4XHJD

Ghgl of varicella-zoster virus in complex with human neutralizing antibodies.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
224
structure length
207
Chain Sequence
QVQLVQSGAEMKKPGASVKVSCKASGYTFIGYHLHWVRQAPGQGLEWMGWINPNSGETNYAQKFQDWVTMTRDTSINTAYMELRLRSDDTAVYYCARGGMTMVRGVMMDWGQGTLVTVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKRVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein H
publication title A site of varicella-zoster virus vulnerability identified by structural studies of neutralizing antibodies bound to the glycoprotein complex gHgL.
pubmed doi rcsb
source organism Human herpesvirus 3 strain oka vaccine
molecule tags Viral protein/immune system
total genus 27
structure length 207
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xhjD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xhjD01
1A6WH 2F54A 1VB9A 2E5EA 3SHSA 1K5NA 5JUEH 4J6RH 3DRQB 4I2XE 3WJJA 3ROOB 1QKZL 1KXTB 5EOTB 3HMXH 1AGBB 3ARDD 4KQ4H 3TP4A 3RWJB 5IESH 3V6ZB 4LSSL 3GJFA 2QTEA 4JAMB 3WXWH 3FB8B 4BM7A 1U91B 4YDLB 5A1AA 5KW9H 2WSKA 4ZFOA 3C09C 3H2WA 1CXKA 4NO5A 4UAOC 4RGMC 1TZHB 4D8PA 1WZ1L 4FZEL 4NQCD 1OB1B 3HR5A 3ARFC 2BSSB 4O00A 2AQ2A 1IQDB 4ODHH 4L8BA 4NZJA 2IH3B 4PJAB 3H3KA 4JGUA 4KJYB 2YD7A 5J9PA 3TO4C 3ORJA 5C0CB 5I15H 1NC4D 1KLFA 4RGOH 3MTRA 3IDXL 1GZPB 1I7ZA 2CRZA 3G6JB 4LQFH 2FHBA 1T0NA 1X5JA 5SWSB 3DGGA 4CRPA 2VZUA 3WMSA 4MCZA 3ARDA 5FYKL 2BVOA 3VE0A 3PWVA 1U3HB 4JRYE 1P7HL 1JMXA 5ESAB 3UTSA 2EH7L 4WV1C 3HNSH 3GUTB 3SEPA 4LKCA 5ITFB 5DMKA 5EZIL 4RQQA 1CE6B 5L0QB 4PJGE 1ZEAL 5IVOA 5GS1C 1RUQL 4YDIL 4NQCA 1ZS8B 4H26A 2ICWB 2ICEA 5EU5B 3VXUE 4UDTA 3QO1A 3MACL 4FXKA 4MAYB 3VFMB 3H0TA 4ZS6C 3PGDB 1S5HA 2VOTA 4M3KB 4MXWL 1ZT1B 4Y5VB 3T3PE 3IXTA 4WFGE 3PL6B 4QF1B 4YHMH 1Z9OA 5E2JA 4P5TB 4D9RD 4L4VA 2BDNL 3OB0H 4QWWC 1T1YA 3VDCA 3QCTL 4J4PA 1EAJA 4O2EA 1G9NH 1J12A 1XGRB 4R8WH 4TRPL 3H9HA 1WT5A 1OM3L 3D85B 1CICD 1S78C 2XA8H 2GKIA 1C08B 3RX5A 4UDUA 1RU9L 5ISZE 2DI8A 5FEBA 3VFSA 2NY4C 1J0ZA 4WWKB 2CDFA 3NA9H 3V0WL 4AL8H 2OSLA 3W5NA 5I1KH 1UB5B 4LOUD 2DI9A 1N6QH 5GS2D 1NFIA 4JPWL 5DYOA 2A6DB 2GJJA 4I3SH 1F2XK 2ZCKL 4LARH 3EO1B 1CDHA 4FFWD 3JBG7 4R26L 4QXWA 3N50A 1DUYB 5HYSB 5IJKC 5CINL 4WVRA 3NIDF 1I7TB 3L3GA 5CEXB 1HHHA 1J1PH 1RUAL 4NZTH 1UZ6F 2J2ZA 1TDQA 5GGQH 3QWQB 5TE6L 2EYTB 1EJOH 4FQXA 4NZRL 1A7BA 3HC0A 2VLLA 1WBZB 3LKQA 4P2QA 2AEPL 1S5IL 3GMRA 1GCFA 4LF3B 4F58H 2IMMA 3VXMD 4XNZC 3ARED 1ZHNA 3JV5A 1BD2B 3O41B 3QUKB 1A5FH 1UWEH 5D7JD 3ECBB 4FN0A 2J6EA 4K23L 5TQ0H 5IF0A 1YMMA 1NC2B 3ZE1E 4MS8D 2UUDK 4Z76B 1MPAH 2NTFB 1T1ZA 4U0RC 4WGWB 2JK5B 4JFFD 3Q6FB 3QUML 5HI3C 5B4MD 5C71A 3NCYS 2LAAA 4DN4H 4V2BA 3I6GB 2E7LA 5IR1A 4PJHB 2CSPA 2W0KA 4NFBA 3I6KB 1HDMA 5FKAB 2FO4B 3MV8D 4KRLB 2JJVA 2WWMC 2ED7A 2L7JA 2C3VA 1SYVA 4OSUL 5LGJA 3O6FB 1WFTA 3EFDL 3DETC 3F7YB 1CL7I 3OKNB 3H7LA 4K3EL 1A1NB 3VDBA 3DVNB 1MHEA 5JNYA 4FTVD 3IFNH 2A83B 3T4AA 4FZEH 2J88L 4KDTC 2AV7A 2IG2L 5KAQF 1LILA 3KXFB 4CJ0A 1J0YA 2E7BA 3O45B 1U8MA 3MV7E 1CLCA 1KPRB 1CFTA 2JIXB 4QKXB 1NUDA 2BNUA 2D03L 3GFUA 2OP4L 5IEHA 3IDXH 1GGUA 4OFIA 3CDCA 2PCPA 5JQ6L 4YUEL 4PRNB 3EOBA 4U7KA 2BCKB 2O93L 3T2NL 2HT2D 1FVEA 3CZJA 1T20A 4JY5H 3TLRA 3ROLA 3Q3GA 2NY5L 3STZA 5MEPA 3LPWA 3IDJB 2A74B 1QSZA 1JZ7A 2R2HA 4XMKL 3LPGA 1AC0A 1OT1A 1G7JA 5HYJD 5IW6B 3QUXB 1CE1H 1BQHA 4LCIL 3RWGA 3FMGH 5I76A 1S9WA 5CSZA 4HKJA 3TT1H 4RDQG 1FNHA 4JQXC 1MCWW 1BFTA 4WW1A 3VG0H 1ZGLM 1CDGA 4ZUSA 2F53E 1EO8L 1J9CT 4M6MH 4PGBA 3IB4A 3RIFF 4H88H 3F7VA 4P4KB 5JIHA 5GGSB 3EGSA 4J12A 3QDJA 2JCCF 1EEYA 2VUYA 4M61A 4GBXC 1CXHA 3AU1B 5T3ZL 3FFDA 2VDQL 3O3DB 3QCTH 1CFVL 4JHZA 4KXZH 4NOFA 4DTGL 4Z7VA 4IS6B 3HE6A 1TCRA 3H9SD 4BH7B 4JFDD 2QR0B 5ANMB 3MRQA 2IQ9H 5HHMB 4M1GL 2N7AA 5T1LD 3UYOD 4AJ0A 5F1IB 5KANI 