4XHJD

Ghgl of varicella-zoster virus in complex with human neutralizing antibodies.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
224
structure length
207
Chain Sequence
b'QVQLVQSGAEMKKPGASVKVSCKASGYTFIGYHLHWVRQAPGQGLEWMGWINPNSGETNYAQKFQDWVTMTRDTSINTAYMELRLRSDDTAVYYCARGGMTMVRGVMMDWGQGTLVTVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKRVEPKSCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein H
publication title A site of varicella-zoster virus vulnerability identified by structural studies of neutralizing antibodies bound to the glycoprotein complex gHgL.
pubmed doi rcsb
source organism Human herpesvirus 3 strain oka vaccine
molecule tags Viral protein/immune system
total genus 27
structure length 207
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xhjD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xhjD01
4Z8FH 1RIUL 2AS5M 1FORL 5IROA 5LGKA 5IQ9B 1MH5B 1W0VA 4NKOA 3HN3A 1P53A 4NM4H 5FUZL 5K9JL 2XY1A 3BO8A 2NY3D 4PJFA 3AVEA 3QAZC 3MRMB 5E4EB 4L3AA 1QRNB 3RWGB 3MV9E 1U95B 2JCCA 3QULA 1MHPL 2AXHA 5FCUH 1QNZH 3RZCB 1SYVB 1CL7I 3AAZB 1FFNB 5D2NC 2JK5A 4PPTA 4NP4L 2J8UF 5E2UH 3D85A 12E8H 1Y6KR 4D0BB 1WFTA 1WBZB 5DJ0A 1FP5A 4WVRA 1RURH 4UNTA 5AAMA 3ZE2E 1TZGH 3UTQA 5TGBA 2F5BL 4O51B 4YFLI 4JREC 3PABA 4AENA 3GDBA 4NGHL 1UWXK 1ZLUH 4PJCF 4G6KL 4GT7A 3DOSA 5HHQA 4N0UB 4JDVB 4L4TB 4EQ2A 4NNXB 4BYHA 4EN3D 3D18B 3P77B 2AV7B 3B9KA 4IEFB 4NRYB 4D0DB 4YFDB 5GSVA 1KELL 1T89A 3J8F7 1RZ8B 3O3UN 1MAJA 1QR1A 1V05A 2NY2C 2DKMA 3QO1A 2M8XA 1IM9B 4S1RH 2H8PB 4BFEA 5E03A 4PRBA 1NUFA 4I77H 3R0MA 1ZXQA 2AK1H 5A2JH 1PJ9A 1NCCH 3IRZA 4I1NB 4JZJA 4PG2A 2D31A 4UI2A 3G5YA 4FMFA 5EUOB 5DC4B 2VLKD 3S4SA 3WIHL 4P5MA 2V17L 3QEUA 5T5FL 2HN7B 4OZFG 4HJGB 2VAAA 5IFJA 3DETD 3WFDH 2IFFL 2HH0H 4U0RB 1D7FA 1JUFA 5TQ0L 3FOMB 5EB9A 5CMAB 2E7LA 5DHVH 1IAIH 2DJ4A 1SYSA 5DJYB 2UYLA 5DRZA 1AC0A 1AD9A 1ZHLB 5EPMA 3IVKA 1DBJL 4Z18A 4JANB 3FO9B 3FTGA 3T4YB 4PJGE 2BXYA 1YNTA 4PJ8A 4WW2A 4ORGB 5DC0A 3EAKA 1LEGA 2QV2A 2HJLB 5EU6D 1A21A 3NCEB 4PB9L 5HBBA 5B4MD 3EO9L 1S7RA 5E8EA 4M1GH 4LARL 1KENH 1UYWH 3VMNA 3DYPA 1QR4A 5T1DL 2HKFL 3W39A 2FYYB 1Q9LB 1A1MA 3AXLB 3DXAD 4OZHE 1WC7A 1CGUA 2HJKB 2WZPD 2A6DB 3E2HC 1FBIL 1GC1C 4CBPA 1VFMA 3U0PA 4Y2OA 5JZ7C 3PIQB 1MLBB 3DSFL 4LP4A 3AU1B 4NO0D 4XMPH 3TO4B 2YK1H 3RL1A 4ODWA 1RY7B 2CGRH 4TVSa 2IBZY 1CDUA 3UTSB 2OBGA 1P7QB 1X5LA 5FKPB 5IOPA 2D3VA 2YD5A 4ONGL 3QEQB 2EKJA 4OZIF 4NJ9L 2P8MB 2KQMA 1JNJA 4M3JA 4JHWL 4Y5XC 3K3QA 2QADB 4MB5A 4LIQE 3O8XA 4XPTL 4QY8A 5DJ8A 4U1HB 3RA7H 3C5JB 3HE7B 3W0WD 5ACZB 2NXYD 4LF3B 3TESA 1KGCE 5DD3L 3PDOB 4K07A 5C0CE 1QSEA 4M7JL 4PJBA 2IG2L 1YYLH 5IFHH 4OF7A 3AREC 4WU5B 1S7UB 4MJ6A 2R9HD 2VKWA 1RFDH 1OAUL 4XP1H 4ZODA 5C6TH 4YR6A 1RZJC 1I3GH 4NQCE 3BP7B 5C71A 1J5OH 4RFNB 3QIBD 1DBML 2ZCLH 4PD4J 5DRNB 4HUUB 1BM3H 1ZT4A 3SCMB 2I60H 3TCXA 4XMKH 1CS6A 2EE2A 1JI2A 3DMMB 1QA9A 1J11A 3ALWA 1QOKA 3D6GA 3HI5L 3BD5A 2WQRA 2VDLL 5C09D 3NA9L 1ADQA 3H0TB 2H32B 3KPSD 3CX5J 4K9EL 3D18A 1OAXH 2C9AA 1KLUA 1OAZH 5MERA 5B39G 1N3NA 2BNRE 2H1PL 3QHTC 3QA3B 4HEME 3V4PH 3U4BL 5HTSA 5ESVA 5DD5H 5CJ8A 4TSCL 1MVUB 1MQKH 2O5YL 4U1NA 3RZWA 4G9FB 4PJHF 3ZT6A 5MENA 4Y4KB 4PJAA 5C08B 4BSVB 2EDFA 3D39E 3HCVA 4XCFH 3MLSL 3N1FC 2X4PA 4EQ3A 4XCCL 3BT2L 3JWOL 4QGYA 3NBNA 3RDTD 2NCMA 4NHCL 3STLB 1CLYH 3KS0J 5C0BD 2IF7A 1NCBH 2OZ4L 1G7QB 3EHBC 2ATPB 3M17B 3C5ZC 1CE1H 3MBXL 1QEWB 1UCBL 1MAML 3TCLB 2ZUQC 5E6IB 2UUDH 1SJVA 5TPWH 5CMAA 3ARGC 1D6EB 4QCIB 5MI0B 3T0EA 1LWRA 2EZ0D 3QZWG 1EXUB 2OK0L 2GAZA 2YN3A 3T4YA 2Z35B 3VXRB 4QRSA 4HZLA 1QFHA 1CFSB 2NY3B 1I3RB 5IBLD 1B0WA 2BFVL 4O2CA 4AEHH 4N1HB 2AXFB 4DCQB 5TE4L 3WFEH 1NAKH 2J6EA 4WFFD 2L7JA 1I8MB 1Z0MA 1KFAH 1U93A 3WE6A 4GG6A 3GHEH 5I1JH 1FO0A 3QUZD 5ICXB 3MRKA 4M1DL 2X4UA 1A7OL 4AIOA 4TNWF 4PLKD 1JI1A 5HVHC 4L29B 3K4ZA 3LKOB 3GK8H 5F6IC 2IADB 4LHUB 1RQ5A 3MRLB 1A6PA 1K8DB 5CZKA 5FKPA 1JK8B 3BUTA 1ZLVK 5IIEB 3QH3B 2X1WL 4N8CH 1S78D 4QTHA 4Z7UE 3PWPE 2BC4A 3B9AA 3MRQB 1OT2A 3DVNA 1R0AH 4FQPA 3O2DH 4DK3A 3S37H 4XI5D 3BD3A 1CD9B 1HSBA 1CFVL 5ID0A 3EGSB 4FQXB 2A6IA 3QUXC 4G7YL 1BWMA 5DFVD 4NRZB 1N5YL 5DVKA 3BP4A 2B5IB 5DI8B 2B2XH 3LEYL 3VFVB 3DLQR 3MNWB 1T3FB 4XZUA 1BQHA 3KPMB 3MLZL 1IZKA 1T7VA 1IKFH 3KLSA 1T6WA 3ZTJH 3PNWA 1UJ3C 3SCMA 1N6QL 4YXHH 2D03H 4NYLA 3B2UC 3BKCH 1RHHB 3JBG7 2JB5L 2DBLH 4WTZA 2IBBA 1PGRB 4DOHB 4JE4B 5CJXA 1BF2A 2WLZA 3FQNB 4FMKA 5AEAA 3U79A 4I0PB 2Z9TA 4LQ1A 3LN4A 4F8TA 2VQUA 5LWYH 1BECA 2RCSH 1FNEA 1NFIB 2ENSA 5DUPH 1GOHA 4KI5F 4NO0B 1FGNL 1BFTA 1KPRA 1F42A 5HI4D 5HJ3B 4Z7OE 5HHMB 5I8CB 2DJSA 5E00A 1BF8A 2VL4A 5T3ZL 4JJ5A 4LAQL 1XCTB 1VENA 4RMQA 1X44A 5HYQA 5SWSA 4S2SA 6FABL 4P2RE 4EUPA 1H3UA 1X5JA 3MJ7A 1BQSA 4J3VA 1QLEH 3RVTD 5I75C 3S36X 4WO4B 3FO2B 5FYKH 2ZUVA 4PTTB 4HUXA 3NPZB 1QFWH 2CDEB 3IAQA 4OCWH 5INDB 2DM3A 3QG7L 2QHRH 4PJIA 4RWHA 3GSNL 4FS0A 1CLOL 1MWAL 3V5HB 3CZFB 4G8FA 2NTSP 2FDBP 2ITCA 3LB6D 1CCZA 4KTEH 1I8KA 1KCUL 4HCRH 4EXKA 4GKZB 3ZYIA 4GS7C 3VXRA 3HZKB 4PY8J 3OWEA 3OXSB 1AGEB 4GRLD 5JHDE 5IT2H 1L7IL 3DNKA 5D7JA 5T3XL 4LMQE 4ODSL 3OKNB 4YDJB 3WS3A 2B7DT 5C0FB 1NC4D 4WWKA 