4XGSA

Crystal structure analysis of novel iron uptake mechanism of gram-negative bacterial ferritin
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
163
structure length
163
Chain Sequence
HLKPEMIEKLNEQMNLELYSSLLYQQMSAWCSYHTFEGAAAFLRRHAQEEMTHMQRLFDYLTDTGNLPRINTVESPFAEYSSLDELFQETYKLEQLITQKINELAHAAMTNQDYPTFNFLQWYVSEQHEEEKLFKSIIDKLSLAGKSGEGLYFIDKELSTLDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Novel Iron-Uptake Route and Reaction Intermediates in Ferritins from Gram-Negative Bacteria
pubmed doi rcsb
molecule keywords Ferritin
source organism Escherichia coli k12
molecule tags Metal binding protein
total genus 80
structure length 163
sequence length 163
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.16.3.2: Bacterial non-heme ferritin.
pdb deposition date 2015-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 4xgsA00
1ZS3A 3ISEA 4KVRA 1RCGA 2CN7A 2C2FA 2CIHA 1TKPA 2BW1A 4IWKA 5E1UA 4LYUA 4LPMA 3T9JA 4XKSA 3SE1A 1VLGA 3KA6A 4DI0A 1NF4A 3QB9A 2BKCA 3E1OA 2F7NA 4M32A 1BG7A 3PVYA 4EVBA 4AM4A 3PW1B 5GU3X 3WVUA 3A68A 4CMYV 1UMNA 3F39A 1SOFA 1LKMA 1IESA 1DPSA 4TOAA 1RCDA 2FKZA 4LQJA 2XJMA 2VZBA 5GU2X 2CF7A 3O7SA 4ISPA 4OYNA 1RCEA 2V2PA 2VXXA 4M33A 1LKOA 3E1LA 5JACA 3FVBA 2FG8A 3F32A 2V2JA 2V2NA 5E2DA 5FFBA 1RYTA 1LKPA 2FZFA 4TO9A 1NF6A 3PVTA 4II4B 4ETRA 3KA9A 1XZ1A 2C6RA 2Z5PA 4TOHA 4CVTA 5GU1X 2JD70 4REUA 2ITBA 4TOCA 3MPSA 4RC8A 2X170 1QYBA 2ZG7X 4ZLWA 4A25A 3WNWA 2XGWA 3SH6A 2FFXJ 3RAVA 3F34A 1JIGA 3F35A 3KWOA 4TW3A 1JI4A 5FFDA 3BVIA 5GN8B 3UOIA 3OGHA 1MOJA 3KA8A 3R2OA 5C6FA 4PG0A 2HTNA 1S30A 2YW7A 2FG4A 4RC7B 3QVDA 4DYXA 3EGMA 4TOFA 3SIDA 3QD8A 1NFVA 4LQNA 3SHXA 3H7GA 4TOBA 3F36A 5GOUA 1RCIA 3AF7X 4U3GA 2Z6MA 2Z5RA 3PW1A 1LB3A 2C2JA 3GHQA 4ZTTA 4ZJKA 1RCCA 1F30A 2CLUA 4ZKWA 1DATA 4EVEA 2CN6A 3E1PA 2Z90A 4ZL6A 5HJFA 1TK6A 2FL0A 4PG1A 3IS8A 2JD60 2UX1A 4KVQA 4CVRA 2C2UA 5K52A 3PW8C 4ZKXA 2D5KA 2WTLA 1AEWA 1VEIA 2HR5A 2GS4A 3F38A 3E1JA 4II4A 5HJHA 3R2MA 2QF9A 2CLBA 4LPNA 5ERKA 4MN9A 4ZL5A 3NP0X 5D8XA 3RE7A 3Q4OA 4CMYA 1QGHA 1L8IA 5D8SA 3QHCA 3IQ1A 3R2SA 4PGIA 5K53A 5JKMG 1TKOA 2WLAA 4LQVA 3AJQA 2Y3QA 3AK8A 3WVWA 5D8PA 5GN8A 2V2MA 3QHBA 1BCFA 5CZUA 3F37A 3BT5A 4AM2A 4LYXA 4ZMCA 3E1QA 3KXUA 4RC7A 3E6SA 1YUZA 5FFEA 2V15A 5JKMA 3VNXA 1DVBA 5D8YA 3E6RA 2CHPA 4MKUA 1H96A 1NNQA 5LG8A 5J9VA 1OTKA 4CVPA 3R2KA 5LBHA 5J93A 2JD80 3R2LA 1JKUA 4AM5A 1YV1A 3F33A 3UOFA 2ZA7A 1BFRA 4Z3BA 5LS9A 1VEQA 1O9RA 2WLUA 4M35A 1XZ3A 4P18A 2XJOA 1JREA 1FHAA 4CY9A 3QZ3A 4DE6A 4CYAA 3R2HA 4TOGA 3GVYA 2C41A 1ZUJA 2IY4A 2RBDA 5JKLA 2IU2A 3KA3A 1VJXA 4DYZA 4LQHA 3ERZA 1R03A 1KRQA 1UVHA 4ITTA 2YJKA 1JI5A 3NP2X 3TA8A 2IB0A 4RC5B 2YJJA 5AXSA 4DYUA 3PVRB 2V2IA 3Q4NA 1Z6OM 4KVSA 3PZAA 1S3QA 4M34A 2ZG9X 4Z5SA 2CEIA 1B71A 1TJOA 4PGKA 1VELA 3PWQC 2OC5A 5D8OA 3PW8A 2CHIA 4XKUA 1N1QA 1JGCA 4XGSA 1JKVA 4MUDA 3WVVA 3KX9A 4RC6B 1Z4AA 2FJCA 4XKTA 3AF9X 5FEJA 3FSEA 2QQYA 4TOEA 