1JHTB 2W0FB 3BVNB 2I07B 4G8IB 4PRPB 5IHUH 3T04D 2VSCA 3GSVA 4TUOB 4WW2A 3L3OA 1EHAA 2DJSA 1KJVA 2CO6B 3TZVC 4KFZC 3SDAD 1CFSA 1NMBL 2XZAL 5LBSH 3BZFB 1XCQA 2ARJB 2KPNA 2BOBA 4M00A 1I3GL 5D1ZB 3CDGA 5KSBB 2IGFL 1AO7D 4JPWH 5I8EA 1MUJA 4PJEA 3JWNC 2ZCKH 2DBLL 1FVDB 5CHNB 2D4FA 4PJ8C 4PRHD 2DQIH 2R69L 2XTJC 3WFZA 1MCQA 5J56B 3HZVA 2WBWB 1P7KA 3T77A 3UTOA 4X7TA 4U1MA 3B5TA 4HWBH 4M3JA 4J3XA 5ETUB 1OP3K 5GJSH 4M4PA 4M6NL 2XA3A 3TN0B 4NZRH 3SCMC 5EBLB 2FATL 4PJDA 5LAXA 1NEUA 5E8EA 4XNXH 1N2RB 3UXFA 2VTFA 4G43B 4HWUA 4JFDA 1GGIL 3LIZH 3TBTB 4E0RA 3HN3A 1MHCA 5J8OA 1A6PA 1PDKA 3CLFH 1ETZB 3L5XH 1MRDL 1ND0A 4PJCA 4BZ1H 1S9XA 1QFHA 3L5WA 1VEPA 1A6VL 3P9MB 4W6XB 4U1LB 1AO7A 5TH2B 4C56A 5DWUH 1VPOL 4K07A 4Z7OE 3D0LB 5SWZE 4OD2A 4NQVA 3BWUC 1R5IB 2GIYA 5DJAB 3ZYJA 2J8UE 1UENA 4BFBD 4IRJC 4XGZA 3WIHH 2EIZA 3CFJB 5I8OL 4XAWH 3FFCE 4I9WE 5DMYA 4NKOA 5DRZA 2VWEE 3QG6B 4UAOB 4YNYA 4H1LH 1U8NB 3F12A 4YHYC 5T5NF 4PUBL 1FZMA 5BMFL 2AJ3B 1TQBB 2X1QA 2XWJA 3MX0A 4NWTL 2NY0B 2I9TA 1EFXB 1CQYA 2V2TA 4LGPB 1WTGT 4DQOL 4V2CB 3TO4B 1NMCC 2D7NA 1B0WA 4FZ8H 1QHOA 2V2WA 5FHBL 2ZPKH 5EUKA 3O0RL 3OAUH 3ULUD 4YUEH 1QLRB 1BGXL 4QYOA 3I9GL 4QOKD 4FXGA 3C5JB 5AEAA 3GRWL 3I84A 5EN2B 3L95B 1HSBA 2CIKB 4X7SL 4X6BB 4H8WC 3LKOB 4H20L 1URLA 1QO3A 4XVJL 1I1YA 5EZLB 3G5XB 5FF6A 5IB5A 1P7QD 1X5FA 2FEEI 4LCIH 4ZUTA 1G7MB 1OGAB 4AT6B 1KB5A 2VB5A 3IRPX 3LN4A 4LLVB 4M1DH 5TDNA 1Y0LA 3NFNB 4MX7B 5TE7L 3QEUB 4G6KH 3ZKND 2Z8SA 3B9KB 3OKMA 9CGTA 1KTKE 4GG6F 3PXJA 4HWZB 3WO3B 5DO2D 5C08D 2Q87A 4JCMA 2EDTA 3P9WB 4CVXA 1EO8H 2Y7QB 3VXRE 3HZMA 5DD1H 3AB0B 5C07E 4Z7UF 4OZHB 4H5SA 5HGAA 4XMLL 3T0EC 1UVQB 4DOHB 5EA0H 2G9HB 3P77B 3LD8B 3QIWD 2VDQH 4NM8L 4G8FB 2O5ZH 4DTGH 2OMNA 4I4WA 4KH2A 4ODVH 1LK3L 5E9DE 6CGTA 1ZVSA 1R5WA 8FABA 2IF7A 1A7NL 3MRMA 4KKBC 1IGYA 4MQXC 4ONGL 5EORH 1S9KC 1RZGA 2G60H 2NY4B 1DSFL 1AR1C 3V7AE 4TNVK 4LCYB 5E5RB 1PG7L 3MLZL 4G9FE 3X11B 1F00I 3BKYH 1QSED 1FLTX 4OLZH 5J6HA 2XZAH 1JZ3A 3QQ9C 4EI5C 2Z8RA 2CH8A 2IGFH 1DL7H 4N0CC 3E6FA 1UYWH 4NO0A 2IBBA 1T21A 3L3JB 3ALXA 1WAAE 4S2SA 3MLTA 4XMPL 5DJXB 4FQLL 3U2SA 1KEMH 3NA4A 3WUZA 1ZSDB 2ADJA 3BZEB 4ERSL 2FRGP 4NRZA 1R6VA 5DJCB 1FAKT 5GRVL 4KHXL 3O3EB 5DJ2B 4QRQB 3VFVA 1T7XA 4KUCF 1Q9LB 4P23C 2FX8L 5L6YH 1CGYA 4N0UA 1HN1A 3G9VA 4XH2A 4NIKB 4JFEE 3RHWF 1U8OA 1U8QB 3DGCR 4CN6A 1CZ8L 2YK1L 1A7RL 5E8DH 3QQ4A 5D8JH 1Q38A 3VW3H 1YZZA 5C0AD 3CNKA 1MRDH 1NFDB 3G6DL 5DJDB 4OFVA 1FL3B 1IM9A 1ZGLB 5DEGA 2B20A 3ZT7A 1XR8B 4PBXA 2Y23A 1HHKA 2K9UA 2AJYL 1VPOH 1ONQB 2QADC 4OCWH 1OP9A 5ALCL 1IT9L 1G6RL 2ZUUA 3OKEB 3LS4H 3OXSB 1IGFL 3R06B 3VH8A 3MFFB 3FONB 5GSRB 1MCHA 3RPIB 5AAMA 3BUYA 1Q9WA 2H1PL 1V3LA 3EDFA 3UPRA 2YD8A 1BZ7A 5KZCD 3JVGC 5CIPA 1HH9B 5TPWL 4D9RE 4OF0A 3RNQB 1SBBA 4P3DA 4OM0L 5FYKD 43C9B 5FYLL 4IBLT 4F8TA 1HOCA 4Z8FL 4GQ9L 1VFMA 2PETA 1MCPL 4P5MA 3GIZH 4M6AA 1UC6A 3K8MA 3MRGB 2X6MA 5DC0A 3C5ZB 3I85A 1AXIB 3MJ8B 4AIZA 3O0RH 2GT9B 1SMOA 4OIBA 1S7UA 1JUFA 1OL0A 5FYJL 2X09A 4OKVA 5IB2A 3GRWH 4F2MA 4WI8A 3V6FB 2I60L 3PXHA 3TFKC 5I8CB 1KC5L 2YUXA 4Q0XL 3THMH 1KJ2H 5FHAH 3LPFA 4ONHA 4XXDA 4MJ2A 5E2UH 1M7DB 3L5HA 4GFTB 2VLJE 4WCYH 5KOMC 1BQHG 1INEL 2R39A 5SV3A 5TQ2H 4Y2DC 3BDBA 3BP4A 5D2LF 3MLRH 3IDUA 1RQ5A 2A6KA 4G7VL 1FFOA 1QEWA 3FCTA 4WEUD 4QGYA 5ADPL 5IBUG 2IFFL 5J3HC 4MLSA 3SO5A 4R2GC 1CGSH 2K7PA 2R2BA 4GW5B 1B6UA 1A64A 3VFUA 3SGEH 1UKTA 1KUMA 4PRIA 1CDYA 5HDQL 2FCBA 3L7EB 3PHQB 4OGXL 3NBNA 4PP2A 2WZPD 2OJEA 5GRYA 3S37L 4RGND 4KRNA 3I3EA 3D5OF 3NCFB 3UJIL 3HPJB 3MV8E 1ZA3A 3GSWB 1PD6A 4MDJA 1BPVA 1ZWIB 4OCRH 3HZKA 5T1MA 2FJHB 3BN9D 3MLZH 4XVTL 1BOGB 1AXSA 5D93C 2AJVH 1U8KB 4H8WH 5IB4A 4EQ2A 1LO2L 1M71B 3WNKA 4PJ8B 4RSVA 2XTJB 4ZOEA 1QZ1A 3DURB 4JANB 4P2RD 4FQLH 4HMEA 5A16A 4JVPA 1SYSA 1AXTL 3W2DL 2UZIL 4Z18A 1EHLH 5GRUH 