4XH2A

Crystal structure of human paxillin ld4 motif in complex with fab fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
SEVQLVESGGGLVQPGGSLRLSCAASGFNVSSYSIHWVRQAPGKGLEWVAYISSSSGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARTWYYGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Synthetic Antibody Inhibitors Specific for LD2 or LD4 Motifs of Paxillin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Fab Heavy Chain
total genus 46
structure length 220
sequence length 220
chains with identical sequence C, E, G, H, J
ec nomenclature
pdb deposition date 2015-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xh2A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xh2A01
3PJSB 4LEOA 5FUCE 1A14L 2DQDH 3MRNB 4NPYB 3PE9A 2AV1A 3LH2H 3SGDI 4CVZB 2VQ1A 5HI4C 4WNQB 4MXQC 3QCTL 4MD4A 4ELMA 3SJVA 4WJ5B 1K4CA 2IADA 4DVBA 1AHWA 1SJEB 3QNZB 2O26U 1NAKL 4JANA 4JFZH 3FB6B 1I8KA 1KPVA 1ZS8B 1S9WA 5AAWA 1WFOA 3TBYA 3D85A 4QRQA 1ZA6A 1QSEB 1IC4H 3QQNA 2GSGB 5D7LD 1H5BB 3BPCA 2MKLC 5EU5A 3PGFH 1MIMH 4MD0A 4RAUA 3O3UN 2YUZA 4M6MH 3CZFA 3P9MB 3T0BA 3TFKC 1CICD 3V52L 4EIGB 2B4CL 3N1FC 2WINB 4N0CD 3HG1D 4N0FB 2ERJC 1P69B 2ZUQC 1FRGL 3I85A 4R7NB 5MEQB 3WJLA 5FA4A 3BKYL 1Q0XL 1Q9LA 4Z76B 1MAJA 4PJDA 3PWLA 3FFDA 3CSBA 5FKAA 3ARDC 1BFOB 1EIBA 3DRTA 5HHOD 3BUYB 2X4NA 2R2BA 4KJWC 4C59B 1A4KB 1P7QA 1JNLL 4ZOEA 1FYHB 3S37L 4NZTH 4P2RA 3MC0A 1ZWIA 3JTSB 4K7FB 4LK4A 3AAZB 2GKIA 1G9NH 3RDTB 1FL5A 3HS0B 4ZOCA 4LHUA 1JL8A 3D2UD 5IF0B 4X5WA 3KPOA 4OLVH 4WUKL 1JHKL 3G6JE 3VJ6A 1G6RL 3QIBA 4JJ5B 4JFHD 4OZHF 4S1QH 4U1HA 4W81A 1KB9J 4XPGL 1OTSD 1H3XA 3DXAD 3HCVB 2VQUA 1YJDH 2X10A 2NY0D 4LARL 3RUGF 2XA8L 4NKIL 3V5KA 5DXWA 2H9GA 5A3ID 4FNLL 2I60H 4BQ6A 1EGJH 5MENE 4TUKL 3EBAA 2ESVD 3TO2A 4LLWA 1TTGA 3MRMA 1P53A 1TJGH 1P4LA 5BRZA 3VXTB 5ADPL 3ARZA 1P4IH 2QADC 4I48A 1K5NA 5BW7C 2E7BA 1YEKH 2FJHA 2Q76B 3MNWB 4HWBL 2HVKB 2R2HB 2Y4SA 2LE9A 3F5WB 2A6KB 2DI9A 3C6LA 1OM3H 3T3PF 1CQYA 3VG0H 4R97C 4YDJB 1U8QA 5IV2B 3EO0A 4XRCA 4KK6D 4AJ0A 3VRLE 3IDMB 3NIDF 3AXLA 5CMAA 2ADFL 1ZANH 3TN0A 3R06A 1RZFH 4KRLB 3BRDA 5MEPB 5CBEA 1S7VA 5IGXL 1MWAA 5FA3A 1EAPB 3C5JA 4OF8A 1AI1L 1ACZA 2APTA 5C0ND 5E5RB 2GFBB 1R5IA 2QJDA 2APFA 3R8QA 4PGCB 1BOGB 5L88L 3BFOA 3DVGA 4PRIB 3HR5A 5B3NA 4X8JB 3T3ME 2E9WA 2IFFL 3S34H 3ZYZA 3GEWB 5EO9B 1AO7B 1K8IB 1ND0A 1T20B 1VB9A 4PTTB 5ECJE 2OCFD 1TZHB 1OTUD 3QI9D 1TZIB 3BMVA 3U0PB 3HR6A 1F4WL 4EOWH 1NPUA 4OGXL 4ZOAA 2RIKA 2VXUL 3GBLA 2E9BA 3WCYA 4QHNB 4LASH 1G7QB 4D9LL 5IMLB 4QGTA 5IOPB 4KI5D 4RFEA 2R23B 1A6WL 5CD5C 3PHOA 5C0DA 1A6UL 3REVB 4ZNEA 1E4KA 2ENSA 3PDGA 5I1LA 4OAWB 2D4DA 1L0XA 4ETQA 1XR8A 5F6HJ 2CIKA 5C9JA 3V79C 2XZCL 3H2WA 4KJYA 2F15A 3U36A 3W9EB 5ALBL 3W11C 3KLAB 3UJTH 1Q1JH 4X7TB 4U49A 3ZL4L 2MPAL 4OLXL 4E0RB 1A9EA 1CQKA 3QEGH 5FYKE 1GAFL 1RIUH 3HG1A 1HE7A 4MD5A 3DUHA 3L3KB 3UZEA 2F8XC 3DBXB 4KZDL 3LDBB 4G8EA 2YUWA 3NACH 2R4RL 4LVNB 5TQ0H 5A1AA 5T1DH 3GBNL 2F5BL 5FK9B 2MHAA 3KR3H 3BH9B 4WY7L 5SV4A 4XXCC 2AK1L 3STZB 2HTKC 2X5PA 5CP7A 2OTWA 3ZSSA 1EMTH 5DHYB 1IT9H 3V7AE 5MHSE 4QCIB 2J4WH 3SDAC 1RFDL 4ERSL 2NNAA 4PRNB 5DJ0B 3D39D 5EDXA 1NLBH 3T3PE 2ESVE 4ODHL 4JDZA 3FQWB 4JM2F 4NHUA 3H0TB 1A47A 1NFIA 1U8PB 1TNMA 5IM7A 3QEHA 3BH9A 4LPVA 2ZG3A 4B7LA 1Z9OA 3BIKA 5DRWB 1QYGH 1X44A 1INQA 1NQBA 1CICC 5KN5B 3GSVB 4LFHG 3MUGB 4X6CB 1VGKB 3QEQB 1DVFA 1BQUA 1A1MB 4Z7UE 3GMRB 2VSCA 3TV3L 2VLKB 4OD1L 4ODXB 4OCWH 1QLFA 2GY5A 5ESVA 3W0WA 4M5YH 2Q7YA 2DAVA 3EHBC 3ELAT 2C4FT 4LPXA 1ORSA 3FQRB 4LSRH 5FO9B 3S98A 5E8NA 3LPGA 3P2TA 4HQQH 3CFDB 4HJJL 2H8PA 1X5HA 3G6AA 5I30L 2UZXB 1KCKA 3LEYL 4JREB 1U95B 3MO1A 4CW1B 4Z7VA 3C60A 3QFJD 1XCTB 5DZNA 4PREA 2PETA 4MDIB 3HB3D 3SQOH 3NCEB 1HXYB 2CGRH 1FSKC 3U2SB 5CHNB 7CGTA 4EUPA 1KG0B 4UV4H 3E8UL 1N7MH 5CKGA 5HTSA 3QQ4B 5F6IB 1LEIA 1NDGB 1CLCA 3DIFB 4IDJH 4OFIA 4YO0A 5FHAH 4WO4B 2P5EA 2ZSVB 3GMPB 3SE9L 3OWEA 4XTRD 3P9WB 5KSUA 2N56A 2DQGH 4BQ8A 2M26A 4ZD3H 2NY7H 3MBXH 4RMTA 3D0VB 4JPWL 3AVEA 1DR9A 2RGSA 5IJKC 3MXVH 4LLYA 1LQSR 4TVPD 2VKXA 1XFPA 3HUJF 4OZIB 3EOAA 5E2VH 4C4KO 5JIIA 4JQIH 4JFDA 4HFUH 5DMKB 3MA7B 4GXUN 3ARTA 2BOCA 1DQJB 1U8OA 2XWJA 1IARB 3M45A 4XPFL 2JF1A 1QBMH 2BC4A 4U3HA 2AK4A 5JZ7C 3H9SB 3GSRA 3UP1A 2WBJD 4XPAL 2FHBA 3HZYA 2D0HA 1HHKB 2ESVB 4C56E 4L9LC 1U8JA 4Z7NF 2A9NH 1OP5H 3WHE0 4HS8L 5DUBB 4NFBA 5GRUH 3VE0A 4IJ3C 5CJ5A 1ZHNB 3MRCA 5LXGH 4WW2A 4NN5B 1D5ZB 2MJWA 1M6OB 1A6TB 4FMFA 3RI5K 1XGPA 5CCKL 2WUBL 1MLCA 3EFFA 2QL1A 2DS4A 3FTGA 2Z8RA 4PJ5E 2XA3A 1JZ5A 1PG7H 2OZ4L 4ZAKC 2IMMA 1AD0A 2I24N 3O4OB 4UIMB 3MRKA 4LBEB 3VXMD 1KPUB 2LTQC 1GHFH 5BVPL 3FO1B 2YWZA 5IT2L 3T2NL 4HUKB 1H3UA 5B39B 3ZLQC 1A21A 3SQOL 1FG9C 2H1PL 5I0ZA 3V6BR 3GO1L 4DOHE 1U8JB 3TA3C 3MRQA 1DLFL 1IQDA 3FO2A 4ZUUB 3MRJA 4DZBB 3P4MB 4LQ1A 2VRAA 3GNML 5L8LB 5HGDA 1E27A 2XQBH 2F19L 3O9WA 3Q5TA 4KUCD 1YMHB 1T1YA 2EDXA 2CIIA 5C0JA 5D72H 1J0IA 4CMMB 1DQDL 4KKBD 2QR0A 4S2SA 3TYFB 3VXSE 1JPTH 5CZKA 3RJQB 3ARRA 1ZT4B 2Z92B 3KPTA 4UT7L 1UZ8A 3TCLB 1JPSL 1KPUA 2YK1L 4Z95L 5HHPB 1JNLH 3TBSA 3RA7L 2E7HA 5C0BB 1N59A 4D3CH 3TBVB 1EDQA 2NY1D 2QQNL 3D6GA 2CJUL 