4XHJD

Ghgl of varicella-zoster virus in complex with human neutralizing antibodies.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
224
structure length
207
Chain Sequence
QVQLVQSGAEMKKPGASVKVSCKASGYTFIGYHLHWVRQAPGQGLEWMGWINPNSGETNYAQKFQDWVTMTRDTSINTAYMELRLRSDDTAVYYCARGGMTMVRGVMMDWGQGTLVTVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKRVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A site of varicella-zoster virus vulnerability identified by structural studies of neutralizing antibodies bound to the glycoprotein complex gHgL.
pubmed doi rcsb
source organism Human herpesvirus 3 strain oka vaccine
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein H
total genus 27
structure length 207
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xhjD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xhjD01
3VGBA 3JWOH 4G80B 1EO5A 2W0PA 5DRXA 1NGQH 1U3ZA 3K1DA 4GRLD 3GI9L 1AIFB 5GISH 1OLZA 1FORH 2IQAB 5D70H 3WN5B 1FCCA 3P2TA 4YGAB 2OMBA 2QSCH 1DN0B 1LEKA 5CSBA 3VCLB 4KRNA 3HS0B 4WUUD 5GGSA 2R39A 1MLBB 1I7ZB 3MLPA 1FIGH 4WHDA 1JP5A 4JB9L 4ODXA 4ZUWB 3RTQD 2OTUB 2D7QA 1GZQA 3QNYA 1MJJB 1CFTB 4IOFC 1M05B 4MNQB 4HIHB 5AAMA 5EO9B 3O9WB 3VXSB 3QB7C 2QSQA 3JV6B 2AKRA 5F7DA 2VQUA 1KJ2L 3RWIA 5DUML 1S78D 3BUYB 1A6WL 1LO4L 1AQDB 4P5MB 1RUKH 1XH3A 2LU3A 4BQCA 1SYSB 1UEMA 4NZDA 1U58A 1P2CA 4FQIL 5MI0C 4MS8C 5GGUA 1GGCL 2VC2L 3TYFA 3QDJD 5HGBA 4XC3H 2WLYA 1SBSL 2HFTA 5EO1A 1VPOL 4O4YL 1V7MH 4PJAB 1CGSH 1HH9A 1N7ML 4XMPH 5FGCE 1F4YL 4MXWL 3WIIL 2XWJB 3TP4A 3G5VA 1MCFA 1U8MB 5CJ5A 2APVA 1ZHNA 2WBJA 5TF0A 3O6FC 5EZIH 4MJID 2CRZA 4JREB 3NFNA 1JHLL 4GUPB 4XGZB 4N5ED 1MF2H 3RWJB 1D5IL 1TMCB 5T1LD 3CUPB 4JQIL 2Y6SD 3RVTD 3RBGA 4N68A 1S7XA 4K3HA 2Z9TA 4TVPL 4QWWC 3ILPA 2CIIB 2W60B 3BO8B 2ZUYA 1ORQB 2PTUA 4OUUB 3U0TB 5IFHH 5ECJE 1LWRA 4CMMA 4NPYA 4JCLA 5KW9L 4YE4L 3MV7A 1U6AH 2AJUL 3P9MB 2QADD 4F57L 1OAUH 5KG9B 2A1WH 2K7QA 2X2YA 4QOKE 2ZOKB 3HE7C 5C08D 3HNTH 3J8F7 4XAWH 3D0VB 1FAIL 4N8PA 4QHKI 1XGPB 4WFGD 1G7LA 3DRQB 1I8LA 1NLDH 3L95B 5A3IC 5J3HD 4P49A 4ZFFA 4BZ1H 1OSZB 3Q1SL 3RU8H 2CO6B 4M3KB 5C2BH 3BXNA 4IHOB 5I8CB 5IB1A 1FIEA 1Z5LA 3L95A 4KC3B 1PLGL 1KCRL 4NKOA 5FUZH 3V5HB 4TUJB 5L2KD 1CGYA 4OCYH 2GTZA 4RMSA 4XHJC 1MWAH 3O6FA 5HDOA 3ARRA 1MSPA 5H2BB 3O3DB 4LSSH 1IGYA 3QCTH 1MFAH 2J5LB 1JYNA 4LPUA 4NKDB 2VKWA 1VACA 2FB4H 3LKSB 4F7TB 1KB5L 1MRFL 5HHOE 5ADPL 3ARBC 4XPHL 5CJXA 1A2YB 5I6XB 1IQWL 3MJ9A 2IANE 4GSDH 5HD8C 3MNZB 4XP9H 2YSSA 1JGVH 4MX7A 4NDMA 1OAXL 4POZC 1R3IH 3H2WA 5T1MA 1NGPH 3DX8B 4CJ1A 1OM3H 3MACH 5IIEA 5IV2B 1CXFA 3ZYIA 4WDIA 4OLWH 1FBIH 1OY3B 2IADA 1IC1A 3RTQA 3WMSA 5C8JA 4NQCB 1FFOB 4JFHD 1HQ4A 5GRVK 2I07A 4JHAL 4P57A 3KPMA 2XQBL 5CLWA 4OZFG 3DO3A 5J3HC 4DAGH 5A3ID 2A38A 1RJZA 4U1GC 5CJXC 1HI6A 4JQVA 2VYRE 4Y5YA 3BPLB 3FZUC 4EQ2A 1NGWA 3HE7B 5D96B 5GGVY 4JJ5A 4YFEA 1QSVA 4HMDA 4LPXA 3PWPB 4GW5B 1IM9D 3EHBC 2DQCH 4P59L 1I1YA 2ICWI 2VABB 4KROD 4RMUA 4IJ3C 4JFPB 1OPGH 5J8OA 1CU4H 3PWJA 1NAKL 1INEL 1EFXB 1LO5B 3WKMH 1HHHB 2AI0L 4NJ9H 5A2JH 1HHKB 5IESH 1BPVA 3QQ3A 4KVNH 2VXVL 3QDJE 3QPXL 1W72L 3CX5K 3I6LE 4QTIL 5BW7A 5EU4A 4JAMB 4YUEH 1QQDB 2QQKH 4Y5YB 5BXFA 1MLBA 1C5DB 4HCRL 4MDJB 3BPCA 5CGTA 3D85B 3QFDB 2FLBT 3RUGB 4TOYL 5FHBH 2XTJB 3MRCA 1A9EB 1DEDA 3NABL 2OL3B 4R9HA 3LRGA 1KSRA 2AABL 3LEYH 2CLZB 4OUOA 3CCHB 5EZLB 2W0LA 3GSRB 2O5YH 2A9NH 3RWHA 3T0EB 5GS2H 3A6CH 2XZAH 1PG7W 5IEHA 5E5MA 1H5BB 3JV0A 1OT2A 2GTWB 3QJHA 3ARGD 4MAUH 4WWID 5GGUB 4NCC1 1EEYA 3PABA 3LN4A 1KENL 1YEJL 4I3RL 3SKJL 1WGOA 5T3XE 2YBRB 3DUSB 4HPYH 5DS8A 5CIPH 3TBWA 5I76A 2JJTA 5MP6H 1T2QH 3U4BH 4URTB 1RIUH 3UTTA 5DD3L 1OAKH 5JUEL 5FYKE 4JRWA 4LVOC 1GZQB 1CLYL 2D7OA 4NFBA 1K4CB 4PS4H 3BKML 3MJGX 2NY5C 4HULB 5E1AB 1I4FA 2V5MA 5JOPD 1I1RA 1YEGL 2A6JB 4S10A 5GHWL 1UZ8A 2C1PB 3HG1E 1BWMA 1W72B 5K9OB 3DI2B 3N1MC 5E00B 2QKIB 2ARWA 2X40A 3AREC 4G8FB 3S37L 3TN0A 2PW1B 5DJXA 4EI5A 2O26U 4NNXA 2OZ4A 2R8SH 2OJEB 4G5ZL 2X4RB 4LOUD 3ESUF 3RZCB 3TN0B 5F9AC 2PXYB 5GISL 3TLRA 1T83A 3VRLF 1UM6L 3D6GA 3SDCC 4WI6A 5F3HA 3KLAB 1LP9B 4R26L 1Z9OA 4P3DB 1I9RL 5CHNA 2XIDA 1E0OB 3KPRB 1CLZL 4I9WE 2FBOJ 1FDLL 4J4PA 4HK3N 1GOFA 3IDIB 3MBEB 2HKFH 1TJIL 2Y07L 3TCXA 3BZEB 5DC9B 2XN9A 3BH8B 5GSVB 1AE6H 5E6ZA 4YEFA 1CIUA 2YA2A 2OR9H 5J57B 4OZHF 2VITA 1N6QL 5BJTA 4I48A 3RX5A 1NGYA 3PP3H 4Z0XA 4D3CL 4ZO8A 4ORZC 4U1SA 1F13A 4EBQL 2ZSWB 4PFEA 4D9QD 5FA4B 4LFHG 5C2UB 4L4VA 4R0LB 4WU7A 3TFKD 1WAAE 1RUKL 1MAJA 2Y7QA 4EI6A 3CFIC 2R56L 2D7TL 1BIIA 4PPTA 5DVOA 4F2MA 1I85C 2DYPD 4CUCA 4UDUA 1B88A 3QR2A 4OF8A 1HSAA 3OJDB 3PJSB 3TIDB 2VLME 3SE3A 4IRJC 3BKJH 4NQDA 2VLRB 2A73A 2Z31D 4S1QH 3QFJE 1RUQH 4KROC 3KPRA 1MJ8H 4GRLC 4J8RB 1YEDB 1GGYA 1F45A 4YH6A 5D7LB 3UTZB 3PGCB 5I2IB 4LLVA 1JNLL 1DBJH 2ZNWA 3SBWA 1BECA 1MJ8L 2HJKB 4LEXH 4XC1L 3EYSH 1ADQA 3TNNB 5FF6A 2B20A 5DHYB 4F58L 3JZ7A 1YYML 2XQYK 4LRNL 2OR7A 2Z0BA 4WY7H 3C09C 2HTKD 4ODVH 4Z7NE 1SY6A 1KYOK 2BSSA 2GSIA 2ATKA 1FNHA 4ODSL 2C5DC 4ODXB 5CIPB 2F5AL 4Z8FL 5D2LB 3SDAA 3QIWB 2GI7A 3CJJA 3RP1A 3VCLA 4FA8A 3RFZC 1EHLL 2GITB 1KIQA 4KKLD 3UBXB 3EFFA 3IJYA 5CBAA 4FTVB 1CFNA 4C59B 