1RUKL 4N8CH 4IM8A 4ELKB 3SCMB 5C0GA 2VLRD 1Z5LA 5KVEL 2VLKD 3MODH 4F15C 4NJAH 4MXQD 3EHBD 1OCWL 2VSDA 3GMNA 2BSED 3MBEA 2R56H 1JF1B 2FX8H 2AXGB 4GRLB 4X6EB 3ZDZF 3PWLB 4AEIH 1P4IH 3CAFA 3RDTA 1U93B 4RNRB 5E7FA 1QQDB 1KIRB 5EIIB 3RVTC 2DWEB 1DQDH 2CDGA 3ZHKA 3QWOA 1I8IB 4WJ5A 2Z0BA 3WIIL 5BRZB 5HYJE 4MJIB 3QUYB 2CR3A 4PTTB 2Q8BL 3EYVB 1KJ2B 3UBXB 1A6AB 1VSCA 3IU3A 3FO9B 2OQJB 3MRHB 2VMFA 4O58L 4XCYA 4HIJA 3WFHB 4ISVA 3A6BL 5E2WL 4AEEA 4X9BA 5GHWL 5EZOH 5ESVB 2MQ3A 2ESVD 1TVBB 4IRJB 2VABA 4TOYL 1T03H 1RJLB 5LWYH 4OZIF 3KPSD 4FQHB 2HYMA 4HK0B 3QUMA 3HKFA 1CS6A 3MYJB 3HRZB 2V5RA 1A9EA 3NIGE 2VLKA 1DQTA 2H8PB 3DX6B 1FDLH 3QULA 1MCBA 1HXYA 2IPTL 4QXGH 5F9OL 1DVFA 5IB3A 2Z93A 1F90H 1F4HA 4TTGA 1LQSR 3SPVA 2E7MA 3ZKQD 4O2FA 4RIRB 3ZSSA 1JNHA 5ILTL 2XKUA 4I13B 5FFLA 1MCOL 3L3IB 4P9HL 1T0MB 2W9DH 1BAFL 1HWHB 2NXZC 5BQ7B 3TA3B 2BSTA 4S1SH 5HHQA 4LNRA 3WS3B 3EYFA 3WFDL 2V7HA 1DEEA 5EBGA 3QIUC 1GIGL 3LQAC 4N5UA 1YN7A 5D70L 5C0BA 3FT4A 3D1MC 1RUPL 2I60H 3NIFE 4WU7A 1JRHL 3DX7A 5IWLA 1BIIB 1H9VA 4N9GB 2X1WL 4YHLH 1YMHB 4AEHL 2JCCA 3DARA 5CILH 2YD1A 1NAML 1AD0A 1FVCB 3FL7A 4UMGA 3G6JF 4GLRI 4N8VG 4HUVA 5FECA 4WTWA 2NXYC 4ONOA 5CUSL 3WDIA 5D5MB 2F15A 4PV9B 4RCAA 4NFCA 4W81A 1F6LL 3GSOB 4X9HA 3T0EB 3QDMA 3CH8A 3HZYB 4QT5A 5C09D 1H5BB 5GGSY 1SJEA 1KCVH 2V2XA 5E99L 4WY7H 3WNPA 3WN5B 4LCCC 4MJ6B 2CPCA 1NGPL 5L2KD 5HDQH 2CIIA 1I1FA 3QQNA 1P1ZA 3VXSE 1RZ8A 4QRSA 2P8PA 4MJ5B 1KGCE 4OGXH 3VFWA 2BRRH 3MNWA 2HN7B 2E6JA 3S37H 5JW4Q 3D87B 1Y18A 3TNMB 1K9TA 3UJIH 4X6CE 5BVPH 3NFPB 4K8RD 2XQBH 1J18A 4OFPA 2P49B 2MSPA 4KY1L 4BFIB 3K8KA 1QRKA 4DVBB 3KJ4C 4QRTA 2ZG2A 4JVUA 3T1FB 2ZSVB 4KKNA 1Z9MA 3GHBL 1CDIA 3PWPB 3VMOA 3RPKA 3I75A 2R4RH 3FO0L 2P8LB 3S5LB 2NY6D 4MD0B 3QFDB 4LBEA 2RGSA 4WUUA 3MXWL 1OAXH 4OF5A 5FO8B 1FZOA 5I18L 4I2XB 5C09A 4CU8A 2W65A 3WJLC 3MROA 1OTTC 4X4MA 1CQKA 2EDEA 3GMOB 3E6HA 4P23B 4HIIA 3ZKXC 2CJUH 1OTSC 1W0WB 4MXVE 3ULUE 4QHUB 5CEYA 2FL5B 4QOKE 1VENA 3KLHC 2R0ZL 4X9GA 2APTA 4MSWB 5FA4B 1SBSL 1XIWC 1ITCA 1QRNE 3BWAB 3OJDA 2R1WA 3QIBA 3JUYA 1KTLB 1EEUA 3S6CA 3CFEB 2XPGB 2MPAH 5CEZE 2Z4QA 2FECL 1ROWA 5DDHA 4KQ3H 2CLZB 3A6BH 4N8PA 5GHWH 2AV1B 3LV3B 3VA6A 4HXAL 5C08E 1LDSA 2H3NA 4K7PH 1KN4H 2J4WL 3FT2A 3ILQD 1IC1A 4ZG1A 1Q94A 4XI5C 1FLRH 1NGWA 3GSUB 5F9WB 2FYYA 3M17A 4PB9H 1G7QB 3VH8G 1HKLH 2GCYA 4L3EE 1FFRA 2HTKD 3NAAH 2XZQL 5E2TH 2F5BL 1ZA6B 3Q1SL 4JRYB 3ZYOA 3IFLL 43CAA 4I0PC 3HS0A 4IRSA 2YRPA 2VDPH 3RA7L 4NQEB 5ACLA 3CMOL 4UQ3A 1FRGL 1KTRL 4P2YA 3K8LA 3N85L 4PJGB 2FIKA 1QFWL 1Q9KA 5J57B 4JDVA 5ILTH 4NO2B 1MCOH 2CDEB 2R1XA 3UAJD 1KT2A 3VXUB 4KMLB 2P5WA 3K1KC 4I48B 5T33L 1RZJL 3UYPA 1MAMH 4PJ9D 1VADA 1T3FB 3EZJB 4X7DC 5A3IC 3HC4L 1QSEE 3HNTL 2MCPH 4C58B 2VKWA 4CJ1A 2HKFL 5C0EA 1A3RL 4LLWB 5HYQA 4M1CD 5KJRH 3UC0L 3IVKB 2EIDA 3T65B 1GVIA 2EZ0D 2ZP0T 1X4ZA 5CGTA 1F11B 4XVUD 3LMJL 3BW9B 1HIMH 1FYTE 3OZ9L 5E4EB 5DHXB 4Z7UA 3HCVB 2BJML 4Q2ZA 4WIQA 3TBVB 5K59E 5ISZB 2EC9T 4NDMB 4Y2DB 1D9KD 3F62A 5DK0B 1NL0H 3QUZC 4NBYB 3IETA 3WSQL 2EH8L 3CVHB 4KUCD 1WCBA 2VC2H 1I9EA 1R3KA 5IG7B 5D96C 3C60D 3EYUL 1BFOB 3UTQB 3DX8A 2DJ4A 1U2CA 5C0AE 4QGTA 1YUHA 5E99H 2CR6A 2VR5A 3UX9B 2XFXB 3ZE0E 5C6PB 3WDJA 1MHPH 3WS6C 1Z2KA 4P2OB 5ICYA 2A9NH 2EDKA 4AIOA 1JGDA 1N8ZA 1T2QL 3IDNB 2VQ1B 4YHZH 2Q7NA 4NNXB 3RWCA 2DQTH 3B9DA 1N59A 1I75A 3QB7C 1MJ7L 1OAZH 3BX7C 4YHOL 3MO1B 4CNIB 4QO1A 4Y19D 3LQAH 5IVXE 1CLOH 3N1MC 1E6OH 2NY3D 4M8QA 2OYPA 3CIQA 3W81A 1MI5D 1D9KA 3IDMB 3DMMC 1PX3A 3GHBH 3UZQA 3SKUD 3LSOB 5LKNA 3FO0H 5I1AB 4ZPTA 1IFHL 4ZUUA 1VDGA 5BZDA 5EWIL 4QHLB 1K8IB 4U1SA 3C60A 1X5KA 2W9EL 5I18H 1ZMYA 4XAKE 1I3UA 1BOYA 1J0JA 1HNGA 3BH8B 2NY2B 4OLEA 4F15B 4M5ZH 3MRDA 4Z78B 3RWHB 2AJZA 1BREA 1AGFB 4Z0XA 5DJYB 4M48L 3DBXB 1QTYT 3BEVA 5L88H 5KSBF 4RA3A 2QL1A 5D2NE 3OAYK 