4CVSA 2FHAA 2PYBA 5CMRA 3BVFA 1JYBA 5IX6A 3BVLA 3AJOA 3EZ0A 4QUWA 4MJYA 4DZ0A 2W0OA 5D8QA 3AF8X 4ML5A 1YUXA 1EUMA 1HRSA 4EVDA 2V2RA 3RBCA 2YW6A 2ZA8A 2Z5QA 4ITWA 2ZURX 3FI6A 4ZKHA 3R2RA 4DYYA 1IERA 3PVYB 3HIUA 4DASA 1GWGA 2GYDA 5FFAA 5JKLG 3BVEA 4IWJA 4Y08A 2XJNA 4RC5A 1JTSA 2ZA6A 4YKHA 5D8RA 4EVCA 3A9QA 3E2CA 3PVRA 5HQOA 1S2ZA 3O7RA 3AK9A 3PWFA 3ISFA 3E1MA 5J8WA 3Q4QA 4TODA 2OH3A 5I4JA 3ES3A 3E1NA 4ISMA 2G4HA 2GYQA 1O9IA 3RGDA 4E6KA 5FFCA 4LPJA 3PVTB 2V2SA 1SQ3A 3UNOA 5J8SA 3Q4RA 5LG2A 4ERUA 3OJ5A 2BK6A 3AJPA 2VXIA 1J30A 4RC6A 2V2OA 3BKNA 2XKQA 3NOZX 3BVKA 3HL1A 5CMQA 3KA4A 3RD0A 3U90A 3PWQA 4MY7A 2ZG8X 1MFRA 2BJYA 1F33A 1L8HA 3GE4A 3IS7A 5ERJA 4CYBA 5GU0X 4R42A 1Z6OA 3EZUA 2V2LA 4IXKA
chains in the Genus database with same CATH superfamily
1ZS3A 3ISEA 4KVRA 1RCGA 2CN7A 2C2FA 2AR0A 1TKPA 2CIHA 2N02A 2BW1A 4IWKA 5E1UA 4LYUA 4LPMA 3T9JA 4XKSA 3SE1A 1VLGA 3KA6A 4DI0A 1NF4A 3QB9A 2BKCA 3E1OA 2F7NA 4M32A 1BG7A 3PVYA 4EVBA 4AM4A 3PW1B 5GU3X 3WVUA 3A68A 4CMYV 3JZAB 1UMNA 3F39A 1SOFA 1LKMA 1IESA 1DPSA 4TOAA 1RCDA 2FKZA 4LQJA 2XJMA 2VZBA 5GU2X 2CF7A 3O7SA 4ISPA 4OYNA 1RCEA 2V2PA 2VXXA 4M33A 1LKOA 3E1LA 5JACA 3FVBA 2FG8A 4E40A 3F32A 2V2JA 2V2NA 5E2DA 5FFBA 3GGYA 1RYTA 1LKPA 2FZFA 4TO9A 1NF6A 3PVTA 4II4B 4ETRA 3KA9A 1XZ1A 2C6RA 2Z5PA 4TOHA 4CVTA 5GU1X 2JD70 4REUA 2ITBA 4TOCA 3KHKA 3MPSA 4RC8A 3C1YA 2X170 1QYBA 2ZG7X 4ZLWA 4A25A 3WNWA 2XGWA 3SH6A 2FFXJ 3RAVA 3F34A 1JIGA 3F35A 3KWOA 4TW3A 1JI4A 5FFDA 3BVIA 5GN8B 3UOIA 3OGHA 1MOJA 3KA8A 3R2OA 5C6FA 4PG0A 2HTNA 1S30A 2YW7A 2FG4A 4RC7B 3QVDA 4DYXA 3EGMA 4TOFA 3SIDA 3QD8A 1NFVA 4LQNA 3SHXA 3H7GA 4TOBA 3F36A 5GOUA 3N6OA 1RCIA 3AF7X 4U3GA 2Z6MA 2Z5RA 3PW1A 1LB3A 2C2JA 3GHQA 3M6JA 4ZTTA 3DBYA 4WJG4 4ZJKA 1RCCA 1F30A 2CLUA 4ZKWA 1DATA 4EVEA 2CN6A 3E1PA 2Z90A 4ZL6A 5HJFA 1TK6A 2FL0A 4PG1A 3IS8A 2JD60 2UX1A 4KVQA 4CVRA 2C2UA 5K52A 3PW8C 2WWXB 2D5KA 2WTLA 4ZKXA 1AEWA 1VEIA 2HR5A 2GS4A 3FRSA 3F38A 3E1JA 4II4A 5HJHA 3R2MA 2G38B 2QF9A 2CLBA 4LPNA 5ERKA 4MN9A 4ZL5A 3NP0X 5D8XA 3RE7A 3Q4OA 3JZ9A 4CMYA 1QGHA 1L8IA 5D8SA 3QHCA 3IQ1A 3R2SA 4PGIA 5K53A 5JKMG 1TKOA 2WLAA 4LQVA 3KDQA 3AJQA 2Y3QA 3AK8A 3WVWA 5D8PA 4X0JA 5GN8A 2V2MA 3QHBA 1BCFA 5CZUA 3F37A 3BT5A 4W4KB 4AM2A 4LYXA 4ZMCA 3E1QA 3KXUA 4RC7A 4YXJA 3E6SA 1YUZA 5FFEA 2V15A 5JKMA 3VNXA 1DVBA 5D8YA 3E6RA 2CHPA 4MKUA 1H96A 1NNQA 5LG8A 2V8UA 5J9VA 1OTKA 4CVPA 3R2KA 5LBHA 5J93A 2JD80 3W54A 3R2LA 1JKUA 4AM5A 2OKCA 1YV1A 3F33A 3UOFA 2ZA7A 1BFRA 4Z3BA 5LS9A 1VEQA 1O9RA 2WLUA 4M35A 1XZ3A 4P18A 2XJOA 1JREA 1FHAA 4CY9A 3QZ3A 4DE6A 4CYAA 3R2HA 4TOGA 3GVYA 2C41A 1ZUJA 2IY4A 2RBDA 3C21A 5JKLA 2IU2A 3KA3A 1VJXA 4DYZA 4LQHA 3FRRA 3ERZA 2MGYA 1R03A 4MXPA 1KRQA 1UVHA 4ITTA 2YJKA 1JI5A 3NP2X 3TA8A 2IB0A 2Y44A 4RC5B 2YJJA 5HU6D 5AXSA 4DYUA 3PVRB 2V2IA 3Q4NA 1Z6OM 4KVSA 3PZAA 2CWLA 1S3QA 4M34A 2ZG9X 4Z5SA 2CEIA 1B71A 3C1ZA 1TJOA 4PGKA 1VELA 3PWQC 4W4LB 3LKDA 2OC5A 5JDOB 5D8OA 3PW8A 2CHIA 