4JHBA 1VGKB 1TQBB 5DURD 3OJVC 3LPGA 1U36A 4AH2A 1G7MB 4OZHB 3VD5A 1T2QL 3U4BL 1HXMB 4QOKA 5IB3B 2A0LC 2AXHA 3R8QA 3WEXB 5HVFB 3L3IB 1RSFA 3PHQA 4Y19B 1MNUH 5E94B 3RVVD 4EUPG 1BD2A 1TXKA 3RVVC 1PZ5A 1WBXB 1DJSA 5J13B 2PNDA 3IKCB 5DO2C 3OR6A 5I18L 3S4SA 2N1KA 1DBKH 3R0MA 1MCKA 1OB1A 4FP8H 5TE4L 5JIPA 3DETD 1VACB 4I18B 5B8CA 1HILB 2Q8BL 5MEPA 2CR6A 4L8DA 4TQEH 3TZVC 3WIFB 4HXAL 2PYED 5F1NA 3G04A 3MUY1 1KACB 4X4ME 1EV2E 2PF6A 4YC2C 1NLBH 5FIEA 1R3JB 1YEEL 3IFLH 4KV5E 3RAJL 3OX8B 2F74B 1SVZA 2B1AH 1WEJH 4NO0A 1D7FA 1M7IA 2FR4A 3HNVH 3VA6A 3WIHH 3VFUB 3KYOA 3KPPA 4F7MA 4IMLB 5DQ9B 2AV1A 3RNQB 1FG2B 3RZCC 1EGJH 3P4OB 1MAMH 3N9GL 1I3GL 4L29B 4OGXH 3AB0C 2ZOLB 1DBBH 3LKRA 1KB5A 4HLJA 4APQD 2GY7B 4HXBH 1TJGL 4KKNA 1LEGB 1VADB 1N8ZA 3K8LA 1I1YB 1RK1A 2CKNA 5CKGA 4JDVA 3SKNB 4NM8L 2H8PB 2XPGA 2BHZA 4NWTL 4QF1A 4ZS6C 1NJ9A 1EHAA 4PV9A 3NCCB 5TH2B 4IS6B 2IPUK 3KJ6H 4TSBH 3U0WL 1G9NH 1OGAE 2CUHA 5E99H 3U7WL 1D5ZB 2NY2D 2R2EB 1F4WL 2YUWA 5KSBF 5D4QA 3ZT6A 4LLYB 4GMTL 2JK5B 2V5SA 1T1ZA 4LQFH 1Y0LB 3QDJB 1T6VN 1F3JA 5IB4B 3G5VB 1I9IL 4QYOB 4KTEH 5GGRY 3TH4T 1W0WB 1BBJB 1EEQA 4LNRA 1I9JH 1GGUA 4M93C 4Y5VA 5KSAC 4I0PC 1ACZA 4PJ9C 4NJ9L 2YA1A 3ESVF 3MJ6A 1EH9A 3ARWA 3R06A 4OFYA 1JE6A 3BIAX 2Q76B 1DSFH 4HBCH 1NGYB 3EO0A 2MWCA 4L8SC 3WNLA 5KVMC 5CEXB 3FT2B 1TPXC 3PXJA 1QLRA 4P5TB 5ILTH 4JY5H 3BH8A 3SO3C 3MRHA 4PJCB 1MIEL 4RMTA 2W1NA 5F88B 2ERJC 1LGVA 2RCSL 4I8DA 2X10A 4LAQH 3TC9A 3L5XH 3SDXB 3S37X 2EDHA 5DI8B 1WZKA 1HYSC 3WDIA 3MV7D 1JGDB 4BFEA 4Y4HA 5A16A 4CNIB 3RWEB 4MZ2A 5ICXA 1KCUH 2MHAB 4PJDB 4PJFB 2AQ2A 4Y2DD 4I18A 2Y5TB 1YY8A 3QEGL 1GGIL 4X6BA 2LQRA 1P7QD 1OM3L 2DQIL 1D5BB 3PGDB 3KPLA 5FCUL 5C08B 1EMTL 2Y5TA 1BZ7A 1CICD 1PZ5B 2C4FT 4Y4FB 1DFBL 5FDWB 3MV9A 3BESR 2Q87A 3K8MA 4BK5A 4PREB 1F97A 5I74C 4QY8B 3LMJL 4U7KA 2W9LA 2AK4B 2Q8AL 5KAQG 2DIAA 3QHFL 1BJMA 3GJFA 3MRHB 5CSZA 3C08H 1NC2B 5BVPH 2F54E 2OXHA 5DF0A 3TPUA 4UAOB 2IALA 2F8OA 3T0XA 2ITDA 3LN5B 1UWEL 1IGML 3DUSA 5GGTH 2NY0B 5T5NG 4LCWD 1RU9L 3MUGA 1YMME 2ESVA 4ETQB 4TN9A 1C12B 4IRSC 4PJAE 4ZQKB 1DUZA 1QA9A 3KYKH 2ZSVA 3GRWL 4HWBL 3OAUL 4TSAH 2DLHA 5IMKA 4B7LA 1A14L 3DGGA 4KRLB 4XNQB 3MSPA 3GMNA 4YHPB 3ULUF 4JPWH 1JNLH 5ACZB 4FFZL 3BX7C 2NY3D 4X6FA 4HAGA 5T3ZH 1U8OA 4FQXD 4EN3C 1KCSL 3T77A 4HWEH 1D5MB 4NN5B 1S9YA 2R2EA 5EC1A 2A9ML 1J8HE 5DK3A 2X05A 3T2NH 3VMPA 5JOFA 3QWOB 1LILA 4GMSH 3G6JE 5HGAA 5KANG 1VESA 4HKZB 1J0JA 1FE8L 1S7WA 1DLFL 5E2UH 3SGJA 4G42B 4ZAKA 1Q72H 3FFCA 4FABL 4U1IB 3U82B 4Q58C 4AT6B 1EZVY 5I1AA 5DHVH 3SJVA 2GAZB 3VA2C 3HZKB 5CILL 2P49B 3O9WA 3WL9A 3RVUC 1JL8A 2DD8L 4NZJA 3VRIB 4WI4A 1FLRL 3MREB 5FGCB 4YDKH 1TENA 3V5DA 4TTDD 3HR5A 4WFFE 3BZFB 5A2KH 1OAYH 1MCRA 4G9FE 3HRZB 4FP8L 2JJVA 1EFXD 5F9DC 4Y16B 3V95A 4UIKL 3T0ED 4RCAA 4Q6IA 2BY3A 4DK3A 1UH2A 2VDLH 3S36L 4G8IB 4M61B 2E27H 5ESVA 1AXTH 4XNUL 3OXSA 2DWDA 4F33B 32C2A 4LSSL 1FZJB 2R8SL 3QXWA 3ZE0F 2FWOB 1R5IA 4KQ4H 4NP4H 3WLWD 4PRPA 4WEBL 2YC1B 1YC7A 1A7PH 1UJ3B 5AYUL 3VRJB 3LEVL 4B0MM 5DEGB 2Q86B 2F19L 2H3NB 2CR3A 1IC5H 1HZHH 3TA3B 3NN8B 4FFZH 2PXYA 2VO5A 2DQJH 1G6VK 5L88H 4QNPF 4I2XE 4K71C 1E27B 1YUHA 2R29L 5IEKA 4ZAKC 4MAYC 4FS0A 1AO7D 4NN5C 4HUXA 4OGXL 4ZFGL 2EEAA 3WHXA 5MEOB 4I3RH 3SKJH 4OZ4B 4Y16A 3Q5YA 5DD3H 2WUCL 3VE0A 1WZ1L 4OAWA 5C0BA 2GKIA 1PW3A 4O02H 4YXHL 1DBAL 2VAAB 3U1SL 1R3KA 1CGVA 3V2AR 5MEOA 1P6AB 2KKQA 2X4QB 3KHOA 2G60L 5B3JE 1ZSDA 5CMAA 4EN3A 5SWQB 1LO3L 2VXUH 1BOYA 2YN3A 3CFKB 2Z31C 5HYJB 1J11A 3ARUA 3OGCA 2E8ZA 3MUHL 5ETUA 4XHJD 1UM4H 3LMJH 5E9DA 4EKXA 2GIYA 3SBWC 5TDOA 5HYJA 1JNHA 4LQFL 3WFCH 2VABA 4C56D 5E8PA 2F53B 3ZL4H 4G7VL 1DQML 1LP9F 5D72L 3PGCA 5I2IA 3MRPA 1E6JL 2CRMA 3AM8C 3EDKA 4OIBA 3PDGA 1NBZB 3TO4A 3AS2A 4HZAA 4IRJA 5I74B 1YEIL 3UMTA 1W72H 1ZKAA 5FYJD 3DYMA 5DJYB 3B5GA 3DSNA 2YZ8A 1ZLSL 3SDXE 2QSVA 1RZ7H 1HNFA 5I15L 3ULVL 4UNUA 5F7EH 1YJDL 3EJYC 5JHDB 3MBED 4QRTB 1MCDA 3ZHKA 2IPUG 3V0VA 4X6DB 3CUPA 1MIEH 1U8HB 5DMKA 3WE6B 2CGRL 1TZHA 3DX7A 3T2NL 4IIQC 2F5AH 3DI3B 3GGWB 3VRIA 4M7ZC 1MVUB 2PXYC 3PWJB 4MA3B 4DZBB 3S5LB 3TZVB 1U3HC 3CVHB 43C9A 3DSFH 5FM4A 1KENH 3RWGA 3CZFA 2B1HH 3BHBA 4W4NA 2EE9A 3QIBC 1AO7E 1IGCH 2JELL 4XMKL 2WP3O 5ABDE 1FH5L 1CBVH 3I9GH 2V2TA 1AGFA 5MEQA 2P8PA 4TVPD 5DJ8A 3UJJL 1MNUL 2BNQA 5IM7A 3MV9B 1Z9MA 5EZJB 3X13A 1BVLA 4OM1H 3WNOA 4LVNC 1CR9H 3KG5A 1Y6KR 3QQ4B 5DFWH 4K94H 1YEHL 4DKDC 1PQZB 1RZ8B 4S1QL 3T65A 5C8JB 3CGTA 2AQ1A 1D3CA 4TTDC 1T7XA 2XG4A 4R3SA 2M8XA 3REWA 3NA9L 7CGTA 2IAMA 5H8DA 4LSPH 3SO5A 4QEGA 2Z93A 3RL1A 1VSCA 4FQ1H 4ZTPH 4PJDA 5FM5M 4MMZC 4I0CC 3QDMD 4XPHH 3HE7A 5I1KL 1BZQK 1NCTA 3OX8A 3QDAA 4OLUH 1FV1B 1RZGA 2W9EL 3LEXB 1I7ZA 5B38B 2HA1A 2YSSB 2ZUTA 5E95B 4ZSOB 3T3ME 4JEGB 1IEAA 5IG7B 4MA7H 4ZUUB 3G04B 2XZZA 2P47B 3I50L 3VG9B 1RJLB 3VG0H 5IJKA 5JW4R 1A0QH 1SY6H 4LDLB 1QHOA 4U1MB 5JZ7C 3O6MH 1JWSB 4GG6F 4WCYL 4WDIB 1FG9C 4P5KA 1RJYB 2DN7A 5C0AB 5EU3B 2DQUL 1MFBH 2QBWA 4QXGL 4YX2H 2QQNH 2A2QT 3BP5B 2W0KA 5CD3B 1IC7L 1RAMA 3S36X 2NY7L 3SGDH 1VCAA 3TV3H 4LU5H 3GK8L 2AXGB 2Q3AA 2JIXA 4HWZB 3B6SB 1BM3H 1JK8B 4LLMA 5F9WB 4R4FL 3OKNA 3O11B 3LQAH 1IFHL 3IJHA 5ESVB 2HVKA 2OR8A 2EDOA 4LCUB 