5KOVC 3VFTB 2YD1A 5F96L 2YPLD 3VWJD 5SX5H 5LJYH 1U8NB 2JJTC 2WUBH 1OTSD 4RBPH 4HHAB 1PG7L 4WUKH 5FM8A 1OP3H 2FBOJ 1KYOJ 4GXUN 4WW1B 4XT1C 3CCHB 4LK4A 3SDYH 2C1PB 5F1KC 3P4OB 4JLRB 2GY5A 2DD8L 5HHOD 3VXUD 3W2DL 4M7LL 1YQVL 1SVZA 5J1SC 1I1FA 1G6RH 3ARBC 4BFIA 4KI5C 2FEDD 1NH6A 1JPGB 4OLYL 3MRNB 3A67H 1XF2A 2DF3A 5KSBE 1G7MA 5HGHA 4EDXB 3SQOH 2H9GB 1A6WL 4GXVH 2VDPL 5C0JA 4O58L 1M7DA 2HTLD 1N64H 2R1WB 3RDTB 3UTZB 1IC7H 1WEJH 4GUPB 1UA6L 2Z31A 4PJCA 1T0MA 4RAVB 2PO6A 1DEEA 4ZFOA 1YY8B 5BZWB 3FFCD 1OM3L 1XGYH 3JTTA 1T0PB 2BOBA 3HHRB 1ZEAH 5DMJB 5GIRB 3SJVE 5FA3A 1EZVY 1KPVA 2C3VA 1S9XB 5DSCB 1BBDL 3PWUB 1XR9B 2Y1VA 4IOIB 1OF2B 1YZZA 3GIVA 3TC9A 2DKUA 4F7CA 3PJSB 3IDMB 1QFOA 4NWTH 1KT2A 1X3DA 4LLUB 4RAUA 1RHHA 3ALXA 3CFIC 3ZDZF 4Y4HD 3WNNA 1QFPA 3T77A 4OLXH 1RUML 2H26A 2EXYC 1WT5C 3MREA 1R5IB 1RJLA 1LO5B 2VLJA 5T3ZD 4ZDHB 1PQZB 2OLDA 3WFCL 3FO0H 3JWNC 3QUKA 4G5ZH 2DYPA 4KKBC 4JM4L 2LTQC 4PRAA 1KXVC 4NQVB 4AY0A 5IEKA 3SOBH 3IAPA 1R3HA 1QKZL 4U1IA 4QXGH 5EBGA 1MCRA 4U6TA 3UJTL 2NX5A 5HYSG 1PKOA 2UV3A 1T7WA 4LCCB 5HYJE 3NOIA 3G6JE 3L7EA 3ZE1F 4DFHA 5L0QB 4P4RB 2OR9H 3N9GL 2Q8BH 4RQQB 3C9NA 4OIAA 4BQBA 3O0RL 4XP9H 3VA2C 1TJIH 1FFPA 3EO1A 3OMZA 4QRPD 5KN5B 4K94C 4XXCC 4H25B 1XIWA 3HMXH 4G8EB 4KAQL 5AZEL 3QUMH 4YHLL 5KVFL 4KH2A 4JPWH 1MJJB 1TQBC 4BQ9A 4XVSH 1U3HB 3EYOB 5T3XD 1UWGH 4Z7QE 3RWDB 3BZ4B 4KRLB 4Q74A 4RDQF 1ZAGA 2I27N 4QXUL 2OYPA 4GMTH 4F7MA 1HYSD 1UQSA 5I1EL 2AJUH 2D9CA 5DFTA 4HKJB 1JHTB 1WIOA 3ET9F 2VDOH 3AGVA 1F4XH 3C2SA 5DVMA 4JFED 5HDBF 2F53D 3O6FB 2UWEE 3GMQA 4J6RH 5FB8B 5F3HB 3VU2A 4L4VA 5HDQL 4MA7H 1IC1A 1LK3L 4PBWD 4AG4H 4P2CG 1FRGH 4KHXL 1NDMB 5DK0B 1HEZB 3OB8A 1MREH 1OTTD 4JAMA 4P5TA 2K7QA 1KTDB 2X41A 3VFOA 1DUZB 4ZAKB 3V4UH 3GI8H 4FP8H 3BMVA 1KJ2A 3JTSB 1JTTA 2OS7A 3O2VH 1N5AB 2PW2A 1NAML 4NCC2 5EZOH 5D7IA 4HC1A 2NY6D 3D85D 3G6AB 3I85A 1R3KB 4LPCA 2ARWA 1LHZA 2NY4D 2N56A 4YBLB 4NDMB 2VDKL 4PV9A 4N5EC 1BOGA 5E0QA 4POYA 4FNLL 5DC9B 4XX1G 1X4XA 3MLPA 2QR0A 2X05A 1AQKL 5I15L 5I8EA 2IPUG 2VDRL 3WJLC 3G08A 3B9KD 5EWIH 1VGEL 2EDJA 5GRUH 5ETUA 4I48A 3RIFF 1HK6A 3GBNH 4R26L 2I9LA 3EZ8A 5GRWA 5E1AB 1G84A 3HB3C 1G7PB 1QYGL 3GMMB 1I1RA 1ADQL 4CGTA 5HGAA 3VFRB 1HQRA 4ERSL 4OUOA 4U49A 2XKUA 3SY0A 3VXPA 4U1GC 1I4FA 3DJ9A 1ORSA 4HWEL 4KHTL 2OI9C 1HHKA 1BJ8A 4Z7OF 4GRLB 5FYKE 3QNXB 1E4KA 1Z5LA 1MSPA 1SMOA 1KCRH 4M93C 1LK2B 4PGEA 1FYTD 3CFJB 2GHWB 2WQ8A 4LCYB 2FH6A 3VWJB 1T0NA 5EBMB 1HN1A 2VWEE 4Y19A 5B38G 4PV8B 3CDCA 4JFFA 1NUDA 1NSNL 5KJRH 3ULSB 3UTPE 5C9JB 5DK2B 5B3JF 3ABZA 5EO9B 3NCYP 2F58H 4RX4A 4OZFH 2XQBL 1T83A 3B83A 4KMQA 4XMLL 5E6YA 3ZDYE 5D4QA 4I3SH 5E2TH 3WN5A 1JVKA 5D7KD 4PJXB 3BRFA 2VLRE 4FQHB 3LH2L 1LP9A 1JRHH 5HDLA 3ARFD 5ENWA 4ZSOA 4POUB 3BDYL 1N2RA 3LMJH 1TVHA 4P3DA 2X1QA 4M5ZL 2ED7A 3F7VA 4F2MB 4I0CC 3NCJH 5MEOB 2J8OA 5EU5B 3V4VH 1LVEA 3TH3T 4TSAL 4P3CH 3LIZH 1Q9KA 4DJMA 3OKOB 4P2OB 4DGVH 3BQUA 3EYOA 4HAFA 1J12A 1FO0L 3PGCA 3W9EB 5I66A 5A2IH 5JOFA 1YPZB 2XZAL 3EZJB 4P4KA 2DDQL 4BK5A 2A77H 4ZOCA 1IJ9A 3C2AL 3HG1A 3K4AA 3HS0B 4I8DA 2AP2A 3EDFA 1H15A 2H41A 1MCFA 1S7TA 3NZ8B 1FZJA 1KB9J 4LCIH 1WF5A 4JY6B 3CGTA 2VSDA 3S8WA 3T3PE 3ARUA 1TCRA 2WMPA 3EJYD 4GAYA 1IEBB 3IJHB 1M6OA 3QCTL 2UVFA 4NZUL 2IAMB 5EO1B 1MFCH 2ZUTA 2MQ3A 5HHNB 1RJCA 4IOSD 2DWDB 1T2QH 4OZGB 4JFHD 4O02L 4DKFL 6CGTA 1WZKA 5TH2B 1CZ8L 4Q0XL 4HJJH 3A6OA 4HIJA 2B0SL 3UX9B 3BZEB 3V2AR 1S3KH 3RJQB 2KZWA 1HZHH 1QFUH 2PN5A 3ZT5A 3FT3A 4YDIH 2XKNA 1OCWL 1SJEB 4D3CL 5EU4B 1A6ZB 3OAYK 3PHSA 4HK3N 4ELMB 1TIUA 2VDNL 2FHCA 3IXAB 2DQIH 4GW4B 3EYUH 4LLYA 3TNMB 4MNQE 4ALAH 4W68A 4EDWH 4FQ1H 1I85A 3ZLQC 3GEWB 3UAJD 2FX9L 1T1XB 4YIQB 3O6KH 2AJSH 2R4SH 4XH2B 2WSKA 4M8QB 1BOYA 1ZSDB 4AT6B 5LGJA 3BD4A 1YUHA 3KPPA 5TE6L 1HI6B 1J87A 1M05A 1HWHB 4KXZI 4LU5H 4MGXA 3ARXA 5CINL 3QWOA 1C5CL 1Z6JT 4LGPB 3GRWH 5MEND 4OM1L 2D2OA 5E7FA 1VGKB 1BIIA 1LGVA 1MCHA 2V5TA 5J7CC 4DQOL 4QRRA 3D25B 1Q0XH 1IEAA 3Q48A 4JFEB 3G6JF 5IR1A 4CMMB 2JLLA 4KZEH 5D71L 1DLHA 3LHPH 3MUGB 4ZOBA 3VH8A 5KSUA 2DN7A 4HUWA 1FZKB 2DJUA 2BNUA 5A1AA 4NQXA 3T0VA 2CIIA 5INCB 2XWTA 1J0ZA 3DBXB 4Q2ZB 4KRPD 3S37X 3EUUA 2R8SL 2JTDA 4Z7QF 5CSZB 2QQLH 1UB6B 1RHFA 2MOVA 1XR8B 2DQCH 2IC2A 2R2HA 5LVEA 1JGLL 3I6KB 5D2LF 3QHZH 1AIFB 32C2B 3GBML 2NY4B 1U36A 2VZVA 4O2EA 4CVZB 4ELKA 4LHJB 3BVNA 2NY1D 4NWUH 3IFLH 4NM8H 3MRRA 1KTLA 2DLGA 4G9DA 4Y5YB 3H2WA 1ES0A 2HT3D 5LGHH 5IKCA 4LSPH 1XCQB 2AK4A 1AHWC 1IGMH 2DIBA 3MRGA 4MXWH 1G0DA 1A7QH 1CGVA 3SE8L 1W8OA 3ZYJA 3D3VA 4HS6A 4MNHB 4OT1L 2Q7YB 1A4KA 4M5YH 3O6LL 3L3KA 1A7PL 2RHEA 2LU3A 2HT4C 4JO3L 1FL5A 2BDNH 5GS0L 5BS0A 4PJ9A 5C07A 3WBDA 2GJ6A 1T21B 4R0LA 4LEOA 2R2CA 5CIPB 1WITA 5DVNA 3ZTNH 1HHIA 1O7VA 3HI1A 5SWZA 1FYTB 4M1CD 2M2DA 4X98B 5F9AC 3RTQD 3STZB 4FQQA 1DUYA 4IS6A 1MCOL 4ZUVA 1JPTH 2YRZA 4RGOH 4H1LB 4GAJL 1T03L 1M7XA 1U8JB 1T1WA 3P0YL 4NPYA 5C0EB 5FO9A 3BRDA 2R2BB 2P4AB 5E9DE 4Y89A 4ZFOL 4J2XA 4U1LB 1NCAH 3WIFA 1FNGA 1JMXA 4HFUL 3ES6B 1WTGT 5I30H 5I6XB 5AD0B 2BZDA 2BVYA 4Q9QL 1XH3A 3ARFB 4NSKA 4OI8A 5EBLB 4JM2B 1RJYA 3J7HA 1R3LA 3W81A 4F7TB 4Z7VE 3L5XL 4HBCL 3WEXA 3QXWA 5HI5C 1FV1A 5EZJA 1ZKAA 4V1DA 5ICZA 3T2NL 