4XKUA 1N1QA 4YXMA 1JGCA 4XGSA 1JKVA 4MUDA 3WVVA 3KX9A 4RC6B 1Z4AA 2FJCA 4XKTA 3AF9X 5FEJA 3FSEA 2QQYA 4TOEA 4CVSA 2FHAA 2PYBA 5CMRA 3BVFA 1JYBA 5IX6A 3BVLA 3AJOA 3GGZA 3EZ0A 4MJYA 4QUWA 4DZ0A 2W0OA 5D8QA 3AF8X 2V8TA 3L0MA 4ML5A 1YUXA 1EUMA 1HRSA 4EVDA 2V2RA 3RBCA 2YW6A 2ZA8A 2Z5QA 4ITWA 2ZURX 3FI6A 4ZKHA 3R2RA 4DYYA 1IERA 3PVYB 3HIUA 4DASA 1GWGA 3VV9A 2GYDA 5FFAA 5JKLG 3BVEA 4IWJA 4Y08A 2XJNA 4RC5A 1JTSA 2ZA6A 4YKHA 5D8RA 4EVCA 3A9QA 3E2CA 3PVRA 4KXRB 5HQOA 3D19A 1S2ZA 3O7RA 3AK9A 3PWFA 3ISFA 3E1MA 5J8WA 3Q4QA 4TODA 2OH3A 5I4JA 3ES3A 4ISMA 3E1NA 2G4HA 3C23A 2GYQA 1O9IA 3RGDA 4E6KA 4YVZA 5JDOA 5FFCA 4LPJA 3PVTB 2V2SA 1SQ3A 3UNOA 5J8SA 3Q4RA 5LG2A 4ERUA 3OJ5A 2BK6A 3AJPA 2VXIA 1J30A 4RC6A 2V2OA 3BKNA 2XKQA 3NOZX 3BVKA 3HL1A 5CMQA 3KA4A 3RD0A 3U90A 3UFBA 3PWQA 4MY7A 2ZG8X 3V3KB 1MFRA 2BJYA 1F33A 1L8HA 3GE4A 3IS7A 5ERJA 4CYBA 5GU0X 4R42A 1Z6OA 3EZUA 2V2LA 4IXKA 3VVAA
chains in the Genus database with same CATH topology
1ZS3A 3ISEA 4KVRA 1RCGA 2CN7A 2C2FA 2AR0A 1TKPA 2CIHA 2N02A 2BW1A 4IWKA 5E1UA 4LYUA 4LPMA 3T9JA 4XKSA 3SE1A 1VLGA 3KA6A 4DI0A 1NF4A 3QB9A 2BKCA 3E1OA 2F7NA 4M32A 1BG7A 3PVYA 4EVBA 4AM4A 3PW1B 5GU3X 3WVUA 3A68A 4CMYV 3JZAB 1UMNA 3F39A 1SOFA 1LKMA 1IESA 1DPSA 4TOAA 1RCDA 2FKZA 4LQJA 2XJMA 2VZBA 5GU2X 2CF7A 3O7SA 4ISPA 4OYNA 1RCEA 2V2PA 2VXXA 4M33A 1LKOA 3E1LA 5JACA 3FVBA 2FG8A 4E40A 3F32A 2V2JA 2V2NA 5E2DA 5FFBA 3GGYA 1RYTA 1LKPA 2FZFA 4TO9A 1NF6A 3PVTA 4II4B 4ETRA 3KA9A 1XZ1A 2C6RA 2Z5PA 4TOHA 4CVTA 5GU1X 2JD70 4REUA 2ITBA 4TOCA 3KHKA 3MPSA 4RC8A 3C1YA 2X170 1QYBA 2ZG7X 4ZLWA 4A25A 3WNWA 2XGWA 3SH6A 2FFXJ 3RAVA 3F34A 1JIGA 3F35A 3KWOA 4TW3A 1JI4A 5FFDA 3BVIA 5GN8B 3UOIA 3OGHA 1MOJA 3KA8A 3R2OA 5C6FA 4PG0A 2HTNA 1S30A 2YW7A 2FG4A 4RC7B 3QVDA 4DYXA 3EGMA 4TOFA 3SIDA 3QD8A 1NFVA 4LQNA 3SHXA 3H7GA 4TOBA 3F36A 5GOUA 3N6OA 1RCIA 3AF7X 4U3GA 2Z6MA 2Z5RA 3PW1A 1LB3A 2C2JA 3GHQA 3M6JA 4ZTTA 3DBYA 4WJG4 4ZJKA 1RCCA 1F30A 2CLUA 4ZKWA 1DATA 4EVEA 2CN6A 3E1PA 2Z90A 4ZL6A 5HJFA 1TK6A 2FL0A 4PG1A 3IS8A 2JD60 2UX1A 4KVQA 4CVRA 2C2UA 5K52A 3PW8C 2WWXB 2D5KA 2WTLA 4ZKXA 1AEWA 1VEIA 2HR5A 2GS4A 3FRSA 3F38A 3E1JA 4II4A 5HJHA 3R2MA 2G38B 2QF9A 2CLBA 4LPNA 5ERKA 4MN9A 4ZL5A 3NP0X 5D8XA 3RE7A 3Q4OA 3JZ9A 4CMYA 1QGHA 1L8IA 5D8SA 3QHCA 3IQ1A 3R2SA 4PGIA 5K53A 5JKMG 1TKOA 2WLAA 4LQVA 3KDQA 3AJQA 2Y3QA 3AK8A 3WVWA 5D8PA 4X0JA 5GN8A 2V2MA 3QHBA 1BCFA 5CZUA 3F37A 3BT5A 4W4KB 4AM2A 4LYXA 4ZMCA 3E1QA 3KXUA 4RC7A 4YXJA 3E6SA 1YUZA 5FFEA 2V15A 5JKMA 3VNXA 1DVBA 5D8YA 3E6RA 2CHPA 4MKUA 1H96A 1NNQA 5LG8A 2V8UA 5J9VA 1OTKA 4CVPA 3R2KA 5LBHA 5J93A 2JD80 3W54A 3R2LA 1JKUA 4AM5A 2OKCA 1YV1A 3F33A 3UOFA 2ZA7A 1BFRA 4Z3BA 5LS9A 1VEQA 1O9RA 2WLUA 4M35A 1XZ3A 4P18A 2XJOA 1JREA 1FHAA 4CY9A 3QZ3A 4DE6A 4CYAA 3R2HA 4TOGA 3GVYA 2C41A 1ZUJA 2IY4A 2RBDA 3C21A 5JKLA 2IU2A 3KA3A 1VJXA 4DYZA 4LQHA 3FRRA 3ERZA 2MGYA 1R03A 4MXPA 1KRQA 1UVHA 4ITTA 2YJKA 1JI5A 3NP2X 3TA8A 2IB0A 2Y44A 4RC5B 