1OD9A 4L5FH 2Z35A 5DMGC 1P4IL 1LE5A 2JKXA 2ZUXA 1FO0A 4DKEL 3ROLA 4UUJB 1FVDB 4UOW1 2DS4A 2BRQA 1A6ZB 4HW6A 3ZKXC 5I1LA 1QFOA 4RQQA 3FO1A 2J8HA 3MRMB 5ANME 5FOJA 4JR9L 3UDWC 4NFDA 2P5WB 4OD1H 1Y6NR 2E9WA 3TEUA 4HUKB 4P46D 3SE4A 3GBLA 3INUL 4H8WC 1GXEA 4OUUA 5IQ7H 1A7PL 5AYUH 3VMNA 1DZBA 2B2XH 1HH6A 3ZLQC 5JXED 1F2QA 1VKXA 1TCMA 2EDWA 3S35H 5IFAH 1NGZB 1FYTA 3EOYG 1TCRA 4QT5A 2QLVB 3FFDB 3M07A 4XAKE 3HG1D 1JGUL 5JOFB 5FUCC 1FVDA 2YRZA 2JCCA 4XNYH 1QOKA 5D8JH 3O41A 1T66D 2R4SL 5INDB 1T3FA 3T77B 1LNUB 3RZWA 1G9NL 4M1DH 1CT8B 2N4IA 1E4WL 5EWIL 2F58H 3SDAD 3S5LA 1XGUB 5CINL 1H3UA 4DVBB 5KN5B 4RGOL 4LRIA 5HGDB 3BGFB 5GIRB 4R4BB 2EYTB 4PRIB 1E6OL 4PBVC 4QGTA 4KI5D 3IKKA 4BZ2L 3W0WA 2RGSA 3TWCL 4GAYA 3V6OE 2BNRB 1C12A 4ZQKA 3MXVH 4FABH 3HZVA 3BKYL 2H32H 4JO4H 5T5FL 4Y4KA 4P5MA 5JZ7D 1CICB 5A2IH 3MV7E 1X5ZA 4KVNL 4WRLA 5ESQB 3VI4E 5MHSE 2ZKHH 4K7FA 4C83B 3W9EB 3EBAA 1KCVL 4HKJB 5E8OA 4TNVF 4M4PA 5FYKU 4GAGL 5EO1B 4N0RA 1ADQL 2GFBA 3UJIL 4Q6YA 5EZIL 3RJQB 4NO3A 3U6RB 4HJGB 4N8VA 4PJXB 3GMLB 1T1WA 4LSVL 4YFLI 2HJLB 4X6CA 1ZLSH 4K3GA 5CJQL 4E5XA 1WFNA 2BSSB 1UENA 2GSIB 5D7JB 1JNHB 4HXBL 1KFAH 2VL5A 1KTDA 2OBGA 4LLWB 1OL0A 4L4TB 5AWNH 3KPLB 1M1SA 4MNHA 4HWEL 1KCSH 2AKRB 2DICA 3O6FD 4DCQA 4ZUSA 4NC0B 2D9QB 3C5ZD 5HDBE 1U8KB 3C5ZC 1QHPA 4MAUL 4PGJA 4ZS7H 4ZFOA 3L5HA 2D7NA 3K4AA 4PJBB 5D7SH 2FZ3B 1HSBA 2DQHH 1N5YL 5D7IE 5HYJE 1MUJA 2A9NL 4Z18A 4P2QD 5CEZL 5HVHB 3BPOC 1WWCA 5IB3A 5DUBA 2HYMA 2VLKD 3BIKA 1MY7A 3OAZH 4QRPA 1PKQA 3GNML 4PY8I 4K7FB 5DFTA 3CC5A 4Z95H 3ZTNH 3FO2A 2Y25A 4HWZA 4M4RA 2L0DA 4QTHB 3RJDA 1JCKA 4ENED 3ZE2E 5GRYA 3GSVA 1EEZA 5FEBA 5HJ3A 4JHZA 2Q8AH 2FHFA 3BKYH 3CSGA 5HHOA 1FCGA 2VLJD 2Q86A 3NMEA 5DEGA 5MHSD 1CGUA 4WV1A 4UT7H 1AXSB 4U4BA 3D2UD 3KPOB 3MRKA 2I5YH 1UCBL 1OPGL 1F3RB 2IH1B 3CPLB 3JXAA 1SEQL 1XGUA 3L5WA 1KN4L 2NXYB 4X5XB 2IMMA 3C09B 3PIQB 3MMEB 5ICZA 1YECL 4PYGA 1ADQH 5GSRA 2IBGA 3I2CL 2ARJQ 3L5JA 3MRLB 2HT4C 3MRDA 5CZVH 2DDQH 5D7LA 4LDOB 1JWUA 1AO7A 4E41D 4QRRA 2Y72A 3FL7A 2XA8L 3UTQB 5SX4H 3IYLW 2ORBH 3QXAA 4JFQB 3TH3T 3F6LA 5HGHA 2CLRA 4R8WL 1C08B 5E08L 3QFJD 2LAGB 4F57H 3HZKA 5ESAB 1M7DA 4M1CC 5HI3C 4XBEL 4YR6B 5EO0A 4LVHB 2E7BA 3L3OA 4NUJB 3BZ4B 43CAB 1G0XA 3EYVA 5DJCB 3A6BH 1A6TA 3H7BA 4PJGF 4JZJA 1UQSA 1CFVH 1QSFA 4YBLB 1R3KB 2H2SD 1NEZB 5I0ZA 3L1OL 1I4FB 1BM3L 3I84A 1KTLA 4YHLL 3BGFC 3LAFA 4ZPVA 1T2XA 4ZNCD 1KC5H 5BO1H 4JM2F 1HIMH 5FK9B 3PWNB 4YBQC 1QFUL 5I1CL 3T08A 3UBXG 5BMFL 5DD1L 3U30C 4Z7VE 2PYEA 1WICA 2AXFB 1E4XI 3RPIB 4FZEH 5GHWH 5D93C 3ARVA 4D8PA 5D71H 1MQKL 8FABA 5DT1L 1WC7A 4MQXC 3FQRA 2XFXA 4FXKB 3LKQB 5JQ6H 1AI1L 3ELAT 4WV1C 2QR0B 4Z0BL 5AG9A 5C3TA 2H2PD 2Z8RA 3PWLA 5C07B 5DVMA 5CJQH 3UBXI 3DTXA 3WHE0 2VZTA 1AY1H 3BAEL 1NC2A 5FOBA 4NQVA 3FRPA 3O4OC 1MI5E 4FZ8L 2KUTA 4YHZL 4U1HB 4CDHA 1A21A 5DMIH 4KJQC 1QVOA 4R6UA 4C4KO 5L8KB 1JGLH 1WBZB 2NXZD 5D2LF 4FZ8H 2VLLB 3F58L 3O3AA 1CXHA 4ZDHB 3K80A 3KYNB 4GRMA 1IRAY 5BQ7A 4DGIH 4F9PA 2F53D 4OV5B 3GKWH 3IS1X 4O00A 2DQDL 5J6HA 2MTPA 4ELMA 3AROA 2AP2A 4LP4A 3BD4A 3QUMA 1IKFL 4LVHC 2QHLA 1DE4B 4KI1A 4Y19E 2BHYA 5DTFB 2VR9A 4FFVC 4K8RH 3UZEA 1KPUB 1YN6B 3QDME 2XWTB 12E8H 3D3VA 4L8BA 1FH5H 3RWEA 1L9NA 3DECA 1AFVH 3I75A 3QCUL 3WUZA 3HKFA 3PHOA 5HVWA 5TDNB 4P3CH 3BKMH 4BQBA 3GUTB 2HTLD 5IVOA 3ULUH 2PYFA 4C56B 2BVTA 5EBMA 1I1FB 2J8UE 2VKXA 2XZCH 1R6VA 4JKMA 1QRKA 3CLEH 4NQDB 4WUUE 2ZJSH 4O4YH 3CVIL 4YUEL 3GM0A 4NOBA 2C3VA 5IGXL 3DX8A 1BLNA 5KS9F 5I15H 1NAKH 2NY1C 3IRPX 3T0EE 2RCSH 3IXAA 5KS9B 5F3BA 3MC0A 3M8OH 1FZOB 1B0GB 4WEBH 4JFED 4PRPB 4JDTH 5GIRA 1YQVL 1BF2A 3O81A 5JHDD 3ZKNC 3LEYL 5EZLA 5F7EL 4MCZA 2D0HA 3VFWB 1FNGB 1CGTA 1G7QA 4M1GL 3MODH 4NM4L 1SMAA 4JFEE 3ZKQD 1YEKL 1AKJB 3NCMA 2VOTA 2HH0H 1AE6L 4DUVA 2A74A 4PJIA 4HK0B 3ZSSA 3VU2A 5C0EA 1CQKA 1Q9KA 1MCHA 2P4AB 2P5ED 4M9PA 4KK6C 4JPKL 1S8DA 1TNMA 1ZVSA 1MUJB 5CINH 1MHHA 4MSWB 5ENWB 1NAMH 4YX2L 1FBIL 5IQ9B 5H35B 2CMRH 4PR5B 2M26A 1RZKC 1D9KA 5KJRL 1PDKA 5D1QB 1NH6A 3WNKA 3MV8B 4GW4A 5EBWB 3LKNA 5E99L 3IETB 3TIEA 3LSOB 1IAII 1WVZA 1NPUA 4U1IA 4ONHB 1WZLA 1DL7H 3R0NA 2LABA 5EA0H 1P7KA 4ZUVA 5TPWH 4JY4B 1G6RL 1IM3A 1S7SA 3MRIB 1A6ZA 1T4KA 2HFFB 3VD4A 4HJGA 4PJXA 2GUOA 3E2HB 3EAKA 3FB5A 3U36A 3HS0A 3TT1H 2O61B 1IILE 4OIIL 3TYGL 3WLWC 5KVDL 4PJIF 4FQ1L 4MA8L 4OM0L 5DRZB 2BOCA 2F53E 1CE1L 1FQ9C 3H3BC 3H9HB 5F8RC 1SEBA 3PP4L 1U3HA 3UTPD 4ZPTA 2W0FB 2V7HA 1XR8A 2EDRA 1C16A 5EORH 3TT3H 4EDXB 1I1AA 2IANB 2ZSVB 5FUCE 1XT5A 4JFOB 3DVGB 4O58H 1CZ8H 5FO7A 4QHUB 3ARXA 2FD6H 4LNRB 3JWDL 1D6EA 4NKOB 2X4PB 4TUOA 1WBYA 1WAAF 5IHLB 4KKCC 5D8JL 3U4EB 1FZJA 4M02A 1QP1A 3RY5A 4NYLB 2FGWL 1RZFH 4MD0A 1G7LB 5LGHH 1RUAH 2UYLA 3QEQD 2D7TH 4GRLB 4FQ2L 3FQUB 3U36B 1U8PA 1U93A 3VXSD 4J3SA 4S11A 2R1WB 1EHXA 5F7WC 5DJ0A 4DN4L 1XR9B 3FQNA 4I3SL 4OKVB 3NFSL 4LHQB 3L3OB 4OZIA 1CDJA 4Y4HC 3V4PH 3VFNB 3WO3B 2AK4E 3HE6C 4FG6D 2HLFC 2Z8SA 1E4XL 2IAMC 3QQ4A 2OJZH 4H8WH 2AV7B 1BIHA 3HB3D 3BWUC 3O6LL 1MRDH 1NGWB 4Y0GA 5HYEA 1CXLA 2H45A 1NFDE 4QRRB 1AQKH 3B2VH 5ITFA 4YFLF 5IBLC 5KG9A 3MO1A 4HUNB 2JJUA 4OLYH 5ACMA 5E8OB 1A7NL 3P0YH 5E6ID 4XVSL 1BEYL 4XNYL 4KDTA 3WN5A 1U8LB 5J12B 5KSAA 