3U6RA 1AIFA 4NN5B 3Q6GH 2KZ1B 1IAOA 1QBLL 1WZLA 1LGVA 4LVOB 1HEZA 5J6GA 2PYFB 3BXNB 4L3CB 4JRXD 1KPUB 1FO0H 2ATKA 3EDKA 3GSQB 3VWKB 5IEKB 3MV7B 1F45A 1CCZA 2RCSL 3W5MA 1AP2A 1B0GB 4DZ8A 3GMMA 3MA9L 1DLFH 1UJ3A 2A38A 2JKXA 4ODBD 1FE8H 4I3GA 2NQCA 4WUKH 5IBTL 2XN9E 1CU4L 1JNJA 3BPCB 1MH5A 4LHUB 1E4XI 2AK4A 1A22B 2WBKA 1LO4H 4CMHC 5D1QD 5I19L 4Q9CA 1JNNL 4XWOD 1MF2L 1S7SA 1RD6A 2YD3A 1KF9B 5D1XA 5IHLB 1I8LC 1YYML 2UVEA 3LN9A 4MNHA 4AENA 2Y07H 4GSDH 3ZKMC 5KVFL 3FAXA 4XCNB 5IUSA 4O4YL 1G6RA 2W60B 4HJ0C 2X4RB 4O2CA 4ZUVB 1R3HA 4ACPA 4JFYA 4HIEB 1IL1A 4JREC 4M7JL 3H9ZA 2DDQL 3EO0B 4RZCA 4LLQA 5TGBB 1N5AA 4JG0H 4RFOL 3X12A 2F53B 3LS5L 2J1KA 5T3XH 4F7MB 1DEDA 4G7YH 2HH0L 4OFYA 2P7TB 1I1AA 2EXYD 3VXQA 2ZUQB 3HNTH 4H1LG 3WL9A 3X13A 1AKJA 5L8LB 4QXTA 5D2LA 2BHYA 1KJ3L 3MXVH 1IC5L 3IFPB 5IV2A 5D7KD 3D2UB 5L8KB 3ARWA 1VGKA 3VXOB 1MCLA 4CVZB 5KS9E 3L1OL 3VFTB 3SDCB 2AJUL 2GAZB 4GW1B 3RTQC 1MAJA 1CYGA 4IMKC 2IAMC 5HHVH 4PY8I 3MV9A 1SQ2N 5HDBF 3TYGH 1G0YR 1V7ML 1JIBA 1ZTXH 4MB4A 2Z91B 3QDGE 5DUMH 3ZDYF 1E27A 2NXYB 3DIFB 4Y0GA 2FSEA 3ARBA 5F7KC 3MREA 5DD5H 1VKXB 4JKPH 2GEEA 5ICZA 3MA7A 2G2RB 1HXMA 2PYED 3WFBL 5IMOA 1JWMA 4POZD 5B8CA 2E6QA 1IE5A 1AI1H 1NGZA 1Q72H 3FO2B 1N0XL 4PLJC 2X4NB 3PABA 4MHHG 4OZFH 1EXUB 5D7SL 4HCRH 4JZJC 3CLEL 4AG4L 1FL6A 4KVNL 1BJ1H 2XACC 3CZFB 2HFFA 2GSGA 5GSVA 3KPSE 4YHOH 4DAGL 3PP3H 3U0WL 5CMAA 1VFBB 4X8JA 2X1OA 4OCYL 1TTGA 1B4JH 3BQUC 1A7OL 5B22A 1QSFD 5FCSH 5TJWK 4HDIA 4CADB 3OHXA 5T1KA 5J12C 4JN2A 2ZUXA 4JM2C 3AAZB 4CUCA 1CFQA 1S7XA 5MENE 3GHEH 2BHZA 2OK0L 5ERWB 1MCIA 3MV01 1CGWA 5DSCB 2X2YA 5IT2L 3JTSB 4OLXH 1TNMA 4HH8A 5C92A 5SWZB 2W9EH 4XZUA 1C5DA 4U3XA 4ZXBC 4R7DA 2OTWA 1JGUL 3FB7A 4AH2B 4P46B 3ESVF 2DYPA 5FIEA 5IMLA 3ZKXB 5CP7A 2C1PA 3S35H 3RZCD 2BNQD 1UGNA 1RJZB 3OX8A 4LASL 1P4LA 3FFCB 1IAMA 1TZIB 2UVFA 4FQQB 4XNUH 1TXKA 1A2YB 1XIWB 5C0IA 1I9IL 5F71A 3R1GL 2VXQH 3RGVA 4Y4KC 4JGJA 5H94B 3QNZB 5F89B 2R29L 3M8OL 3OGOE 3HMWH 4EIGB 2H32H 5F8RC 3ZHLA 2DTMH 1QSFA 4HJJL 3V79C 1YEEL 4CAGA 2H26A 1TMCB 1EZVY 4D0CA 5ENWA 5IFHL 1XGPB 5IBTH 4JO4L 3O9WC 3CSYB 4W4NA 4R4NC 5T5NG 2AI0H 4PJXF 2PTTB 5IM7B 5IMKB 2HT4D 5I19H 4U6XB 3ROOA 2FEDC 3FO1A 3DUSB 3VD7A 2GY7B 3LB6C 4LAQL 5JHLL 1YYMH 1IEHA 5E08L 2GK0A 5A2FA 3BFOA 2OXHA 1ZE3C 1IC4H 3RWJA 1U3HD 1VACB 3O8XC 1MREL 1WJ3A 2YKLL 2DMKA 4I3RH 1R3LB 5HGBB 3FB5B 3FB8A 3MRJB 2DQGL 2CD0A 1U91A 3RUGE 1R3IH 3MLYL 3CPLB 1RULL 5CCKL 4OZFB 5BJTA 1TZHA 5DJ6B 1DBAL 4MCYB 2KUTA 1OB1A 2WUBL 4HQQL 4NHCL 4MAYD 5DD3H 1SEBB 5KTEL 2QV2A 4C54A 1NLBH 1IQDA 1Z6JT 1XZ0B 5IKCB 2IH3A 1JE6A 1EV2E 3L5JA 3VXRB 3WFCL 1S8DB 4KJYA 5C07B 3KGRA 3PL6D 4BSJA 4KAQL 5GS0C 5C0CA 5CZVH 3RBSA 4JM4H 1KJ3H 3BHBB 4P5TD 3G6JA 2VITB 3H42H 4NN6C 3BKCL 2XI9A 3QO0B 1XF2B 3RY6A 4OJFL 4ZFGH 4LNVA 5SWSA 1TZGL 1I7UB 5DEFB 5E9DB 1J1OL 3D85D 4PJ7E 4EVNB 4LEXL 5LVEA 1CLYH 4RMRA 1IM3A 1U3HA 1U8LA 1K6QL 1DDHA 4WWKD 3OR6B 5GZOD 2YBRA 1AGCA 4AMKL 1F3DJ 5KSVB 3MGAA 4TULH 4YLQT 4MMXC 1BQLH 2Z31D 1IILE 4NJ9L 1WFOA 3H3BC 4YC2B 2Q3AA 1ZS8A 1T22B 2ICWA 3VFRB 3MRFA 1SHMA 4QHNB 5A2KH 3VFMA 2CRYA 3OXRB 3EJZD 4FRWA 3WNNA 3WHXA 2FWOB 2FBJH 1NAMA 4RMSA 5SX4I 1BWMA 5FGCE 3PGDA 5D9SB 2VNCA 1M05B 2AEQL 4QNPF 4MVBD 4LPXA 1ZT1A 4WO4C 1YNLH 2BRQA 3ES6B 1GZQB 1DR9A 3PL6A 2H32B 2XQYK 4KVNH 3QSKB 5FM8A 3UDWC 5LXGL 2GFBB 4LRIC 4U0QB 3JV6B 1QFPA 1WEJL 4YDJA 5DMJB 5T1DL 5E03A 5K9JH 1F4XL 3ARGC 3DXAA 1BD2D 4PJIE 3SDDA 4DAGH 2P24B 4DGIH 4JFEB 5I0DA 3PDDA 5DFWH 4L29B 5KVDH 4B7LA 2P5EE 3GM8A 2FIRT 2XXMB 3BYTA 5DQDH 5GGTL 1ED3B 4WWKA 3IJSB 1Z9LA 3GO1H 4R7NA 1ZT7B 4CU7A 3G6AA 1F8TH 3UTTE 3RWDB 4QTIH 5AD0B 4IDLA 2A6DA 2GY5A 4LAJH 5HHNB 4GOSA 5KVGL 1PQZB 3NCYP 3L3HB 2NW2A 4ZOCA 1MLBB 4UOW0 3WKMH 5CEXA 3SDYH 3K3QA 5F9AC 2C4FU 1Z9SA 2F54E 4RMTA 4OD3L 4X83A 3LKNB 3O6FD 2X70A 