2YJJA 5HU6D 5AXSA 4DYUA 3PVRB 2V2IA 3Q4NA 1Z6OM 4KVSA 3PZAA 2CWLA 1S3QA 4M34A 2ZG9X 4Z5SA 2CEIA 1B71A 3C1ZA 1TJOA 4PGKA 1VELA 3PWQC 4W4LB 3LKDA 2OC5A 5JDOB 5D8OA 3PW8A 2CHIA 4XKUA 1N1QA 4YXMA 1JGCA 4XGSA 1JKVA 4MUDA 3WVVA 3KX9A 4RC6B 1Z4AA 2FJCA 4XKTA 3AF9X 5FEJA 3FSEA 2QQYA 4TOEA 4CVSA 2FHAA 2PYBA 5CMRA 3BVFA 1JYBA 5IX6A 3BVLA 3AJOA 3GGZA 3EZ0A 4MJYA 4QUWA 4DZ0A 2W0OA 5D8QA 3AF8X 2V8TA 3L0MA 4ML5A 1YUXA 1EUMA 1HRSA 4EVDA 2V2RA 3RBCA 2YW6A 2ZA8A 2Z5QA 4ITWA 2ZURX 3FI6A 4ZKHA 3R2RA 4DYYA 1IERA 3PVYB 3HIUA 4DASA 1GWGA 3VV9A 2GYDA 5FFAA 5JKLG 3BVEA 4IWJA 4Y08A 2XJNA 4RC5A 1JTSA 2ZA6A 4YKHA 5D8RA 4EVCA 3A9QA 3E2CA 3PVRA 4KXRB 5HQOA 3D19A 1S2ZA 3O7RA 3AK9A 3PWFA 3ISFA 3E1MA 5J8WA 3Q4QA 4TODA 2OH3A 5I4JA 3ES3A 4ISMA 3E1NA 2G4HA 3C23A 2GYQA 1O9IA 3RGDA 4E6KA 4YVZA 5JDOA 5FFCA 4LPJA 3PVTB 2V2SA 1SQ3A 3UNOA 5J8SA 3Q4RA 5LG2A 4ERUA 3OJ5A 2BK6A 3AJPA 2VXIA 1J30A 4RC6A 2V2OA 3BKNA 2XKQA 3NOZX 3BVKA 3HL1A 5CMQA 3KA4A 3RD0A 3U90A 3UFBA 3PWQA 4MY7A 2ZG8X 3V3KB 1MFRA 2BJYA 1F33A 1L8HA 3GE4A 3IS7A 5ERJA 4CYBA 5GU0X 4R42A 1Z6OA 3EZUA 2V2LA 4IXKA 3VVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZS3 A;  3ISE A;  4KVR A;  1RCG A;  2CN7 A;  2C2F A;  2CIH A;  1TKP A;  2BW1 A;  4IWK A;  5E1U A;  4LYU A;  4LPM A;  3T9J A;  4XKS A;  3SE1 A;  1VLG A;  3KA6 A;  4DI0 A;  1NF4 A;  3QB9 A;  2BKC A;  3E1O A;  2F7N A;  4M32 A;  1BG7 A;  3PVY A;  4EVB A;  4AM4 A;  3PW1 B;  5GU3 X;  3WVU A;  3A68 A;  4CMY V;  1UMN A;  3F39 A;  1SOF A;  1LKM A;  1IES A;  1DPS A;  4TOA A;  1RCD A;  2FKZ A;  4LQJ A;  2XJM A;  2VZB A;  5GU2 X;  2CF7 A;  3O7S A;  4ISP A;  4OYN A;  1RCE A;  2V2P A;  2VXX A;  4M33 A;  1LKO A;  3E1L A;  5JAC A;  3FVB A;  2FG8 A;  3F32 A;  2V2J A;  2V2N A;  5E2D A;  5FFB A;  1RYT A;  1LKP A;  2FZF A;  4TO9 A;  1NF6 A;  3PVT A;  4II4 B;  4ETR A;  3KA9 A;  1XZ1 A;  2C6R A;  2Z5P A;  4TOH A;  4CVT A;  5GU1 X;  2JD7 0;  4REU A;  2ITB A;  4TOC A;  3MPS A;  4RC8 A;  2X17 0;  1QYB A;  2ZG7 X;  4ZLW A;  4A25 A;  3WNW A;  2XGW A;  3SH6 A;  2FFX J;  3RAV A;  3F34 A;  1JIG A;  3F35 A;  3KWO A;  4TW3 A;  1JI4 A;  5FFD A;  3BVI A;  5GN8 B;  3UOI A;  3OGH A;  1MOJ A;  3KA8 A;  3R2O A;  5C6F A;  4PG0 A;  2HTN A;  1S30 A;  2YW7 A;  2FG4 A;  4RC7 B;  3QVD A;  4DYX A;  3EGM A;  4TOF A;  3SID A;  3QD8 A;  1NFV A;  4LQN A;  3SHX A;  3H7G A;  4TOB A;  3F36 A;  5GOU A;  1RCI A;  3AF7 X;  4U3G A;  2Z6M A;  2Z5R A;  3PW1 A;  1LB3 A;  2C2J A;  3GHQ A;  4ZTT A;  4ZJK A;  1RCC A;  1F30 A;  2CLU A;  4ZKW A;  1DAT A;  4EVE A;  2CN6 A;  3E1P A;  2Z90 A;  4ZL6 A;  5HJF A;  1TK6 A;  2FL0 A;  4PG1 A;  3IS8 A;  2JD6 0;  2UX1 A;  4KVQ A;  4CVR A;  2C2U A;  5K52 A;  3PW8 C;  4ZKX A;  2D5K A;  2WTL A;  1AEW A;  1VEI A;  2HR5 A;  2GS4 A;  3F38 A;  3E1J A;  4II4 A;  5HJH A;  3R2M A;  2QF9 A;  2CLB A;  4LPN A;  5ERK A;  4MN9 A;  4ZL5 A;  3NP0 X;  5D8X A;  3RE7 A;  3Q4O A;  4CMY A;  1QGH A;  1L8I A;  