2XRAL 5IEKB 3CXDH 5K9KB 4JQVC 4LSPL 4OM1H 5FA3B 3GI9H 1P5VA 4U1GB 4G8GD 2Z93A 3L3JB 1CGUA 2P43B 3PHQB 1CLZH 3HUJA 2EDJA 3ARFD 4HUVA 1YEJH 4YHIA 5E8DH 3RTQB 4XPBH 3T04D 1EUTA 1JCKA 1V3KA 4JVUA 4LCWD 4F8QA 3FCTB 4YHMH 2IAMC 5F7HA 2RFXA 2BXYA 3WFDH 1BVKB 4IS6A 1LE9A 1PKQB 2YEZB 1GSMA 4X4YB 2R9HC 3JV6A 4LCWA 4HD9A 3RHWK 2DQUL 2AJXH 7FABH 2PR4H 3T4AA 4MX7A 4PP2B 3ARQA 2E27L 2VSDA 15C8H 1G7IB 3HI1B 4XWGL 2HT2C 5D7JB 4OI7A 3DSFL 4HZAA 3DOSA 5E8OA 1S7RB 4XVSL 3NBNA 1BBJA 2WANA 8FABB 4PJGF 5DVMA 5CGTA 2MOVA 1MHPH 4PJDE 4UINL 1FBIL 1FYTD 2JLLA 1I75A 3HA0A 5ENWA 2VITB 4G80B 4EVNA 3X3FH 1U2HA 4PD4J 4UT6H 3L5XH 4Y19D 5I1HH 1MIEH 1KJ2A 4UNTA 4IRZH 5L7XL 3QWRD 1J1XL 2DLFH 4XPHL 5BQ7B 2OP4L 2OM5A 4KJQD 1AI1H 3SDDA 1M4KA 3VFUA 4X5LA 4KV5E 3U6RB 5GJTL 5ILTH 1HIMH 1T3FB 3R4DA 3MLUL 3O45A 1PKQE 4KJPD 3PABA 4G7VH 4XPTL 4NQEA 4WEBL 3GRWA 4NQXB 2GITB 1RI8A 3FRPG 2ZUXA 3D5OF 3L3IA 4CN6A 1UWXH 1RY7B 5E03A 1J1PL 1Z0NA 3RNQA 3UMTA 4L8SB 1OGTA 5BV7L 5J1SC 1PYWA 1JNHA 1WIUA 4Q7DA 4PBWD 1JHLL 1R3IL 1N5AA 3VFTB 1FLRL 1T80A 5DJ6A 3CCHB 5FYLD 3MJ7A 1BZ9B 4J3WA 2DQCH 3BJ91 4X5WB 4ZTOH 3VGDA 1XZ0A 1G84A 5D6CB 1FVDA 2BNRB 3BW9B 4PRHB 2NTFB 3MNVA 1A6VL 3KS0H 1QSVA 2VLJE 4KXZH 4LSTH 1PAMA 4HG4K 3LS4H 1F4XH 5FO7A 2A73A 3HZKA 1A1MA 4MLSA 4YGAB 3CD4A 1Q1JL 1KCRL 4J3TA 1DQTA 1QBAA 2EH7H 1K8DB 4YHML 1OD9A 2CLZB 1HQRA 4HF5H 2VC2L 5H94B 3LRSB 4J3VA 5D71H 5T3ZL 1U3JA 3GMQB 4EXKA 1T0PB 4PRBA 3I6KA 1UYWL 3S9DB 2BHUA 3VXUE 1CDHA 1UACH 5T1DL 4M02A 3RIAK 1H0DB 1GL4B 4OFYD 2IPUK 4BSVB 4LLMA 1T5XB 5INCB 1FPTH 2CKBH 1MVFA 4FABH 2HWZL 2VQTA 5IOPA 5CIPB 3W39A 4XNYH 4Z7VB 5D1ZA 4J4PD 4NQDA 1OOAA 2FX9H 2D7OA 5I74C 1YYLH 2BJML 2VWEC 3CZFB 3FHAA 3L5XL 5D1ZD 4IHOA 5E94B 3SDXB 1F6FB 3KPNA 5FO8A 5GISL 2J8UA 1RU9L 2CMRL 1YEEH 4OTXL 4J2XA 1BBDH 3DETC 2C3VB 5I66A 1EHLL 4P5TA 3PL6D 1I3VA 1JZ4A 4JY6A 5GJTH 3O2DL 4KROC 5LBSL 2HJFB 5HGGS 4NJ9L 5D1XB 3RWCA 2UUDH 1KTDB 4O9HL 4OLWH 3PNWA 3O6MH 3VWJD 3IVKA 1HINH 4PG2C 5AYQA 1GYAA 2AI0H 1NCBL 2A2QT 4NO3B 5K9JH 4UILL 3PWVB 2QSVA 4YEFA 4AEHL 2YSSA 4RBPH 3SKOA 3T4AB 2DTML 2ZG2A 1MRDH 4HFWB 4ZSOE 1G7MB 5I8EA 1U93A 4OD3H 5TDOB 1XGQA 5GS1A 4NWUL 1B4JH 4JFXB 4K8RH 1TZIA 4QCIA 2EE9A 3MLTB 5JW4M 4HWBA 1XIWB 4LPYA 3IFOB 3STZA 5B3JE 2NW2B 4ODBD 4O58L 5JR1L 1IGYA 1YEDA 3QXDB 4PJ8D 4BSWB 4HKBA 1OAKH 3RPKA 1BQHA 3UROR 1U9KA 1UJ3C 5EUKB 1FNGB 4L4TE 4Y2DC 4JO4H 4KJWD 1REIA 1QFWL 2VLJD 3CVHA 5CD3A 5A2FA 5KJRL 2Y06L 4LCIH 1E4XL 3EDJA 3JBG7 5C71A 2KDGA 3O0RL 4NBZB 3BP6A 2EO1A 3QCVH 2JK5B 3A67L 3EO0B 4XRCB 1ORQB 4WI5A 2VLME 2V5MA 5IJKA 3QZWG 1IGMH 4UIKH 1Q94A 4ZAKA 1YNTA 3KLSA 3C6LC 3O81A 4GW4B 4O2CA 1B6DA 1RPQA 3QH3B 1CE6A 3DX9A 3WFHA 2BSRA 3NA9H 1P7KA 4G9FD 4LCYB 5E2VL 1DBMH 4HFUL 5E94A 1WLHA 2P45B 4KHXH 3QDGE 2ICCA 2P5EE 3U79A 1CGXA 5D8JH 4YFEA 2X09A 4TSAL 5D6DC 3CC5B 2LABA 4R4BA 4CDHA 4N9GB 3S36X 4I5BB 1NCBH 4MQSB 3RKDC 1I1FA 1L0QA 1Q9KA 2IAMD 3KYNA 2HT2D 4EI5A 3QEQE 5D2LF 5F7NC 4IBLT 5GGRB 1T1WB 1IZJA 3QIBB 1YYML 3DMMB 4QY8A 4O00A 3T0ED 3GMQA 5DSCA 4RMUA 5IESL 1OAUH 4P2QA 3QNXA 1NCTA 5EU5B 4I0PA 1HXMA 2BRRL 4GS7B 3QDMB 1F13A 1KACB 3P30H 3EHBD 1Q94B 4NHCL 4XZUB 3SBWA 1NGPL 3LKPA 4KPHH 2ICWA 1PZ5A 1JF5A 1HHJB 1YNKL 1EV2E 4Y8AA 1WZKA 3TT3L 5SWQA 5IMMA 1FH5L 2BMKA 4XCYB 1I1FB 2MQ0A 4PB9L 2G5BB 3IDGA 3MRFA 1JYWA 1U8HB 4M7ZB 3RIFF 3VD3A 3O2DA 3V8CA 5HYSB 5IFJB 3PDDA 4HIIB 2DWDB 3QUYA 4WHDA 5CINL 2DWEB 1CL7I 2UVFA 2R2CA 3E6HA 1JMXA 3D25A 3IXTA 3B9KB 4QT5B 4XC1H 2AJZB 1JWMB 2ZCHL 1J8KA 4X9IA 2YXMA 3KJ6L 2QHRL 3QUKB 4Y5VC 4JKWA 3WKML 3TZVC 3AUVA 3EDFA 1IC7H 3EGSB 1IM3A 5EZOH 5E6IC 5D1QA 3W82A 1LEIB 4JHWL 3WIIH 3KPPA 4LCUB 3VG9B 3I6LD 4NSKA 4IMKA 2WBWB 4Y16D 2AJYH 4P2CG 3BGMA 3G6JA 4FP8L 1S7TA 4ODUB 1OSPH 1OCWH 4HCRH 3KPRD 1SY6H 3OPZL 3PQYB 4OB5H 1ZLVK 4F3FB 1A3RH 3QDGA 4NYLA 4W70A 5F1NA 3VCLA 1NGZA 4OCLC 5I15L 2J12B 1JPFA 2VR5A 3W0WD 3WFDL 5ITFA 3FT3A 3DURB 1FDLH 5JXEA 2GJ6E 4U6VL 4WHYH 1KTKE 1QBLH 1DQQB 4QHKI 1V7MH 3L95A 3IS0X 4DTGL 2EH8H 1PSKH 4Y4HC 4Z9KB 3WFCL 2MCPH 3S4SB 1QFPA 3F7VB 3L6FB 2JIXD 2A38A 1X5JA 3VH8B 4X7SL 2GW5A 3FONB 5FXCH 1FZMA 4Y5YA 3CH1A 4M7LL 3HI5L 1Z3GH 2XWBB 5EUOB 1CZ8H 4G3YH 5FYKH 4LVOC 1CS6A 3C08L 1EHXA 5CJBA 4GMTL 1P7QD 3U9UB 1T5XA 3L5JA 2Q3AA 1I9JL 2D3VA 2VN4A 4JFZL 4QHKJ 1E4WL 2AGJL 5C8JB 4FFWC 1A7PH 1C1EL 4LLUA 3B2VL 3BVNB 3BE1H 3OX8B 2NX5A 5IHZA 2ITDA 1R5VB 4YO0B 4JJ5A 5IEKA 1FHGA 2FD6H 4L3EA 1VEMA 3MODH 3BH8B 3VXQA 1MCWW 4JQXC 5IK3A 4JFDE 4J6RH 1SJHB 3SJVB 3IU3B 2XZQH 1DN2A 3HMWL 3MRHB 2VXVL 4OZHE 4PJIF 5CEYB 3WLBB 4HK0A 43C9A 4WW1A 4JHZA 3E1F1 4PJ9B 3SDCB 2ADJB 2AXFB 2UVEA 4MCZB 3HMXH 4Y1AB 4LSVH 1A22B 4U7SA 2AJYL 1YECL 4LVEA 4MAUH 3VXRB 4HIIA 1G0XA 5FOBA 4GQ9L 1ZLSL 4JFDB 4OLYH 1TETH 1TQBC 5EH1A 1AC0A 1UA6L 3O6FB 5KBNC 3ECBB 1I8IA 1FL3A 4KKAC 2IF7A 2FR4B 3L1OL 2YHGA 1ONQB 5SWZA 1YEFH 4GXUM 2D03L 5D7KE 3F7YB 4PG2A 5T5FL 5KG9B 1O7SA 3QISA 2AJVH 2NYYD 4MA8L 1IKFH 1JNJA 1VFBB 4S1DC 5GGTL 4HK3N 1QLRA 3PGCA 2V2WA 2V2TB 4CNIA 5DEGB 3V6OA 3PGFL 1P6AB 3CFJA 3BKJH 3I6GA 3KPSE 4YWGH 2P4AB 3SKNB 4FQXB 1NMAH 3ULUH 4KKNA 5TE6H 5EU6A 1FQ9C 3LQZA 5IR1A 2YPKA 2DYPB 1UM5H 