4Z95L 1EHLH 5EZIH 4XCYA 2DBJA 1YEDB 1ZHBB 3V6OE 4OV6F 1P6AB 4TUKH 4JFOB 4UQ2B 1P6FA 1UWXH 4GKSB 4QHNB 3ZDYF 2DQTL 5T33H 1A02N 2H2SD 3S4SG 3OSKA 1EFQA 5BVPH 3Q5OA 5IVOA 2O93L 3JVGC 4H0GA 2HFTA 5HVWA 4I2XB 3L9RB 3T0WA 4XNZC 3MUGA 4XCNA 1AGFA 5JUEH 2GY7B 4UDTA 2FHBA 1KOAA 3TA3A 1NAMB 5JQ6H 2XQYG 2P8LB 4BQCA 1B9ZA 4OFIA 3SE3C 5I1CL 1VEPA 4N1EA 3ARQA 1YEGL 5TDOA 1U8KB 2NR6D 3SGDI 3VDAA 3VW3H 1YYMH 1BQUA 4X4MA 5INCA 4JB9H 3SDAC 1YMMB 3CVHL 4M6OH 1A14H 1T22A 5I1GL 3VG9C 3IGAB 1D5BA 3EFFB 5CSZA 1AC6A 3WJJC 4FXKA 1EJ6A 4HX1B 4WWKD 4Z0BH 1TZHA 3UJIL 1SBBA 2P5WA 3HPLB 2BY0A 4ZFGL 3NMEA 3TEUA 1J1PL 3K2UL 2AV1B 3QP3A 4LVNB 1FLRL 1NGQH 3T3PF 3S34L 3MBEC 4G8GA 1IM3B 1N0LA 2XPGA 3DARA 2V6HA 4P57A 1H8OA 3C6LA 5DHYB 5F9WC 2IPKA 5GS0D 2A6KA 4G6JL 5KVEL 4M9PA 4YK4B 3K4DA 3QI9C 5FCSH 2PCPA 5HVFB 4BUGA 3NIFF 3D2UA 2VWEC 4OD2A 5FGSA 2D7PA 1VFBB 3SGJC 1OP5H 1FHGA 3IDYB 3ZL4H 3GMLB 3P4LA 4B0MM 1JWMB 4HT1L 3UTTA 3OKDB 4S1SL 2Q3ZA 5H2BA 3MCLL 3QIWA 4ZUUB 1AFVH 1EGJL 3P4NB 5FO7A 2HLFC 4TNVF 4PJ7A 3RWIA 5A2FA 3I02B 2HFEB 4WUUE 4XXDA 1PBYA 5HI3C 1OTUC 2NW3A 5C1MB 1OY3B 4ISVB 4A2LA 1MJUL 3BW9B 2WBKA 2ESVE 3UYRH 1S7VA 2VAJA 3P9MB 2Z8SA 2PYFA 4LSRH 2Z31D 1DE4B 1JZ8A 4I18C 5K9QG 1RIUH 4IRJA 3S3PA 5IGXL 2DTML 3KLAA 3MR9A 2F54B 2XIDA 3G5ZA 1NGYA 3MRPA 1DJSA 2X9YA 2BVQA 5L2KA 3KXFE 1BIHA 1JFQL 3FB8B 3UJJH 1LO2H 5JOPD 5FYKU 3TZVC 2FCBA 1DQML 2VR9A 1QQDB 2W1NA 1TTFA 2VXVH 4D9QD 4MXVE 3MLVL 3LKNA 3WDJA 3WKML 4CNIA 1YEFH 4LBEB 2YHGA 4X4YB 4G42B 5AZ2H 5E4IA 3RUGE 1YEEH 3OXRA 1IGJA 5M7QA 4G6KH 1AXTL 4Y16C 2VLJD 4KKCD 3BISA 4JDZB 4HS3A 5J1TC 3ARED 5ERWA 2DYPD 3CUPA 4XNYL 3QDMB 4UOW1 3OB0K 5KTEL 1KELH 2NYYC 5ITFA 1DBBH 3HE6A 1KJVB 4QF1A 1YQ2A 4V2CB 3MCKA 2NX5D 4UILL 5DA0B 3RI5K 4S10A 2DMKA 1GGCL 4ZYKB 3RKPA 5F7NC 1MFEH 2DI8A 3KYKH 4YDKH 1T7ZA 2OJZH 2G5RA 4AMKL 3H9HA 4HXAL 3VXSD 3WV0A 4OFPA 3ARPA 3IU3A 1R5WB 1EUUA 2OR7A 5LQBH 2MSPA 3BIAX 1C16B 3WIHH 4KV5E 4RGND 3RFZC 2A73B 1GGBL 4MA3A 1CFTB 5DD0L 4ODVL 2CKBH 3F6LA 3I3EA 3RTQB 1CDJA 3X3FL 1YN7B 2EDKA 4G6FB 2IFFH 5DJCB 3QDJE 5EO0B 3MV8B 1NC2B 5H94A 4OI9A 4MSWB 5IV2A 3C87A 1I1AC 2G5BB 3P0GB 1HWGB 2BJML 1JPST 4HKBB 3FHAA 3GJFB 5ISZB 4FQ2H 3UC0H 5IW1A 4H88L 2F5AL 4RAHA 1JWSB 3WUZA 1J8KA 5GGUA 4X7SH 5I17A 4LARH 3K7UA 5DDHA 1RVFL 5GGVL 2ADJA 1S7QA 3HZVA 1CR9H 1ZOXA 5I71B 5DGRA 4WHCA 4HF5L 1T4KB 3R1GL 3AMKA 4J3TA 1FYHB 1FBIH 4OF5A 2D7TL 3G5XB 5F7EL 2HFFB 2P1YA 4WFGE 1V7NH 4X6EB 1IQDA 4MNGB 5C0GB 1S9VB 1TXKA 3V8OA 3ARGD 1ETZA 3LQZB 3CFEB 2OQJB 4EJ1C 4U1KB 2CIKB 4PJDB 2NW2A 3UP1A 3RWCB 4UTAL 3QAZB 5E5MB 4ONGH 2RBLA 2KH2B 1EV2E 2EDTA 4UZGA 5GPRA 5D2NB 2MCPH 3UROR 4FN0A 1HXYB 1K2DB 3OKDA 2WBJC 4Y4FC 3B43A 1WBYB 3MRBB 4YHIB 2KZ1B 3E8UL 4KROD 3OX8B 4IMLB 4TUJA 1RZ7L 2MHAB 1F4YH 4JREB 3X3GL 4KZDL 1O0VA 3RQ3A 1MJ8H 4PR5B 4OLUL 5DD3H 1ZHKA 4M7JH 3PL6C 4KC3B 4A2MA 2IH1B 1DQQB 2WNGA 3OHXB 4RZCA 4L8CB 3L7FB 4B5EA 1BQHG 3QFJA 3ZE0F 3X11A 4X6BB 3HMWL 3CNKA 4M3KB 5JNYA 4NFCA 3HFML 5EFIA 3MQIA 2W91A 4YHKH 5FECA 4Z7VF 1CXEA 3FKUS 2ICWB 2NY2B 4FQLL 2FNBA 3NIGF 4LSSL 1JZ2A 1ZGLB 1NANH 1MFAH 4WTZG 4NO5A 1JNHB 1A1NB 1NGWA 5F1OB 5EZLB 3HI5H 3QUXD 2N7BA 1ZANL 3ZZ1A 2DI7A 1IKNC 3MJ8B 5IB3B 3NA9H 5GGRA 4Y19D 5BQ7B 3MYJB 2VLKE 4C57C 2FD6L 5JPMA 4CU7A 1BGXL 1H3PH 4JFFD 4K9EH 2YS4A 2EDWA 5ADOL 2JJSA 4WU7B 2APVA 5EG6C 4K2UL 4DZBB 1EHNA 2VRAA 3OKYA 5I1HL 4RX4D 4Y2DA 3QIUC 1JP5A 2JJWA 2FH8A 4X99B 4TSCH 1OGAB 5EC1A 3RWHB 1TJGL 2J88L 2RQ8A 3IFOB 4EUPG 5C0IA 5EU6E 5I16B 4BUHA 4JQVC 3PGDB 4XCCH 3BT2H 2V7HB 3B6SA 4QHLB 1OSZB 2A73A 2J8UB 4NHCH 3CFCL 4OJFH 3MV7E 4UUJA 5D2LA 3E2HB 3HRZB 3DXAE 1BX2B 4BSWA 3LS5L 2G60H 1OB1B 4LCWD 1P4BL 1JWUB 3VFMA 4E41E 3BQUD 5J3HC 1Q94A 4FXLA 5I18L 8FABB 4P4KD 3X14A 4Z76B 4D9RD 2OK0H 2ZNXA 5BRZA 4MDJA 3HG1D 3PF2A 4HKBA 1V3MA 1FVDB 4FTVB 5J11C 5C0AD 1GIGH 4LIQL 1TNNA 1NBVH 2BFVH 5F6HJ 1HHJB 4YX2L 2I07A 1ZT7A 4Y5XB 2CD0A 1GOFA 4POZD 3DURA 1CICA 5BW7A 4EKXA 4KK5D 2W0FB 4PP1D 1X7QB 3MV9D 4OF0A 5IWLC 3TN0A 3U0TA 2NXZC 4UOW0 3U36B 2QLVB 1ZE3C 3V6OC 2HKHH 1DL7L 2AXGB 3O4LE 3W0WE 4Y8AA 5IEHA 5DS8B 2X4OB 1NL0H 4X6EA 3GSXA 4P9MH 2VL5A 3CZJA 3AREB 5FYJD 3LQZA 4M62L 1AXSB 1CDIA 4LGSB 3EOAA 2VDMH 2YEZB 3LKQB 5CGTA 5E5MA 3BAEL 3T8XA 1T1ZA 1KCVL 2WWKT 4XBGA 2D0HA 1CQKA 1WWAX 4HK3J 5KAQG 1MRCH 2I9TA 3AY4A 3HR5A 1K2DA 35C8H 4KY1L 4AEIL 2QSVA 1CFVH 2EYSA 4F7EB 1ZWIB 1B0GB 1B6DA 4HH9B 3OX8A 3IKCA 4G7YH 4YQXH 4P2QB 1UZ6E 4HW6A 1TPXC 1NLBL 2YR3A 1MCPL 5F8QC 4TN9A 5A2KH 1B90A 4H0IA 3T65A 3RUGF 5C09E 4DGYL 3LSOA 4KKLC 3KPSE 4LSDA 2HVKB 4HK0A 5IMKA 3PP3K 2DTSA 4FXGA 3CXDL 4TULL 1A64A 4U2ZA 3VE0A 4ESKA 4KI5D 1Q1JL 2B1HL 5BXFB 4M43H 5BJTA 3DV4B 2EH8L 3TBWA 2A1WL 4JN2B 4QRRD 2EDDA 3FO1B 4NUGH 4GLRI 4WI4A 5IVXF 1MF2L 1ZLWK 1S8DA 4OZIB 2JB5H 2W59A 1A6TB 1YEKH 2P7TA 2I5YH 4PUBH 3KPQA 3X13B 4KJWC 3SGKA 3QXAB 4IRSC 3SE9H 4OBRA 1VACB 4KV5F 5C0BE 3C5ZB 3HZMB 4PRDB 3UBXA 2ZUQB 1FGNH 2YRPA 5GRYA 3ARGB 5HGBB 2PR4L 4YE4H 5HD8D 3C5SB 1S7WA 1T5XA 4R3SA 5T3ZH 3QNYA 2X9WA 4MLIA 1BP3B 1FZOB 4PBXA 6FABH 2IQ9H 3VFSB 4Z77A 3ZHKA 4Z8FL 5FOBA 1CDGA 5TDNA 3P9LA 2EEBA 5FV1L 3GM8A 3S7GA 5KS9E 2EXYD 2G75A 5CJOL 4WFFE 2B8OT 