5D8S A;  3QHC A;  3IQ1 A;  3R2S A;  4PGI A;  5K53 A;  5JKM G;  1TKO A;  2WLA A;  4LQV A;  3AJQ A;  2Y3Q A;  3AK8 A;  3WVW A;  5D8P A;  5GN8 A;  2V2M A;  3QHB A;  1BCF A;  5CZU A;  3F37 A;  3BT5 A;  4AM2 A;  4LYX A;  4ZMC A;  3E1Q A;  3KXU A;  4RC7 A;  3E6S A;  1YUZ A;  5FFE A;  2V15 A;  5JKM A;  3VNX A;  1DVB A;  5D8Y A;  3E6R A;  2CHP A;  4MKU A;  1H96 A;  1NNQ A;  5LG8 A;  5J9V A;  1OTK A;  4CVP A;  3R2K A;  5LBH A;  5J93 A;  2JD8 0;  3R2L A;  1JKU A;  4AM5 A;  1YV1 A;  3F33 A;  3UOF A;  2ZA7 A;  1BFR A;  4Z3B A;  5LS9 A;  1VEQ A;  1O9R A;  2WLU A;  4M35 A;  1XZ3 A;  4P18 A;  2XJO A;  1JRE A;  1FHA A;  4CY9 A;  3QZ3 A;  4DE6 A;  4CYA A;  3R2H A;  4TOG A;  3GVY A;  2C41 A;  1ZUJ A;  2IY4 A;  2RBD A;  5JKL A;  2IU2 A;  3KA3 A;  1VJX A;  4DYZ A;  4LQH A;  3ERZ A;  1R03 A;  1KRQ A;  1UVH A;  4ITT A;  2YJK A;  1JI5 A;  3NP2 X;  3TA8 A;  2IB0 A;  4RC5 B;  2YJJ A;  5AXS A;  4DYU A;  3PVR B;  2V2I A;  3Q4N A;  1Z6O M;  4KVS A;  3PZA A;  1S3Q A;  4M34 A;  2ZG9 X;  4Z5S A;  2CEI A;  1B71 A;  1TJO A;  4PGK A;  1VEL A;  3PWQ C;  2OC5 A;  5D8O A;  3PW8 A;  2CHI A;  4XKU A;  1N1Q A;  1JGC A;  4XGS A;  1JKV A;  4MUD A;  3WVV A;  3KX9 A;  4RC6 B;  1Z4A A;  2FJC A;  4XKT A;  3AF9 X;  5FEJ A;  3FSE A;  2QQY A;  4TOE A;  4CVS A;  2FHA A;  2PYB A;  5CMR A;  3BVF A;  1JYB A;  5IX6 A;  3BVL A;  3AJO A;  3EZ0 A;  4QUW A;  4MJY A;  4DZ0 A;  2W0O A;  5D8Q A;  3AF8 X;  4ML5 A;  1YUX A;  1EUM A;  1HRS A;  4EVD A;  2V2R A;  3RBC A;  2YW6 A;  2ZA8 A;  2Z5Q A;  4ITW A;  2ZUR X;  3FI6 A;  4ZKH A;  3R2R A;  4DYY A;  1IER A;  3PVY B;  3HIU A;  4DAS A;  1GWG A;  2GYD A;  5FFA A;  5JKL G;  3BVE A;  4IWJ A;  4Y08 A;  2XJN A;  4RC5 A;  1JTS A;  2ZA6 A;  4YKH A;  5D8R A;  4EVC A;  3A9Q A;  3E2C A;  3PVR A;  5HQO A;  1S2Z A;  3O7R A;  3AK9 A;  3PWF A;  3ISF A;  3E1M A;  5J8W A;  3Q4Q A;  4TOD A;  2OH3 A;  5I4J A;  3ES3 A;  3E1N A;  4ISM A;  2G4H A;  2GYQ A;  1O9I A;  3RGD A;  4E6K A;  5FFC A;  4LPJ A;  3PVT B;  2V2S A;  1SQ3 A;  3UNO A;  5J8S A;  3Q4R A;  5LG2 A;  4ERU A;  3OJ5 A;  2BK6 A;  3AJP A;  2VXI A;  1J30 A;  4RC6 A;  2V2O A;  3BKN A;  2XKQ A;  3NOZ X;  3BVK A;  3HL1 A;  5CMQ A;  3KA4 A;  3RD0 A;  3U90 A;  3PWQ A;  4MY7 A;  2ZG8 X;  1MFR A;  2BJY A;  1F33 A;  1L8H A;  3GE4 A;  3IS7 A;  5ERJ A;  4CYB A;  5GU0 X;  4R42 A;  1Z6O A;  3EZU A;  2V2L A;  4IXK A; 
#chains in the Genus database with same CATH topology
 1ZS3 A;  3ISE A;  4KVR A;  1RCG A;  2CN7 A;  2C2F A;  2AR0 A;  1TKP A;  2CIH A;  2N02 A;  2BW1 A;  4IWK A;  5E1U A;  4LYU A;  4LPM A;  3T9J A;  4XKS A;  3SE1 A;  1VLG A;  3KA6 A;  4DI0 A;  1NF4 A;  3QB9 A;  2BKC A;  3E1O A;  2F7N A;  4M32 A;  1BG7 A;  3PVY A;  4EVB A;  4AM4 A;  3PW1 B;  5GU3 X;  3WVU A;  3A68 A;  4CMY V;  3JZA B;  1UMN A;  3F39 A;  1SOF A;  1LKM A;  1IES A;  1DPS A;  4TOA A;  1RCD A;  2FKZ A;  4LQJ A;  2XJM A;  2VZB A;  5GU2 X;  2CF7 A;  3O7S A;  4ISP