1QR1A 1CR9L 2YPLB 3AGVA 1YZZA 3VXSB 5C07D 3C9NB 4XXDA 3V6OC 5T1KD 3BZEA 4JY5H 4WWKC 4KZEH 4RGNE 1CE6B 3MLVL 3BKYH 1NCWH 3DUUA 1FVCA 2NLJA 4PJHA 5F7EH 1MCEA 4LEXL 4JRXB 5K59F 3VGHA 5TGBB 2BERA 3FAWA 1TDQA 5A16A 3QO1A 1LO2H 1NBZA 3OZ9L 1A2YB 3OTTA 5IHBA 3QJFA 4H8WL 2EKSB 4UT9H 4P23C 5ETUB 5E24E 5ESQA 2KH2B 4EQ2A 3UYOD 4XHJC 5I17A 3O8XB 1FO0B 3HE7B 1GH7A 3KLHD 3GKZA 3GHEL 4BQBA 5DSCB 5D7IE 4EKXA 1QRND 5F97E 4WDIA 3TEUA 3QWOA 1S7WA 3EFDH 4HLZH 4Y4FD 4QEGA 4TRPL 3LSOB 1PKQA 2YWYA 4PJEF 3RWIB 4XNZC 4P23A 4PJ9C 1E4XI 4W4NA 5E5MA 1X3DA 3VMNA 4EZMA 1Q8MA 3BIBX 3EOBB 5I1DA 2P5WA 3FRUB 3WUWA 1ND0B 2YUXA 1QVOB 3QFDB 4NQCB 1S78C 5EA0L 4JR9H 4NCC2 1LNUB 1MI5A 4RWHA 3NA4A 1LK3H 4OM0H 1I1CA 5IB1B 5DD0L 1CGSL 1UH2A 1M71A 2Y7QA 1QHOA 3Q6GL 1MFAL 2FWOA 5JO5B 2EC8A 3QP3A 1BD2D 4MS8D 3DX8B 1FC1A 1KLUA 4RA0C 4OLXH 5I6XC 3GB7B 5BCAA 5TE6L 3P73B 5CJOH 3SPVB 5FF6A 1U3HD 4KJYB 4MS8C 4ZUTA 3OKEB 2Y6SC 3NAAL 1S9VB 4OGZA 4F7TA 3PP4L 4NDMB 4UU9B 3O3DB 5D7LE 3L5WB 5JXEC 2APBA 1W72L 2R23A 4OIIL 3WFEL 1NBQA 2NY3C 1CWVA 3QDHA 3LKRB 5DHVH 5F96L 4NP4L 1O5DT 4O51A 1MAML 4N90E 5HHNA 2BNUB 2R4SL 3NIDE 4XP1H 5FHBH 3VI3F 1UM6H 1F5WA 4YR6A 5HD8C 4GAYA 4RNRB 1YEHH 5C07E 4LVHC 1M7IA 3TNNB 1R3HB 4LBEA 3QI9C 5HDBE 3VFGH 1K85A 2C4FU 4OFVA 5EBLA 3S5LG 2OK0L 2XFXA 1GZPA 1QA9B 5DJXB 4AENB 4NM8H 3SPVA 1F6AA 4K7PH 1JGLL 2BNQE 1JPST 1XGUB 3HFML 1S7UA 1DBAH 3X14A 1FYTB 5D9SA 1A9BA 4MQ7A 1R5WB 3OJ2C 3WDJA 2A73B 1MPAH 4JM4H 3UJTL 1RZGA 3PDOB 3O6LL 2WQRA 3UBXA 2X4NB 2VDNL 3E2HB 1PQZA 2ZSWA 1FNSH 3AS3A 5IB2A 1XCQA 4P3DA 1U8OB 3QUML 1GGTA 1ZGLP 1CFTB 4Q2ZA 3LEYH 2NY6B 2W9LA 2HJKB 1AO7D 1QKZL 3GBNH 5ISZE 3WLWD 1MFBL 4PIRF 4EN3A 5IUSA 3V9FA 5F9WB 5KSBF 3UBXI 3SQBA 3RL2A 3X3GL 4HXBH 2QHRH 1C08B 5HDLA 1RURH 1I3UA 1YN6A 4B50A 4P2RE 3QT2A 4LLMB 1ZT7B 5BMFH 1D9KB 3WHE1 4KHTL 1RIHH 4Q6IA 4R4FH 4G8GB 3BWAB 3MLXL 3G5ZA 4FQ2L 4M4RA 4ZNCD 2GAZA 4YQXL 3TPKA 2ARJA 3S35L 1OAYH 4C56A 1ORSB 3RDTC 5DT1L 1KEGL 2C1PA 3O3AB 4XCCL 1MSPA 4Y4HB 5E9DA 4FQCH 1A6PA 2HVKA 3BO8A 3GIZL 4U1IB 4QHMA 2IC2A 4YGVB 4JHBA 4Z7UB 1GRWA 2P5WD 3C60B 2ICEA 3TO2B 1FDLL 1JWMA 2CUIA 3FJTA 5DRWA 5I75B 1LNUA 1UEMA 4FS0A 3WEXB 5C0RL 1TJGL 4PR5A 1T22B 3HAEG 3HAEA 4YIQA 4XPFH 4POYA 1ZLVH 4HWZA 5E8NB 5EU3B 5IFJA 4Y5YC 3OAZK 4NZUH 4D8PB 1Q0YL 2DBLH 3C5ZC 1X5FA 3LQAL 3U0TA 4OKVB 2J8OA 5SX4I 4CU7A 3V4VH 2B1HH 4BUHA 3LKQA 1MPAL 2XTJE 1U8KA 2P8MB 1ZANL 1JZ7A 1EK3A 2YN5A 3AY4C 3V2AR 2JIXB 1U92A 2DQEH 1V3MA 5EIQA 3UJJL 1AKJB 4Y16A 1QO3A 1AHWC 2XKNB 3BE1L 5MENA 3MRIB 5FUOH 4Q9CA 2DIBA 5C0AD 3FB5A 2J3SA 3DBXA 1JZ6A 2FHFA 4KY1H 3DRQB 1S5HA 1S9WB 4YEEA 5ADOH 2IFFH 1HH6A 1LO3H 3PWJA 1JK8A 1BJ8A 5D7KD 3HZYB 3DV4A 4JZNB 1JJUA 4KI5E 4M1DL 3O9WC 2IADB 3GO1H 3C60C 1F4WH 4U1MB 2VWEE 3H8NA 3P77B 1FFPA 3G5VA 5CZVL 4X80H 1EX0A 1IGIH 4KVNH 3SO3B 4UAOC 4XBEL 3BD4A 3QUZD 4U7MA 1NUNB 1GZQB 2WINA 4GG6A 1G7IA 5IROC 3U9PH 3VXSA 1OSZB 3CMGA 2CLVA 3W2DH 5ISZD 2IGFL 3QIUB 1I7ZB 4JQIL 1LWRA 3UZQA 4LKCA 2IPTH 3QH3A 3FT2A 1FNEA 2VISA 3I6GB 5D2NB 3L3GA 3IAGC 5HGAB 2IJ0C 4D3CL 2YD1A 3N1QC 3H9ZA 4I9WE 4L4TD 4BQCA 2P42B 1XF1A 1ZT1B 2FJGA 5BS0E 3MREB 2LVCA 1EEQA 3LKSB 4DGYL 3VWKB 1NFDA 2A9NL 1G7MA 1BOYA 2HLFD 1FFOA 5CZXD 1AO7E 2WZPD 2WNGA 4NO0B 1CDJA 1RZFL 5C0RH 3CIQA 4P2QD 4HGWA 1HHHB 1HDMB 2W1NA 1TENA 4DZ8B 4NO5B 5IFAL 3FOMB 3M8OL 4MA8H 5E99L 1FO0L 5C0GA 1YEIL 3BUTA 4Z77A 3CLFH 4K9EC 1SYVB 4M7JL 4I4WA 4HKBB 3M17B 1AQKH 5C0AA 4S1RH 5C0BA 5EWIH 5ACMA 5IP4A 1MRFH 5GZNC 4L29B 2XWTB 4OZGB 4GW5A 4WU5A 5EB9A 2H8PB 1WFNA 4JG1L 1MLBA 1I3GL 4HPOL 1YPZF 4J3XA 2ILLA 5DK2A 4NKQB 4PJAF 2VISB 5FUOL 2YD5A 2PYFA 4DVRH 1NCCH 35C8L 3BZ4A 1IEHA 5IVXF 4U3CA 5GGUA 4XAKE 1SY6A 4ZXBB 4L8BA 5HYQB 5BRZD 3QUYD 4QRPD 4DCQA 2ADJA 1WWBX 4JY5L 2DQTL 1P4BH 1YY9D 1OY3B 1JHTB 3SKOB 2RCSL 1T7WA 1IAIH 4L29A 4OZGA 4M6ML 5F3HB 1M1SA 2FECI 4BZ1L 2WK2A 1TPXC 2EC9T 3TJEL 4PJ7E 4JKMA 1BIHA 2C5DC 4XVTH 1NMBL 3N9GH 1NDMA 2B4CH 4P46A 3ZE1E 1K9TA 1IGIL 4NN6C 1KC5L 4Q97A 3BH8A 2V2TA 4OZ4B 5JA9A 4C57C 1I1AC 1F3DJ 1Q0XH 1F90L 1JGVL 3MA9H 4MQXD 4X6BA 3KLDA 3IRPX 3HS0A 2FEDC 3UTSE 2ZUQB 1KJ3L 4P59L 3SCMD 1INDL 4JFEB 3EFDL 3S37X 4G43B 4KRPD 4R0LA 3LH2L 4ELKB 4OZFB 4YX2L 5CEZE 3SDXA 5IVOA 1HSAB 5EU4A 1RZ8A 5CILH 1F3DH 4QNPF 1IEAB 3FZUC 5C09B 3IU4L 4HJGA 4Y4FB 4U3XA 1NFKA 1BZ7B 5E08H 4LFHD 2DQCL 4RX4A 5D5ME 5LQBL 5FGSA 2Q20A 4CBPA 4EI6A 3UTOA 4XCNA 4CUCA 1A6VH 4DEPC 2R1XA 5EIIA 1TMCB 4JFFB 5AWNH 3X11B 1JWUA 3OKYA 4DQOH 5HHMB 4O02L 2JJSC 5DK3A 4ORZC 5K33A 1JZ2A 2VABB 2OZ4A 3KG5A 1TJHL 4KI1A 2V2XB 2GJ6D 2HLAB 4HT1H 1QG3A 4XCFH 4Y2DD 1B0RB 5F3BB 5C0DB 1RJLA 5BQ7A 4GFTB 1MRCL 1EO7A 3H9SE 4HV8B 2UZYB 5H2BA 3Q0HA 1ZLWK 5KVMC 3PXJA 4Z7WB 4QOKB 3MRDB 1JYNA 1W0VB 4PJ5A 2O61B 1SJXA 3OX8A 3DTXB 4HDIB 2DYPD 3ZE2E 1MJ8L 1HSBB 4WEBH 3IETB 2AQ1A 2EYSA 2OMBA 2DQIL 3DYPA 1OPGH 4XGZA 1UADC 1V7NL 4FTVE 1YEHL 3GBML 4RIRA 5F89B 5BV7H 2DF3A 2E6JA 5LBSH 2RJMA 5ANMA 4ALAH 5IB3B 1RUKH 3RKDD 2F53E 4I3RH 5AG9A 3JSSA 3S4SA 2HJKA 4Z7UA 5ID0B 1FLRH 2AK4E 1B9ZA 2XN9B 3TN0B 2H3NA 2OK0H 3ALXA 4Q0XL 4LPUA 1I8KB 1KPVB 1ZS8A 4I2XB 5A16B 4DUWA 2EDYA 4LSTL 4KRPB 3O3AA 2XWTA 5K9JL 