 A;  1M10 B;  4PEQ B;  3A79 B;  3TSR E;  4LI2 A;  4XSQ A;  4R5C A;  3DZE A;  4U06 A;  1D0B A;  4XGO A;  2O6S A;  4NKH A;  2JQD A;  1OTM A;  1O6T A;  4Q3G A;  2Z66 A;  4U7L A;  2ASS B;  3RGX A;  5D3I A;  4Y61 B;  1KOH A;  1OOK G;  4BSS A;  4J0M A;  2Z64 A;  5AZ5 A;  5IJD A;  1KOO A;  4FD0 A;  3G06 A;  4LXS A;  3PMH G;  1OGQ A;  1OTO A;  2RA8 A;  4LXR A;  4K17 A;  1A9N A;  4FDW A;  1XCD A;  1PGV A;  2WQU A;  3WPD A;  3E4G A;  5B0N A;  4Q62 A;  3ULV A;  3OJA B;  1Z7X W;  5AWA A;  3E3Z A;  2P1P B;  1FS2 A;  4GLP A;  3BZ5 A;  2Z63 A;  3WPC A;  2Z82 A;  2JE1 A;  4Z94 G;  4MN8 B;  5GMH A;  1K5G C;  2OMY A;  4BV4 R;  4CNM A;  1FT8 A;  3WPI A;  3UN9 A;  2Z7X B;  2IFG A;  2O6Q A;  2A0Z A;  3WPE A;  3C6O B;  4WYK A;  4C2B B;  4ECN A;  4EZG A;  4R58 A;  2Q4G W;  1P9A G;  4Z79 A;  1H6T A;  4FMZ A;  5IJB A;  4QC0 A;  4V2E A;  4PKI G;  4FHO A;  4Z8G A;  4R08 A;  4LSX A;  1W8A A;  1P8V A;  4CP6 A;  4PER A;  2WQW A;  1M9S A;  1XKU A;  4RWT C;  4R09 A;  4G8A A;  4KNG A;  5GMG A;  4LSX C;  4QBZ A;  2OMT A;  1WWL A;  1U0N D;  2JE0 A;  5B4P A;  3WPH A;  2RR6 A;  2UZY A;  4Q3I A;  3RFE A;  3W3G A;  1SQ0 B;  2OMZ A;  3G3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...