A;  4OYN A;  1RCE A;  2V2P A;  2VXX A;  4M33 A;  1LKO A;  3E1L A;  5JAC A;  3FVB A;  2FG8 A;  4E40 A;  3F32 A;  2V2J A;  2V2N A;  5E2D A;  5FFB A;  3GGY A;  1RYT A;  1LKP A;  2FZF A;  4TO9 A;  1NF6 A;  3PVT A;  4II4 B;  4ETR A;  3KA9 A;  1XZ1 A;  2C6R A;  2Z5P A;  4TOH A;  4CVT A;  5GU1 X;  2JD7 0;  4REU A;  2ITB A;  4TOC A;  3KHK A;  3MPS A;  4RC8 A;  3C1Y A;  2X17 0;  1QYB A;  2ZG7 X;  4ZLW A;  4A25 A;  3WNW A;  2XGW A;  3SH6 A;  2FFX J;  3RAV A;  3F34 A;  1JIG A;  3F35 A;  3KWO A;  4TW3 A;  1JI4 A;  5FFD A;  3BVI A;  5GN8 B;  3UOI A;  3OGH A;  1MOJ A;  3KA8 A;  3R2O A;  5C6F A;  4PG0 A;  2HTN A;  1S30 A;  2YW7 A;  2FG4 A;  4RC7 B;  3QVD A;  4DYX A;  3EGM A;  4TOF A;  3SID A;  3QD8 A;  1NFV A;  4LQN A;  3SHX A;  3H7G A;  4TOB A;  3F36 A;  5GOU A;  3N6O A;  1RCI A;  3AF7 X;  4U3G A;  2Z6M A;  2Z5R A;  3PW1 A;  1LB3 A;  2C2J A;  3GHQ A;  3M6J A;  4ZTT A;  3DBY A;  4WJG 4;  4ZJK A;  1RCC A;  1F30 A;  2CLU A;  4ZKW A;  1DAT A;  4EVE A;  2CN6 A;  3E1P A;  2Z90 A;  4ZL6 A;  5HJF A;  1TK6 A;  2FL0 A;  4PG1 A;  3IS8 A;  2JD6 0;  2UX1 A;  4KVQ A;  4CVR A;  2C2U A;  5K52 A;  3PW8 C;  2WWX B;  2D5K A;  2WTL A;  4ZKX A;  1AEW A;  1VEI A;  2HR5 A;  2GS4 A;  3FRS A;  3F38 A;  3E1J A;  4II4 A;  5HJH A;  3R2M A;  2G38 B;  2QF9 A;  2CLB A;  4LPN A;  5ERK A;  4MN9 A;  4ZL5 A;  3NP0 X;  5D8X A;  3RE7 A;  3Q4O A;  3JZ9 A;  4CMY A;  1QGH A;  1L8I A;  5D8S A;  3QHC A;  3IQ1 A;  3R2S A;  4PGI A;  5K53 A;  5JKM G;  1TKO A;  2WLA A;  4LQV A;  3KDQ A;  3AJQ A;  2Y3Q A;  3AK8 A;  3WVW A;  5D8P A;  4X0J A;  5GN8 A;  2V2M A;  3QHB A;  1BCF A;  5CZU A;  3F37 A;  3BT5 A;  4W4K B;  4AM2 A;  4LYX A;  4ZMC A;  3E1Q A;  3KXU A;  4RC7 A;  4YXJ A;  3E6S A;  1YUZ A;  5FFE A;  2V15 A;  5JKM A;  3VNX A;  1DVB A;  5D8Y A;  3E6R A;  2CHP A;  4MKU A;  1H96 A;  1NNQ A;  5LG8 A;  2V8U A;  5J9V A;  1OTK A;  4CVP A;  3R2K A;  5LBH A;  5J93 A;  2JD8 0;  3W54 A;  3R2L A;  1JKU A;  4AM5 A;  2OKC A;  1YV1 A;  3F33 A;  3UOF A;  2ZA7 A;  1BFR A;  4Z3B A;  5LS9 A;  1VEQ A;  1O9R A;  2WLU A;  4M35 A;  1XZ3 A;  4P18 A;  2XJO A;  1JRE A;  1FHA A;  4CY9 A;  3QZ3 A;  4DE6 A;  4CYA A;  3R2H A;  4TOG A;  3GVY A;  2C41 A;  1ZUJ A;  2IY4 A;  2RBD A;  3C21 A;  5JKL A;  2IU2 A;  3KA3 A;  1VJX A;  4DYZ A;  4LQH A;  3FRR A;  3ERZ A;  2MGY A;  1R03 A;  4MXP A;  1KRQ A;  1UVH A;  4ITT A;  2YJK A;  1JI5 A;  3NP2 X;  3TA8 A;  2IB0 A;  2Y44 A;  4RC5 B;  2YJJ A;  5HU6 D;  5AXS A;  4DYU A;  3PVR B;  2V2I A;  3Q4N A;  1Z6O M;  4KVS A;  3PZA A;  2CWL A;  1S3Q A;  4M34 A;  2ZG9 X;  4Z5S A;  2CEI A;  1B71 A;  3C1Z A;  1TJO A;  4PGK A;  1VEL A;  3PWQ C;  4W4L B;  3LKD A;  2OC5 A;  5JDO B;  5D8O A;  3PW8 A;  2CHI A;  4XKU A;  1N1Q A;  4YXM A;  1JGC A;  4XGS A;  1JKV A;  4MUD A;  3WVV A;  3KX9 A;  4RC6 B;  1Z4A A;  2FJC A;  4XKT A;  3AF9 X;  5FEJ A;  3FSE A;  2QQY A;  4TOE A;  4CVS A;  2FHA A;  2PYB A;  5CMR A;  3BVF A;  