1NGQL 3RQ3A 4MGXA 1WBZA 3PUCA 3W11C 4JPKH 5DZOA 1KIPB 4Y16B 4AM0A 4DGYL 1CD8A 3R1GH 3GK8L 4DGVH 4CN4A 1FJ1B 3QUKA 3KVQA 4H0IA 1DQJB 5JIPA 1NCWH 3LEVL 1LP9F 1NC2A 1JGEB 1BVKB 1XGQA 1QBMH 4F57L 4HJJH 1MWAH 4KK9C 4E42B 2NTFA 3Q6FA 4LLMB 2A73A 5IFHH 1RIUL 5JDJA 3I6GA 5D7IF 4CMHB 3MOAL 4PJHA 3HFML 4CVWA 3I6KA 5JXAH 1G7LB 5FKAA 3VCLA 2FO4A 3EOAA 3TESA 3NH7L 1W72L 2QHLA 4ZS7L 4LAQH 4MNQA 4F9LC 4HZLA 1X7QA 1T2JA 5KSUA 3WNMA 1MREH 3QUXD 2YKLH 3O6FA 4RAHA 1B0RA 1KEGL 2I5YH 5FKPB 1UZ8B 1K8DA 3F7YA 3U36A 1HYSD 4TVPE 5IFAL 2VLJB 1A1NA 3QEHB 2ADGB 1BECA 5IROA 2A83A 4Q6IA 3U9PL 4NHCH 1QR1B 3VXMB 3KXFA 3UTSE 1IGCL 4PGCB 4EDWL 5ADOH 3QISA 5D7JB 3WD5H 4F9PC 2JIXA 4Q9RH 4P4KD 4WFHE 6FABL 4RMQA 2YPVL 4OZ4B 1WITA 3RKDD 1HZHL 4KAQH 5DK2B 4GXUN 5HI4C 4PRNA 2DQUL 3OKKA 2DWDB 3MJ9L 4XPTL 4OJFH 5CWSB 3RTQB 4JJ5A 4LPVA 1J1OH 2IAMB 5HHMD 1PG7X 2NYYD 4JFXA 5F7FA 3IDJA 3MV8B 4LEXH 1HNFA 4FQ2L 3O4LD 3OAZK 5IW6A 3BRGC 4L4VE 5IBLC 3GI9L 2YEZB 3OG4B 2ERJB 3HTLX 4DW2L 3QCVH 1IJ9A 5TDOB 5D1ZD 5ABDE 3KLDA 4DN3L 4TTDD 1E6JL 4P4RB 3D9AH 5HVHC 3UPCA 3IFOA 2PO6C 3PHOA 3RWIA 4F7PB 1MIMH 3O6LH 2ED9A 3SJVA 3OSKA 5K93A 3CXHK 5LCVL 4Z7NE 1IGIL 4JZJB 5AG8A 4P4KA 5GGSA 1CR9L 2HLAB 3TN0D 3SKJL 4F8QA 3AU1A 5FYJU 4HGKC 2I25N 1UWGL 5HJ3B 3J7HA 4IS6A 4JQIH 3L3KB 4BH7A 1P9MA 4LPWA 4YR6B 2JLLA 5D5MF 5ANMA 4YDVB 5GS0H 1F4XH 1U8JB 3W9DB 1T4KB 4U31A 4LDEB 4RWYH 3TBWB 1PEWA 3BQUB 5EDXA 5F1IA 4S0SD 2W0FA 1KCUL 3BVNA 2I07A 4G8IA 4PRPA 1JGLL 1C16B 2YD4A 4P2QE 4ALAL 4JM2B 4LKXB 1KYOK 3QI9A 2VXUL 5HYJB 2P45B 4C59B 3BZFA 3KYMB 4JHAH 1V5JA 2ARJA 4K3HA 5D1ZA 5KSBA 1JHLL 4PRAB 3HLAB 4XCEA 5I17B 1FSKC 3MJGX 1YMME 4R97B 1FVDA 5CHNA 4NYLB 2YD2A 4LSPH 5KVGH 3MJ7B 4M6OH 1RPQA 2FZ3B 1HHJA 5FUCE 1MFNA 4ODWA 5CJQH 2GHWB 3I2CL 4Y4FC 5F6IC 3I50L 5ETUA 2JJUA 1NGQH 3VGDA 5EBLA 3PHSA 1GPOL 1U9KA 1CDJA 3EZ8A 1N2RA 1ZLWH 3ARFD 1GHFL 4L3AA 4G43A 1HQRB 3LZFH 2DQHL 4LSUL 4DK3A 1S7VB 4JPIB 3UEZA 4RFNB 5C0FB 4HGWB 3TO4D 1H3XA 3MBXL 5T1LB 3UJTH 3IXAA 4UB0L 2YD9A 2EE9A 1IGML 4JPVH 2FGZA 4XPFL 4UNTA 2FX9H 5FV1L 5ECJE 1B2WH 3O9WB 3P9MA 3MLXH 3QP3A 4DUWA 4Y5XB 4M5YL 3SDAB 1F02I 1REIA 3S4SA 4D9LL 4ETQB 4L5FH 5DVLA 4LSVH 2NW3A 4UIKL 3T3ME 1RV6X 1PZ5B 4QRRD 3QXDA 5DJAA 4NRYB 1W72H 3SOBH 4KI5E 4YFDB 2PYEE 3F58L 4PRBB 4GXVL 4PY7B 3O8XB 5E94B 1KV3A 4JY4B 4EEEA 3C6LA 1DFBH 3DTXB 1NBVL 4KVCH 3SBWA 5DUPH 4LCWA 1Q0XH 1OGAD 4YXKL 4R4FH 1N64L 3QH3A 3QG6A 1D5BB 4NN7B 3VGGA 1L7TL 1U8NA 1Q1JL 5F9JA 4DEPC 3B9KD 4NGHH 2EYSB 5A2JH 3BN3B 5TF0A 4CDGC 3GEWB 1GH7A 2AJ3A 2DMBA 4ZS6D 4M4RA 2NZIA 4KDVA 1EFXA 1EA9C 4ODUA 1ACYL 5IGXL 4D9QD 4U1NB 1IGCH 1BWWA 1P6AB 1LDPH 1MCDA 2B8OT 2E7HA 2GJ6D 2LTQC 4QWWD 1I8KA 2VZVA 4NN6B 3S37X 3CK0L 2IPUK 4M7ZC 3N9GL 12E8H 3VXSB 4HSQA 4OGYL 4FFVC 3QWRD 3OF6D 1S78D 3WFEL 2WBJA 5EN2A 3L95A 5F7NC 5HVFB 4X6BA 1NEZB 1PFCA 3QDJE 4PS4L 3LKOA 2NY4D 5HHXL 3U1SL 2P46B 1R0AH 1FL5A 2VXVH 4X6CB 1RHHA 3BI9X 4LGSB 5EZLA 3TC9A 3PJSB 4DW2H 1ZLVH 2DLFH 2BNQE 2V7NB 1G7MA 4Z7VE 5CBAB 4LLVA 2GJZB 4RISL 4MX7A 3GIVA 3QEUA 3T3PF 3WHE0 2YD6A 1JNLL 3B9KA 4B0MM 3NPSC 4HWZA 3ARZA 1MCCA 5C2BL 4BZ2L 3B43A 3QQ3B 1MCFA 4OD1L 4A6YB 5E56A 2ADIB 4OUOA 1MEXL 3T1WA 4HG4K 1UVQA 1T5WB 5EZJA 1CR9H 4F7CB 1I4FA 2ZKHH 4N0RA 5CJOL 3HR6A 3SKJH 2YD5A 5I73B 1A14H 2G5BB 3SKOB 2BVQA 3RIAK 3ULSB 4G8FA 2A77L 3RL2B 3OF6A 2ZSWB 1ZV5A 4HXBL 1II4E 4G9DA 4QOKB 3CUPA 3LN5B 3O6ML 1QA9A 4JQVA 5E1AA 4KXZI 1DUZB 4LCYA 4PJDE 1GOFA 1QRNB 4PY8J 3V5DA 3OB0K 3BD4A 4NKDB 3TEUA 4PG9A 3LHPL 4TQEH 3ZKSD 2K1MA 4GRWH 1I8MA 4CVUA 3UJJL 1T6WA 1CGVA 4R0LA 2HG5A 3CXDL 4NSKB 3X3FL 4EOWH 2OJZL 2Z92A 5KOVC 2WWMD 5C08B 1TCMA 5ID0B 4F3FA 3GGWB 3DETD 1KIQA 2IPUG 5DJCA 4LU5L 1UH4A 1ZLUH 3TT3L 4E41D 3I50H 5MI0C 4C56E 1LNUB 3ZE1F 4L3EB 1MQKL 1DANU 1TITA 2YN5A 5DJ2A 4M02A 2Y6SD 5IOPB 1Q9LA 