3MLZH 3PJSA 1CDGA 5F9OL 5E24E 5EUKB 3HCVB 2G2RA 3RVXC 4OLWL 4MNQD 4JPWL 3P30L 3VGAC 5DRXB 1KEMH 3FQXA 3VFGL 4EI6B 1NBQA 4XPGL 3B9KD 4U7MA 4GAYB 1AGCB 4PTTB 4WCYH 4UTAL 3GMQB 3L3IA 5D6CA 2CDEB 2AJZA 3IVKA 4DTGL 4MNGE 4UQ2A 1OWRM 4I5BA 1UH4A 1FN4A 3QRGL 1JV5A 1MCWM 4RGOH 5EG6C 5CZKA 5LQBH 2BY0A 4ZPTB 5HHVH 2V7NB 3R1GL 2DMKA 4XNZC 4RDQG 2NY1B 4U1MA 3MRNA 1B90A 1NDGB 4N9GB 4BFGA 4G8GA 1QFWI 2XKNA 1FNLA 2UUDH 5INDA 3RWDA 1CFTA 5JXEA 1L6XA 3P4MA 2FGZA 1DL7L 5EA0L 4Z7VB 1BP3B 3WNPA 1LE9A 3EJZD 3O6FB 5FXCH 1TJHH 5ERWA 5KSUB 2R2HA 4ZOEA 3VXNB 4YWGH 4J6RL 5C0JB 3VFRA 1PG7H 4NGHL 3WIHA 1K4DB 4WWKB 4JG1H 3KLDA 4QXUH 3SE4C 5IFAL 1RQ5A 3UEZA 3T65B 2IG2H 4GW1B 4HFWB 2P5WA 4YWGL 1M71B 3LH2H 3SGJC 5D7JD 3VFSB 1P6FA 4P3WA 3GB7B 2X4QA 3UPRB 2PKDA 4P99A 4WFEE 3WNNA 1KB5H 1MRFH 4L4TD 3PL6C 2AGJL 3PDOB 1ZEAH 3PGFH 1LO2L 2YKLL 2NXYD 4PGBA 1LE9B 3OWEA 1PX4A 2DQEH 3GIZH 3V6OC 1TIUA 1JNNL 4M6OH 3SE8H 2R0ZH 4KPHL 4L4VE 5L2KB 3UZVB 4U1HA 1BFVL 3AS3A 3KXFA 2B1AL 3OKDB 1T0MA 3FB7B 3O11A 5CEZH 3FB6B 5FGSA 3NIFF 5BZWA 3FQWA 2AJYH 2LVCA 4M5YL 4M6ML 2C26A 2CH8A 5DS8B 4OIAA 1KIPB 4NBYB 3CFBA 2ZUVA 4MVBD 5LAXB 3MNWB 4QXTB 5IK3B 3QO0B 5GS3A 4DTGH 2EIZA 3QPQC 1DTUA 1LK2A 4NZUH 3N0PB 5EUOF 2I26N 4YBHA 4HMCA 4IIQB 1BFTA 3AS0A 3WBDA 4R4BA 4QOKB 1S3KL 3KPQA 1ZHBB 3V5KB 5C09D 3D0LB 5CP3H 4HGKC 3VXQA 1NAML 1N0LA 4M8VA 3PXHA 2KZWA 1K3ZA 3TVMD 2E6JA 3LB6C 3IDMB 4JG0L 1NEUA 4D0CA 1U42A 2R0LH 3MBEA 1UYWL 3ARDD 3V7AG 1BBDL 1MQ8A 4TPRH 1NC4B 4XMLH 3L3GA 2O5XL 1AP2A 2RFXA 3Q6GL 2JTDA 3NIDE 2NW3A 3BKCH 1LEGA 3N50A 3OF6A 4P5TC 2AK1H 4NRXA 5B22A 5E2VH 4PV8A 4JFDA 1U41A 1FNFA 2R1XB 2V17H 5C0CD 1JGLL 2DRUA 2FO4B 4LCIL 4AG4H 4X6CF 3IDXL 3SGKA 2ED9A 5JORA 4YNYB 4FNLL 1U93B 1U8PB 3K0WA 3KS0J 4BSWB 3W82A 5I17B 2FYYB 1IGCL 1CZ8L 4XMKH 3REVB 4O2CA 3U7YH 4JO3H 2FBJH 3PIQA 4HJ0D 1IE5A 1MPAL 4H0GA 1EJ6A 3OKEA 3I02A 5L2JA 3QEGH 4H5SB 1H3PL 4RX4D 4AMKH 4MAYB 2KBGA 5AZEL 2PO6D 3BP4A 2B1HL 4X7DC 1EEYB 3PABB 1NGXB 4JZNB 5FCUH 5I1CH 1EDQA 3F7YA 1DUZB 4DQOH 1NC2D 5C0RL 2EIZB 5BS0A 3VRJA 2VLKE 1LQSR 1CDHA 1BQSA 3V8OA 2HRLA 1JF1A 4N0YL 3RVWC 4HD9A 4H26B 1CFSA 1YEGH 3F7VB 4OSUH 5L0QB 1XMWA 5DJYA 4HG4K 1JN6A 1UZ6F 2VISA 4RBPK 3SDXF 3L7EA 2JB6A 4JKPH 4C56A 3BVNA 5B4MD 4KMTH 4PRBA 1EJOH 4HBQA 4XCCH 3FTGB 1IQWH 1UWEH 1NEZA 3JTTA 1HE7A 3AREA 3T0EC 2YMXH 4D9LH 5E8EB 2HP4A 5J4MA 1SM3H 2NXZB 1HKFA 2PO6B 4DK6A 2ORBL 3UO1H 4UNTA 1TZGH 1ZHLA 3IU4H 2OP4L 5F93C 5I9QC 3O6KL 3MPCA 4X9BA 2AEQH 1C08A 1GGBL 3NGBB 4J2XA 5BQ7B 5DR5L 4CU6A 3E3QE 4NRYA 1MHHB 2EKJA 1KC5L 5BO1L 1F6AA 1MFBL 1QVOB 2DI9A 1LEIA 3LHPL 3FMGH 3HC0B 2A74B 3QUMH 4OGYH 4PJIB 4HUXB 1XIWC 4MVBC 4ODHH 4LLAA 3X3FL 4BK4A 3MLRH 3UP1A 3OXRB 3V6ZB 1E27A 2J8UF 3HA0A 1QFWM 2Y1VA 2X1WL 3TJHD 4W68A 1CK0L 3CVIH 2RQ8A 3X3FH 4YQXL 1HYRC 3EO1A 3PL6A 3WKML 2HWZL 5D1QD 1CDIA 4UIMA 2BCKB 5E4EB 5IEHB 3ORJA 3FRUA 4LARH 3F7PC 3DOSA 3ROOB 3LS5L 5IF0A 2RAMA 4U1SB 1OVZA 4Z7WA 1H3XA 1KIPA 4HXAH 2XA3A 4WJ5B 1T5WB 3WIHL 1PD6A 2ED7A 1OP3K 4QNPE 4N5EC 2FIKB 4KKAD 4S1RH 1BAFL 4KMLB 5SWSD 1OWWA 5IFJA 3LQZA 4OLVH 3HC3H 5I1HL 3QUXA 3SCMB 2EDNA 5F96H 4G8GE 1N3NB 1SJHB 4GBXC 4WGWB 1FJ1A 2IGFL 1KV3A 1JFQL 3P0YL 2VMFA 5DVNA 4OFVA 1AJ7L 3HI1A 2D03L 2Z31B 3QIBA 2IH3A 3LV3A 5B39B 3RUGE 4MNGA 2FD6L 2GK0A 2Q6WA 3UYPA 2WWKO 3ES6B 5AUMB 4HKXB 3U7WH 4CN1A 1A3QA 2VNCA 3EFDH 3QEQE 2D0FA 2PO6A 2LU7A 3A6BL 4FN0A 2DJ4A 3MLYL 1ZMYA 1AGEB 1ZSDB 5CMAB 5SWQA 3KR3H 3K74B 1TFHA 1VERA 3MV8D 4Y5XB 5MERA 1K9TA 5HPMA 2HVJB 2X41A 1QR1B 4Z7OF 3ROLB 5ID0A 1AGDB 5LCVL 4DAGL 1GC1L 4LF3A 2BZDA 3NIGF 4QRSB 4YK4B 3F62A 2F5BH 2LE9A 2P5EB 2WM0A 1IFHH 1E4KA 3UPAA 2C3HA 1Q0YH 4NQED 4Z7WE 5T1DH 4P9HC 1NCUA 4TPRL 4Y4HD 1AC0A 5BV7B 4PRHA 1AIFA 1NCBL 3ZTJH 1I8MA 3P9LB 1F11B 1R3LA 1IMHC 1ZLUK 3QUZA 3O4LB 4PRHD 1EAPB 5CP3A 1DBJL 1QTYT 3LD8B 1W0VB 1OCWL 5FYKD 1FNSH 4XI5D 2MQCA 2PCPA 2VN7A 1AGCA 1JMXA 1RU9H 4ONOA 3ARBD 2MCPL 5JPNA 4G7VH 3MRRB 2WUBH 3HUJA 4NQCE 1KJ3L 3BH9B 1BBJA 3N06B 2BRRH 3D25A 3WS3A 4P2RA 2ZWLT 5E56A 1EO8H 2IFFL 3JWOL 3K7UA 1A7RL 1WWAX 4XP9L 3B9EA 4ORGB 5KS9E 4FXGA 4RIRB 4K3JL 4QY8A 1ZGLM 3OKLB 4BH7A 1G6RB 1YEKH 1JHTB 3QH3A 2AQ3A 4OF0A 1BFVH 3D39B 3BSZL 5JW4N 5SWZA 3S7GA 3NCFB 3QIBD 4X99A 3VFSA 4OB5H 3BPNC 2EH7L 1EMTH 1FO0H 1IEBB 4X7FC 1LO5A 4Y8AA 2Y06H 4MB4A 4I3SH 2WANA 4YR6A 5TQ2L 1A7OH 4OKDA 4GG8A 5IBTL 3CXHJ 1WFOA 5F7DB 5I1AB 4IOSD 5AUMA 3KR3L 5FF6B 2CKBL 1INDH 1RK0B 4OZFB 3VRLE 2JCCE 5JOPE 3QNYB 3QXAB 1XCQB 4JFQA 1WAAA 1CQYA 3E0GA 1IEHA 3EDEA 5I1LB 3U0PA 1OP5K 4BKLB 3MRQB 1ES0A 3IJSB 1CD0A 3NAAL 3CLEL 1DBKL 1F2XK 4PJ8B 4I0PA 4PGEB 1AH1A 5ITBH 1KJ2A 4LCUA 3BE1L 3QDMB 4P2CG 5B8CB 3NZ8B 4FQHA 4PP2B 5GRZA 2BVOA 5KSVA 1Y6MR 1SVCP 1MH5B 3JWDC 2NY2B 1ZHBA 3UYOD 3V5KA 1OOAA 2J1KA 1OT1A 4XPFL 2ZZUT 3K4ZA 3GMQA 2X4NB 1LHZA 1QA9B 5LXGH 4PY7A 1NFIB 5DQDL 1MF2L 4AG4L 1I3GH 4J3UA 1ERNA 1CFQA 1OAZH 4EVNB 1Z6JT 2ZUUA 5T3ZD 2GQHA 1T7WA 4Z9KB 1I8MB 1EUTA 4D9LL 4H88L 3P11L 1GOGA 2A9MH 4OZGF 1BQHB 5IJKC 1H8OA 3IAQA 4Y4FC 4H25B 3VD7A 1XF3A 4G8GD 5EB9A 4WUKL 3C2AL 1TTGA 3CFCH 4PJEB 2R0WL 1B3JA 4MD5A 4QHLA 2FX9L 1T22A 3VH8A 3RU8L 5DR5H 5GZOD 2QQQA 4OLZL 3NPSB 