1JYB A;  5IX6 A;  3BVL A;  3AJO A;  3GGZ A;  3EZ0 A;  4MJY A;  4QUW A;  4DZ0 A;  2W0O A;  5D8Q A;  3AF8 X;  2V8T A;  3L0M A;  4ML5 A;  1YUX A;  1EUM A;  1HRS A;  4EVD A;  2V2R A;  3RBC A;  2YW6 A;  2ZA8 A;  2Z5Q A;  4ITW A;  2ZUR X;  3FI6 A;  4ZKH A;  3R2R A;  4DYY A;  1IER A;  3PVY B;  3HIU A;  4DAS A;  1GWG A;  3VV9 A;  2GYD A;  5FFA A;  5JKL G;  3BVE A;  4IWJ A;  4Y08 A;  2XJN A;  4RC5 A;  1JTS A;  2ZA6 A;  4YKH A;  5D8R A;  4EVC A;  3A9Q A;  3E2C A;  3PVR A;  4KXR B;  5HQO A;  3D19 A;  1S2Z A;  3O7R A;  3AK9 A;  3PWF A;  3ISF A;  3E1M A;  5J8W A;  3Q4Q A;  4TOD A;  2OH3 A;  5I4J A;  3ES3 A;  4ISM A;  3E1N A;  2G4H A;  3C23 A;  2GYQ A;  1O9I A;  3RGD A;  4E6K A;  4YVZ A;  5JDO A;  5FFC A;  4LPJ A;  3PVT B;  2V2S A;  1SQ3 A;  3UNO A;  5J8S A;  3Q4R A;  5LG2 A;  4ERU A;  3OJ5 A;  2BK6 A;  3AJP A;  2VXI A;  1J30 A;  4RC6 A;  2V2O A;  3BKN A;  2XKQ A;  3NOZ X;  3BVK A;  3HL1 A;  5CMQ A;  3KA4 A;  3RD0 A;  3U90 A;  3UFB A;  3PWQ A;  4MY7 A;  2ZG8 X;  3V3K B;  1MFR A;  2BJY A;  1F33 A;  1L8H A;  3GE4 A;  3IS7 A;  5ERJ A;  4CYB A;  5GU0 X;  4R42 A;  1Z6O A;  3EZU A;  2V2L A;  4IXK A;  3VVA A; 
#chains in the Genus database with same CATH homology
 1ZS3 A;  3ISE A;  4KVR A;  1RCG A;  2CN7 A;  2C2F A;  2AR0 A;  1TKP A;  2CIH A;  2N02 A;  2BW1 A;  4IWK A;  5E1U A;  4LYU A;  4LPM A;  3T9J A;  4XKS A;  3SE1 A;  1VLG A;  3KA6 A;  4DI0 A;  1NF4 A;  3QB9 A;  2BKC A;  3E1O A;  2F7N A;  4M32 A;  1BG7 A;  3PVY A;  4EVB A;  4AM4 A;  3PW1 B;  5GU3 X;  3WVU A;  3A68 A;  4CMY V;  3JZA B;  1UMN A;  3F39 A;  1SOF A;  1LKM A;  1IES A;  1DPS A;  4TOA A;  1RCD A;  2FKZ A;  4LQJ A;  2XJM A;  2VZB A;  5GU2 X;  2CF7 A;  3O7S A;  4ISP A;  4OYN A;  1RCE A;  2V2P A;  2VXX A;  4M33 A;  1LKO A;  3E1L A;  5JAC A;  3FVB A;  2FG8 A;  4E40 A;  3F32 A;  2V2J A;  2V2N A;  5E2D A;  5FFB A;  3GGY A;  1RYT A;  1LKP A;  2FZF A;  4TO9 A;  1NF6 A;  3PVT A;  4II4 B;  4ETR A;  3KA9 A;  1XZ1 A;  2C6R A;  2Z5P A;  4TOH A;  4CVT A;  5GU1 X;  2JD7 0;  4REU A;  2ITB A;  4TOC A;  3KHK A;  3MPS A;  4RC8 A;  3C1Y A;  2X17 0;  1QYB A;  2ZG7 X;  4ZLW A;  4A25 A;  3WNW A;  2XGW A;  3SH6 A;  2FFX J;  3RAV A;  3F34 A;  1JIG A;  3F35 A;  3KWO A;  4TW3 A;  1JI4 A;  5FFD A;  3BVI A;  5GN8 B;  3UOI A;  3OGH A;  1MOJ A;  3KA8 A;  3R2O A;  5C6F A;  4PG0 A;  2HTN A;  1S30 A;  2YW7 A;  2FG4 A;  4RC7 B;  3QVD A;  4DYX A;  3EGM A;  4TOF A;  3SID A;  3QD8 A;  1NFV A;  4LQN A;  3SHX A;  3H7G A;  4TOB A;  3F36 A;  5GOU A;  3N6O A;  1RCI A;  3AF7 X;  4U3G A;  2Z6M A;  2Z5R A;  3PW1 A;  1LB3 A;  2C2J A;  3GHQ A;  3M6J A;  4ZTT A;  3DBY A;  4WJG 4;  4ZJK A;  1RCC A;  1F30 A;  2CLU A;  4ZKW A;  1DAT A;  4EVE A;  2CN6 A;  3E1P A;  2Z90 A;  4ZL6 A;  5HJF A;  1TK6 A;  2FL0 A;  4PG1 A;  3IS8 A;  2JD6 0;  2UX1 A;  4KVQ A;  4CVR A;  2C2U A;  5K52 A;  3PW8 C;  2WWX B;  2D5K A;  2WTL A;  4ZKX A;  1AEW A;  1VEI A;  2HR5 A;  