2A6JB 2FGZA 1GGCL 1AGEB 3A6OA 3MLZH 2X42A 2EDQA 2EH7L 4JLRA 4EN3D 2VDNH 3CX2A 4WUUD 3CMOL 5ID0A 4WNQA 3FT4B 1KGCD 2DRUA 4RSVA 1FNSL 1WITA 1WV7T 3GUTA 5B21A 5DD6B 3WDIA 4MX7B 3QUMH 4NWTL 3GMMA 5ADPH 4NOFA 2W9EH 3S96B 3BN9C 3F6LA 3TJHD 2W60A 3V5KB 3GSNH 5DS8B 3SE8L 3X3GH 5BOZG 1S7QA 5B38G 3GSQA 2H32B 5T1LD 2QHLA 3T65A 4LU5H 2ICWI 5IB5B 2CJUH 2PW1A 3JV0A 4HUVB 3QZWA 4Z0XB 3CPLB 5FKPA 3UTTB 1VSCA 4HFWA 1MRCH 3NFNB 1C12A 2I25N 1N8ZB 5C0NC 2OI9C 2X44D 1R5IB 4IEFB 2I9LA 4K3DL 4Y5VB 5E70A 3MJ9H 2DWDA 3QUYB 4A6YA 3PDOA 4MSWB 4C54A 5JQHC 2NY0C 4LSQH 1ZHLA 1ADQA 2LV4A 4IOSD 2Z4QB 3OJVC 2BP3A 1RJCA 4FQCL 4O5LH 1S3KL 5ACLA 1XGTA 5JXED 5EZJA 5GRVL 4GBXA 2P49B 3AREA 3VD4A 3VMPA 3J8F7 4LASL 2HKHH 1H9VA 4JFOB 4EI6B 1T1YB 4L3AA 1IAII 2BK8A 2NXYB 5C92A 3AS1A 2KL6A 5MEOA 2XQBL 2E7MA 2X41A 1E27B 4P2OA 1FVEA 4F7PA 1HI6B 2CUHA 2DD8H 2W9DL 4ZUUA 5BXFA 1JYXA 3DROB 5IROA 5I1JL 1UCBL 2H9GB 2F54B 3FN0H 4Z95H 2ICWJ 1J1XH 2OI9B 4FXKA 1MCRA 5GRWA 1OARL 5DF0A 5IK3B 2GTZA 2AXJA 2YRPA 3ROOB 1DLHB 4WWKA 1X4ZA 1FC2D 1MI5D 1F11B 3C2AL 1OAZL 1X5LA 4PY7B 3CFKA 3TWCL 2NX5B 4Z7NE 1DBBL 5D6DA 1WAAA 3H9YA 4GS7C 2BSRB 4ZUSB 3GSXB 1J1OL 4GSDH 3CJJA 3R06B 4L4VD 2HLAA 2VAJA 3S37H 4NJAL 3SGDH 3BDYH 4TTGA 5DA4A 4W68A 4PP1D 1DQML 5F9OL 1F58H 3KYMB 3C6LB 3WYRA 1IC5L 2VXTH 1T6WA 4QXUL 3JWOH 3KPRA 4V1DE 3DUUB 4CMHC 3VA6A 3BZ4B 2VZTA 5GSRA 2NXYD 1X6LA 4M00A 1JBJA 2ATKA 3UYRH 5JNYA 4F7MB 4PJ7A 4ZODA 7FABL 4ONOA 5I8KH 2D2OA 3N1PC 4QRRA 5CEXA 4DEPB 4QRPE 2ZUYA 3MRBB 3P9MA 4GRLA 1JIBA 5IBUG 4H8WC 4FRWA 2Y5TB 5FDWB 1QFOA 3MXVL 1Z5LA 3K7UA 1FO0A 1S9KC 1W8NA 4WUUA 4MVBD 4TSBL 2X4UA 3TZVB 2ATKB 1B88A 1U36A 3V52H 3DUSA 3BIAX 3VFUB 5J12C 5FO9A 3PGCB 1IEBA 4K94C 4UDUB 3ME0A 5I8OH 4XHJD 1FO0H 3CUPB 1YEIH 2I07A 3KYMA 4UUJA 4HJJH 3QUXC 1U41A 4PJIE 3NN8A 1PKOA 2DD8L 3VRJA 1IAKA 3ARBB 4HLZG 1GPOH 1LILA 1B4RA 4G6JL 3A6CH 2JB6B 4WI4A 1OAXL 1TCRB 2FR4A 5CJ8A 3IVKB 1I3GH 4HPOH 3HI6H 4CU8A 1CBVL 1U8NA 3BP5B 4X6EA 1CGVA 1MY5A 5T3XE 1XGYL 2CGRL 4PJDB 5B22A 1UWEH 4NBXB 3UPRA 3SDYH 3V7MA 3RZCD 4L4JA 1I3RA 2DL2A 2OR9H 5FIEA 4CAGA 1C5BH 4PRNA 2CK2A 5DJ0A 4PRPA 5F6IC 4P5KA 5GGTA 1TQBB 4DN3H 1HOCA 5L8JB 2H1PH 5EU4B 1I9JH 2AGJH 3GK8H 4HC1H 1X6NA 3MBEA 3BJLA 1NC2D 3LS4L 4YHPA 5FK9A 5TE7L 5EUOF 3BGFB 3GMRA 5K9OA 1P6FA 1P9MA 2FD6L 4FQIH 4B5EA 4X6CA 3T2QA 4Z0BL 4M7KL 3O3BB 4J6RL 3VXOB 1L7IH 3BIKB 4OT1L 1UYWH 3I6KB 4JCLA 4ZYKA 2JKXA 1UACL 4RFOH 4NHUB 3HMWH 1CDGA 1I8LC 3SE4A 2HVJA 5TH2B 5T3XL 4G6MH 5J11B 1SBSH 2GY7B 1I7TB 1K3IA 1XIWD 2JCCB 5I15H 1RIUL 3HMXL 3OG4B 1MQKL 3GI9L 1J0YA 3OKKA 1G6RA 4L8DB 3PJSA 4HZLB 2P44B 1KELL 1YA5A 4AZ8A 4FTVD 1U8IB 4M6AA 1AD9A 2PYEB 4PJGB 1FP5A 3RWJB 1TVHB 4Y2DB 4HKZA 3KWWB 4O2EB 4POUB 3G08B 1UJ3B 1CT8B 1TFHA 3HI5H 1EO5A 4O9HH 4IIQB 4XWOD 3MRRB 1HEZB 1VFOA 5B8CB 4OD2B 5J57B 1CXLA 2NTSP 5ACZA 2AJXL 3ARDB 4JRYD 4L8SC 2VXUH 3EDKA 4PJXE 3KXFD 4KVCL 2WAHA 3BKCL 3ZKXB 1RK0B 3PL6B 3MGOA 5IQ7L 1FBIH 5IHUH 1ETZA 1JFQH 1N3NA 2AJSH 2XZQL 3I3EA 1KTLB 2YK1H 5EO0A 4ZFOL 4JFPA 3T65B 2Z31A 3UTQB 3ZZ1A 1AD9B 3I02B 4D94A 5C0AE 2UWEE 4LSRL 4Y89A 1OAUL 3WL9B 3ORJA 4PRAB 2ICES 5E8EB 1ZHKB 4WFGE 3BP7B 5IVZB 3SJVE 2D0FA 2VZSA 4JPIA 5FECB 2X89A 4LAJH 1XF5B 3P30L 3BZDA 3ARBD 4U1NB 2VZ3A 2VDPH 5F1NB 5KW9H 3PWUA 1S8DA 4RFOL 1LP9B 2R1WB 3LD8C 4NZDA 5C0FB 1JV5A 5FYJU 1OF2A 1RJYB 5JHDB 3SGJC 4H88L 1YNLL 2BMKB 2P5EB 4XPBL 2A83A 4TVPE 3RZCC 4HIJA 3LHPH 5L2KA 3REWB 4YDVA 1RMFL 1T1ZA 2V7NB 1ERNA 2I07B 1NC4A 4ENEC 5H2BB 4GRMA 2HJFA 1D5ZA 3PUCA 3L3JA 1M7IB 2I27N 2H6PB 3DRQA 3QXVA 5EZIL 3EAKA 3RHWF 5BRZB 1FL6A 3WIHH 2CD0A 3GHBH 5DK0A 1WISA 3TT1H 4BH8B 1RAMA 4WFHD 1LP9F 4C56D 2UV3A 2FBJL 4RIRB 3RZCA 1AKJA 4PRPE 2KZ1B 4F8TA 3QG6B 2AK4B 4ODVH 3VFMA 3L3OB 3RU8H 2EIBA 4KUZH 5DWUL 5KSAA 5EA0H 4JZJC 2WW8A 4P4KB 3KWWA 4O2EA 4UMGA 4FTVB 3TH2T 5HGBA 4CMMA 4M7LT 5DD0H 4P0DA 2VDLH 3FFCE 1G1CA 2FGWL 3RNKB 3CDGB 1AGDB 5CBAB 2GT9B 1HIML 3QUZA 2E5EA 2XTJB 4R3SB 1B6UA 5T3ZD 1QRNE 5EBMA 3KHOA 1DJSA 2ZOKB 4P3CH 1KJVA 4WTZA 4AIZA 4YGVA 2IAMA 4YUEH 1AXSB 2FLRT 5CJOL 4HLJA 1LK2A 4P2RB 1UEYA 3TNMA 2NQCA 3D85B 3BSZL 3U7WH 3OZ9H 2F74B 4PGDA 2APVA 5IEHB 3UBXG 1WBYB 3LKOA 3WKNA 3FFCB 3L5IA 3GIVB 4Z76A 5FYLH 4PBXA 3VFVB 3NFSL 2PTVA 3WUWB 3EOBA 2GAZB 4NUJB 1PG7L 2OZ4H 2X7LB 2AXGB 1KIPB 5EN2B 3IKCA 5CINH 4ISVA 1EXUA 4X7FC 5BVPH 5BW7A 5TE4L 1MAMH 3CC5A 3JUYA 3MRBA 4PJCA 3MGAA 4MXWH 1MJ7H 4LEOB 3G6AB 5CLWA 4JFDD 2AJ3A 5CJQL 1CDCA 3OMZA 4ZXBA 2LTQB 4KMLB 5EOCL 1JZ8A 4JR9L 3C2AH 1XGQB 1B4JL 4QXGL 3UTSD 2B0SH 3HNVL 3HZMB 5F9AC 1WUNT 3D3VE 3CDCA 4ONHA 5KOVC 1A1OA 3KXFA 2EDBA 3RKPA 1J1OH 2BSTB 3SDCD 3HTLX 2V5YA 3Q6GH 4JO1H 3WXWL 4O58H 3MFFB 2IQ9L 1T66D 1RV6X 4MA3A 2C3HA 2XZAH 3BQUA 3SJVD 6FABH 4XX1E 1SMAA 3GSUB 3GSWB 4MD4B 1JUFB 2XPGA 4YDLB 4HWNA 4K7PX 5E8OB 1WWAX 5GSVB 3JWOL 3C6SA 1ZTXH 1ZEAH 3ARGC 1BJ1J 4NFDA 5EBLB 5KJRH 1PX3A 2VLLA 4GAGH 1EHLH 1N8ZA 4D0CB 2ZJSL 1R3HA 4JDZB 1S9YB 4Q6YA 2HG5B 2EYRB 2X89D 5HHXL 3QULA 4FHBD 1XR9A 4M8QA 3VGEA 5FO8B 4PRHE 1U6AL 2C1OA 4ODWA 4OLUH 4CNIB 4O4YL 5HI3C 1WT5C 1EEZA 4KHTH 5BZDA 3WNOA 2NW3B 1MVUA 2OTUB 5EPMA 3GKWH 1U58B 2PR4L 3NCYS 