1VENA 4QRUA 2OTWA 1K5NA 3DX6B 3B9AA 4N8VG 5K93A 4GOSA 2R69H 4YDIL 4PJFA 1YEHH 3RIFF 1MJJA 2Q3ZA 4OI7A 5HI5C 3LB6D 2MNUA 3CH8A 3IRZA 4W70A 2YPLD 4AEFA 2F74A 1LO0H 3GO1H 4P5TD 3QZWG 4RFOL 3M45A 1K8IA 3CK0L 1C7SA 1NLBL 2R0KL 4X80L 1IL1B 2VDQH 3TVMB 4RIRA 4YHZH 3MRJB 4S1RL 2YR3A 4I4WB 1X44A 1GH7A 1JGEA 4JQIH 1X5AA 3MRNB 3MRGA 5D1XB 5M94B 3IU3B 2NTFB 3S3JA 5C0DA 4N90E 4ODSH 3N1FC 5FCSH 1HN1A 3IDXH 1B0RB 4QOKD 2W38A 5D7IF 2AK4D 1T20B 3T2PA 4KQ3H 3RA7L 4GBXD 4LRIC 2EDJA 3CIQA 4KUZH 3O2DH 4LGPB 1H15B 4WI8A 4GUPA 4MJIB 5IT2L 3H42L 4JFFD 3CSYB 4WI5A 1U3YA 2IWGA 5EUOE 1MH5A 5F8QC 3T0BA 4Q7DA 5C3LD 4PRDA 2X09A 4HEPG 2NW2A 5DJAB 4L4VD 2AAVA 2IMNA 1AFVL 4LMQI 1EHLH 4P2QB 4ZXBC 1DQJB 4IOFD 1MPAH 2JELH 4L3EA 4WHTB 5IOPB 3VJ6A 1KTLB 2IAMD 4L4TE 1FGVH 3VXMB 1IKFH 5LBSH 1RZIB 4GKNA 4CVZB 4YHYC 3FFDA 4E9LA 2I9TB 3OAYH 3OF6D 4XC3L 4F8TA 5JOEA 1I3RB 2A6IA 3JVGC 4RISH 1BX2B 2ZKHL 3V52H 2AI0H 4NSKB 3BOVA 4IRJD 4PG2A 2XYCA 5HHQA 1WJ3A 5T3XD 1IT9H 3BWAB 5TE6H 1G9MH 5CZXD 1X4YA 4YQXH 2NLJB 3KWWA 1P1ZA 2QQKL 1I7UA 4XVUD 4XVTL 3UTSD 2Z31A 4WHYH 4L9DA 2E7MA 5IQ9A 1OSPL 3VFUA 4HX1B 1G9ML 1YY9D 5DJ0B 2P24B 1I9EA 1X5JA 3AREB 2BRRL 4NBZB 5IESL 1NCNA 2AK1L 1X5KA 3ARDB 1MREH 3V6FB 1LEKB 2NTSP 1QBLL 5AZ2L 5DJDA 3ZTJG 3MXWH 3ZE0E 3AVEA 4WFHE 3O45B 2GJ6A 4KJYA 4CADA 4OGAC 2CUMA 4ZO7A 3HN3A 3O4LE 1NBYA 4HDIA 4R4ND 2AABH 4HCRA 3MYZA 1ZV5A 4PJCE 3QP3A 4CN4A 1C7TA 2GT9A 4JN2B 4QXGH 5J7CC 1JPFB 5J1SC 5FA3B 3WFZA 2GEEA 4MAYA 5A43C 1DDHB 5T1KA 2EXYC 4XAWL 3KYAA 1I8IA 3DMMB 3TPUB 5I1IL 1V5JA 3DWTA 5BZWB 3QEUA 4LKCB 2FEEI 3OR7B 1CF8L 3OAZK 5KSBA 4PRIE 1CLCA 4EXKA 2YEZA 2LTQB 5EBLB 5ALCH 1SHMA 3IDNB 3GMPB 4DKEH 1KIRA 3GI9H 3LOWA 2XZCL 4JFHE 4RA3A 3T1WA 2XTJD 1Z0MA 1I9JL 1HEZA 1K2DA 3C87A 1U8KA 2R0KH 1HHIA 4M8QA 4TSCL 1HHKA 4X9IA 4XWGL 1FL6A 1P4LB 4QHMB 4UINH 3Q5TA 3MTRA 4Q6IC 3FQTB 1KJ3H 5D1QA 4JM2A 3U9UA 1J1PL 3W2DL 1NSNL 4FFWD 2JJSA 4OZGB 1XIWA 3HAEH 1FVEA 3O2WL 4JDZA 5ELIA 1BMGA 1ZGLA 3U6RA 2YEZB 3UC0L 1QBLH 2A1WL 4MXQC 5CZVL 1QLFB 3LQZB 2VLRA 4RFNC 1D5XB 4GRWB 4GKOA 4XCYB 4YGVA 5DSCA 4M43H 1NGPL 2P5WE 3KWWB 1TJGH 1DUYA 2B4CH 2ZP0T 4HIJA 2X6MA 5IW1A 5LQBL 2E7HA 2O5ZL 2HJFA 4S1DC 5IIEB 5IV2A 4EUPA 3MJ7A 3R06B 4BQ8A 3RY6C 3MXVL 3TZVD 3TJEH 5MP6L 2NCMA 3NACH 3C5JA 4HLZH 1J5OL 3STLB 3SKMA 1A22B 5IHZB 4L8SB 1J7VR 4X7TA 4IMKA 3C08L 3QO0A 4PGDA 5CEYA 4ALAL 3T0EA 4JY6B 1UB6B 4HZLA 2VTFA 4ZODA 4JO4L 4LSPL 3RWCA 1FNEA 3VGHA 1J12A 2X4SA 4P9MH 3QDGE 1HHJA 3KJ4C 4DN4H 3L9RA 3NCYS 4C55A 4F7TA 3ARGB 4FQHB 5C08E 4L9LB 1KPRA 2E9JA 5CUSL 3GJFB 3QHFH 2P8MA 2J4WL 4PBWD 2PYFB 4NNYB 4M93B 3C8KA 4ETYA 4AIOA 4QHNB 3MGOB 5FHAL 4XXCA 2C1OB 2DB8A 5JO5B 5ID1B 1BEYH 5E5UB 2JB5H 3QULB 3S35L 2ARJB 5D7IA 2W07A 3MLWL 3BN9C 2MKLC 5EO0B 2BC4B 4UILL 3GRWH 4HWBH 4TNWK 1L0XA 4KK5D 1FFNA 5D1XA 1MCWW 3U46A 3LIZL 4QRPE 2R4RH 2HFGH 5E00A 3LDBC 1RURH 3AMKA 3ILQC 4NUGL 4JFEB 4GG6B 3GSXA 4U3HA 1J05B 1QO3B 4HIXH 2OR9L 1QRNA 3D1MC 3P4NA 4MNQE 4PJEA 4D0BB 2ZCLL 2R9HD 3LVEA 1ND0A 2OI9B 4V1DA 3DX9A 4LBEB 1AKJD 2WINB 3WIFA 4OCNC 5J1AB 3DHJA 1TNNA 5T5FH 4PRDB 4LGRB 4U6VH 3S88H 4CMMB 5F1IB 3QUZD 2ENSA 3L6FA 1IGIH 1DQQA 2EO9A 1VEMA 4LVNB 4UQ2B 1J8HB 4U6HA 4GS7C 5FM5O 3OKOB 5GS1B 3BW9B 2IANA 1ZTXH 3MNVA 5J12C 3W81A 3P4LA 1Z2KA 3D18B 3TNMA 4XGZA 3V8CA 5HGDA 2IG2L 5IR1B 4TNWF 3TCLB 1AD9A 4LSVH 1U3HB 1TJHL 2COQA 1H3VA 5GGTA 1OSPH 3GMRB 5D9SA 4JKPL 5CSZB 1JGVL 1NANH 4OM0H 4N1HB 5DJDB 3HC4L 2EYRB 3MA9H 3M8OL 5E2VL 2ADJA 1D5ZA 1L7IL 3IT8D 3QIUC 4HFUH 5EOCL 1ZOXA 1U95A 5CFHA 1NMCB 1QFWL 3GBML 4WENB 1U0QA 3U7AA 4X6EB 3S34L 3HPLB 1QFPA 2PTTA 5AAWA 2D31A 3EW3B 3ULVE 2VDOH 3WL9B 1MCQA 5I8CA 3BIBX 1DVFD 1G1CA 4Z77B 3VXNA 2Y06L 5L88L 3LV3B 1LP9E 1JYVA 3CFDB 3LZFH 3QULA 1YMHB 1XR9A 3UTOA 5GRUL 4K7PL 4MD5B 4QHLB 5ISZD 4JPVL 1KJVB 1PX3A 3BN9D 4NKIL 4ZOBA 1GIGL 2F9BT 4Z7VA 2UZXB 4LCCA 1BF8A 2A6DA 4KKCD 5E0QA 2P8MB 4YAQA 3DVIA 5I1DA 4TSBL 3U0WH 4U1LB 4NC1E 4P3CL 1K6QL 1MI5D 5DRNA 3CPLA 3CFJA 4XP6H 3I6GB 1V3LA 1IEBA 4XPTL 1YA5A 4MJIA 1XF4B 4P46B 5DQJA 2WUBL 4V2BA 4G8EB 3Q3GA 3T4YA 1MJUL 5BV7H 5FYJE 2YD4A 2BX5A 5K9QG 2VXVH 4LSQH 2C3VB 3IFNH 1LK3L 3W39B 3FKUS 3VI4F 5H94B 1XAUA 4ELMF 3E6HA 3IU3A 3JTSB 2GK2A 5T5NF 2DMCA 2VWEC 3G6AB 3OBAA 1KJ2B 1KLGA 4Z5RB 4MA8H 3QEHA 4MA1B 4ELME 2OM5A 1CLZH 1S5HA 5T3ZL 3ARFD 2WBKA 3B2UC 4PD4J 1VEPA 1HYSD 4NQXB 3SDAB 1WISA 3L3HA 1UGNA 2HFFA 5C0NC 2J88L 2YPKA 3GJEA 5DJ2B 1AGEA 4QKXB 1UWGH 3K2MC 4G7YL 4JM2B 4WTZG 2NY7H 4GKZA 2NZ9C 3OKMA 4PJDE 3VXOA 4WUKH 4ISVB 1D5BA 1KXTB 2I24N 3QIUD 4NM8H 2Q6WB 1A6VH 2VZ3A 4UT7L 1AHWC 2EZ0D 4PJ5E 4OM1L 4EIGB 4PY8J 1UXSA 3F12B 3QIUA 5EOQL 1J1OH 5EBLA 2AXJA 4JFZH 3ARPA 3FFCE 4OCRH 5MERB 3WNMA 4LSUH 4LHUD 5TE6L 2RBLA 3G6AA 2EC9T 4EUPH 3RHWF 2YPLB 5BS0D 5GS1C 1IAIL 3S96A 2ZPKH 5CEXA 1B4RA 3T1FA 3HE6A 1AD0B 5J9PA 3ILPB 1IQDB 1PG7L 2ICWA 3DIFB 3ECBA 3NN8A 3KPTA 2Q8BH 4C4KT 4X7CC 4BA8A 1IAMA 4LRNH 4LVOB 4XZUB 1U2CA 4Y2DB 4S2SA 4JRXA 1L7IH 3STBA 4AIZA 1NCWL 1YEFL 4WWKD 3TBSB 3QA3B 3ULVC 4JQVC 1A6PA 5H37G 4G9FD 4OLEA 4WFFD 4JN1L 1EXUB 1RMFH 4XNMA 4KK8D 3D69A 5DLML 1NSNH 4POZD 3EJYD 1Z9SA 5JA8B 5DRWA 2VLKB 3IDJA 1NL0L 2PW2B 