1VFAB 2WP3T 3HRZA 3QG7H 4TPRH 5FCUL 1FL3A 4Z78A 1J86A 3GSNH 1EAJA 1PVHA 5DMYA 1MWAH 3U9UA 4URTB 2J5LC 4UT7H 5HVHB 12E8L 1MPAH 3D3VD 3KYAA 4KJQC 5F6IB 4FQCH 2ORBL 3QRGH 4LLQA 1TITA 1AO7A 1AR1D 1TZGL 5C0CD 4UNUA 2A6JA 1U92B 4LKXB 4PJ9D 5D1ZA 1E0OB 5T3XH 1F58H 4ODSH 2GJ6D 5D7SH 2YC1A 4G3YH 4O4YH 4JHZA 3L3JA 2XXMB 4PJHB 3RJDA 3QJFB 2QQKH 4N8PA 3LKRB 3QUXB 3LQAL 5CSBA 3IXTA 1L9MA 4QOKB 2H6PB 4WCYH 4XX1E 1G7LA 4KTDL 3MA7B 1LE9B 1I8LC 1PZ5A 1DN0A 1IFHH 1NBZA 4FFWC 4YNYB 2ZKHH 4NQEB 4C83B 3W2DH 1NEZA 4M7LH 3L3DA 5IW6B 2ITDA 4PRNB 2Y7QB 3ROOB 2CLZB 4NKMA 4P23C 3V7AG 1U41A 1UKSA 3FB5B 4J3OC 4OLYH 3BKML 3MYZA 3WXVL 43CAA 3M8OL 1UJ3B 4PYGA 1D5XA 3PV6A 2ADIB 3QXUA 5J57B 1A6WH 3T2PA 3X12B 1CXHA 4BZ1L 2RGSA 4PJ5A 2J8HA 3FB7B 4KK8C 1CN4A 4OLVH 3SO3C 4HPYH 2F8XC 1J05A 2IPTL 3HUJE 4O58H 2ZUSA 5SV3A 3P73B 1E4XL 1W72B 5D72H 3VFNA 1M4KA 1EHXA 1P7KA 2GFBA 4LCWB 3TV3L 4M1GL 1KENL 3HKFA 1T5WA 3HAEB 5DQJB 2FO4B 3T09A 4V1DD 5I1LB 1OM3H 3RVVD 1INQB 4NFBA 3TNNA 3M1BA 3KWWB 3TBSA 1AP2A 4KRNA 1F2QA 3I6LD 4A6YA 1PY9A 3G5VB 5D7LB 1DQDL 1BBDH 1DQLH 4TTDC 3MRCB 1JZ5A 3RL2A 2MTPA 1XGQA 2KQNA 5C0AB 4MZ3A 1HDMA 1P84K 1BJ1H 1NMAH 4XMPL 1R24B 3ARYA 3FQTA 4F15C 2YK1L 1IARB 5KW9H 2P43B 5HSFA 5I75B 1F97A 1F3RB 1TVBA 1U91B 3PWVB 4MDIA 4ZUWA 3X13A 3MV9B 4P46C 4DKDC 3TA3D 3BGFC 2VXQL 2DIAA 1JN6B 3WFCH 4UIMA 1KIQA 3PQYA 2VO5A 4DFIA 1GZQA 5IBUB 2BVPB 3F58H 4RMTA 1Q38A 3FRUA 4X8JA 1QKZH 1YNLL 4G43A 4C4KT 4AEEA 3KDMB 4QXTA 3RA7L 4R9HA 3D1MC 4GS7B 5EN2A 1ZA6B 5TE7L 5BVJB 1GL4B 2ARJA 3CDGB 3QO0A 5FUCE 1HXMB 1YA5A 3MRDA 5ELIA 5IK3B 3SGEI 1KN2H 1YYLL 4EN3C 5IFHL 4XNMB 2YUZA 1CT8A 3DX7B 2MKWA 4Z0XA 5D9SB 4YPJA 1OW0A 1ZK9A 4KAQH 1AJ7H 4YHLH 2YPLE 5KVFH 3FT2A 5IVNA 2ZCLL 4KDVA 3EYFA 3HAEG 3VXTA 1BM3L 1A1OB 2I60L 4XMKL 2P47B 1J8HA 1J18A 3WUWB 1C5BL 1HNFA 4UU9B 3JWDL 1U8OA 3PHQA 5D70H 4JFQB 1HILA 1I7ZB 3U7WL 3D2UD 3HC4L 3SKMB 5HHOE 3ARBB 4PJEA 3V5DA 3VXUE 5I1EH 3SE4A 2XWJB 2VH5L 1PLGL 4G7VL 1M71A 5L9DH 1BBJB 1ED3A 5JW3L 3IFNH 3HTLX 3SKOB 1K6QL 3DETC 2EYTB 5L2JA 1J88A 3PWNA 1X9QA 3SPVB 3NVQA 4PJGB 4MJ5B 5DD5L 1VERA 2EEAA 5GGQH 1MQKL 3ZYZA 4IRJD 3V6FA 5F44A 4FZ8L 5B4MC 1AKJB 1F3JA 2CLRA 3V6ZB 1MJ7H 4YNYA 1CFNB 2FLBT 4XCFL 1AGBB 5L2KD 4OZHB 3EDEA 1EVUA 1UENA 1UM6L 4Q58C 3EYSL 5CCKL 4PRNA 2IALB 2Y7QA 3FFCE 5EUKA 3FN3A 2ICWI 2NTFB 1NCBL 2ZUUA 3GUTA 2R0WL 5ACMA 1CE1L 1H3VA 2VDKH 3X12A 1DDHB 4LPYA 5FM5O 4OAWA 1RZKH 1I7TA 5TPWL 4RSVA 4IRZH 1S9WA 4Q9BA 1G7JA 4RRPA 2X40A 5AG8A 3P73A 4JVPA 4HZAA 1W72A 4EI5A 1CQYA 2AKRA 3BDBA 3Q3GB 4R26H 1HYRC 1CG9B 3ZKXC 2YMXL 2L4OA 3HE6D 5KVGL 2E6PA 3LOWA 3C60A 5T3ZE 3UZVB 4HMDA 1ADQH 2LTQB 5I1AA 1EFXA 5GHWH 3WFEL 1N4XH 4QRQB 3V0AC 4M00A 3MV11 4YPGA 3GMPB 1KFAL 4OGXH 4KHTH 4HWEH 1F3DH 4HEPG 5I1JL 5C0CB 2NXYC 1IGTA 5D6CB 5E56A 4JJHA 4U1MA 1I8IA 4HWZB 4X6CA 1R24A 4GRMB 4EOWH 2CO7B 5DEGB 3EBAA 4JFDE 3EOYG 4NQCB 4JPVH 5FGBA 4H8WH 3VH8G 5K59E 4QRPE 3MXWL 3SDDA 4U33A 2Y6SC 4YJZL 3QIBC 4N8CL 3OAZK 1TQBB 4WNQA 3DX6B 1A6VH 5HVGB 1R0AL 4JFPB 1KJ3H 3O2DL 4NUJA 3K2MC 4LPXA 5JW4M 3HC3H 3ZDXF 2XQBH 4MD5B 5T3XE 4XMLH 4CADA 1FL6B 4OKVA 4K55A 3MGOA 4GRWF 1CVSC 1XF4B 5F3BB 3CC5B 4L8SA 3CDGA 2HJFB 1T20B 1H8NA 1HXMA 1FH5H 2B2XL 1ZA3A 2HRLA 2BNRB 3VGAC 4NOFA 2W38A 1EAPB 5L88L 2YD8A 4ODXB 5IHZA 3KYOA 1EEZB 4QRTB 2F53E 1IKFL 2PNDA 2EDBA 4MWFA 4Y1AA 2J6EH 3N85H 4O9HH 4TSAH 5ITBH 1JYXA 3D39B 2ZUWA 4YXHL 2ED9A 4RA3A 3BKCL 1DVFA 1FO0H 1P2CB 2YBRA 4R97C 5F1NA 4IIQC 4HMEA 2XZAH 2DBLL 3RVWD 3C2AH 5CGMA 4PJFE 1Q0YL 5CHNB 2JCCE 2FSEA 5HYEA 4XNXL 3E6FA 1MELA 5DMKA 5I74C 5HGDB 2Q87A 1UT9A 4QRUB 4X6DF 5DUPL 5F89A 2ZOKB 2X44D 3S5LB 3BPCB 3OKLA 4NZUH 2EZ0C 4RIRA 2VYRE 4WFED 4PRIA 2P5ED 3GJEA 2ICES 3RWEB 4CL7A 3QFJD 4O02H 4ZPTB 3LRSB 5IBLC 4PYHA 1CZ8H 2ATKA 4NO2A 3VI3E 2EC9T 1CFNA 2DICA 5GJTH 3AFLA 4LSVL 4NKQB 1A6AA 4OZHA 3N06B 4ETQB 4JG1H 4PY7A 4JO4H 4U1GB 1C08A 2OI9B 3QDAA 1A7RH 1WWBX 3QUZC 3HI6L 4OCWL 2BY2A 4KQ4H 2QHRL 4JRYA 4NT6B 2HG5A 5GS2D 1Y18B 5IB1B 1BEYL 2YSSB 4JZNB 2Z4QB 4M93B 2RIKA 5DRWA 5CKAA 2BVOB 3DRQB 1K4CA 3R0NA 2FX9H 4KFZC 3QDHA 3ULUF 5IVXA 4HCRL 4MQ7B 1N8ZA 5GGSB 4Z7UB 3PWPB 1FVEB 5B8CA 4DKAA 5IF0B 1IAKB 1S78C 3BP6B 5ESAB 1NFDF 4Y2DD 3BH8A 2EICA 4C58B 3RAJH 4PRHA 3W5NA 4LDEB 2SEBB 5DJ6A 3VD4A 3UPRA 1C5CH 4JRXD 3HZYA 4OQTA 4BM7A 4MAYC 2XTLA 2O5ZL 2X4SA 4YGVA 5DFVC 4MQXD 1MFDL 1NUNB 3KNBB 4DQOH 1ZT1B 1R5VB 3D69A 5E8NA 2X2YA 5D7KE 2IAND 1H3XA 1D9KC 3SDCC 5ANMA 3MZGB 3BH9A 3OGCA 3TH2T 4EUPH 5D71H 1CD0A 4R8WL 4JFXA 3MO1A 2LABA 1HIML 2AABL 1RK0A 3MJ9A 3A67L 1K85A 5C0DB 3O3AA 3TVMC 2Q76B 2GEEA 5BRZD 5C92A 4OUUB 2VXTL 4XBPB 4YHML 4K9EC 3U30B 2AJVL 2AJ3B 1X5AA 4GXVL 2VZ3A 3DUSA 1QLRB 4GG8A 1N64L 3FONA 5DHVB 2JJUA 1XF4A 2YPKB 4HIIA 1CICD 1JGLH 1PG7W 2V9TA 4HFWB 1WEJL 2NMSA 2XI9A 2GJJA 3DX9A 25C8L 4QHMA 3TN0D 3BGMA 3NFNA 3WLWD 1KEMH 1T2XA 1ONQA 4GAFB 1H5BA 5E8DL 3FFDB 4UIKL 5IP4A 1XGTB 5D5MA 1HH9A 5GS1A 5M95B 2VXUL 3QPXL 3ILQD 1QSEE 4P2RB 4PJBE 2GTWB 4HSQA 2EIZB 2A74A 1P5UA 3MXVH 2X1XR 4JFHE 4NC2B 4JPIB 1MCDA 3SBWC 3QQ9D 2CSPA 5EH1A 3UMTA 2BSTA 3O6LH 4TUOB 3VRIB 3RVTC 2BCKA 4X7EC 3GO1H 4HG4J 4AIXA 5GS0H 2YA2A 1OT1A 2BVTA 