5KG9A 1IGCL 1BD2A 3H7BA 5F9JB 3L5WA 5GPRA 1A5FL 1FV1A 3KPSD 1T04B 2UYLB 1MRDL 3Q2CA 1JUFA 5B3JF 2Z91A 2DICA 4M1GL 2B8OT 4W4OA 1A02N 3FFCA 3EYUL 2C9AA 5E4EC 2MSPA 1J8HE 2AKRA 4C83B 4LIQH 2NXZC 3H9SD 5DMIH 1SEBB 1UZ6E 3D3VB 3FFCD 4U1LB 2X4TA 1ZT4A 2JJUA 4M1CC 2AABL 1RK1A 4W6XB 4BUGA 4A6YH 5JR1H 4PJ8C 3K2UH 4K71B 3W11D 2BRRH 3MFGB 1D6EB 1KCSL 1FNAA 2DLHA 1CXHA 4MNQD 3MLUH 4HZLA 4ODSL 3IJYA 3WS6A 4L4VA 3LQAH 1EUUA 5B8CC 2Q6WB 2VTFA 1YECH 3F12A 2R0LH 4M6NH 3EJYC 3VFSA 1ZXQA 1HSBA 3CVIL 2NNAB 1LO2L 3B9KD 3KDMB 2I9TB 4HX1A 1ZK9A 4FFVC 4UDTB 5DHVB 4PGCA 5HPOA 5C6WH 5FV1L 4YC2B 5DVOA 4ZFZA 5ICZA 4L4VB 3CFEB 1Q9WA 2ITDB 5IBLC 4KJQC 3MLXH 3LZFL 3LV3B 2XV6B 4JAMA 2D03H 4NC1C 1EA9C 2BXZA 3CU1A 4U6XA 5F9DC 4R97B 3QEUA 1BD2E 4IMLA 4QRSB 1IAMA 4EN3C 4OV6F 1FZKA 3QFJB 1MCDA 3QA3A 4RCAA 4Y4HA 5E9DB 3CFIC 5HHQB 4QF1B 3OGCA 5JOPE 1A6ZB 4JY4B 1CU4L 4IRSA 4NKOB 5JMRA 4Z8FL 1LEKB 5GIRA 5FGCB 3TM6A 3V6FB 2H3NB 2Z4QA 5A2LH 4XBGB 3MA7A 4X6FA 1PDKA 5E6IB 2BVOB 3BGFC 3KPSA 4F7EB 1X5KA 3FZUD 1I7RB 4QRRE 5TFSH 3TH4T 3OPZH 4L8CB 4X6DE 3WSQL 2WM0A 1F42A 1C16B 4WI3A 4APQA 3HC3L 1AY1H 1U3HB 3SY0B 4PJEB 1OB1B 1A1NB 3U30C 1NMCB 1WVZA 1I9IL 1FSKB 3NCCB 2ZSVA 2W0PA 4YHLL 2A0LD 4P2OC 1LDPL 2XI9A 4Z6AT 4MAYD 3TA3D 1V8HA 2AV7A 4Y88A 4XNQB 5FV2A 2GK2A 1F4YL 4D0CA 4RZCA 5DFVD 2J5LB 3LS5H 4H1LG 1IGJB 3RWDB 1CZ8L 4HEME 3AAZA 4OFKA 5IQ7H 3D39B 2XPGB 1A4JB 1UB6B 3WIFB 1KFAL 4MDIA 8FABA 1ZT7A 4I9WD 3GMLB 2JELH 1XGUA 4TPRL 2DQHL 3WO4C 4TRPH 5DTFB 5C2UB 1G0YR 2Z92A 2QLVB 3RTQC 5E7FA 1GOFA 4GG8B 3R1GL 5CIPH 4E41D 4ELME 4LMQE 2VDRH 4HKXB 2XN9D 3TVMB 4JG0L 5JW4N 2ZNWA 5MEND 1KIRB 3MRMB 4S1SH 2FBOJ 3D9AL 5HYFA 4ZAKD 1XCQB 5L6YL 2NYYC 3HFMH 3VXME 1NMBH 2G9HB 1AFVL 3P3YA 5DRXA 1Y18B 1RZJL 3QA3B 2FYYB 3AU1B 4FQHA 1H15A 3FOLA 4A2MA 4KROB 1VCAA 4KK9C 2Y07H 3T4YA 3QEQA 2NX5E 1ZV5A 1H0DA 5D2LE 3B3IA 5EUOE 5CUSL 1TVBA 1HYSC 4PY7A 3DO3A 1HDMA 1K3ZA 1Z9LA 3VFVA 1KLGB 5JW4R 3GHBL 2P7TB 2YPVH 4OQ1A 4G6KL 1QFUL 1T03L 1A0QH 2GJ6B 5A2IH 1Z3GL 3IAQA 3ZDXF 3IU4H 5HYJE 4D0BB 4U1NA 3JXAA 1J86A 1BECA 3QUXA 4YK4B 4M03A 3LMJH 3IJYB 4K2UL 3AMLA 3QCUL 2BHZA 4JB9L 1G6RB 2ZPKL 1CYGA 4KGLA 2QKIA 3ARUA 1OLZA 1ZSDB 2MNUA 4YHOL 5DUPH 3BRGC 1I7UA 4KKBC 2A6IB 3EZJB 2G5BA 2VNCA 4OD3L 5E2TL 1F2XK 4GW5B 3T2PA 1T7YA 5CEZD 2IFGA 4NZJA 2FH8A 4BZ1H 4Z7WF 4JKLA 2VXQL 4V2CB 3TBWA 1OW0C 1RHHB 4BK5A 3U36B 3W9EA 4HK3J 4XVUC 1XGRB 1JK8B 4R0LB 4QO1A 5I16A 4XP5H 2J5LC 3BGMB 1T3FA 1DTUA 1KJMB 1OAKL 3WBDA 1A14H 5GS2H 5FYLL 1LE5B 4AEEA 3UPCA 4IMKC 1BQHB 4PJHE 2D0GA 5EPMB 4RZCB 2AJUH 5MP6H 3D48R 4NO2A 4LCCA 2YA2A 5L6YH 4FA8A 5DVLA 1W72A 2BDNL 5HVWA 1SM3H 1T4KA 1RZJH 2I5YL 5MI0C 3WE6A 4WV1B 1CFSB 3QCVL 4EDXA 3RGVC 4YX2H 3TIEB 4WI2A 3OSKA 5KSVA 5DFVC 3FRPA 3L1OH 3KJ4C 4ALAL 1BQHG 2B2XL 5JPMB 4OGYL 1IL1A 1WWCA 1M05A 4JQXA 3D2UB 2CRZA 3GHEH 4Q9QH 3CX5J 2GK0A 2W0FB 5ITBH 2EYSB 2JCCA 3T1FA 4D9QE 3BESR 4BZYA 1D6EA 1RUMH 5IVXE 3VXMA 3TH3T 1BPVA 1T03H 1A0QL 1CICA 3GMPA 4R0LC 2D31A 3T0EA 2NY2C 1RQ5A 1MNUH 3KNBA 3WHXB 4U1LA 4WU5B 2R0ZH 2BOBA 3F5WA 3GIZH 2L0DA 3ZO0A 1OVZA 4LHUG 1N0LA 2IG2H 4OM0L 2C3VA 3QDMA 4MQXC 3ZTNL 4GKOA 3R0NA 1XMWA 2W0LA 2AVGA 2VL5B 4WGWB 3TO4C 3S36L 2ZNXA 2D7NA 5FDWA 1VHPA 1HNFA 2DQDL 1KPRB 2GJZA 5I1GH 2NX5D 4KAQH 2J88H 4FXLA 3ULVF 2VDKH 4GAJH 1GIGL 2HT3D 5IG7A 4JPVH 4ZQKA 1GCFA 1OPGL 4XAWL 5FOBB 1NKOA 4LLDA 4K3DH 4L9LB 1VGEL 1SYSA 1NAKH 1KBGH 1TTFA 1YY8A 5AUMA 3WFCH 1LO0L 3CSPA 3SDXE 3B6SA 1T7XA 3ILPA 4LCYA 3P0VL 4J3SA 4WW1B 3QXAB 2GSIA 4M7JH 4K23L 4BA8A 1GGYA 4QRSA 1ONQA 3AS2A 3I9GL 3KXFE 4XAKD 3GSUA 1SJHA 4TSCH 1E6JL 1NBVH 1Z2KA 1LVEA 2MWCA 3MTRA 5FB8A 3TPUB 3ARFB 3QB7C 2RHEA 4N8CH 1MFDL 4HUUA 4HKJA 3SDAB 3DETD 2OL3H 3KPQB 1KCSH 4LLDB 4RMSA 3BRFA 3G6DL 4DWHA 2F9BT 1Y0LA 3OKDA 4J3OC 1ZSDA 4GH7B 4ZQKB 2W92A 2NY1B 3GMOB 1NGXB 1BZ7A 1CGSH 3MX0A 1IRAY 3VFMB 4GRLB 3MYJB 3N85H 1DBKH 1A3LH 3DVIA 4X9BA 4FP8H 5BZDB 3MMEB 4BFIA 2O5XL 1MCBA 4K55A 1IMHC 1UXWA 1XR9B 4M8QB 3HE6C 3DVFA 1AR1C 4YBHA 3CSGA 5EU3A 3V4PL 5D1ZC 1W8OA 1JHKH 5DC0A 3SO3C 1KJ3H 1KJ2B 2X1WL 4P59H 1MCNA 5M95B 5I18L 4ZPTB 4XPGH 3QUMA 5C0AB 3U7AA 2VDQL 2J88L 2X2YA 4EOWL 1HQRB 1O0VA 3K4DA 2X1PA 4OGXH 1LO4H 5ANME 4N0RA 5MEPA 3MV9D 3FB8B 4OF6A 1LK2B 4JPVL 3G6JB 1GGBH 1DDHA 3AM8A 1A6WH 1MRFL 5EZLA 2D9CA 3I50H 5KTEL 1BF8A 2QQLL 1D9KC 2A6KA 5GJSH 4F57L 3ULUC 3NCJH 1LO0H 3KPPB 4LCUA 4WCYL 2VR9A 2OX5A 4I13B 3X13A 4Y4KB 3SKMA 1YEKL 4EDXB 5HJ3A 4LLWB 1D9KD 25C8L 2OSLB 5SWSD 4HUWB 3R0MA 3D39E 4TSCL 4MJ6A 3VXUA 1E6JH 2XNAA 3HRPA 4QHLB 2B5IB 1CFNA 1DEEB 3G9AB 4LL9A 4OQTH 5IGXH 1IBGL 4YFDB 3EJYD 1VFUA 1BIIA 4ZO7A 4AQ1B 5LGKA 2VLJB 3ZKMD 3NPZB 5DYOA 2QSCH 4PG9B 4KZEL 2B1AH 4KK5C 3MRDA 2ZOLB 2ZCLL 5EBGA 5FF6B 5H35B 3E6FB 3KPOB 5A40E 1F90H 5GGSY 3TBVA 1N4XH 2QBWA 5ERWA 4AM0B 2C3WA 4WEUD 5ESVB 3SE3A 5C6TL 3TA3A 5HPMA 2BSTA 2IAND 3IKKA 4RFNC 1FG2A 1TQCB 5IKCA 3PWPA 1NLBL 3GGWA 1INDH 3DX8A 3PF2A 4NIKB 5I19H 3JTSA 4K7FA 3VFNB 4IRJD 3JV4B 5KZCD 1OHQA 2J2ZA 3UO1H 3FB5B 4KH2A 4D9LH 1EEYA 2GTWA 5BMFL 4KU1A 3SY0A 1OTTD 4UTBH 3RGHA 5EOQH 2NZ9D 3VWKC 3CCHA 1QVOA 3C8KB 3QFDA 1HWHB 5GRZA 4NQEE 4WWKD 1WCBB 4F15C 