35C8L 5SX5K 1JP5A 1T7YA 3QIWB 3WV0A 4NQDE 5AYUL 3MUY1 1MVUA 2DQHH 2R23B 4PJXA 4Z0BL 4WI3A 1JPTH 3A6CH 1MJJB 4L8CB 5D6DA 3ZLQC 3VFPB 4Q9QL 4JLRB 5IK3B 2MJWA 2WM0A 3CFIC 4XPFH 1FL3A 3C5ZD 1ZGLA 1RJCA 2DM4A 4HS3B 1KLUA 2C3XA 4G6ML 4BK4A 4M62L 2QQLH 1XR8A 4HC1H 3TWCH 1QSEB 4D9LH 1A6UH 4X5WA 1J1XL 4XNYL 4FABH 1ONQA 4OLVL 1JI1A 4UILH 5C9KA 1JZ5A 1U3JA 2NY7L 1DN0B 4UIKH 1BJMA 3OKEA 2G75A 3R06A 3MFFA 1FYTB 3FONA 5GSRA 5DQJA 1NBVH 3RAJH 2VL4A 1AY1L 1U2HA 4Z5RB 1HILA 2BSRA 5KSAA 1Q1JH 3FQWB 4WFED 3RNQA 2X4SB 1JPST 1YY9D 1MFBH 4HWNA 43C9A 1RIHH 4PV8B 4QRPA 5E70A 4OIIH 4Z7QF 3RY4A 1C1EL 4S1QL 4S0TD 2ZOLA 3OKLB 4I77L 3EJYC 1D6VL 3DSFL 4LIQE 3MRGA 5BXFA 4GBXD 2PXYB 3C5ZA 5C0AB 5EOCH 3MJ8A 4KK5C 5DHVB 4PP1C 2ATPB 1RZIB 2GT9A 3B2UD 4JGMA 4LPUA 1X5GA 4YBHA 4N90E 4DUXA 2VE6A 5E6YA 3V6FA 2DLIA 4WEBH 3P0VH 5TE4L 1MJ8H 4HWEL 4MNGB 4YEFA 1N3NB 3PDGA 3TZVD 2ORBH 4HS6B 4P5KA 2F8VA 1M7DA 5IVXB 1BEYL 1EO7A 5DXWA 1NCDL 1J86A 3GBMH 4RISH 1MIEL 2YR3A 1GL4B 3OR7A 1JNLH 4KK8D 2XWBB 5A2LH 1MVFA 4PJ8D 5L7XL 2XTJD 3W9EB 3SQOL 4P3CH 4GH7B 3TH3T 4H25B 1MFDH 3VGBA 2VL5B 3D18B 2EDOA 1NSNL 2BMKB 2XKSA 1WV7T 2VERN 4GW5A 4KMTL 3V6OC 4KMQA 5DURB 4P59H 3SCMD 3MLPA 1OAYL 2CKNA 1JK8B 3X14B 4LSTL 15C8H 4WU5B 4MD4B 3PHQA 2OL3H 3TVMC 1H3UA 4GRLD 4LVNB 2DQCH 1CFNB 4WRLA 5D2NB 4HXBH 3D39E 3WJJC 1HHIA 5DRWB 3HPJA 3MR9B 1ZWIA 4NO3A 3JSSA 2WINB 2FJHA 5BRZD 3VXPB 3GKZA 3B3IA 3ET9F 4MJID 1BOGA 4KTDH 3MZTA 3T09A 4D0DA 1NLDH 4N0UE 1FSKB 1ZHKB 4QRUA 5JW5B 4HHAA 2B2XH 1KG0B 4YBLC 3WEXA 1N4XH 2R0KL 1G7PB 2XN9B 3DURA 2M8XA 4IRJD 3CXHJ 5GGTA 2DN7A 4M43H 3BJ91 4Y4FB 1LP9A 3ZTNH 4NQXB 3V4PL 2APBA 4JFZL 1UFUA 3BPOC 4NOBA 5KG9B 4OV5B 3AXLB 1JHKL 3QEGH 4GRLA 5D7IA 3S88H 1O5DT 1PBYA 4DKEL 1U93A 4MYWB 4RNRA 1QQDA 2YA1A 1U36A 4KJWC 1SY6L 5EIIA 2DWEA 3HAEA 4WHDA 2D9CA 3DO3A 1KYOJ 1R3JA 3O2WL 1ZK9A 4Q9QH 3ARDC 4JY6B 1QFUL 3O4LE 2MHAB 4WWID 3QUYA 4HIXL 4PTTA 4NNPL 3EYVA 3JWDC 3UBXA 2VAAA 1G9ML 1A6AA 3FO9A 2OQJA 1J1XH 2JB6B 5HI5C 1MFEL 4OLVH 3DHMA 3BUTA 3S4SG 1YEGH 1Q9OA 1A7QL 5I66A 2WANA 1FN4B 1RJLA 4FQHA 4HK0A 2HT3C 1T0PB 4HPOH 1EFQA 5KS9B 3FQNA 1F4WH 3MYJA 4WENB 4WI7A 1N6UA 1AY1H 4DEPB 2H8PA 3DX6A 2G5RA 3B2VH 3P11L 5BVJB 1IARB 1S7TA 1NCNA 5BO1L 3TBYB 3U82B 3QDGB 4GUPB 4J4PC 2NZ9C 4QXUH 3KNBB 2YC1B 2RQ8A 5DJZB 1WT5C 1I1CA 5EC1B 3RU8L 1KFAH 3T0ED 3CH1B 1BIHA 3ULVC 4L8SA 2LTQB 2B0SL 2KBGA 5H37H 5BQ7A 3TA3A 4KTEL 4LLDB 3OB8A 4CMMB 4U2ZA 4K2UL 4M7ZB 2X44D 1CDUA 3V4VH 1XFPA 4KJQC 1T04B 3I02B 4K94L 4WHTB 1PVHA 2IPKB 4JRWA 4ZODA 4KKBD 5JO5A 1MY5A 5EO1B 5I1JL 4GW4A 5MHSE 4HEPG 3JWDL 1AR1D 1A7PL 4X9IA 4PRIE 4ZTOL 4NKIL 5ITBL 1BIIA 4N9GA 4PBVC 1PZUB 3KPSB 1UA6L 1YY8B 1T80A 3QQ9D 4EI5D 3MJ9A 3KHQA 3NZ8B 3B8SA 1LWRA 2UUDH 1B6DA 4N0CD 4QHMB 3F5WB 1FVCA 3PWPD 4FNLH 4FQXC 5JQHC 5BV7L 2ZJSL 4GMSL 1XCTB 5CSBA 5FM5M 4FFYH 2OR9H 3FQTA 5MENB 4G8GD 2OI9C 2BZDA 3FQXB 3S36H 3TV3H 5D5MA 3EFFB 3MYZA 1UZ6E 1TTUA 3GSOA 3VXNB 4NM4L 1H5BA 3MRNA 1G7IB 4KMTH 1LO5B 3TIEB 3WN5A 5IHZB 5JXEA 4MJ6A 1OAYH 4EI6B 4HUMB 4P23D 4XXCA 5FUCC 3REWB 2WLYA 4LOUC 3JV4A 2HN7A 3SGEI 1UACH 3TNMA 5F7MC 2E7LC 3T4YB 3R4DA 4QRRE 4FFWC 1GGBH 1WAAF 3NFPA 2O5YH 3BAEL 1CL7L 3NGBB 2DD8L 1M7XA 1RK1B 4DVBA 1I3RB 1MY7A 2Q86A 3T1FA 2ZSVA 1JWUB 3PWPA 3LKPA 3VWJA 4Q74A 1IAIL 2QADD 4FP8H 4DKFH 5TDPA 1S7RB 3QFDA 3QHZL 3U79A 3MOBH 5DS8B 1ES0B 4R9HA 3ZDXE 5BZWA 3KYKH 3F7QA 5GRZA 2VUOA 4HG4J 3DV6A 3ELAT 5JW3L 5EBWA 2M1KA 5DA0B 1WIOA 1OWRM 1LEIB 3L7FB 1C12B 1KCKA 4PIRF 1EO5A 2UWEF 2AABH 4NWUH 1YNKL 2GJ6E 5DTFB 3S3PA 3QHFH 3FRUB 5HGDB 4GO6B 3GM0A 4QHUA 4X99B 2CGRL 1J11A 3RUGB 1GGCL 2FL5A 2YOCA 4RAVB 4ZYKA 3SKMB 3EYSH 4TSCL 4MSWA 2W0LA 1INDL 4FFZH 3X3GL 3LVEA 3T0DA 4LSRH 1TLKA 3BWAA 3VXUD 4MD5A 3K2UL 4J1UB 3IDYB 1L6XA 5LGKA 1AE6H 3F6LA 4G8EB 4HIXH 3UYRL 2XPGA 4XPAH 