1FFOB 2DQFA 1S7SA 5ICYB 3FO0L 1EEUA 4NZDA 4G5ZL 1JCKA 1RMFL 2GJZB 1X5IA 3LB6C 1KLGB 3CH1B 2Y5TA 4QXGL 1MI5A 2YWZA 4IDLA 4L9LC 1TTUA 5JHDB 3ECBB 3U4EB 2APWA 5FUCC 3NCCB 5F88B 1HHHB 4GAJH 1T03H 4ZPVB 1UZ8A 4F33B 3CPLA 4G80B 1RZGB 2QBWA 2Q8BL 5GRVL 4APQC 2EKSB 3LVEA 5TF1H 3B8YA 3L3GB 3QXVA 2BOCA 1KIRB 5D93C 5F9DC 1LMKA 3WYRA 3NN8A 4OF6A 4HFUH 5MENE 2F74A 3E6HB 4PJAE 5EORH 1Y18A 2HLFD 3GSOA 4OGZA 4Q9QH 5EOQL 2W9DL 2R15A 3F5WA 2WWKO 1SMAA 2H3NB 4L8BA 4LPWA 3V6BR 2EECA 4KDTC 2WINB 4GMTL 2PTVA 5JA9A 5GGSA 1LNUA 3ARDC 4KK9D 2FEDC 1MCJA 5KSBB 2BX5A 3KPOB 5F1IA 1UM4L 3AM8C 2V2WA 2VDOL 1F4XL 2SEBA 3T0EE 5E70A 4J6RL 2K3TA 4Z95H 5GISL 5HDOA 4MA7L 1F11B 4Y5VA 1DEDA 3RY6A 2HWZL 1FRGL 4AG4L 1WUNT 1K3IA 2HTLC 3U6RA 3VWKC 2BERA 2DQTH 4XCEA 1U8HA 2QQNL 2X4RB 3L3OA 4ZUTB 1PG7X 3V4UL 2C1OA 4FP8L 5JW5A 1U3ZA 3MGTA 1WIUA 1HH6B 3HC0B 3OB0H 4L8DA 5CWSA 3UYOD 3SJVB 3CFDB 2E8ZA 3O2VL 4GG6E 1AQDA 3AUVA 2QQQA 5ADPH 3OKEB 3QEHB 2GUOB 3NFPB 2X70B 4RFEB 1F3DJ 7FABL 1NKRA 1AHWB 1F45A 4V2BA 4F57L 5I1CH 1YEGH 5I1KH 2ADGB 1CFQB 3MACL 3ZHLA 2JIXB 1AO7D 1AXIB 4D8PB 2V7NA 3ROLB 5K9KB 3CVHH 5DJAA 5I8OH 1BFOB 2DS4A 1BZQK 2X4NB 5I1GH 4RWYL 1R6VA 4U6XA 4M6ML 4Y4HC 4J3SA 4HDIA 5DJZB 5EWIL 3MLRL 5T1KB 3IDJA 5SX4H 5E99H 3GB7B 4J1UB 4K3GA 2C4XA 5C8JB 2JCCF 5D1XA 2LAAA 3L3IB 4ODHH 4DTGH 1J1PH 3K2UH 4WV1A 3QWRA 1RK1B 4YUEH 4B7IA 2OM5A 4GKNA 2BXZA 4XNQA 1J1XH 2ARJQ 5HYJB 3G6JB 2R1YA 1GGYA 3H9ZA 1QO3B 4MNQD 4G6JH 5KVEH 3LRGA 1OPGL 4R4BB 1I1AD 1I7RB 3VJ6B 3MRJB 2WP3O 2Z0BA 3GHBL 3TBTB 1DQJA 3V0VB 1JIBA 4M6NL 1KJ2H 1MUJB 4GBXC 3FQWA 1W0WB 4JG0L 4HT1H 3QNZA 1T1YB 3MCLH 4I5BB 4PJ5D 5GSRA 5EA0H 3P9WB 4HC1H 3MRFB 5IMOB 15C8L 3KYMA 3CFKA 2IANB 3IKKA 4LLWA 4CAGA 2F58L 4MAUL 4GQ9L 3C8KB 1U8PB 3H9SA 1HYSC 5HYFA 4I3SL 4JO1L 1YMHB 1ZHNB 4XAWH 3CSYB 3LPWA 2DTMH 4NKDA 2A38A 4XB8A 2BVEA 2FATL 2DQHL 2UWEB 4OBSA 3P0VL 4M7ZC 5GRJL 2Y4SA 2BY3A 1JFQH 3F7QA 3L3GA 4OF3A 1K5NB 1PDKA 1YN6B 3TBYB 2V9RA 1QHOA 3LMJL 4EVNA 1CGSH 3JV5A 3WLBA 4PG9A 3NCJL 1OTTC 1YEHH 5SWSE 2E3VA 3QQ3B 1QG3A 5IROC 3WKMH 3DGGB 4P3CL 1F00I 3LIZL 4LCUA 5CP7A 5F7WC 4I0KA 4ODBD 1FJ1A 1G9EA 4NNYA 3TYFA 4DGVL 5CKGA 5CBEA 4WJ5B 2P24B 3L3HA 1QSFA 4LKCA 4XNZB 2A77L 2R69L 4PGBA 3O2WH 4ZXBA 2AAVA 4YBQC 3PQYD 5KTEH 3DIFB 3FMGL 4PJIE 5KSBA 2NY6C 5KZCB 2HLAB 4UILH 3U2SB 3SDAB 3O3DA 2AJZB 5LCVH 4NNPH 5F72S 1KUMA 4CMHC 2OJEA 1JHLH 3VG9B 1MFCL 4U1JA 3TBVB 2OSLA 2XXCB 3B9KC 1T2QL 4F9PA 3CLFH 4PLOB 5AAWA 2OTUA 4YWGL 1T89C 1T2JA 4ZQKA 1MHHA 4AH2A 1GGBH 4HJJL 3RPIB 3KPNA 5D96C 4W4NA 2G2RB 2IJ0C 5C0ND 2HMIC 1S3KL 5J12C 3MBEB 3X3FH 1Z3GH 1KJMB 1FFRA 3C08L 3VGHA 1OL0A 2WBWB 5F9WB 3GSQB 3T0AA 2HVJA 4JZJC 3QIUD 2LAGB 4PG2C 1ORQB 3FQRB 2UZXB 4K8RH 2DQIL 1CFQA 3QI9B 3EYUL 3VXMA 2BJMH 3GKWL 4PJBF 4ALAL 1ZLSH 1BFOA 3QJHA 3SGDH 1CXKA 1NCTA 2AEIT 3HRPA 1AD0A 2GT9A 4N8VB 2R4SL 1RVFH 5GGVH 2KUTA 4C4KO 4NQDA 2E7LC 3S96A 1BVLB 5FYLL 1Y0LA 4CW1B 4HS8L 3B9VA 3R1GH 2KDGA 4LU5L 5E9DD 2K7PA 4PJ8C 4WW2C 2D7TH 4X6DA 3GRWL 1SEBB 3QQ4A 1TFHA 2VLRB 4I18B 5J3HD 4J4PA 3FT4A 1LO3H 4XVUD 5F7DA 5C2BL 4PJCE 3VXNA 5IJVB 4R7NA 3BEVB 4UTAH 2ICWJ 2FBJL 3CDFA 5A16B 5DJDB 4N1CA 4XP4H 3RWJB 4KZEL 4YAQB 3WFHB 3REVA 1OP9A 5FYJH 2YWYA 3TZVB 5IG7B 1PEWA 5JOPE 1G6RB 3LEVL 3MNVA 2G9HB 4Z5RB 1RZ7H 4D9QE 5IMOA 2VIRA 4PLJD 3X3GH 4KZDH 2CDGB 4EI5D 1J7VR 4OLUH 3MLTB 3OZ9L 4Y16B 3BZFA 1A7NH 3O3BB 2QQLL 2MNUA 1B4RA 1KCLA 2VLJE 3C60D 4PRPA 2CR6A 2DQCL 1EFXD 3SDXA 1RSFA 3O8XC 3EYVB 2UY6A 1IILE 3BEWB 4DZ8A 1CFBA 2CXKA 1HHGB 5IB4A 1KV3A 2VITB 3EJYC 1A9EB 1QBBA 2FWOA 4FQLH 4O00A 1NFDA 1UVQA 2NX5E 4N8VG 2C3HA 1CK0H 3TBYA 1KG0A 2Y07H 1BLNA 4MXQD 4OFYA 3NABH 5DYOB 1KACB 2MQ0A 4LSPL 1ZS8B 4CDHA 1XGPA 1IGML 2FJGB 5F7UA 3VXSE 2FR4B 3FQUA 1U8LA 2GQHA 3B9EA 1ZANH 3GMOA 2RFXB 2IH3B 4BH7B 2GKIA 5I8KL 3SDDD 5DUMH 2GI7A 3LV3A 4RGNE 2NNAB 4M5YL 5I2IA 1D5ZA 3PP3H 5K33A 2NY5L 1BGXH 1RZKC 3UBXG 1MQ8A 4MJ2A 2CUIA 4Q6IA 1CYGA 2BDNL 4K2UH 4NQTA 4MNQB 1AE6H 1WBXA 4HGWA 4OLZH 1VKXA 4P5KA 5J1AB 4Q9RH 1KIPB 2XG5A 1I1AB 1G7IB 3U2SA 4KMTH 1H9VA 1TJGH 1NEUA 1J0YA 2J88H 3VG0L 3BGAA 2ZNWA 3VRJA 2JE8A 3LDBC 1MHEA 1LEIA 1AGDB 1IAII 4UDUB 2EH7L 3N0PB 5ESQB 2KPNA 2GSIA 4RGOL 1FZMA 2FX7L 1XZ0A 4X5LA 2MJWA 3NCMA 3I2CL 3CFCH 4KJWD 1P9MA 1I9EA 2CMRH 3GSWB 2KKQA 3RNKB 3B4NA 3BUYB 1A7BA 3B3IA 4WI8A 2Y36L 4ZO7A 3LS5H 5JDSB 5J6HA 1A9BA 3GZKA 4U3CA 3EO0B 3HLAB 1DVFD 2ZCHH 4H8WC 1QVOA 4U1SB 1LE5B 3D0VA 4WUUD 4XNUL 2EYRA 3QUMB 4RMWA 4C56A 1WQVT 3LKPB 1UWEH 5FYLD 2FECL 4QO1A 3IJYA 5D7IE 4YDVB 3KPLA 4HV8A 4DUXA 5FK9A 2VABA 43C9B 1RUQL 3SKNB 4YX2H 2DQEH 3V7AE 1V5JA 2WBJB 4Y4FB 4BQ8A 1JZ7A 4PD4K 1HNGA 3THMH 4PP2B 2YD2A 3T0EC 2PXYA 2DM4A 4Z7WA 4F9LA 4PRID 2Q86B 1BD2A 2BNQA 4XPAL 2C7UA 5D1QA 5IW3A 1NDGA 2E7CA 1EHLL 4KRPC 1QPPA 4M48H 3WKNA 3PL6B 5FF6A 2ICEA 4I18A 4TUKL 5HPMB 3LKSA 5H37G 3L6FB 3DTXA 4X5WA 1CTNA 4KJQD 4LMQI 1NEZG 4M62H 1FNFA 3KPRA 5T33L 3CX5K 5DZOA 4PREA 5BVPL 4PGDA 1IAMA 3BHBA 1X5KA 2NLJA 1F5WA 1SEQH 3BAEH 3MRHB 1IGYA 5A16A 1W0YT 2NY1C 3DRTA 1E28A 3HA0A 2PTUA 4JRYD 4NO3A 2GK0B 4OZ4B 3CDYA 3BP5B 4AEIH 4ZNEA 4HUVB 1WAAF 2OL3A 2D0GA 5JQ6L 2HT3C 2IMNA 4FZEL 5JXAL 2BSRB 3V0WH 