4ONGL 4PTUA 5I71B 4WTZG 4XCNB 3D0LA 4BFGA 4I0CC 2FNBA 2RFXB 5IBTL 3HE6D 4YHZL 2XTJD 3MLRH 4FFZH 2HH0H 2UWEA 3MPCA 4PLKC 1IILE 3CVHL 3MRPA 4H1LB 4UAOB 1EVTC 4IMLB 1QEWA 4DAGL 4N5EC 4NRYA 1H3PL 3L3HB 2IPKA 3EOYG 1YQ2A 3MRIA 4JHAL 1KEML 1S9VA 5D93C 5KVFL 2MKWA 1JWSB 5IMKA 3GSNA 1YPZE 3JWOC 3QWQB 3FB6A 2R2BB 1BEYH 4XMLL 4TOYH 4KFZC 4DGYH 3U1SL 1FL3B 4HS6A 1A6AB 3JVGA 2FJFA 2OMNA 5C0CB 4I0PC 4PUBL 5A43C 3H42L 5HY9B 1KIRA 3CGTA 1OAXH 2IQAB 2DQEL 2YUVA 3MXWH 1MHCB 3M8OH 5E99H 3BPNC 3MLSH 2EZ0D 4J3UA 1QNZL 1UWEL 4OGAC 5FHAL 4RRPA 4RFEB 4FQLH 1BLNB 5CD5D 4I77H 4TVSa 1WWWX 1G9ML 4TUJB 2GUOA 4ZPVB 5GRJH 5HSFA 4Y5XB 3ARGB 3LEVH 1LO3L 1IC4L 5IW6B 3MROA 4KMQA 1OW0A 3QHFL 1H5BA 3BPCB 3V0WL 1FIEA 3MV8D 4PJXA 3RWFA 2BSED 3BZFA 1KXTB 4J4PA 4M5YL 3TA3B 5HPMB 3TO4A 4XP5L 2HKHL 4XI5C 3P0YL 3Q48A 3B4NA 4U0RB 2DQTH 1RJLB 4QGYA 2RCSH 1KG0A 4KXZI 4N8PA 5DYOB 5KAQG 3NCMA 3VFPA 4V1DB 5C86A 2IGFH 4G6FB 3O41B 4AH2B 1DBAL 2AJSL 2APWA 2W9DH 4DZ8A 2IPTL 2G60H 4JLRB 4YHZH 4NCDA 2OTUA 1EGJA 3HPJA 4OI8A 2XNAB 3O6LH 4TYUA 3FN0L 5DLML 1OGAD 1F00I 4R90H 3CH1B 4JRYE 4IJ3B 1UG9A 3VWKD 5JPNB 3IRZA 3FHQA 1WT5A 1G7HA 2CR3A 5EC1B 1VERA 2BOCB 3WJJA 3L95B 2PO6B 5FYJL 3Q3GA 3LY6A 3TVMA 3TWCH 3KPRB 5IFAH 3ARYA 4OLVL 1MFBH 5HGDB 2G5RA 4IHOB 2VLLB 2F53B 1EHNA 3LKNB 2R2EA 5HHVH 2PYED 2LU4A 4NJAH 3M17A 4LSQL 3MGOB 3BDYL 1RK0A 3SE4C 1NGXA 2P5WE 1MHEA 3PIQA 2VIRA 3I3DA 5F88B 2QADB 4ZSOB 4H25A 1DCLA 5JW3L 3O3DA 3VU2A 4G5ZL 1T21B 4BH7B 4CJ0A 4NQSA 3RVXD 4APQC 4U1JB 5C08D 5DA0B 3KPQA 2FH6A 3EFFB 4HUUB 4DOHB 2V17H 1QFHA 5D7IA 3TNNA 3MGTA 3OAYK 5E8PA 5J9PA 1QLEH 4MNGE 1Q9OA 4YHYB 4NM8L 1D5MB 4ODVL 4R26H 1AGBB 4IRSC 5TPWL 3VG0L 5B38A 1VFAA 5ISZB 4M43H 5EC2A 3IDNA 4FQXD 1IQWL 1Q72H 2MHAB 1BAFH 3LKQB 3U83A 1CLOL 3F7VA 1D7FA 4UV7L 1EAJA 1G7JB 5DRNB 4K3HA 1FJ1A 4R7DA 2YMXL 4PJXF 4F7TB 2LAGB 1J0HA 4H0GA 2GITA 5GIRB 5L9DL 1HHJA 2HLFC 3RZCB 4OF5A 5IFHL 3GBMH 3ARXA 5E2UL 1RURL 3MLYL 1Q9OB 3KPMB 3AB0C 3AREC 3N1GC 1DVFB 4YAQB 2Z31D 3RP1A 5D96C 2IAMB 2I9LB 4MMXC 1AR1D 4R4FL 4P9HH 4XMKH 4XVSH 1PD6A 3MUZ1 3ULVH 1L4IA 4FQ2H 1NFDB 4UBDD 1FGNH 2FJGB 3VW3H 3CFBA 2E7LC 3FRUA 5GGRA 4HXAL 4F37K 4UT6L 5BS0D 1V3LA 5CWSB 2XZCH 2EIDA 3GK8L 1JPSH 1N0XL 3RA7H 4ONFH 2VUOA 5CJQH 4XPHH 1ULVA 3VFSB 4G5ZH 4HUNB 1WJ3A 3FQNA 3RU8L 3ZL4H 1FRGH 4UNVA 1JRHH 3B9DA 1T22A 3CXDL 3QEGL 5DD6A 1PEWA 4LSPH 1M05B 2LAAA 5EBWB 3BQUC 5DK0B 1MFEL 2PO6A 5CBEB 4XBGA 5ETUA 1YNTB 3NIGF 2FLBT 4Y4HD 4PJFE 4DUXA 2HA1A 3D18A 1JGDA 4JFPB 1LEKA 4B0MM 4RDQF 4U31A 5GGQH 3W0WB 4FQ1L 5IWLA 2FSEB 3X12A 4PJ7F 2D31B 2WLYA 1B3JA 1MQKH 4OF7A 4X5XB 2J8HA 2VH5H 4XC3H 1EFXD 1XH3A 3ZHLA 4ZTOL 4YJZL 4PG9A 3O41A 4S1QL 3UJJH 3QQ9C 2E9IA 4ZFOA 4QHUA 5GRVK 4G8GA 3PWUB 4MSWA 3HZVA 1QO3B 1J8HA 2XKNA 2FIRT 3OBAA 1T1XB 5IM7B 1LEGA 5ICYB 4XBPA 2W38A 1WEJH 5D7SL 1MCQA 1U8LB 1NJ9B 4G9FA 1QP1A 5I2IB 4H5SB 3G5YB 4LOUC 1WAAF 4TUKH 4U7KA 1AXTL 4U0RC 2G75B 3WE6B 3IFNL 3RVUC 4BKLA 2O5ZH 2I26N 4BELD 1MOEA 1KNOB 5CFHA 35C8H 1P4IL 4GKZB 3PQYD 3CMOH 3ZT6A 1KCLA 4UTAH 3LN5B 2ZSWB 1N6QH 1NLDH 4P9HL 1CE1H 1CXKA 1CD0A 3NIFE 3U9PL 1GZQA 4OF3A 4GG6B 4KK8C 1IAIL 32C2B 3SE3C 1DDHB 2JJTA 3WNMA 5C2BH 4LSDA 5ABDE 4HUXB 2WIIB 4XNXH 1E28B 1A6AA 4HS6B 1N59B 4ZNEE 3KPLA 4TUOB 1OARH 1I8IB 4E41A 1L6XA 5HD8D 3RJDA 1UKQA 4ORGA 3LDBC 5MEQA 2COQA 2DDQH 3ES6B 4FTVA 5HGBB 1AIFA 2HFGH 2X6MA 1M71B 5EU7C 3M07A 4L1HA 1N7ML 4GAGL 2F54A 4Y5VA 4JM2B 2BNQD 1DEEA 1H15B 2YBRB 4FQHB 3PWNB 4MB5A 3IDYC 1JI2A 5IIEB 5IB5A 3SE9H 2ZUVA 4P2YA 2HH0L 2N4IA 1AQKL 3GRWH 3ZSTA 5EWIL 3QPXH 2GJ6A 4O2FB 3MLPA 4LSUL 4PP1C 3PL6C 4WFHE 3LSOA 4NDMA 3BT2H 5AAMA 3PXHA 4MNQE 2VXSH 4YXKH 4Y2OA 4DAGH 1IFHL 2CDGA 2ARWA 2F74A 5KVDL 2ICEB 2X4RA 4N8VG 2HMID 3UZVB 4DQOL 2ENYA 2FZ3A 5C0CD 3O8XD 4EBQH 4YZFE 4XVJL 3U1SH 5H8DA 1JFQL 1UCBH 4TNVK 3PNWB 2R2EB 3F7RA 1U8QB 2E6PA 1MREL 3SN6N 1FZMB 1WQVT 3G5XA 3RY6A 1DL7L 1YEEL 1AGCA 4G9FE 4ONHB 2D4FA 3RWEA 3IJSA 1IVLA 2E6QA 1U8MA 5HVHC 1HILB 3QDGD 1VEOA 1CE1L 4JRXD 1MEXH 3U2SA 1DQQA 2R0WH 1V5JA 4OFYA 1JTOA 4UZGA 5E5MB 4E42B 1DBBH 3JWDC 2A74A 2VZVA 4G8GE 3KLHC 1DUYA 3BPOC 2VDPL 3O6ML 2NY4C 3D0VA 4CGTA 3WFBH 3UTSA 5HI3D 2DQIH 3HE7D 3IETA 5IT2H 4OSUH 1YNLH 4OZFA 4BSVA 1F58L 3QG7H 1IM9D 4IRSD 2WLZA 1CFTA 4Q2ZB 2F58L 5E2WH 4YXLH 3GJFK 1YUHB 1A6UH 4PJFA 3V6FA 3O2VL 2Y36H 3MJ6A 5FYJD 3TYGH 2HKFH 3GI8H 3F62A 4FZ8L 4Q74A 3INUL 4TNVF 1T2QL 4P4RB 3I2CH 5ESAA 1KULA 4CN1A 3MJ8B 3QDJE 4MNQA 3BUYA 5DJ8A 3U7YL 4R6UA 5HVHB 1UB5A 5DJ2A 3SHSA 4M62H 1CXIA 1FYTE 1MELA 2VDRL 4GAFB 3CFEA 2E9JA 2QQNH 1F6AB 2VXSL 5I73C 2EEAA 1J5OL 3RTQD 4NWTH 2DYPA 1NH6A 3B9VA 5ALCL 1LMKA 3DX7A 2FEEL 2QADD 1FJ1B 2YEZA 4JY6B 2ARJQ 1T89C 3R8BB 2LU3A 4L8SA 4N9GA 4JREC 4GAYB 4RNRA 4WY7H 5TH2A 5KSAB 4Y19A 3T0DA 1Z9SA 4LP5A 5KSAC 1SBBA 1FGVH 3VXRD 4NRZA 1NCDH 5SWSB 2GJZB 2X1OA 4OUUB 5J11C 3BPLC 4P2OB 1CD9B 4ODHH 4YDKH 2VL5A 4HHAB 4ZO6A 3RWHB 4X6DB 4E41E 3S3PA 3BXNA 3GSXA 2W0KA 3BOVA 1NFDE 3O2WL 5I71C 2A1WH 3UTPD 4KROD 4GKNA 4E0RA 3KJ6H 3VXQB 2HFFA 1F3RB 3OKNB 2A6DB 3G04B 1J8HD 2EICA 4PJBA 4BZ2L 4OCYH 1VKXA 3TCLA 2UWEF 1MF2L 4KQ3H 1EFQA 2F8OA 4KQ4H 1V05A 2HFTA 