3EIFA 5CJOH 5HYQB 5KBNC 1KOAA 1YYLH 1JNJA 1N26A 3O6ML 3GI8H 1MFDH 2XZQL 1ZLVK 1OD7A 3I6KB 4PJFE 1QBBA 4X98A 4F9LA 3UXFA 4S2SB 4J12A 4K23H 4L8BB 4AY0A 3PWUB 4JY4A 5JPMB 1FL5A 1KEGL 1RK1B 6FABL 2FJGB 5K9QI 1A6WH 1BQLH 1Y18A 3RZCA 5GS0H 3HZYA 4PRNB 3SJVB 1RUAL 4PTUB 5EBWA 1I7RA 1UKQA 1UM4L 5IWLC 4NQTA 3O8XD 4G3YH 3MZTA 2CO7B 4WW2F 4PJBF 1ZVSB 3X3GH 5I18H 4YPJA 2VJXA 3F7RA 1T5XB 2ZG1A 3FTGA 1H3TA 4K94L 4BQ9A 2DAVA 4HV8B 4Y5XC 2EE3A 3BRDA 3WUWG 4X6CE 3HE7D 4FMFA 4ODUB 4B53A 3B6SA 2CJUL 3IKCA 2ED8A 2JJWA 1WQVT 4G80A 3D18A 3TNMB 3G5XB 5BRZD 2HT3D 1CGXA 2VDOL 3NCJH 4PJBE 4M48L 1LK2B 4QXWA 2DQDH 3CX2A 4JZNA 4MA1C 2W65B 4PJFF 5HJ3B 5K33A 3UTSB 5E5MB 1OGAB 2J6EH 5GGRA 1T20A 1AC6A 3VDAA 3LCYA 4KI5E 4ACPA 1MVFA 5EN2B 2GJ6B 4KJYB 3HE6B 4HUVB 4S0SD 4YE4H 3WJJA 1OARH 1SEBB 3MRCB 1X5GA 1TZIA 2WUCH 1QPPA 3GNMH 2XRAH 5GS0D 3GKWL 4NJAL 1G7JB 1OARL 1VEOA 3QUXD 1J0KA 3KGRA 4PJEE 2K1MA 4FFYH 1BGXH 4OF3A 1A6VL 2EDLA 2IPTH 3PDOA 3C6SA 1V05A 2H6PB 6FABH 4FQ2H 5DA4A 4NKQB 3M1BA 1NBYB 1UACL 4UT6L 3EYVB 5DJCA 1SJEA 2FJFA 3S3SA 1HDMB 3W5NA 2ADIA 1N4XH 1CXIA 5E8NA 3VMOA 4Q9CA 1WTGT 5EULV 5D72H 5HYSG 1F6LL 4G8FA 2K3TA 4MNGB 4OLXL 1RI8A 2VIRB 1V7NH 3ETBF 1S7WB 1RJCA 3O8XA 5IVZB 5EU7E 1B6DA 1UA6L 2HJLA 2HG5A 1T22B 4X4XB 5KVDH 4CNIA 2HKHL 4NQXA 2E27L 4XCFH 2DDQL 4JZJB 1NFDB 1XZ0A 1RJZB 4QRRE 3CMOL 5E4EC 3L7EB 1YPZE 3QNZA 4XX1G 2HLFD 1OAZL 1G7HB 3HAEA 2G5RA 5HHPA 1EXUA 2VAJA 4P2QE 3TBYB 4KK8C 3BP7A 3DGGB 4RFEA 5JPMA 1UH3A 1R24B 2E3VA 4PY7B 4R7NB 3STLA 2ZCHL 4JFXB 4YC2B 3VGAB 4OF6A 4K94C 3BYYA 2HRPL 3FZUD 4P4KC 3CFBB 1YMMA 2ADJB 2IJ0C 3OKEB 5J6GA 4KJPD 4HH9A 4M5YH 4M6MH 35C8L 4JQXA 1ACYL 5ICZB 2WAHA 4Y8DC 3GMRA 3HLAB 3JUYA 1SJVA 4MHHG 5E8DL 4BSVA 2R1YB 5K59F 1CDBA 5DXWA 4BJLA 1S9XA 3HI6H 4NIKB 4PD4K 1ZHKB 4LL9A 3D0LA 1G7PB 2ZUQC 4JKLA 2H32A 5I8KH 2Y4SA 1S5IH 2WQ8A 4YZFF 3QI9C 4L1HA 5EUOA 4NRYB 1DEEB 3MLSH 4XZUA 3G5YA 1BVKB 5IJVB 2P8LA 2Z91B 1DQQB 3I2CH 4OT1H 2FHBA 4YDVB 3BEVA 3VXPA 5L6YH 3QHTC 5C9JA 4PRPD 4P2OA 4OIIH 3SEPA 1OSZA 3H3PH 4OCWH 3EDDA 1EPFA 1IAIH 1QFWH 1MI5A 1NCWH 1XGRA 2MKWA 5MI0B 1WEJL 3VFOB 4CVWA 2AEPH 4JY5L 4WTXA 5T33L 5ANMA 1W8NA 4JKKA 2IF7A 3VE0B 3GRWA 4HWBA 5JW3L 1IC5L 2DQEL 1GPOL 4KXZI 1RZ7L 3QCVL 1FFOA 2MFNA 1CL7H 1QSFD 2IPKB 3SCMD 4XPGH 2E6PA 2IQAA 5I76B 4HUVA 2JIXB 4GAJL 5D7SL 4MXVF 2BOBB 4XCNB 5D1ZC 5DUPH 2Q7YB 4HHAB 4KGJA 5EIQA 3GSUB 1LD9A 2EDXA 3PHSA 3TV3L 4X9FA 3QRGH 1U3HD 3ABZA 3M17B 2P42B 4WO4D 2CRYA 1ZVYA 4F7CB 2IPTL 4MMXC 3L6FB 2DLIA 3O2VL 1X7QB 1J8HD 3W11D 5GJTH 3L3JA 3SGEH 2AJ3B 5T1LA 1MLCA 2UWEF 3NZ8A 4NHUB 1EA9C 1RUPL 1Y0LA 3UJJH 4I2XA 1CGSL 1FNEB 3VXSE 4UI2A 2GUOB 4N0YH 4MCYA 3SKMB 5IHZA 3FJTA 1GJIA 1OP9A 2J3SA 4Y5XA 4AEIH 4QTIH 1XEDA 1J88A 1NUGA 1T1XB 5FDYA 4CJ0A 2B2XL 3FOLA 3G6JA 3CU7A 4PJ7B 2WP3T 4NN6B 1D5IH 4LCWE 2ESVD 4M03A 4HFUL 5EOCH 2B0SL 1D6VH 4YDVA 3G6JB 3MLVL 5EOTA 3VXTA 3MGAA 4B41A 4H1LG 4UV4H 1CD1B 1MFNA 4R4NC 1ETZA 3F8UB 4O2EB 3B83A 4MDIB 4MSWA 4JGMA 3ULSA 2C1OA 1ZT1B 1IAOB 3WFEL 4M7LH 4G43B 4ZFOL 4BKLA 2BNUA 1MELA 5IOPA 3QEQB 5C6PB 3QWRA 3VWJA 4GFTB 4DUWA 5GSRB 3MQIA 4WUUB 5C0AE 3RWGB 4WWKC 4PJIE 3ULVD 4LQ1A 4P2RB 4X5WA 3QUYD 1I8KB 4FQIH 3S4SB 2VWEE 5IB2B 4ZUTB 2J6EA 3GGWA 1BQLL 5IKCA 3KPSA 1LO4H 3OKKB 1MCBA 1S9VB 2CDEA 4J1UB 2P5WD 4JPIB 3RDTA 1A9BB 2DOCA 4Y2DA 3C6SB 4IOIB 3BDYH 5HHOB 1G6RA 2BK8A 4I9WD 3ZDXF 4UT9H 5KN5A 2UWEB 5D5MA 4DUXA 1MCNA 1RULL 1RZJH 1ED3B 4JR9H 1KN2H 4ZMAT 2PN5A 3GIVA 5DUBB 3HUJB 3OHXB 4TVPE 1JPFA 2C3WA 1RZGB 4QHUA 1KFAL 2NY1D 1TCRB 4QT5B 1CGWA 1KGCD 5GS1A 1QR1A 4HUUB 1Q0XH 1UM6H 1HSBB 1XIWB 3SQBA 3EGSA 3B43A 2G5BB 4YXKL 2BSTA 5HYFA 4Y2DC 1XH3B 2YUXA 2NZ9D 2VDML 4NQDE 4HIIB 3RDTC 3TPKA 5I1EL 1OAXH 2H26A 5F7MC 1I1CA 3WS6C 3DGCR 1U6AL 1YY8B 1FC2D 3HAEG 2CRIA 3D39D 3QIBB 3D0VA 5IJVA 3O6KH 2BY1A 5DHVA 1NCDH 4ZXBD 4NC2B 5J13C 5JW5B 4E0RA 1GGTA 3U7YL 1FFQA 5FGBC 1QBAA 1KT2A 4KV5F 3MFGB 1Q94A 1MRCH 5E03A 3DPBA 2PXYD 2VE6A 1DBMH 4FFYL 1OAKL 3ARGC 1CBVL 2D9CA 4DVRH 3BFOA 2A6KA 4G8GB 1G9EA 3C6LD 1I7RB 3IDUA 4HSQA 4RMWA 4PB0L 4RWYH 1TVHB 2CXGA 3IGAA 5KAQF 3CZJA 4JM2D 5E2TL 4PJ8D 4G9FB 4NT6A 4Z7WB 1QD0A 1VFAA 1ZLVH 4L8SA 1JYXA 4XBGB 3EYOB 2NY4C 3QJHB 4RISL 3WDJA 1A7QH 2R0LL 3BP6A 1BZ9A 3FCTA 1RVFH 4RMQA 2OYPA 4RFEB 5L8LB 4N9OB 1EX0A 1YMMD 1LVEA 3UJIH 2CLZA 1S9XB 4S1SH 2HKHH 2YPVH 5A2FA 5EUKA 1UADC 1PY9A 1U8MA 3CZFB 3WO4C 1UA6H 4LSTH 3S35X 1UCBH 3GHEH 5C7XH 4XCYA 4LKXB 4LLYA 2FYYA 4EOWL 3D85A 5ACLA 3UC0H 3HC0A 3QEQA 2MCPH 4YBLC 4ZPVB 3KDMB 2ZG3A 1NFDA 2DYPB 5I73B 3GUTA 5JORB 3SJVD 5I30H 4KQ3L 5F96L 2FLRT 3DURB 2AV7A 4Z7UB 3CDGA 3PV7A 4I0PD 5DTFA 5GGSY 3RX7A 3IGAB 1UG9A 2FDBP 3THML 1A47A 3WUWB 5J6HB 4F7PB 5EBMB 5I75B 3KPNB 4MJ4A 4WFGE 4UOJA 5HGAB 1RIUL 4J8RA 4LSUL 4LPCA 1DBML 1Q9KB 5JQHC 5I8EA 1JI2A 4LPVA 1U92B 3QBTB 3BD3A 1CDCA 4UDTA 5I66B 4H8WL 3D69B 2YD3A 3CVHA 43C9B 2EIDA 1MWAL 5I9QB 4LNVA 3TCLA 2XTJE 4R7DB 3SDDA 5F21B 4YDJA 2OCFD 3KPOA 1HNGA 5JQ6L 4U3CA 1WLHA 3PV6B 5KTEL 2B8OT 3MRBB 4RZCA 1V3JA 3QO1B 1BLNB 4QXTA 3S37H 1R5VA 3MA7A 1QBML 3NTCL 2Q1EA 3T0WA 1LD9B 4FQCL 3CFEB 5HI3D 1RFDL 1Q9LB 5BJTB 1F90L 1ZANL 4RMVA 3ARSA 2NX5A 4HCRH 3SE9L 