1ACYH 2BP3A 3QDGA 1TETL 1YYML 4QT5B 4JB9L 4I4WA 2XFXA 3IAGC 1T6VN 3BXNA 4F7PB 1A14L 2CPCA 3GMRB 4Y19E 2XN9A 3G04B 1AI1H 1FAKT 4R2GD 4PRHD 3ULVH 4JFFE 1NCNA 3CXDH 4TULH 2QHLA 1K4DA 3QIUB 1IQWH 1PD6A 1Q1JH 2B1HH 4PJIF 2VITA 2EH8H 1HQ4A 4JY4A 4NHUB 5CEXA 1NGPH 4M1CC 2A1WH 4AL8H 1U58B 3OR6A 2DKSA 1PEZA 2DI9A 2W9EL 4KK8D 1ZS8A 1LP9E 1CGXA 1J1OL 2FJGA 5FO8B 3GSVA 2PYEA 2QTEA 3AS1A 4ZUSB 1MFBH 5MEQB 4QHUA 5DQ9A 4ZSOE 3PWJB 4GSDL 2GTZA 1VADB 2NNAA 3TJHD 3I3DA 5E9DB 4UV7H 4S0TD 3H42H 1KB5A 1XGRA 2VDQL 4F37K 3ZL4L 2FJFB 1D5MB 5SWQA 1UEMA 3RRQA 4X0KB 1FN4B 2PTTA 4K23L 4AM0A 4UB0L 5CEYA 1RIVH 3K1DA 5TDPA 1JHKH 3S35H 2X9XA 3BIKB 5CJXC 4D9RE 5J11B 1PFCA 3BDXA 5GZOD 3HG1E 2R29H 4GMSH 2DWEA 5MEPA 1TQCC 4Z7VB 5C0AE 3RVUD 5KVMC 5DA4A 1G1CA 3CXHJ 4OZFB 5ESQA 3JV6B 5DD6B 5B3NA 5C0BA 5JLZB 3ETBF 5F9JA 1BVZA 4WTWA 4MD0B 4XRCB 4P46D 5CJOH 4HQQH 1T66D 5KAQF 4DKEH 2NXZB 1YDPB 4NRXA 2CRYA 1NGZB 3UJJL 1LO2L 4S11A 1JPSH 2IWGA 3VGFA 1XF5A 2VXVL 3O45B 3WS6A 2H2SC 2ORBH 1YEFL 5FA4B 1TZIA 4U4BA 5FYJE 5AZ2L 3VFPA 1YEEL 3IF1B 1MIEL 4U6YA 43C9A 3I9GH 4RCAA 3BE1H 2JKXA 3QUYA 5DT1H 1DBBL 1KBGH 5MI0C 2NR6C 3LQAH 1TPXB 4KTDH 4LDLB 1FC1A 4LNRB 4HPOH 1I1YA 1MFEL 3KYKL 4YDKL 3DHJA 2ZSVB 3E0GA 1OAQL 2OJZL 5D7JC 3DO3A 5KSAA 3L6FA 5KANI 5DTFB 3PWLB 1U8IA 2R1XA 3QEGH 4PB0L 1SJHA 4WWKC 5LQBL 3LN5B 4N90E 1NJ9B 3FQXB 5BO1H 5ALBL 1FVCB 1RZIA 1B4JH 1BHGA 3R4DA 4L3EA 3BKMH 4EI6A 4DAGL 1FCCA 3WXVH 4KI5E 3M8OH 3VFGH 2CKBL 3H7BB 4IBLT 3DROA 1EEYA 3TH4T 4W6YB 4E9LA 3DV6B 2X5PA 4BZ1H 4QRRE 4RRPG 4DN3L 1PKQA 1ZLUK 5DRXB 4FG6D 5GS0C 5T1LB 2R56H 2IPTH 2XACC 2IBZX 4GQPH 1OGTA 2X4QB 1E4XH 3GGWA 1BZ7A 1EHAA 4FQ2L 4IRSB 3UC0L 2HRPL 2CUMA 5JR1L 3RI5F 5E94B 3TV3H 4QYOB 4X7SL 3U46B 4F58L 5IMMA 5CFHA 1P5VA 2D4DA 4OI7A 5TJWK 1I7UB 3MV7D 4WUUB 1UB5A 2P42B 1VB9A 1CR9L 4NQSA 3F12B 1DQDH 3IJSA 2ESVB 5ACLA 5DUBB 1ULVA 3TIDB 1CDBA 4E41D 2XNAA 1UH2A 1CI5A 2X7LA 3QRFM 2Z31C 1V7NL 4S0SD 1QBLH 1YEJH 4MX7B 3WO3B 2PO6C 4ZUSA 3WFBH 3KXFB 1S9YB 5B39B 3QFDA 4JGJA 1S7XB 1PYWB 2VXQH 3DVGB 2ZOLA 1CXFA 1ZVSB 2JB6B 5AUMB 1MCLA 3TPUA 3WNPA 4KGJA 2MCPL 3O9WA 4ONHB 5JXEA 2AK4E 3VFUA 2J5LB 2F19L 5JORB 4MJIA 1FN4A 1YNLH 3RUGB 3C8HA 1QFWI 1KYOK 2UZYB 1M7IB 1NGXB 3D3VE 3RGVA 3O4LD 2QEJA 1F4YL 3T1WA 5TE7H 1G1YA 1LO4L 3H3BC 3O3EB 1MJ8L 4FQJH 2WWMC 5DJXA 1WWWX 3PHOB 4KKCC 5BS0E 3IDNA 1ZGLM 5C07E 3TYGL 3QWRD 5D7IF 2GJ6E 1MH5A 3R06B 5IQ9A 5E08L 2FGWL 1HKLH 1X4YA 3OV6A 1CE6B 4DK6A 4YHKL 5SWZE 2Y6SD 3MRMA 4N5UA 4Z7NE 3QZWB 1QRNA 3UDWA 3RWGA 1U95A 3RZCA 1SYVA 3AAZA 1FFNA 3WHE1 5J6GB 2FJHB 3RBGA 4I3GA 4D0BA 1C5BH 1MFAL 3EOTH 1KTKE 2XWBB 3JWDH 1T04B 1WBZA 1QBMH 5DEFB 3U7WH 3HC4H 1L6XA 4E5XB 4RGNC 4O51A 1XIWC 2VH5H 4P23B 1PLGH 4G7VH 3CLEL 4N0UA 4JDVA 4L4TA 5JW3H 3QDJB 1H3PL 4NNXA 2VISB 2AV7A 3P77A 1K6QH 2OP4H 4H5SB 1QLFB 4NRYA 4D0DA 2FIKB 2YXFA 1RZ8A 1MNUH 3H9SD 1E6JH 4R96B 9CGTA 3MTRA 3ULVE 1IM9A 1DSFH 4FZ8H 2H8PA 4LRIA 3ZDZE 3TM6A 3VFWB 1JGDB 4EIZC 5K93A 3QPQD 2VJXA 2YD3A 1UM6H 4K71C 3EYSH 5EUOA 5CCKH 4V1DE 5C70A 5FFLA 1P4LB 4OJFL 2V2XB 3ULUL 3I6LE 4P5TC 2HN7A 1SY6A 2G60L 2R0WH 3DO7B 4HJGA 1CXLA 2NZIA 1CIDA 2EEDA 4F15B 1IAOB 2Y06L 3FOMA 1QSFD 5DJYA 2WM0A 3TO2B 1ZHLA 1T7YA 2A2QT 3ZE1E 1YEIL 5I1IH 4JANA 3FO9A 4ZXBD 5HY9B 3U48A 4P46B 1LQSR 1LP9F 1UH4A 4ORGA 5GS2H 2HJLA 1GIGL 1NBVL 2YMXH 5KVGH 1MIML 4X5XB 1L7TL 2FYYA 1BVKB 1NCWH 1RZFL 1Q9LA 2B39A 4U7SA 4X4ME 3AXLA 4KROC 1AGCB 2HJKA 5J06A 4TSBH 2A6DA 3CU1A 2HKHL 5JPNB 4JGMA 2R2EB 1NL0L 3PIQA 1MLBA 3AU1A 3TO4A 4KJYB 4P9ML 3V52L 4EN3B 2P5WE 3GI9L 4MVBC 3B9DA 4KJPC 1SQ2N 5BOPA 3UTSA 4KMLB 1P7QA 2VDML 3MXWH 2X4TB 2EXWD 2UUDK 3QEQA 3VXOB 5HDBE 4G8GE 4N0YL 2P8MA 4X80H 4CVXB 3VRLE 3T2OA 1MRCL 4JR9L 1MCWW 1E4KC 35C8L 2Z93B 3UYPA 4U1HA 3D5OF 2VQ1B 4MAYD 5GGVY 2VLKB 4YQXL 1VHPA 3C5JA 3HE7A 5ACZA 4LF3A 3BFOA 3R8BB 4HGMA 3NPSC 1G0XA 2GITB 3PDOA 5ECJE 4NQDD 3UTTE 4XVJL 1F4WH 5EC2B 2WAHA 4WU5A 1S7UA 3VMOA 1D9KD 3SDCD 5L88H 1JNLH 4PJ7E 4UQ3B 1UACH 1J10A 3BSZH 3SGEH 1A4JB 3VD3A 1T83C 3BP7A 3MNZB 4M43L 3WN5C 4J4PD 3ME0A 4HUUA 5DRNA 5EU6B 5J6GA 5HHVL 3P4MB 3PE9A 5L0QC 3TVMD 3TT1L 4NUGL 4OD3H 1N59B 5K9OB 2LVCA 3DMMA 2QSTA 3F8UB 3MV7B 1YEKL 2CLVB 5L2KE 1KN4H 1Q0YH 4KRMB 3DXAB 2I5YL 4PUBL 4NCC1 4XGZB 3GSRB 4XNXH 2OMBA 1R3JB 2FHFA 3H0TA 4K8RC 3SE9L 2H32A 3P2TA 4E41B 4J3WA 2GCYB 4ONFH 2NY0D 4JDTL 3BQUC 2FEEI 3S3JA 4LPTA 5KG9B 3QA3A 1IL1B 1XGUB 4YE4L 3VA6A 1WAAA 4P4KC 5C0RH 4YHZH 1MVUA 4DWHA 5KSVB 4G9FA 4TOYH 3ULUD 2FGZA 4Y4KA 5C08A 4BSVA 5IJKA 3ZKXB 2IQ9L 4M61B 4GW1B 3VCLB 4LSVH 4POZC 1H0DB 4GJTB 4KK5C 2VB5A 4PP1C 3MLWH 3STLA 3GMNB 3O4LB 4OFYD 3W0WB 1V3KA 1OSPH 3HI6H 3FN0H 1G7QA 4OFDA 2ATPA 2NXYB 5B3JE 3M17A 4TPRL 1QEWA 4N0FB 4F8QA 4YHPB 3TCLA 1BEYH 5E6IA 4KPHL 4UT7L 1IAOA 1MPAL 4LGRB 3T0BA 1D6EA 4QCIA 4FQCL 1EXUA 4PJXF 3WHE0 3QRGL 5IB2B 3O41B 2Z35A 1A2YB 3OJDB 1CFSA 2W65B 5I9QC 3QIBB 1NMCC 1I3RA 3I6GB 2DOCA 4NZTH 2AXFA 4D0CB 1F58L 4H26B 3ZSSA 3BZDA 4DCQA 4PTUB 5D7SL 4G3YL 4O4YL 4APQD 5GGTA 4WGWB 5FGRA 4LLDB 1E6OL 3QCVH 4UTBH 1I8MA 1KB5L 1FG2B 1TTGA 1HOCB 1I85C 2QQKL 3V5KB 2O5ZH 2AQ2A 2D4FA 2Q6WB 3INUL 5ICXA 1MFDH 4WCYL 5C09B 4RGMC 1IFHL 