2E7LA 4PGBA 5HGAA 3B5HA 4X7CC 4MAYB 4HWZB 3TVMD 3MLZL 2Y7QB 1CLOH 1ZLUH 5CP7B 2BZDA 1BD2B 3H7BB 5F93C 2YA0A 5F9JA 5F6HI 5L7XH 4Y5YB 4F9LA 4IDLA 4RMWA 5IB4A 3AFLA 1S9XB 3PV6A 1L7IL 2L4OA 4L4VE 4M1GH 2AS5M 1SY6L 4OB5L 4X9GA 4LDLB 3ZKXC 5DVKA 2Q8AL 4U33A 5I1CL 3SCMC 5ESAB 2X4TB 1UZ6F 3C87A 4PPTA 1F3JA 5HYJD 5DS8A 4UUJB 1VKXB 3O3EB 4ZXBD 3KAAA 5FUZL 3S88L 4IOFD 2V5RA 5LJYH 3GJFB 4AT6A 2Z93B 1BFVL 4JKKA 5EU7E 1J0KA 2KPNA 5FYJE 3PP3K 2CO6B 4X4MA 4Q6IB 1JHLH 1R3IH 4OIAA 2QV2A 3REVA 1IGFL 3H3PL 4JFYB 5SWZD 3U4EA 3CXHK 5FYKL 5KSBE 5CMAB 2VB5A 1CFNB 2E8YA 3DVNB 2W07A 2HRLA 4ESKA 2DJ4A 1GGIL 1C08A 1MFNA 1QQDA 4IIQA 3VFOB 2F5AH 1QR4A 1N0XH 2A6IA 3WO4B 3FQXA 5C08A 1F6LL 2OR7A 2BNQB 5F9WC 4OBRA 4PJGE 4G8FA 5I8EB 5F8QC 3EOAB 2FCBA 2FATH 3CAFA 3UPRB 1HKLL 1WSST 3ULSB 4UT7H 3QJHA 5F1IB 1MJJA 3BP5A 1U0QA 5DGRA 4XP9H 4F33A 1H8OA 4HWBH 1R3JB 4XPAH 3RL1B 2XRAH 5T3XD 2ZP0T 3K4ZA 4MA3B 3FOMA 2O61A 1IJ9A 4FQQA 4MCYA 2JJTC 3T0XA 4HS8H 3DXAA 2AAVA 4G9DB 3FTGB 2R0KL 4L3EB 4QTHB 3TO4D 1JTTA 4L5FH 5C7XL 1VACB 4ODTH 1SQ2N 3T8XB 2WBJA 1BM3H 3LKSA 3MREA 3BVNA 2IPKB 3UX9B 4YR6B 3HZKB 1UENA 2VDKL 4OLEA 4ZTPH 5CJXC 4X7SH 5ANMB 3RY5A 2IANB 5DJYB 1UKTA 3IDJA 1NUDA 4EIZC 2R39A 3OF6A 5DMGC 2BNRA 2EEBA 1U8KB 2I5YH 2P8MA 4LLVB 3ZHKA 3STLA 4Z78B 3HB3C 4Z7WE 1AP2B 3H9HA 4NM4L 5FUZH 2VR4A 3OAUL 4OCSL 4DKEL 5D96B 4LKXA 4G42A 1R6VA 4L1DA 3ZKSD 2WWKT 3V0VA 1YMHA 1OWWA 1FN4A 1JPFB 2FJFB 3OB0H 1ES0B 2JJVA 2Q8BH 1BFSA 1T7VA 1RUML 1KB5L 4MDJA 5FDYA 1OGAE 4MXWL 5M94B 4AYFA 1MCKA 3LKPB 4XVUD 5KAQF 2QEJA 4XTRC 4X0KA 1I85C 2FX7L 3IGAA 1UM5L 4Y16C 4OFDA 1BF2A 5D7IF 2MQCA 2UY7A 3SKJH 5D7IB 3QQ4A 3VFWA 3HNVH 1GGUA 4NSKB 3B6SB 3ILPB 4PJIB 1T0NA 1MCWM 1ES0A 2V6HA 2AQ3A 2Q3ZA 4CADA 4M6OL 4PJEE 2HRPH 3ZMRA 2VDLL 3LD8B 5T1LB 2PW1B 4LGRB 4R96B 1A7OL 4CVXB 3BYYA 3SGEI 3HE6A 3PWPE 5CEZH 1WGOA 1WAAE 4S11A 3VFRB 3MOAL 1MAKA 1UA6H 2NY1C 4X4ME 4AEIH 4H8WH 3UTSB 1U3HA 2HTKD 1VEPA 1GIGH 2KKQA 2OBGA 5AZEH 1RZ8B 1P2CA 1RFDH 4ERSH 3E6HB 4YIQB 1GC1L 4A2LA 3JTTB 3U46A 5HXMA 4ELKA 1URLA 3AY4A 2PYEE 2ED7A 3QQ3B 3UCRA 3OF6D 1G7PB 5F7FA 4O2CB 3E2HC 5E6ZA 4PJAE 2Z31B 3EDEA 1U93B 4M61A 3OQ3B 5CS7A 3RBGA 1ZVHA 4KMTL 4XH2A 5L2KB 3U82B 5KSBA 1XGTB 5D5MA 1D6VH 4X9HA 3V5HA 3IF1B 3KPLB 5DD3L 4PJAB 3IB4A 2BHYA 3CK0H 3TV3H 4YWGL 1QFWI 4NM4H 1NMAL 5LGHL 3LIZH 2QQKL 3EYFA 2GCYA 2JELL 3GJEB 4JZJB 1OF2B 4K2UH 5JHDA 4TPRH 2FB4L 2W65A 4HPYL 3T1FB 3QDJD 4J1UA 4YDIL 5J3HC 2JCCF 4WWKB 3W5MA 5ILTL 5EOCH 3D69B 4FABL 1YEDB 3B2UC 3QXDA 4Z0BH 4BSWA 1ZHKA 5AD0A 2NXYC 4Y4KC 1NC4D 4PRID 3KVQA 3TVMC 4NGHH 4M9OA 1RZ7H 2WMPA 4CKVX 5DJZB 1H3GA 3IXAB 5DHYA 5KZCB 3P9LB 3ESUF 1XIWC 4PJ5B 2XICA 5FEBA 4AMKH 1DVFC 3SKMB 2EDKA 3ZTJH 3KPRE 3LKRA 1JRHI 3O9WB 5JDSB 3E3QC 1FNHA 5D1QD 4F2MB 1OGAA 5E6YA 2Y07L 4I4WB 4YBLC 3WFHB 1I7RA 4GJTB 2LFGA 4YXLL 2CDEA 5EZLB 2EC9U 3HE7A 1HINL 2DTSA 1L0YA 4PRPD 5F96H 2FIKA 2YS4A 1NC2B 4PV8B 4XC1L 2EDHA 1UVQA 2ZCHH 2GQHA 3S3SA 1CK0L 1ZLUK 3ALWA 3LHPL 4H0HB 1UJ3A 3U7YH 4D9QD 1A6TA 5DURB 3ZDXE 1F2QA 2QR0B 2ITCA 3VXRA 4WRLA 1CG9A 5SX5H 5KTEH 5GRYA 4UB0H 2QQLH 3BGAA 43CAA 1WCQA 1CGTA 1MCHA 1LK3L 2BVPB 5GS2D 4UQ3A 3FQUA 3N1MC 5IB4B 3JTTA 3F6IA 4HULB 5SV3A 1X4XA 1SYSB 1FPTL 2CKBL 3MLRL 3NZHL 5HVGB 2VJXA 3C09C 25C8H 1TLKA 4K3GA 3FO9B 3G5YA 4LIQL 3B9AA 2R69L 2FB4H 4PRIA 1MJUL 3GM0A 1T83A 3EYVB 2BVEA 3OB0K 1IKNA 4UNUA 1YEGL 5IJVB 4HJ0D 5GZOD 2YKLH 1TVBB 3RY4A 4FFYL 1OM3L 4LLUB 2EH8L 3RAJH 3A67H 2MCPL 4LHQB 4NGHL 3ZE2F 3AXLB 3FOLB 5JIHA 4DK6A 5D7LA 1CGWA 3ET9F 5KSBB 3SEPA 1F8TH 1KTDA 2CXGA 3KXFB 1LGVA 2OS7A 1FNLA 3B5TA 4EVNB 5FYLE 2BVQA 2OQJA 4QWWC 4WHCA 4JFHE 3CNKA 4Y19B 3ARDD 3BPLB 3ARWA 4JFQA 2K7PA 1MWAH 1G7PA 2FECL 1HHIA 4KK6C 2NY2B 4JO3H 3S34L 1S5IH 2A9ML 3LEVL 1NGQL 3BN3B 1SEQH 3C9NA 1XEDA 4XXDB 1DN0B 1U58A 3HAEB 4N0UB 4NQXA 5JUEH 3CDYA 2YPKB 1S7WB 1MFCL 4HIEB 4Y5XC 4KRMB 4X4YA 3C09B 4HH9A 4PJ8B 1YYMH 3F65A 3O11B 4X7EC 3OG6B 4X6CE 5B38B 3L7FB 2OL3A 2DKUA 2HG5A 2XTLA 1OP5K 2OJZL 3CFBB 1I85A 3OKMA 3V4UH 4M48L 1KJ2L 5A3IC 4U6YB 3OJMB 3MUHL 3P4NB 2X70A 3UJIL 3K74B 5I1IH 2AV7B 3CDFA 4K07A 4NNYB 4YDVB 3BZFB 3KNBB 3H3PH 1D5IH 5K93A 1MCCA 3KGRA 3HNSL 1JN6A 5E1AA 1K6QH 3B8YA 2CRMA 4JKPL 4RA3A 5BOPA 4HMDA 1VGKA 4IOFC 1UT9A 4ZUSA 4ZPVA 1TITA 2Z8WC 1FLTX 3ULVE 2YD3A 4OLZL 1FVDB 5CUSH 3X11A 4R4NC 1UM4L 3QUZB 4KI5F 2XWBA 5HHME 1BVLA 3VXNB 1Q9LB 5J0BA 1JGEA 1KV3A 2IH1A 1FIGL 1I1YA 3MXWL 3KPSB 4F7EA 5I76B 3MNWA 1AJ7L 4S2SB 1YEFL 3TYFA 1YQVL 4NNPL 1ZA3A 4EI5D 1L9MA 3MRGA 4Y8DC 4KHXL 3PP3H 4K8RD 5GGVY 3L3IB 4P9ML 4TSAH 4PS4H 3FT3B 4D9RD 5IIEA 3W5NA 3U0WL 4HK0B 1QBBA 5F7MC 4N1CA 4OLUL 4X80L 2B7DT 1RVFL 5BV7C 5D1ZB 1I8LA 2EDOA 3PL6A 1DE4B 2LU7A 4YHNB 3GKWL 3UXFA 4D0DB 1BGXL 3TFKD 4UU9A 3L3DB 1KUMA 3P4OA 4PJFF 1Q9WB 3QIWB 2CDGB 1DUZB 4AT6B 3UTTD 4ETYA 3QNZA 3SOBH 1K4DB 2IEPA 5J13B 1ZGLM 1AQDA 4ZSOA 3RWFB 1PY9A 2BY2A 3FO9A 4Q58C 5F70A 1A4KA 5DLMH 2OTWB 4N0YH 4PY8I 4HWUA 3PHOB 2O93L 4PP2A 1JHTA 2NR6C 2NY6C 5JOFA 4Z5RB 1P84J 2CRYA 4Z0XA 1YY8B 4JFFE 5AUMB 4LNRB 5I1IL 2EDWA 2ZCLH 2YR3A 2BDNH 4S1RL 3RI5F 3RUGB 5HYSA 3HG1B 1NCUA 3P4LA 3QXTA 1WBZB 4GMTH 3CVIH 