4NT6B 5F93C 1B9ZA 1U3ZA 2A6IA 5I74C 1KCLA 1MELA 1MRCH 4U1JA 1JV5B 2CLZA 5EU6A 4POYA 4ZOBA 4K71B 3OG6B 1X6LA 3LV3A 2MQ0A 4NQTA 4X4ZA 5GIRB 3GJFH 1FG2B 2Y5TA 5K33A 3ZYZA 3U9UB 5GZNC 4Y4HA 3GSUA 4P9ML 3REVB 4PJ7B 3ARXA 4GKZB 5J0BA 3MNVB 5ISZD 3PWUA 4Y2DD 4KPHL 4OUUB 1ZA6A 4GAGL 4JRYA 5J11B 1NCAL 4NQEA 5AZEL 4R96B 1OSPH 4F33B 5J3HD 3HE6C 3M07A 5DMGD 4D3CH 4I5BB 4NO2A 4XBGB 2KDGA 2CDEA 4W4OA 2JCCE 4HPYL 5I1CL 2Y36L 4I48A 4KTEH 2BERA 4K2UH 4HGMA 5FGCB 2B1AL 2Z8VC 3GJEA 4WW2C 3SGKA 1I9JL 4FMFA 2V9TA 4LLWA 1OP3H 4NCDA 1XGYL 1FBIH 2V17L 3IVKA 3QDME 4JDZB 3MLVL 4HKBA 3V0VB 5I1JH 3QA3B 2O26U 1T7ZA 2VH5L 3JWDH 4EN3A 1A7PH 1GAFH 3CC5A 5GRJL 1OARH 3WIFB 1IGJB 1OLLA 4YDKH 3CFBB 5I8KH 3P4NB 4FQIH 3HCVA 3OPZH 2Q8AH 4PJIB 2FGWH 1WCQA 3TBVA 5ISZA 2ZCHL 4JDTL 4NDMA 2P5EB 5DK0A 4HMDA 4LDLB 1UCTA 3CVHA 5BV7H 2ZJSH 3BO8B 1QPPA 3PV6B 3IJYB 5GJTL 3PP4H 3UTTB 3AROA 2LU4A 4UTBH 2OX5A 1BZ9B 4BELD 2VDNH 1FQ9C 3Q0HA 2XTLA 4K9EC 1YEHH 1BFOA 2VZTA 4ENEC 1UB6B 4XP1L 2NY2D 4LGRB 4IIQB 2HMID 2RBLA 3D0VB 2XFXA 1L4IA 1UT9A 2B1HL 3K46A 4WUUE 1DZBA 5F96L 4P2OA 1WUNT 2F54B 3A67L 5H8DA 4YXHH 3ULVH 2R8SL 1FCGA 2PF6A 3LRHA 1KCRL 3IDNA 4X4ME 3TIDB 3RKPA 3ALPA 2D7PA 5FDYA 4J3WA 3ZYIA 4JR9H 5C6TH 4IMLB 1SEQL 3B9VA 2ZG3A 4Y1AA 3WXVH 4CNIA 5JW4M 2V9QA 2I27N 3BP5B 2FHCA 1S9VA 1M4KA 3GJFB 3VWKD 3MV7D 3E8UL 4TSBL 4APQB 2CLRA 2CK0L 3H8NA 4AEFA 4UOW1 3O2VL 1X5XA 3WCYA 3P0YH 1FNSL 2WW8A 2JB5L 3WLBA 4LHUD 4QHLA 1J10A 3HR5B 3TCLA 5BS0D 4KROB 4FHBD 2ENSA 4HH9B 3KPRA 5J9PB 4G6FD 5I1HL 3BPOB 3OJMB 3FTGB 1NDMA 4MQ7B 4ZQKB 3RWHA 5DJYA 2RIKA 3ZSTA 4U3CA 1DE4B 2CUMA 2J6EH 5J1SC 4XWGH 3DGGB 1X44A 4MDIB 4LLUA 3VDAA 2FEEL 4MCZB 4TSCH 3TH4T 1KB9K 3X3GH 2WQRA 2VDRH 3PWVB 3HAEG 4UNUA 2F53D 1ZHBB 3BXNA 3UTSB 4QHKJ 3VWKA 2ID5A 5IEKA 1BP3B 2D7TL 1WBXA 4KJPC 5I71C 5E2VH 3UYRH 3HPLB 3QIUD 1IKNA 5DMKB 1F4YL 4U33A 1MI5B 3BSZL 3O3BB 4RBPH 3NIGF 3UBXG 1P4BL 3NFSL 5JHDE 5DD6B 3LRGA 1NCBL 1YECH 3BPCA 5GGVH 4LHUA 2XG5A 4UDTB 1A1MA 2P5WE 3D2UD 1A6TB 1HQ4B 2NY1B 2X4QA 5F3HA 5DC9B 3EYOB 3KYNB 1S5HB 4NC0B 4YE4H 3FT3B 4NUJB 4KV5F 3V52H 5CD5C 1OGTB 2B4CC 3SGJA 5FO7B 4GG6E 1BFVH 4KPHH 2IANA 4PYHA 1LO3L 2I9LA 4L4VB 5FCUL 1ZXQA 2NXYD 3H9HB 4ZUVA 3MCLH 2HRPL 5AZEH 1FAIL 5E1HB 4Z7UE 4GS7C 4HIEA 3C9NB 3IS1X 1KSRA 2A9MH 4NZUL 1J5OH 3EO0A 4LSQH 1ZKAA 5TGBA 5I1CH 3O2DL 1YEKL 1BLNB 2F53A 4F7MA 4EZMA 3WLWD 4N0YH 3L6FA 4YZFF 3P2TA 1T2XA 4OQTA 1WISA 4C4KT 1JYVA 2AJXL 4YHKL 4M9OA 5DYOB 3GKWL 4KKLC 2UYLB 3O11A 3V95A 3IFPA 5DT1H 4JO1H 4CW1B 5C6WH 7FABH 3HI1B 4CVZA 5FGSA 1KB5L 2B5IB 4HLZG 3VFTA 4ZPVB 3SDCA 1CD1B 2GAZA 3KPQA 4GW1A 4LSDA 1TJIL 5EU4B 2YXFA 4FQXB 4PREB 5BCAA 3HC0B 3U0PB 1JRHI 2Y06L 4P2QB 2Q76A 2Z91A 4FQCL 2ICWI 4M7LT 5DVNA 1FIGL 2B4CL 3PWNA 4O9HL 2X9YA 3NMEA 1ZHNB 4OT1L 3U7WL 5B3NA 1O7VA 1OTTD 3BE1L 4Y5YA 5SX4H 4Z95H 5SWZD 1RUMH 5EUOE 2BVUA 3ULUL 4X6CF 3QEQD 4P46D 2FH6A 4HS8L 4FXLA 3FO2A 4LRNH 1T1ZB 1OTSD 2X4NA 3EAKA 4BZYA 3NABL 4OCXH 1NCTA 3W82A 2ADFH 1RZKL 3FFCD 3KLHD 4I9WD 3DECA 5IR1B 1CTOA 3P30L 4JHBA 4FA8A 1KCRH 1YQVH 4UV7H 1XIWD 3CZFA 1EZVX 3EYQC 2Q20A 3WE6A 2OXGA 3T0XA 4OCSL 1VFBA 5I1GL 3CVIH 1P5VA 5LGJB 3HI5L 3P4LA 4GJTB 1QP1A 4CADA 4TSBH 4RA0C 1MHEB 1FH5L 1UM5H 4HF5L 4UT6H 4G3YH 3JWOL 1H3TA 1FNSH 2AV7B 4MXVF 4XPBH 3ULUF 4E5XA 1T1XB 5DSCA 3HE7B 3KHOA 3JTSA 4GQPH 2AGJL 1GGTA 1N5YL 4XNQB 2GI7A 4YJZL 4UBDD 5JPNB 4KGJA 2A1WL 4AH2A 4P46A 5EU7C 4KGLA 4MQSB 2BNUB 2PYEB 5IEHB 4I0PD 4K9EH 2V6HA 4K3JL 1J0IA 5F70A 3V5KB 2AK4E 1U95A 2D31A 1NDGB 3FFCA 3EOBB 4HFUH 5I75C 4FQQA 1FVEB 3BGMB 1UEMA 1A2YA 1T20B 1KCSL 3ROLB 2PR4L 1DBJH 3K74B 1HE7A 5H94A 2R2HB 4LFHG 2N56A 3QNZA 3UTZB 1CBVH 4TSAL 5F89A 1G7JB 1NQBA 5A3ID 1BQHB 3C6SB 4U6VL 4XP6H 3RGHA 3VXRD 3RWGB 2D7TH 4UINH 3VD5A 5I76B 2H6PB 4QEGA 1S9WB 5CSZB 2HTLC 1Q8MA 2D3VA 