2GS4 A;  3FRS A;  3F38 A;  3E1J A;  4II4 A;  5HJH A;  3R2M A;  2G38 B;  2QF9 A;  2CLB A;  4LPN A;  5ERK A;  4MN9 A;  4ZL5 A;  3NP0 X;  5D8X A;  3RE7 A;  3Q4O A;  3JZ9 A;  4CMY A;  1QGH A;  1L8I A;  5D8S A;  3QHC A;  3IQ1 A;  3R2S A;  4PGI A;  5K53 A;  5JKM G;  1TKO A;  2WLA A;  4LQV A;  3KDQ A;  3AJQ A;  2Y3Q A;  3AK8 A;  3WVW A;  5D8P A;  4X0J A;  5GN8 A;  2V2M A;  3QHB A;  1BCF A;  5CZU A;  3F37 A;  3BT5 A;  4W4K B;  4AM2 A;  4LYX A;  4ZMC A;  3E1Q A;  3KXU A;  4RC7 A;  4YXJ A;  3E6S A;  1YUZ A;  5FFE A;  2V15 A;  5JKM A;  3VNX A;  1DVB A;  5D8Y A;  3E6R A;  2CHP A;  4MKU A;  1H96 A;  1NNQ A;  5LG8 A;  2V8U A;  5J9V A;  1OTK A;  4CVP A;  3R2K A;  5LBH A;  5J93 A;  2JD8 0;  3W54 A;  3R2L A;  1JKU A;  4AM5 A;  2OKC A;  1YV1 A;  3F33 A;  3UOF A;  2ZA7 A;  1BFR A;  4Z3B A;  5LS9 A;  1VEQ A;  1O9R A;  2WLU A;  4M35 A;  1XZ3 A;  4P18 A;  2XJO A;  1JRE A;  1FHA A;  4CY9 A;  3QZ3 A;  4DE6 A;  4CYA A;  3R2H A;  4TOG A;  3GVY A;  2C41 A;  1ZUJ A;  2IY4 A;  2RBD A;  3C21 A;  5JKL A;  2IU2 A;  3KA3 A;  1VJX A;  4DYZ A;  4LQH A;  3FRR A;  3ERZ A;  2MGY A;  1R03 A;  4MXP A;  1KRQ A;  1UVH A;  4ITT A;  2YJK A;  1JI5 A;  3NP2 X;  3TA8 A;  2IB0 A;  2Y44 A;  4RC5 B;  2YJJ A;  5HU6 D;  5AXS A;  4DYU A;  3PVR B;  2V2I A;  3Q4N A;  1Z6O M;  4KVS A;  3PZA A;  2CWL A;  1S3Q A;  4M34 A;  2ZG9 X;  4Z5S A;  2CEI A;  1B71 A;  3C1Z A;  1TJO A;  4PGK A;  1VEL A;  3PWQ C;  4W4L B;  3LKD A;  2OC5 A;  5JDO B;  5D8O A;  3PW8 A;  2CHI A;  4XKU A;  1N1Q A;  4YXM A;  1JGC A;  4XGS A;  1JKV A;  4MUD A;  3WVV A;  3KX9 A;  4RC6 B;  1Z4A A;  2FJC A;  4XKT A;  3AF9 X;  5FEJ A;  3FSE A;  2QQY A;  4TOE A;  4CVS A;  2FHA A;  2PYB A;  5CMR A;  3BVF A;  1JYB A;  5IX6 A;  3BVL A;  3AJO A;  3GGZ A;  3EZ0 A;  4MJY A;  4QUW A;  4DZ0 A;  2W0O A;  5D8Q A;  3AF8 X;  2V8T A;  3L0M A;  4ML5 A;  1YUX A;  1EUM A;  1HRS A;  4EVD A;  2V2R A;  3RBC A;  2YW6 A;  2ZA8 A;  2Z5Q A;  4ITW A;  2ZUR X;  3FI6 A;  4ZKH A;  3R2R A;  4DYY A;  1IER A;  3PVY B;  3HIU A;  4DAS A;  1GWG A;  3VV9 A;  2GYD A;  5FFA A;  5JKL G;  3BVE A;  4IWJ A;  4Y08 A;  2XJN A;  4RC5 A;  1JTS A;  2ZA6 A;  4YKH A;  5D8R A;  4EVC A;  3A9Q A;  3E2C A;  3PVR A;  4KXR B;  5HQO A;  3D19 A;  1S2Z A;  3O7R A;  3AK9 A;  3PWF A;  3ISF A;  3E1M A;  5J8W A;  3Q4Q A;  4TOD A;  2OH3 A;  5I4J A;  3ES3 A;  4ISM A;  3E1N A;  2G4H A;  3C23 A;  2GYQ A;  1O9I A;  3RGD A;  4E6K A;  4YVZ A;  5JDO A;  5FFC A;  4LPJ A;  3PVT B;  2V2S A;  1SQ3 A;  3UNO A;  5J8S A;  3Q4R A;  5LG2 A;  4ERU A;  3OJ5 A;  2BK6 A;  3AJP A;  2VXI A;  1J30 A;  4RC6 A;  2V2O A;  3BKN A;  2XKQ A;  3NOZ X;  3BVK A;  3HL1 A;  5CMQ A;  3KA4 A;  3RD0 A;  3U90 A;  3UFB A;  3PWQ A;  4MY7 A;  2ZG8 X;  3V3K B;  1MFR A;  2BJY A;  1F33 A;  1L8H A;  3GE4 A;  3IS7 A;  5ERJ A;  4CYB A;  5GU0 X;  4R42 A;  1Z6O A;  3EZU A;  2V2L A;  4IXK A;  3VVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...