5I71B 1JN6B 2YD7A 32C2B 4MJIE 4JHWL 3HZMB 2RR3A 3S96B 1TZIB 1VB9A 4NQVB 3BJ91 2FIRT 3FHQA 4LF3B 4QRSA 2RJMA 3V7MA 1DLHA 1CLOL 1II4E 4RAVB 4QO1A 2H1PH 5BCAA 4JVPA 2BVEA 5KSBE 5HHMD 2DJUA 4OQTL 3G5XA 2PYEB 3QQ3B 1P7KB 1X4ZA 4WI7A 2DD8H 4HS8H 1NCCL 5T3XH 1R5WA 4ELKA 2IAMB 4WWKA 5F9WC 5DD5L 4XNXL 3H9SD 3K2UH 2WWMC 3BI9X 2XACC 4HC1L 1Q72L 1WTLA 1NAMA 5K9OA 4U2YA 4G6JL 5T1DL 3HI1B 1M6OB 1I3RA 2EICA 4X8JB 1P69B 2F5BL 3H8NA 4JRYE 2CPCA 4NO2A 4X98B 2G9HB 4PGCB 1AO7B 4G6JH 3ZSTA 4PJAF 3ARTA 3UTSE 3QUXB 4NZTH 2DM3A 4M00A 2X9WA 2EXWC 2X4UB 2VSDA 3W9DA 1YECH 4TSCH 5ACZA 3VFWA 5H94A 3S36H 5C6WH 1NUNB 3FFCB 3SOBH 3MCG1 3D85D 4JFDE 3VXRE 4F37K 3WFDH 4YDLB 2D03H 5GQBA 3MLWH 5AG8A 4FQXC 4EN3D 3G6DH 4BH7B 2KQNA 1WCBA 3ZO0A 1YYMH 2EYRA 1U8OB 4MS8D 2BY2A 4O5LL 4CMHC 4ODWB 1XF5A 5CJOL 1E6OH 2AJ3A 3VFGH 5IBUB 2CD0A 4GBXA 5KANI 1AD9B 5IHUH 3DSFL 4PJ8A 4M1GH 3RVUD 4PB9L 1UXWA 5CD5D 4MHHI 3MGTB 1EGJA 1T80A 2EEBA 1REIA 3E2HC 3I75B 4JLRA 3V5DB 4OLZH 2YOCA 4JRYA 2AJSH 2QQLL 2DKSA 2X4TA 4FQQB 4FHBD 4WNQB 4BFIB 1DR9A 5GGQL 4WEMB 2IALB 4KJWC 5IB1B 4GG8B 4PS4L 4DCQB 4YHIA 2P1YA 2FX7H 5SX4I 5I66A 2YPLA 4MB3A 1PKQB 2A77L 2IC2A 1XGPA 4OV5A 4X99B 5D1QC 5TFSH 2ZJSL 4V1DE 5DJ2A 4N0UA 3RBSA 3CX5J 3FO0H 3G9VA 4Y4HB 4OCLC 4HS6A 2JIXD 2X5PA 5FYJL 3HMXL 4LIQH 1PG7X 1T7ZA 4OCSL 1NDMA 3MRLA 1I8LC 1YPZF 1HHGA 3A6OA 4Y4FD 3IFLL 3RAJH 3MJ9L 2ADGB 1RFDH 4XPFH 2DI7A 2DBLL 3A6CL 4P46C 4UMGA 2H26B 4KQ4L 4NP4L 3MOQA 5C0JA 1NGQL 25C8H 3CSBA 2XICA 4J3WA 5BZDA 1OP3H 4XH2A 5I1EH 1TETL 2VDKL 2G5BA 1DP0A 5D70L 4EDWH 2DTMH 4G7YH 3IAGC 1QFHA 5JW4Q 1P5UA 4U6HB 4WHCA 3PQYB 5D1ZA 4L3EE 4KKAC 3RWJA 5DQJB 2E8YA 5EPMA 3EOAA 2WIIA 2IFGA 3B3IA 5I30L 3PDDA 4KFZC 4PUBL 4XB7A 1KLGB 4LCWB 4Z5RA 3STZB 2OL3A 5JHLH 1JWSA 3L7FB 2CK0L 4JQXC 1QLRB 3KYMB 2NY6C 5C0FB 3HFMH 4O2CB 1T5WA 5F71A 3EZJB 1FL3B 1W0YT 5J6GB 5DC4B 5EU5A 3MYJB 1GZPB 4NKIH 4PGDB 5CEYB 6CGTA 2A6DB 3HRZA 1G9NC 5ID0B 3BT2L 2N7BA 1OGTA 4IOIA 2NY3B 1T4KB 3GSXB 1WWBX 4NNPL 2J2ZA 1ZAGA 4LASH 3VW3H 2DLTA 4QRQA 4R90H 4YO0A 3NIGE 4OV6F 2A77H 2HT2D 2IAND 5FAAA 5HHOD 4AEIL 1PYWA 4O2FA 2V5TA 4IMLA 5F9JA 1I9RH 1WT5A 3RNQA 1O5DT 3X13B 4U7SA 4A6YH 2PR4H 2ZOKA 5C6TL 3LKOB 3AM8A 4KZDL 3QWOA 5JHDE 5FYKH 4DN3H 4X4XA 5DJ8B 1NGZA 3MRDB 5J56B 3EYQD 4ODTH 4GH7B 2OP4H 4OF7A 4OZGA 5C6TH 2R9HC 5MEND 1JZ6A 1FNAA 1DQTA 5TF1H 1CN4A 1VFUA 5D5MF 3RDTD 4X5XA 2VDMH 2MCG1 5EORL 3P77B 1FZKB 3TT3L 2W91A 1T7VA 2HH0L 1N2RB 3LD8C 4TVSa 3VFTA 4WV1B 3GMOA 1G1YA 4HUWB 2BCKA 4NRZB 4RRPG 4BUHA 2EYTA 4PRIA 3QUZB 2NX5D 1P7QA 1FO0B 3QQ9C 1V8HA 4H20L 2EH8L 5I1JH 4JO1L 3U2SA 4J4PD 2CIKA 3TJEL 5MENA 2ITDB 3LN5A 1ZHNB 2WBJB 5B39G 3TO4D 5K9KB 4ZXBB 1UB5A 1DUYB 3ZE1F 4OZIE 4PJ9D 5ISZB 4W4OC 4OZHE 4Y19D 5SWSA 2AK4A 3F6IA 4U1NB 1NDMB 1RZJL 5LGJB 1Q9WA 1WT5C 5TQ0L 5JPNB 3AAZB 1V7NL 2RHEA 5HGBB 3TYFB 1N6VA 4YLQT 2VDRH 5FV2A 1MI5B 3NA4A 1J86A 3MUJA 2H2SC 1IAKA 1MQKH 4QGYA 5FHAH 3N85L 4WY7L 5GGVL 4V1DD 4FQLH 2YUZA 1HQRA 2EIEA 3FB8B 3OKMB 4QLRA 1KTDB 1IAKB 3P4OA 4HQQL 2FL5A 3F58H 2MHAA 3WFEH 1OW0C 5TE7H 3D48R 1MFEH 4PJHB 1N0XL 1F42A 4MQSB 2VXQH 1BJ1H 4OCXH 2OZ4L 3P4MB 4UTBH 1IARB 2BHUA 1CLOH 3QDHA 3VDBA 5SWZE 2EDQA 3LZFL 3LSOA 1IBGL 1Z0NA 1FO0L 3D3VD 1FFNB 3S4SG 3U0TA 4PRNA 5DDHB 4GMSL 2DIJA 5E6IB 4CKVX 4YHOH 3BEWA 4GMTH 5AZEH 4JO1H 1DFBH 3GMOB 4HUWA 1A4KA 1OGTB 2V6HA 3GSQB 1K6QH 3FAWA 3RKDD 5IMOA 3MLRL 1OAQH 3CFJB 4TYUA 3NOIA 3MOBH 3HLAA 5J89A 2DL9A 1N59A 1P84J 1MOEA 15C8L 3TZVA 3L3JB 3PL6D 4Q6IB 1QLFA 1A3LL 5DK0A 3EOAB 3EYFB 5B38A 3DV6B 4AIZB 1DSFL 3VXRB 1F4XH 3K8KA 1EGJL 3U79A 4U1JB 1PBYA 1NKOA 1J0YA 4UZGA 4YFDB 1XCQA 3SKNA 3DIFA 4E41E 1F58H 4MWFA 5DDHA 3VH8G 1FGNL 2ZOLA 3O3BA 3Q6GH 4GRWF 2XV6B 4L8CA 5D2NE 5DMIL 1PKQE 4CDGC 4JHWH 2VR5A 1HDMA 2V2WA 2HJKA 4HKZA 1HEZB 2DBLH 2H1PL 3RWFB 2R29H 1MHPL 4NO0B 1F3DH 2XOTA 1F4WH 1B2WL 3FN9A 3BRFA 4PJHA 5HHME 2OSLA 3OKLA 4Z7QF 2HG5B 5DHVB 1IGTA 1KPUA 2XWTA 3QQNA 4PLOB 2VLJE 2JB6B 1IKNA 4LK4A 4NHCL 5JUEH 1P4BH 4IDLA 4NWUH 2OI9C 1S7RA 3RPKA 1X5LA 1YUHB 5IEKB 2IADB 4YDLC 2EO1A 1X7QA 5FKAA 5F6HI 4AEHH 1HHIB 4M8QB 2VQTA 1GVIA 4IIQA 4PGZA 1UZ8B 2C1PA 5C0CA 4RZCB 1ULVA 1IGFL 2OL3H 4PJ9A 3F7YB 4N0UE 3OKOA 2J4WH 4KRPB 1UFUA 5FYLL 2ZSWA 3RPIA 5FUOH 2ZPKL 1H3GA 5SV4A 4RDQF 1VHPA 4MQ7B 3MLTA 1G7IB 1NFDF 1MJ7L 3S5LG 5J1TC 2Y36L 1AXTL 3O4OB 3ZT5A 2OLDA 4UDTB 4HH9B 5T33H 1FVCB 1DDHA 5T1KB 3IF1B 4F58H 1VA9A 4PJXE 5ADPH 1H5BC 3QT2A 4PGBB 3U48A 5E08H 1LK3H 1T0PB 4KMTL 4NRZA 4KGLA 1HWGB 3T4AB 1N0XH 1QEWA 4UV7L 1L4IA 5F7UA 3QWRD 1A64A 3U4AA 1GHFL 5LWYH 2VR4A 5BRZB 1QLEL 4NNXB 1U8JA 5DYOB 2X70B 3O3EA 5C07D 5CJ8A 4KRPD 5HY9A 1MWAB 5D7IB 1J18A 2FBJL 4ZFZB 2A6JA 4BSWA 3UTZA 4G43A 5I16B 5DZNA 2QQLH 1JZ8A 2PYEE 1KJVA 1S3KH 1AHWB 5C0EB 3PWPE 4F37F 5C0CE 3AU1B 2APXA 2FNBA 3A67H 4NNYA 3SDXA 3I85A 2CK0H 2C7UB 2WW8A 4BSVB 1R0AH 3VDCA 1MCOL 3GBNH 3T3PF 2BSRA 3OB0H 3WXWL 5BRZA 4WJ5A 3VFPA 5I6XC 4M62L 3GMNB 1F02I 4YHPA 5FECA 3IB4A 4EI5C 2D31B 3UZQA 1INEH 1ITBB 3OAYK 5E2WH 1AP2B 4OD1L 3SOBL 3SDDC 1Q38A 3I6KA 4PJEF 2ZCKL 2EDBA 5L7XL 1CG9A 1MJ7H 1MJUH 4EUPB 1KJMA 5BV7L 3ECBB 4JFFA 5JHDA 3MYJA 3C60C 4DZ8A 2IBBA 4MD0B 3HI5H 