1YPZF 3KPSB 2O61B 4EEEA 4E0RB 2ZKHL 4L29A 3VGAB 2DMCA 3LKOA 3UPCA 1MCSA 2IADA 5HXMA 1KB9K 2PW1B 4LHUA 3FOLB 4HIEB 4R8WH 3ARDD 3MRLA 1K8DA 1XF1A 5IIEA 1JK8A 1MCBA 1EZVX 1HIMH 4FFYH 2AABH 3QH3A 3UCRA 1JRHI 5HYSB 3JV4B 3MRQA 1F02I 2XA8L 4P99A 3PV7A 4Z7NF 3ILPB 1FIEA 4ONOA 2CKBB 3X17A 2VXTH 1GPOH 4R97B 4YHMH 4IIQB 5FYJU 2AJVH 2FZ3B 3QXDB 4X4XB 4DW2H 3MJGX 4OLVL 5HHPB 3EGSA 4FQXA 4HPYL 4RMSA 1NBQA 4NRZA 3VWKD 3OBAA 3D0LB 4IDJL 1QSVA 5D72L 4ZFZB 5C0BB 3EKCA 1CD1B 5DI8A 25C8H 5SX5K 5I74B 3VFVA 2PXYD 4RBPK 3MNWA 1JPFB 3L95B 1T3FA 1FNHA 1BD2D 2BNQD 3KPMA 5E8DH 4LOUC 4NZJA 2MPAL 1OP3K 4UIKH 5HD8C 5IUSA 4OGYH 4F80A 3JUYA 1DQLL 4ELMF 1U6AL 2VXUH 3QPXH 3I75B 4WFEE 2P5EE 5BOZG 3IYLW 3QFJE 3ULVF 3SKJH 1NMAL 1HKFA 5KW9L 5KS9B 2IQAB 4YH6A 1MFNA 1W8NA 3MC0A 5IESL 2WANA 2CLVA 3FCTB 4U6HB 3FQNA 4HAGA 3OG4B 4RISH 5H37H 3IFPB 4I0PA 1MRDH 3QUZB 3MROB 3O6ML 1NFIA 4BKLB 1RMFH 4MS8C 4NO0A 3BPLC 3F58L 2WK2A 3OF6A 5LAXB 1WK0A 5HJ3A 1WV7T 1HSAB 3IU4H 5I8CA 4IOFC 4NBZB 4LLMB 4QTIL 2XN9D 4WI9A 4Y7MA 4AIZB 1AR1C 1NCUA 4X6FB 4R4FL 1XCTA 4PJ9C 4XHJD 2DQGL 2AGJH 4JFDD 4R0LC 1WGOA 4GW1A 1KN2L 1GZPB 4WO4A 2Z91B 4Z9KB 3FO2A 5IB5B 1MLCB 4GBXD 5FHBL 4PTTA 2AXJA 3GMNA 1AJ7L 4MAYB 2CDEA 4JRXE 3W0WA 3Q6FB 3U9PH 2FRGP 5INDA 3Q2CA 3KJ4B 3OAUL 2X10A 3RX5A 4A6YH 3BIBX 5EOQH 2W9DH 4LSTH 3V5HA 3CZFA 4P9HH 2XTJD 1SBSH 1D9KB 1RUAH 3F7RA 5D70L 3AC0A 2IANE 1TCMA 4GKZA 4WIQA 4GW5B 4W6XB 5D2LE 4W4OA 3HZKA 3OXSA 1AGEA 5EULV 5IHLB 4OV5B 5L9DL 1UM4H 1JE6A 4H26A 3OKNA 2YOCA 3L5IA 2XYCA 4K3JL 3IFNL 3TVMB 4JY5H 5C6WH 1QUNA 2JELH 4YDJA 5C0FA 3VRLF 4LEXH 3VFTA 3W11D 5GISH 4PGCB 3T1FB 2VR5A 3HUJB 3U1SL 5BRZE 3ULVC 2HWZH 1U8NA 4J8RB 1P1ZB 4HHAA 3LEXB 4ZTOL 5GGQL 5IMLB 1U8MB 4OIBA 2QQNH 5B38B 4WW1A 3CCHA 1MJ7L 1H8SA 2C1PA 2EDEA 1EA9C 3P4OA 4JFYB 4JLRA 4OGAD 3RVVC 1Q9WB 4RNRB 5FDYA 1QBAA 4IMKA 5DEZA 4YBQD 1IT9L 3MX0A 5D6DA 1JPGA 4PJ7F 3MRNA 7FABH 4F57H 1RUPH 1UXWB 1EO5A 4O2FB 4MHHG 4EDXA 2CQVA 2H9GA 1JF5A 3L1OH 3MACH 4XP5L 3OJVC 1RZKL 1D6VH 4KVNH 4IRZL 3O11B 3VD5A 4RWYH 4M6MH 4YHNB 1VESA 2R1WA 3RDTA 1LEKB 3MLRH 3UTZA 3TA3C 4HUNB 3CH8A 3JXAA 1INEL 4XPHL 1CD1A 4GUPA 1KPUB 5CSGA 5EOCH 4G6ML 1OAYL 1JF1B 4RAVA 2UZIH 1YY8A 5BZWA 2HMID 5GHWL 1N4XL 5L6YL 5GIRA 4L9LB 1O7SA 1S9XA 5DSCA 3PWUA 4CVUA 1XR9A 4OGXL 3IDIB 5KSAD 5F7YC 1MY7A 1K8IB 5E8OB 4IOIA 5A40E 1OF2A 3TIEB 4K3EL 1OPGH 4MCZB 3PJSA 3IDMA 1IC5L 5DWUH 3EOBB 4LLUA 4EOWL 4J23A 3GHBH 4JM2F 3IRPX 4APQB 5CLTA 4L3ED 5IFAL 1CGYA 1NC4B 1G0YR 2R4RL 5KBNC 1I9JH 4M6NH 4JPVL 1B0RB 2YPLB 5D93B 4H8WL 4JG0H 1ND0B 2XZCH 2Z92B 1R5IA 1JYVA 1RD6A 4KK6C 3WSQL 5GQBA 1LO5A 4C59B 3KVQA 3C6LC 4ZOEA 4ZDHA 1PQZA 1A6VL 15C8H 1KJ3L 5IM7B 3CIQA 4NKIH 5IVZB 5J89A 4NQVA 1SY6L 2ZSWB 3HC3L 4PJ8D 5EU3B 5HHOB 4MAUH 4GQ9H 3VXUB 3C6SB 1C5DB 1ROWA 4NN7C 4ZNCD 2DLHA 4LLMA 5DF0A 4JO1H 3ARDB 4MD4B 4LCCA 2W92A 2YKLH 3LQAC 4P4RA 2FATH 3QIWC 4XPFL 4OCXL 4CN4A 1FH5L 2DQHH 4N9GB 3KYNB 5JMOC 4RQQA 1W72H 3P0VH 4JKLA 3MMEB 5GRJH 4KI1A 5KN5A 2CDFB 4J3XA 5E8PB 3UO1H 5DVOA 5IB5A 4H25A 2RB8A 4G8EA 5J9PB 5CUSL 3P40A 3DX8B 4F3FB 1HINH 2J6EL 3PUCA 3N85L 2VE6B 3VWKB 4IRJC 1JV5B 1MJJA 4O9HL 5ITBL 1U3HA 3F7PC 2NPLX 5T1MB 3L5JA 2E9BA 4JZOB 3BZ4A 3RWDA 4KQ3L 3CFBB 3FFCB 5HGGS 2R69H 4PS4L 5H35B 5DJ2B 3OQ3B 3O9WD 3FMGH 5JXED 4H0HB 2XRAH 4HKJA 1JHTA 4MJID 3O8XD 4OFKA 5F6HI 3E3QE 3H9YA 3RGVD 1TDQA 1RI8A 3O6FA 1FAIL 5FB8A 5F3HA 5CBAB 3W9DB 1AO7E 4MCYB 1NDMA 5DK0A 4Y4HB 1HEZA 1QSED 4NN6C 5F7LB 1NBYB 2XA3A 1KTDA 5I76B 4JKWA 3AB0C 3NH7H 1DUZA 4YWGH 4ZAKA 5EDXA 3NIFE 3JTSA 3HE6C 3L5WB 3PG2A 5GJTL 3F7YB 1QRND 2BRRL 3RWFB 1N5AA 5BZDB 3RZCD 4JG1L 4LLVB 3LCYA 4R6UA 4HULB 4JO4L 1VDGA 3C08H 3IETB 5EOTB 1A7RL 2VLLB 3WDHA 3G6AA 4KQ4L 3RIAK 1R3KA 1C1EH 1B3JA 5FHAL 1LD9B 2OZ4A 1IGFL 4NDMA 1WLHA 4JFDB 3GKWH 3BKJH 3GSNB 1JZ4A 4QRPB 1MWAB 1MCNA 1E27B 4NBYB 4L4TD 4GBXB 2GSGB 3MRIB 2F8OA 5E5RB 1KC5L 3R8QA 3UZQA 5I1DB 2EIEA 1IMHC 3ZKNC 2XICA 1XEDA 4UT6H 1DANU 1QZ1A 5FYLH 3RU8H 4HS8H 5E1AA 4PJ5E 3RAJL 1G7PA 3GMMA 4KDWA 3QWQB 4L3CB 1KXQE 4RMVA 3VFRA 2QKIB 3PP4L 1IM9D 1SHMA 3BN9D 4JCLA 3HNVL 2OCFD 2L7UA 4HLJA 2B1AH 3KR3H 1RU9H 2H2PD 4GRLA 1N0XH 3QNXA 5C2BH 2WW8A 4CJ0A 5EBWB 3VXQB 1GAFH 5ID1B 4G8IB 4EZMA 2R23B 1LK2A 1XF3B 2FBJH 4M7ZB 3CFJA 4QGTA 2F53B 3MFFB 4LCYA 3VWJA 5EBMA 3JWDC 5C3LD 2Z92A 2OTWB 3S36H 1JYWA 2RR3A 3RNQB 4PV8A 2DQUH 3LEVH 3T0ED 3ULSA 4NKOB 5C9JA 2HTKD 5DK2A 5CILH 2ZUYA 5EO9A 3BO8B 4PJFB 3OZ9H 5GGRY 3RVWC 1V3JA 2JCCB 3QULB 1B6UA 3DSNA 2JK5B 2NY6B 4PJXA 3D85B 4AQ1B 4FQHA 3PQYE 2Y5EA 1BMGA 3UTQB 3B5TA 5CP3A 5TGBB 1KEML 3EFDH 3PABB 4AENB 4DN4L 2M1KA 4CMHB 5IHBA 5HHQB 4UAOC 4F2MA 1UH3A 3TO4D 5MEOA 1OQXA 5EU5A 2ZG1A 4G6AD 2VE6A 3B9KB 7CGTA 2QSQA 4OQTH 5F21B 3OKOA 4L4JA 4P2OA 5GSVB 3MXVL 3RY4A 5I8KH 3UTSD 3KS0H 3W9EA 4JZOA 1CXIA 5D96B 1QR1B 1YPZA 3H3KA 3QEQD 2NY5H 3GO1L 4MQSB 3QO1B 5J12B 3WDIA 3HS0A 5DJ2A 3IB4A 5E2JA 4BH8B 4PRBB 5E2VL 2HAZA 3NZ8A 1UXSB 2W0PA 4JY6A 4JZJB 1J8HE 2D31B 4OCRL 3G5YB 4U2YA 3S4SB 3MJ9H 3HE7D 5BCAA 1IEBA 3VG0H 3IJHA 4P5MB 1EMTL 2IAMA 3QEUB 4PJEE 4ZOAA 5EO1A 3ZKSD 4XP6L 2VAAB 5IFJB 3IS0X 5HHNA 2EH7H 4PJDF 2DWDA 4OZGA 5TFSL 2FX7H 