4PTTA 2YPVL 3MACH 4JKPH 4LLYB 2Q7NA 4JM2C 4LRIC 1KCUH 2C1PB 4P5TC 4U0QB 1IGTB 1X5XA 5T33H 1HKFA 2CLRB 3QCTH 4MZ2A 4F3FA 3PABB 1WF5A 5CZVH 1EJ6A 1ZHLB 3ULUD 1GGBL 3CH8A 5EOQL 1FV1B 2J6EA 1VADB 4S0TD 1A7NL 5TDNA 3IDIB 3PGDA 2IALA 3FQTB 3NCJL 2WBJB 4NFCA 4YHOH 1U91A 5D5MB 1MNUL 2VXVH 4XNUL 4ZUVA 3OR7B 4ZD3L 3RBSA 3LN4B 2BCKA 4WW2C 2AEQL 1UJTA 4XNYL 2VDMH 3OHXB 1E6OH 1KTRL 1R0AH 1FNEB 1YYLL 2DIJA 4Y4KA 1NCAL 3QSKB 4UOW0 1XCTA 2NPLX 3DARA 5HI4D 5CSBA 4N0UA 3FN9A 1V7ML 5JZ7D 3ABZA 5ELIA 3GJFH 3O2DH 3ULVD 3UTZB 1B0GA 2NY5H 4GW4A 1MCJA 4MLIA 1YN7B 3VD9A 1SM3L 3VGFA 4HJ0C 4I3GA 5HDQH 4ZUVB 4JZNA 1K4DA 3KS0J 4QRTB 1QLRB 4ZYKB 1HH9A 5HI5D 5LGHH 5MHSD 1KN2L 4NN7C 1HQ4B 2R4SH 5FHBL 2YD7A 2Q76A 2EECA 4YHKL 4OJFH 1MCPH 1MH5B 2HMIC 3S3JA 5T3ZE 4K23H 4I0PB 5EBWA 5C09D 3BKJL 3ZYJA 5IJVA 1AXTH 2PO6D 3DHMA 5I75C 3IFNH 4ZFFA 1HOCB 1PZUB 4TULH 5T33L 4XCFL 4XNMB 4LHUD 4JN2A 2R0ZL 4JM4L 4PJ7B 2OLDA 1H8SA 2NY5C 3G6DH 4AQOA 1KC5H 1C5DA 4JVWA 4PTUB 4LCCC 3QIBD 4JN1H 2IG2L 4G6AC 4IIQC 2Z9TA 2BVQB 1MCOL 2O5YL 4YBQC 4G6FD 2H45A 3U4BL 4JY4A 4F7CB 3JWNC 3HRZA 1QLFB 3QXUA 4OKDA 3DX9B 5ISZA 5DJ8B 1LD9B 5DMYA 3MRQB 4RAUB 3OJDB 5I1KL 3TBTA 1H8NA 4HSQA 4XNUH 5HYEA 2V2XA 1KCVH 2GSGA 4NC1E 1X4YA 1AY1L 1AXSA 1XT5A 2P48B 3VH8G 3GGWB 5CILL 2ED9A 1SMOA 4FG6C 1RUKL 3QFJE 1GAFH 4M3JA 3PWLB 4YHLH 1KENL 4GW1B 1DBJH 5TQ0L 4L3CA 4LF3A 5F71A 3BWAA 1XF4B 1CLZL 2DLEA 4LHJB 3P0VH 1NAMH 1NFDF 1RHFA 4JRYB 2HP4A 4ELMB 4DGIL 4XMPL 3DV6B 4GXVL 2EXYC 4MCZA 3NZHH 1G9MH 3ULUE 4GBXD 1FCCA 2A77L 3QPXL 1WZLA 2XOTA 5C0IB 3W9DB 1HI6A 1TJHH 3CFDA 1F02I 1UWGH 1W0WA 2YBRA 2XWJB 4G8FB 1DANT 1T20A 2CPCA 4YHKH 1BZQK 1X7QB 1J05A 3FB7A 4GG6F 4WI9A 2BFVL 3DI2B 3P0YH 1KIQA 2E7CA 1RK1B 1NLDL 3OXRB 4GG8A 3RGVB 4HBCL 1KXVC 3D69A 1T1ZB 5D70H 5JXAL 3WHXA 2AKRB 4C83A 1AHWB 1R5VA 3CFCL 4OFPA 4P46C 1OL0A 3K4AA 1RZGB 4K94H 1OLLA 4L4TB 1YDPB 3EYSH 2G60L 4WO4C 3LRHA 3THML 2ADGA 4IRZL 2OXHA 1Q72L 2P47B 4CVZA 3NOIA 1JPGA 4OZFG 4RAHA 4MHHI 4ZS6D 2FO4B 1V7NH 5F1IA 4UT9L 4XP4H 2M2DA 3P4NA 4WO4D 2R0WL 1A1OB 1IL1B 4OV5A 4KKAD 1G7QA 5GGUB 5HYQA 2PCPA 3VWJB 4HMCA 5HHMD 4PRDA 5FYJH 1P4LB 4NP4H 5DJDA 5DMJB 3ZE0F 4AY0A 3BPOB 1C5DB 2V5TA 3L7EA 5D93B 1TJIH 3FN3A 3KR3L 3QPQC 2AJ3B 3DGGB 2FX8L 1T4KB 1F4AA 3DURA 1JYVA 1PY4A 2GEEA 4X83A 5EO9A 4KRNA 1SJVA 4P57A 1UFUA 4QRUB 1NANH 3WJJC 4TQEL 1WIOA 4HWEH 4F58H 1BX2B 5D5MF 1V3JA 4KVNL 4ISVB 3BT2L 5L2KD 4ONGH 4U1KB 4NC0B 3RIAF 4IDJL 1U8MB 3W2DL 5FOJA 2OQJB 4JFED 3F8UB 1CF8H 5SWQB 4FFZL 4JVPA 3WD5H 4WVRA 5FB8B 4L9DA 2EE3A 4ONFL 5JA8B 3RX5A 4Q9RL 4Q6IC 2VLKD 4DKFL 3C5ZA 4ZMAT 2CIIB 3VXTA 4V1DD 1QEWB 3LB6D 5MENB 4LAQH 1TNNA 4MQTB 4YE4L 2DJSA 4Z5RA 2BFVH 5F89A 3A6BH 3S36H 2DIAA 2QSCL 2WBKA 3CDGA 3QZWB 3EO9H 4J4PC 5FA4B 1NFIB 1W72H 1FGVL 5I1DB 3P9LA 5IQ9A 2QQQA 4S0SD 4GG6E 4FQXA 2XTJC 1T0MB 3FKUS 2NY4B 3TIEA 4G3YL 4O5LL 3HCVA 3EO1A 1S7SB 4Z7UF 3SGJA 3QDME 3QWOB 3ARGD 2VH5L 1S7XB 1MLCB 3WJLC 4XP4L 4HMEA 4PGZA 3WN5C 4UTBL 3S5LA 2WIMA 5GRJL 3E8UH 1QSEA 1FL5B 4I0PD 2VE6B 3MJ9A 1HZHL 5D7SH 4XMKL 4HHAA 5K9KA 1Q38A 3INUH 3V5HB 5EUOA 1HCFX 2X4PB 4WU7A 3RUGE 2V7NA 2ID5A 4F9LC 4HXAH 3T0VA 1SJEA 1I4FA 2UWEB 1AGDA 4KUCF 3GM8A 4F58L 3U0TB 5CD3B 3K80A 1I3RB 3NH7L 2P46B 4UTAL 4M5ZH 2VQ1B 3U4AA 3TC9A 4PLOB 3HHRB 1IM9A 1G7JA 5FCUL 4R9HA 3NIFF 4Y1AA 3O4LD 3EOTH 3QG6A 2NW3A 5LKNA 4NQVB 3N85L 2VAAB 3P0GB 5HYSG 4MWFB 2BRQA 1CL7H 1VFAB 4TN9A 2DMCA 1HHGB 3BMWA 2O5XH 3MV8E 1N5YL 3GFUA 3RQ3A 1HILA 1RUPL 3ILQC 4Z7WA 3OKOA 1GOGA 2XZZA 5AD0B 1HQ4A 4PB0L 4UQ2A 5HDOA 3KYAA 4XC3L 3EGSA 2DN7A 3VD5A 5I18H 3O2WH 5LGJA 4ZG1A 1VPOL 3P4OB 4KK8D 3SDXF 2D7QA 1MWAB 5DT1H 1KEGH 4ZO9A 3MRCB 4I0KA 5TE7H 1AC6A 4K9EL 3MV11 1U95A 12E8L 3MO1B 4XH2B 4M7KH 3MLTA 4GT7A 3LQMA 4DCQB 4M61B 2V17L 4HT1L 1U3ZA 3V5DA 4KWUA 2EDRA 5F7WC 2MTPA 1X5IA 5D8JL 5HHNB 3BD5A 1KGCE 4UI2A 2FO1A 1Y6NR 3ISWA 4G6ML 2NY5L 4PJCF 1TZGL 5FAAA 2VYRE 1PZ5B 1OP9A 1QPXA 4EDWL 4MJ2A 3EYOB 5FYKD 4QTIL 3HPJB 3QDMD 2FDBP 2B4CC 3GSOA 5I1HL 1DBKL 3F7PC 3DV6A 4Z77B 2GI7A 1TCMA 4R90L 1DL7H 5T5NG 1IAOA 3HI6L 5TDPB 1L9NA 5C08E 2EE6A 3S88H 4Z18A 4I18A 5JTWA 5DEFA 3LKOB 3H0TA 3QIWA 4NQCD 3EOTL 2AP2A 5L9DH 3TPUA 2C4XA 5CLTA 2HFGL 1BQSA 2CLZA 3GB7A 4XNQA 3HUJE 3V4PH 3ALPA 4Z7VE 3IAPA 4MNHB 1I9RH 1ZHNA 5DZOA 1I1AD 1J88A 4NQUA 4OSUL 1MJJB 4I18C 1RD6A 3MBEB 4PJHF 4HG4J 5BXFB 4HC1L 5DD1L 1YEJL 4NQVA 2X1XR 1I7ZA 2C26A 3HC0A 1FVEB 4HBQA 5D6CA 3GRWL 3RWGB 4PJBF 2AXHA 1FZOA 5EIIB 1N5AB 1G7LB 2X4SB 5DQJB 2P5WB 5HVFB 1ED3B 4JE4B 4KKCD 4MXVF 4X6FB 1XF3B 4FZ8H 4UBDC 1T2QH 3OKEA 1NJ9A 1JGEB 1ORQA 3UAJC 3O8XC 4NKIH 2ORBL 3MCLL 3MLWH 4U1MA 2R29L 4YHYC 2R9HD 5HYIA 1INEH 1BWWA 4RAVA 4LLVA 3LQAC 5H94A 5KVDH 2K3TA 4XP6H 1FZJA 1IC7L 4PV9B 1A6ZA 4JPWH 2YZ8A 2FIKB 1KLUB 2ICWB 1EGJL 1YMME 2IANA 3CXHJ 5DJYA 3ZKNC 1IQWH 3D39A 3ARFC 1WC7A 4RGMC 3DYMA 1MH5A 1MIEL 2XXMB 1MREH 1HHHA 1KB9K 1OT2A 1FFNB 2XY2A 2X70B 2H2SD 2YC1A 4JHAH 1QBML 4YHPB 3RX8A 3MOAH 2C7UB 1H3TA 4QHNA 3DMMA 4QY8B 1F3JB 1T5WB 4Y1AE 2CKBB 1IM3B 3T0WA 3CLFL 1MEXL 5DHVA 1A3RL 3ILQD 4NRZB 4OIIH 3WFEH 4XMLH 4EI5B 3RVVC 3EZ8A 1KYOJ 2J6EH 5BZWB 2EIZB 3KHQA 3RWIA 5IW6A