3L7FA 5DJZA 2UZIH 4XC1H 3MRJA 1MFAL 1CYGA 1JGUH 2CKBB 1RMFL 1BD2E 2X4OA 2DM4A 1MIMH 3HE6D 3MLXH 4GQ9L 5TH2A 3TA3C 3FCTB 3H42H 4ODTL 3P73B 5F3HB 5JLZB 2VN4A 1QUNA 3DMMC 4OTXL 1F6FB 4JPVH 4NZUL 4Q2ZA 4XP1L 1EK3A 5F70A 2BP3A 5DUMH 4HPOL 2GAZA 4DKAA 4F7EB 2QEJA 4OQTH 4ODUA 2A6KB 2FH6A 4PLKC 1CVRA 3KYNA 2QV2A 3JBG7 5E2TH 3FMGL 1RV6X 4N8VB 3AAZA 1E28A 2F8VA 4GRLA 2P45B 2VDPL 4AJ0A 5L9DL 2AEWA 4GG6A 3P9MA 4ORGA 5SWSB 5MEPB 3NH7L 3RVTC 3ZL4L 3WLBB 4D0DB 3JWOC 3ZKMC 3NGBC 1KLUB 1U8IB 2GJZB 3A0OA 2R15A 3G9AB 4UT9L 4ZTPL 3WS3B 4X6BB 2P7TA 4DJMA 3UTPE 1GSMA 2YN5A 4U6YA 4X7EC 4HLZG 1OGAA 3G6JF 4LSRH 3DRTA 1LDPH 3C6LA 5B21A 4HQQH 5H37H 2CJUH 4U6TA 4UQ3B 3DUUA 3OKKA 4U1NA 4DGYH 3GFUA 1JPGA 3SPVA 4F9PC 4P9HL 5DGRA 3RUGA 3HC3L 5I1HH 4ZXBA 3ULUE 5F6HJ 1CTOA 2DQUH 2J88H 2UWEA 5D5MB 3FRPG 5HPOA 2VH5L 2WWMD 1GIGH 2C4FU 4MJ2A 3MODL 4NM4H 5KW9H 3O2DA 1EHNA 4CU7A 4KJPC 3S97C 2HVJA 5HBBA 4EBQH 3C60D 1FE8H 2YD8A 4JPIA 1JHKL 4OD2B 4PRAB 3RDTB 4CN6A 3RI5F 1GGCH 2VC2H 1VFAB 4PLKD 3NCEB 2A83A 1UT9A 4NUJA 5EOCJ 4IDJL 2Y23A 2IQ9H 2P7TB 3OXRA 4FG6C 3ARBA 4OB5L 1B0WA 3ARFA 4AM0A 2HTLC 4MD4B 2JK5A 4F3FB 3DYPA 2DLFL 1J10A 1Q94B 4KTYA 5JXAH 1JZ4A 2OX5A 1RHFA 4DKFH 5JTWA 1XF2A 1SJHA 4XP6L 3CDYA 4HS3B 5GXBB 4JRXE 5GGVH 2NY6B 3VGFA 4P57B 4N5UA 1PYWB 3KYKL 5F9JB 5M7QA 4NGHH 5HY9B 1UVQB 5DGQA 1T0NA 4L4JA 3T0VA 1MY5A 1ZHLB 4Y4KC 3HPJA 4WI9A 1FC1A 4A6YB 4ELMB 3B9VA 3WFHB 3C60B 1FL6B 1P4LA 4QHMA 4XPAH 2AS5M 2CLVB 1T1XA 1DVFB 3MRRA 5E94A 1NFKA 3AC0A 3G6DL 3L3KB 2YPKB 2VXTH 4YK4C 1IZKA 3NBNA 1J8HA 1DLHB 4M1CD 3FQUA 1QLEH 4HWNA 4XH2B 5LAXA 4QWWD 2Z8VC 1G7JA 5CKAA 5C92A 4P23C 4LKCA 4L8DB 3KS0H 2XWJA 1UJTA 5ISZA 4UV7H 5F1SA 1MLCB 1C5BH 3EFFB 4HPOH 3BGMA 5GZNC 5LVEA 4MQ7A 1CXKA 1QSFE 1IEAB 5D96C 1ZS8A 5D93B 4FRWA 3I6LD 4PJHE 3O2VH 2EDKA 4PJ9B 1W0VA 1MFCL 1N2RA 4LOUC 2HLAB 3FOMA 4ZUTA 1YZZA 2VXSL 2J8UB 2XXCB 3ZDZE 5GGTL 3P77A 2OJEA 2VDLL 2AJVL 3ZKXB 1NMAH 5FV1L 3P0VH 3SO3B 2OL3L 3UCRA 5D7JA 4YAQB 3B2VL 5ALCL 4N0FB 5JIKA 2APBA 3H9ZA 3MV8E 3T2OA 5F6IB 2VLLA 1T5XA 5EDXA 4TVPH 1YEDA 5ITBL 4OLVL 3D5OF 4N0CC 1MCLA 1R3JA 4RGNB 4Y1AB 2X4OB 1WZMA 4LHUG 5IW3A 1ZVHA 2P24A 5SV3A 1RUQL 3KPNA 4JO2H 1GCFA 1QKZL 1QPXA 3FONB 4CMHB 3BZ4A 1X5FA 5I19H 4AM0B 4Z0BH 4NRXB 1U8QB 4X9GA 3S98A 2BC4A 5I19L 4X0KB 1AR1C 2B4CC 1FFPB 3QDGD 4LGSB 4OTXH 1QEWB 5BS0B 3TESA 1TZHB 1OTTD 2WBWB 5AEAA 4G9DB 1A9BA 5E2UL 5EU6E 3P73A 5FKPA 4R7NA 4XXDA 3MGOA 2I9LA 3KLHC 3VXMA 3QUYB 3RWHB 2ESVE 1S7VA 1W0WA 2B4CL 5TDPA 1WFTA 4I48B 3HCVA 4I2XB 3T0DA 1N6QH 3IDJB 2DWDB 1G7HA 3S8WA 1N59B 12E8L 3PWVB 1H3PH 4I18C 3ZDYF 2QHRL 1A1MB 1QSEA 4HJ0C 4LHUB 1RPQA 5T3XL 1A7BA 3IDIA 3O41B 3R1GH 1H15A 4P2OD 3WS6A 1NBZA 3QXVA 4ALAH 3IXAB 4XX1E 5IW6A 5KS9A 1IGIL 3C5JB 1PSKL 2Y9RT 1CL7I 4OZFA 2EZ0C 5EOTB 2VUOA 1NKRA 1M4KA 1U8QA 5IGXH 2C4XA 3FO2B 2M1KA 1EEUA 3MRGB 3IXTB 1XIWD 1YNLH 1T0MB 3FB7A 3OKDA 1Q0XL 4BM7A 5HGHB 1SQ2N 2FSEA 3BIKB 4GRMB 4P2YA 3DX9B 3CXDH 4OLYL 3FT4B 4RBPH 3C5ZB 1JF5A 4L3CA 4X8JA 1LE5B 1IBGH 2FATH 3B9DA 3HHRB 4NO5B 2VIRA 1ZEAL 4L3AA 4CW1A 4OJFL 3SE3C 4LPYA 2WMPA 3O0RL 3BN3B 4IJ3B 4P2OB 4Z7QE 1GGBH 2V2XB 3FB8A 5GRWA 3O2DL 3SKUD 1GHFH 1I8IB 1KG0A 5KZCD 3WFBL 2K7PA 4P9HH 2HLAA 3FOMB 1S7TA 1YEJH 3AY4C 3VH8B 4NDMB 1CD9B 2X1OA 1G0YR 5ALBH 4U1GB 1S7TB 3GSVB 4K8RL 3VWKD 4OZ4A 2VUYA 3MCLL 5EU3A 3L1OH 2ATPB 4W6XB 4AH2B 5GRVL 4GBXB 5D7LD 5I8KL 3H9HA 4I1NB 1WUNT 1AGBB 4JM4L 4DGVH 2B7DT 1N64L 1PY4A 2P43B 2RIKA 2XN9E 5CEZE 4DEPC 1S9WA 2GJ6D 4JZOB 1YMMB 1UWXK 1J0ZA 1R5VB 3QUYA 3LEXA 1J0IA 3HZVB 3BKCL 3DO7A 3ZE2F 1MCEA 1AI1H 2UV3A 8FABB 1HINH 2GTZB 3PF2A 2NXYC 4H0HB 1OTUC 43CAA 2OK0L 3SDDB 2B0SH 3OZ9L 4X0KA 5C0BE 4YEEA 3I02B 5L2JB 1HXYB 3V4UL 3GSNA 4MNHB 2NZIA 4KKLC 2VLJA 2YD5A 4K3EH 1PQZA 1A3RL 2VXTL 1ZA6B 2IH3B 5F9OH 3DXAD 4DOHE 2Q20A 3Q48A 1T1WB 2ADFH 1TVBB 3GSNL 1FP5A 3V4VH 4JFDD 4K3EL 1MREL 3QJFB 1JGDA 4ZNEE 3I3BA 1GGIH 2V9TA 3MACL 3ULSB 1HWHB 2VH5H 5EC1B 5ICYA 1BOGB 2XG5A 3KPMB 2HTKC 1KUMA 1UZ6E 5D2NA 3JV4A 4NWTH 3U9UB 2XKNB 5IHUL 3OG6B 2BNQD 4QRRD 3BWAA 2X4SB 4NBXB 3IFOB 4QRQB 4KI5F 5IMOB 4OD3L 2BXYA 2DLEA 3DXAA 4I5BB 1DBAH 5TQ2H 1WFUA 2APFA 3SDDD 3WXVH 4JREC 5L9DH 4KK9D 2RB8A 5B8CC 3V0VB 3IDNA 1JBJA 2ENYA 4UB0L 1FRGH 4G9FA 5E2WL 4BH8B 1HKLL 2MPAH 4XAKD 1D5MA 1AD0A 5J9PB 1RHHB 4K9EH 4I77H 4AQ1B 5FYLH 5KSAB 3ISWA 3MMEA 4NYLA 1J87A 4FFVD 2Q7NA 1LNUA 4KZEH 1T03H 3QFDA 3MLTB 4QXUL 5D7KE 1KN4H 1T1YA 4PREA 1UCTA 3TBSA 1AXSA 1A7NH 4Q74A 5TDNA 1F90H 1ZANH 3VFMB 3CMOH 4JDZB 4JDTL 1YY9C 4XBGA 2DQGL 3L3KA 5HHNB 5F72S 3JSSA 1EAPA 2CDFA 1JTOA 5DLMH 3V6BR 3QXDA 1EEZB 3O6LH 1M71A 3OSKA 2YPLE 4LEOA 1Z5LB 4V2CB 1RJYA 4R97C 2XY1A 2R2CA 2FH8A 1CDUA 4XP1H 3RTQC 2E9IA 1AR1D 3EDFA 5E6YA 2FX9H 1QNZH 4EN3B 1SY6L 3OJMB 5E8EA 5ICXB 3HNTL 4DW2H 3O3DA 2EH8H 5I1JL 1QYGL 4RNRA 1YDPA 2GYSA 4NJAH 5IMLB 1K8IB 4PB9H 4Y5YC 4AL8L 4U33A 5LGJA 2EDDA 5D1XC 1XGRB 3KLSA 4I3GA 3RWDB 4MJ5A 1BZ7B 4RGNC 4CAGA 4WO4B 1ZE3C 3LKNB 1FPTH 4LLWA 1BFSA 2BVYA 2DM7A 3MJ8B 4U2ZA 2NNAB 5FA3A 2ZCKH 5GJTL 2A6IB 4DFHA 3NIDF 3O8XC 5ERWB 5KSUA 4UU9A 4UAOC 4ERSL 1DEEA 4OCMC 3EYSL 4PTTA 1CR9L 4ONFH 3MNZA 4DKFL 1DQDL 3OHXA 4X83A </