2JJSC 5JW4R 1JUFB 2YUXA 5TH2A 3I2CH 3IVKB 1SYSB 5DRZB 2UYLB 1CVRA 3NACH 1AD9B 4Y2DC 5EPMB 4NCDA 2FB4H 2EDRA 3DECA 3BZEA 5TF1L 2Y36H 3FTGB 1YNTB 4PJ8B 4WW2B 1LEGB 2LV4A 4XPBL 3SCMD 4EBQH 1ZTXL 4R4NC 3WO4C 1S7RB 4TQEH 5E8EB 5KVDH 1SJEA 2WLYA 1IGCL 1A6ZA 4MQXC 4XNUH 5EU4A 5GJSL 5EORL 3DMMD 3W39B 4ELMA 3IXAA 4GW4A 2VLMD 3TNMA 1A1MB 1WC7B 2EDHA 3C09C 1ODAA 3ZE0E 1K3ZA 3JSSA 1RUQH 1T1XA 1YY9D 1MRFH 4YIQA 4U3HA 3U0PB 4XH2A 3OKKB 2VZ1A 4M8QA 1VEOA 1ZSDA 2E6QA 3RL1B 4AT6A 4WI5A 4WHTB 4QNPE 3H3PL 4ODWB 3AS3A 1HI6A 1C7SA 3NIGE 4XPAH 3EYQD 1YNKH 5IOPB 5SWSD 4Y4KD 5C08D 1VGKA 4D9LL 3SN6N 4ENED 1ITCA 1MEXL 3MOQA 2RJMA 1CICC 5BW7C 3D25A 3O8XB 5JW4Q 4QY8B 4JFEA 5EOCJ 2AQ1A 3TN0C 4S1QH 1P4IL 3WLWC 1KNOB 4CMMA 1YJDH 3WHXB 3PXHA 5ADPL 1QSEB 4PJBB 1FZKA 2P46B 2AVGA 1UADC 1MCIA 3ILQC 4FZEH 5JXAH 4MJ6B 1TMCB 4X6CE 5I1KL 1TETH 1RULL 3I84A 4OIIL 4YR6B 4KUZL 3VXRD 3DBXA 4Q2ZA 5TQ2H 3QQ9C 5I8OL 1NANI 4K7FB 5D7JD 3WMSA 1ZT4B 3AY4C 3CK0L 1UB6A 1XR8A 3I6KA 5E99L 1AIFA 32C2A 1QA9B 2P49B 3LRHA 4CVZA 2BHZA 2VTFA 4ODHL 4DTGL 4YUEL 3LDBB 1J1XL 3WFZA 4Y5YA 2W9EH 3V9FA 1XCQA 1EBAA 1KLUB 1J1OH 5MERB 4BQ6A 1FQ9C 4LHUD 3B2VH 1N3NB 4S1DD 4DVRH 4GSDH 3VI4E 4MNHA 2Q7YA 5ESVB 3NFSH 4CVWA 4U1NB 1KJ2L 1PSKL 4Q9CA 2VDQH 4Y1AE 5MENB 4BH8A 4PJAB 4JVUA 3HCVB 1RIHH 1UXSA 3T3MF 1NFKA 4YGAB 5EA0L 4K23H 2X4PB 4M4RA 4OCSH 1T21A 4UB0H 4FQXD 5CIPA 2BHUA 4HC1L 4R7DB 5L8LB 4FFVC 4JQIL 2A9NL 1FYTA 5IHUH 3AMLA 3SGKC 4X98A 2HT2C 3STZA 5FYLE 1G9MH 1FLTX 2MCG1 1I75A 4KK9C 4H1LA 2PO6D 4XAWL 1CIUA 1EUTA 1U8JA 3T0EB 2GAZB 2C3GA 4JQXA 5C0EA 4QRSB 4HZLB 4KRPB 2R2BA 4PRIE 2DLFL 1KLFA 3A6BH 4O2CB 1CGSL 1DFBH 1LO0L 4U1LA 4ZG1A 1YEHL 3ES6A 3OGOE 5JIIA 5AD0A 5GRZA 2VXSH 4WRLA 1OP5K 3ARFA 1MIEH 3QHFH 1U93B 3WE6B 4GG6B 4I0PD 2WWMD 4NN5C 2NY1B 1FO0B 3MRKB 5EBLA 4OF8A 4JM2A 3O2WL 2X4UB 1FSKC 3OKKA 5L7XH 4F7TA 4JRYE 3OF6D 5JO5B 3RVXD 1II4E 3E3QC 3OPZH 4WHTA 3UZEA 5HHMD 4M8VA 1MCKA 1N7MH 5LCVL 5CAYB 4NNPL 5IVXE 1YEDA 1ZHBA 4QTHB 5D1ZC 4YHOL 1OAQH 2BC4B 2Q8AL 1JHLL 4EXPX 5CEZD 5I19H 1FIGL 2A9ML 4M7LT 4JFOA 4UQ2A 1FDLH 3DVNB 1ZGLP 1EDQA 4PB0H 4GKSA 4QHNA 2Z8VC 1HSBB 2MFNA 2X09A 3CLFL 4WO4D 1QFWM 5ID0B 4PRHE 5ALBH 4LVHC 1XIWD 2A6IB 2BSED 4DAGH 4I2XA 3L9RA 1KNOA 3WHXA 1PX3A 4HIXL 3BP4B 1Z3GL 3NCFB 1NAMA 2P8LA 3E1F1 4DN3H 4XC3L 4XZUB 1BQHB 1U8KA 4MJ4A 4K8RL 1M1SA 5ANME 1YMMA 2DB8A 2Y9RT 4KUCF 1ZLSL 2HRPH 3LS4H 3PNWB 4OCNC 3IGAA 5JR1H 4K7FA 4F58H 3EFFA 4LSQH 4NYLB 1IVLA 1F6FB 4ODTH 4HX1A 5FEBA 1SM3H 4L4VD 2Y72A 3H8NA 3HPLA 4OSUL 4YZFF 3VGEA 4X7TB 2AV1A 1WTLA 5E2WH 3ESUF 4P5TD 4QHKJ 1UCTA 4CRPA 4XBEH 3MA9L 1TQCB 1IM3A 3LN4B 4U0QB 1DQTA 5JIPA 1FNEB 2L0DA 2Q20A 5DHYA 4PJEF 1LO3L 1KPRB 3LD8C 3V95A 1CU4L 3RP1A 1BZ9B 5J8OA 5E00B 4GRWH 3MLUH 4LDOB 3BN3B 2B4CH 4JJ5B 4P9HC 4XP4L 5D5ME 1VFBA 5HYQB 5LXGL 5FYJL 4S2SB 5SWSB 3GMLA 1JWMA 2F19H 4EUPB 2FO1A 4ZUUA 3MJ7B 1KCSH 3P4NA 3ZMRA 4X8XA 3I02A 2HFEA 4R7DA 2AEPH 1D3CA 1LO4H 2YD6A 4ISVA 4WEBL 3MZTA 4HUXB 3BW9A 5F7FA 5TF0A 1TNMA 4IJ3C 3P9MA 4Y0GA 1A7NL 4PJIB 1DE4A 5CGYD 1ZLVH 2WV3A 3TYGH 5E08H 4MVBD 4HWBA 2FGWH 4G8FB 1RPQA 2F54A 2ITCB 4KJPD 5EU7E 1I8KB 3FHQA 4HUKB 2AJXH 4B53A 4QNPF 1MI5E 3FB8A 3QT2A 1CK0L 1F8TH 2Y07L 5D7JB 2ILLA 1QQDA 3NABL 1DLFH 3WS3B 1CL7H 1XAUA 4WWKB 4LBEA 4X4YA 4G42A 1OW0C 1GOGA 5DUML 2W0KA 3CLEH 5C0NC 4JDZA 3QDMA 5JO5A 5BV7H 1AE6L 4Q9RL 1KJVA 4OLZL 3TGXA 4KMTL 1I1FB 4BFIB 4ZYKA 1BQLH 3SE4C 4X6CF 1UKQA 4XWOD 5FOJA 1XFPA 1XF2B 4BK4A 4FFZH 4KWUA 1G7MB 5HGHB 2IPUK 3NA4A 1R5WA 1C16A 3ZSTA 1D5IH 2CMRL 3ULUH 5C0JB 1CFTA 1M7DB 3RGHA 5HYIA 4K8RD 3DI3B 3WIIL 1SVCP 3RTQA 1HCVA 2APBA 1U3HD 1YN7A 3ZE2F 1A5FH 2CJUH 2Z31B 5DJCA 2ERJC 5EO0A 4PJCB 2Y06H 1T0MB 2ZCHL 3MV8A 4YBHA 5IQ7H 3WXWL 2PO6B 1NC2A 1DEEB 4ZFOB 3OJMB 4XVUC 4MSWA 3JTTB 1YEIH 2BOBB 1UWEL 2G5BA 3GJFA 5FA3B 1KPVB 5ISZA 2C3VB 2VUYA 1JWSA 1A22B 3VI4F 3GIVB 2VR4A 1MIMH 2DQEL 4DGIL 4F7CB 1KT2B 1L7TH 3O6FD 4RAUB 1CLZH 2FL5B 1RZFH 5BMFH 2W60B 2ID5A 3THML 4X9FA 2GK2A 1IGIL 1T4KA 4X7TA 3T77B 1J0KA 4JPKL 2H26B 4PLJC 1P69B 3U0WL 4L1HA 4MLSA 3MREB 4EI5C 1JF6A 3G5XA 4M48L 1RJLB 3LPFA 2HFFA 4JKPL 4ZAKD 2VLJB 5C0GA 4MNGA 1S9VA 3V52H 3ZO0A 5CJQH 3QUKB 2DYPB 4LHUG 3C60C 3GI9H 2E27H 3CFEA 4PRAB 5IEKB 2OQJA 2VN7A 3NCYS 4U1KA 2CIKA 4PJDA 1R3HB 1BZ9A 4HWNA 4U1IB 1UFUA 2XZQL 3RWCA 2NX5B 1SEQL 5I73C 4N0YH 2QJDA 3PXJA 4JR9H 5GZNC 3QBTB 5D2NA 3L7EB 4KVCH 1HXYA 3GNMH 4MXQC 4PJGF 3C9NB 3VXSB 1WBYA 3MRBA 4YHIA 3V0WL 1FFPB 3EO1B 4IMLA 1ACYL 5FGBC 2MHAA 1GJIA 1MAKA 4RGNB 1XIWB 3SDDC 4PR5A 4ZO6A 2PUQT 1FNSH 2IH1A 4OZHF 1DQQA 3OHXA 3Q6GL 4XVJH 4L8CA 1AI1L 3CVHB 2PKDA 3L7FA 2YD4A 4IHOB 2EC9U 4N90D 3ULVL 2NQCA 4X6BA 1F4HA 3DUUB 1EPFA 4FHBD 1IQWL 1XMWA 4F7MB 4UT9L 1UQSB 2ICWA 3H9SE 1ZVHA 2DQJL 2HA1A 1NGPL 4U6VH 1I9IH 4L8SC 5HHVH 4AL8L 2YZ8A 2D7OA 4PFEA 3REWB 1CF8H 1GVIA 3TT1H 3MLXH 4JHAH 1ZGLA 1JNHA 1A1NA 3GMQB 5EZLA 1MFBL 4K71B 4L4VB 4OQ1A 5DK3A 1U8QB 3MJ8A 5IB3A 5FDWB 5BQ7A 3MYJA 3BWAB 4P5TB 4JAMB 5F7HA 4UV7L 4LHQB 3H42L 3VFOB 4GXUM 4WU7A 3K81A 4JDTH 4DZBA 1DVFC 1KJ2B 3O81A 5K9QI 1V3LA 4LOUD 4UBDD 1RIVL 4X99A 2PW2B 1JHKL 1OGAA 1QSFE 2OL3H 3RWHA 3S35L 4Z6AT 5D7IB 3IFOA 2R29L