1KIUA 4WFFE 1SY6A 3RFZC 1XGPA 2R0WH 5IBUB 3U7YL 2EO1A 4PTUA 3CSYA 4G8GE 4YXLH 1QNZH 1FNGA 2FECI 5IMKA 5E9DD 4OKDA 4U6XA 3DUSA 3SKNA 4AYFA 2MMXA 3MRLA 5F6HI 1TETL 1CK0L 3QDJB 5DFVD 2Q1EA 5D2LE 4GAJH 1VACA 4M61B 1R3LA 1MHHB 2EIEA 2B7DT 2E3VA 5HGBA 3FB5A 3MRJA 1GSMA 3AS2A 4G9FD 4J8RB 3RZCB 2BNQB 3MUGB 4S1RH 4Z7VB 3CPLA 4PB0H 4HUXA 5E8PA 3HE6B 1TCRB 2HRPH 1FAIH 3ZL4L 1FZKA 1WWAX 3MRQB 2CMRH 3MV9E 4NZUH 4U2YA 3TO2A 5J1AB 3O2DH 5FYJE 3UO1L 1G7HB 2LVEA 4MA8H 1XZ0A 3GSVB 4BFEA 5IKCA 3L3OB 1E4JA 4HKXB 2DJUA 1S8DA 1KJVB 1QFWI 1CFSB 5C07A 1H8OA 3VG9C 2QSCH 1Z0NA 2BOBB 1D5IH 5K59F 4XP5L 5IMMB 1NGYA 3GKWH 5I8EB 1GYAA 1QYGL 3BHBA 1TJGL 3MRKB 4U6TA 3QO0A 1XF2A 1UH2A 3T0VA 3RWFB 1V3JA 1I7UA 3HZVB 5DEFA 2IWGA 1KB5H 5E9DA 1P7KB 2WIIB 3T77B 4EVNA 1RIVL 2NTSP 4JFED 3BPLC 4LIQH 2WV3A 4UV4H 4X7TB 3T0BA 3VRIB 3GSNB 1TJIH 2O5XH 3AM8A 4XP4L 4PJDB 3OR6A 3ZE0F 1R5VB 1J8HE 5KSVA 1YEIH 4HJGA 4I8DA 4TN9A 1KACB 2WUCL 2B4CH 5C70A 5MP6L 3MBEC 3N0PB 4RGNC 4NCC1 3ILPB 1T22A 2LVCA 2MKWA 1X5YA 4KRMB 4KTYA 3RDTC 3VFRA 4XBEH 1WAAA 1XH3B 3OXRA 1E0OB 3NZHH 3MRBB 5F21B 3VMPA 5D72H 2HRLA 4XPGL 1ND0B 3EO9H 2P4AB 1S9XB 1M05A 4KZDL 4N0FB 1JFQH 5IVXF 3ZDZE 4YHNB 5IQ7L 5E6IB 1GZQA 3BZDA 2AQ1A 3LEYH 1EEZB 4C56B 3QNXB 4Y16D 2AERT 1NC4A 3JV6A 3C2AH 2DB8A 2F19L 3T2PA 3DOSA 2BNRD 1JPGA 3HUJB 4NQDB 4OTXH 1CXLA 2P24A 4JFEA 1JTTA 4XVSH 4XRCA 2PTUA 2HVJB 2UWEA 3K81A 3HI5H 2EO9A 3RVXC 1ED3A 3IJSA 4MXQC 4FQPA 1ZT7A 2N7BA 3VGAC 4HUWA 4JE4B 4R3SA 1Q0YH 3QXTA 1FZMB 4M93C 1DVFC 5AD0A 4OZIE 1ZVYA 2I9TB 5J89A 1OY3B 5B21A 2Z31B 4X7EC 5AZ2H 4NUGL 4X80L 5HHNA 3MRCA 1VFAA 2ICCA 4YX2H 3L3HA 2J5LC 3VRJB 5GQBA 3ZTJG 3ZKMD 1AQKH 5GISH 2V2WB 2QBWA 2RB8A 4ZAKB 1FNAA 2EDHA 1XGUA 2BFVL 5H2BB 3L9RA 3LKNA 4K3JH 4UTAL 4HJ0D 1E4WH 1U8HB 4QYOB 2X89D 5C0RH 3AY4A 3MLUH 1TJHH 2VLJD 4FXGB 4Y16A 4TUKH 5F7UA 1FORH 4CGTA 1F58L 4I18B 3M1BB 5TFSL 4L9LA 2AJSH 1JTPA 1FJ1A 2Q6WB 3VJ6A 1U6AL 5FUOH 4U1HA 2QQQA 1CICA 5IWLC 5FF6B 1EMTH 2OCFD 3WBDA 4ZTPL 1JGEA 1BVKA 4ODSL 5HYEA 3PGFH 3QXAB 1YA5A 4N8VB 2LV4A 2QQNL 2BVPB 4E42A 4L4JA 4X6DF 3OKMB 3IU4L 3O6KH 5EO9B 5AWNL 3BRFA 3INUH 1MLCB 1N7MH 3U7YH 5HHPB 2NY5C 1X5AA 3ABZA 2W9LA 3PNWB 4KRPC 3RTQD 4BKLA 2IAMD 4H5SB 4JZNA 5CIPH 5HGAB 1RY7B 3ARVA 4C4KO 1TETH 1CK0H 4GG8A 5DGRA 1QKZH 4G5ZL 4JHWL 3FQUB 4UT9L 1F42A 2JTDA 4CU6A 3BZ4B 1LE9B 1UZ8A 1XF1A 5HVWA 4LSSH 2VLJA 4GS7B 1AHWB 1UM6L 2XT1B 3LH2L 1R5WB 2SEBA 4P57A 8FABB 3ZL4H 1KB9J 5HVGB 4L8DA 3FZUC 1QR1A 3VXMA 1KENL 1WZ1H 1YDPA 3AREA 3FKUS 5KS9F 4GAYA 4GMTL 4BFGA 5D7JA 5J6HB 5C0JA 5IFJA 4JG1L 1A4KA 4NO0B 1KN2L 4EBQL 1F13A 4JFFA 1I1RA 4HW6A 5CWSA 5EOQL 5BS0E 3QYCA 3B6SA 5JOFB 3RVVD 1N0LA 1S3KL 5H37G 1LE5A 3D39B 4NRZB 3BQUD 3MV8A 1ITBB 1NFKA 2VLME 2CQVA 5FYKH 4LHQB 4JM2D 2YEZA 3CMGA 4KK6C 1EGJL 5TDOA 2EH7H 1YJDL 3DXAE 4N0UB 3IDGB 3GBNL 4P4RA 4DCQA 5EZIH 1U8OB 4ZXBD 4FTVA 1ZEAH 3QQ4B 1RUQH 2IQAB 4YDIH 4F7PA 3SO3C 1KULA 4XC3L 4K8RC 3MACH 3TYFB 1IM9B 4IOIB 4LQ1A 5DEGB 5EG6C 3MUZ1 3QIBC 4FG6C 1VEOA 3S98A 2HLAA 2VXSL 5E0QA 1HHKB 2F8OA 3W0WE 4DVRL 4MXWH 2K7QA 1OTUC 25C8L 4Y4KD 4HZAA 2VDKL 2BDNH 3HI6L 1DCLA 5KN5B 4JN1L 4YDVA 4TRPH 3VH8B 1HCFX 1U8JA 3W9DA 1T4KA 3TBWA 2LAGB 1DBML 3N1QC 4V1DD 1OM3H 3BUYB 1MNUL 4B53A 3UPRB 1C16A 1RU9H 2VXTL 1U3YA 2NX5E 3O4LB 5HYJA 3KYMA 3O9WD 3LCYA 4UIMB 4PRAA 3V0WH 3EDEA 4IRSC 5I17A 2R1YA 3PP3K 2YMXL 4P99A 2FEDD 2ITDA 2MWCA 4NUGH 3GSXA 3LB6D 5F3BB 3QAZC 2HJLB 4R26H 5DUBA 3O8XD 5CINH 4X4XA 1LMKA 3HG1D 1EDQA 2BFVH 2P8MB 1NPUA 3D25B 2C4FT 4BUHA 5I75B 4AK1A 1S7UB 1RUAH 5E00B 1CF8L 5TE6H 4K8RL 3ZZ1A 4JFOA 5SV4A 4OKVB 5D4QA 5IB2B 1FFNA 2AEPH 4MNQE 1S5IH 1HQRA 4OZGF 2BC4A 3ILQC 2BXZA 1PG7W 3H9SA 4XXDB 1VERA 1WBYA 5C0FA 5T1LA 4K23H 5GS0D 3TJEL 3NACL 4U6YB 2X1PA 5AWNH 4Y5XA 5L8JB 1QHPA 2ILLA 3SDAA 4PJBF 3VXSD 4ETQA 4UT7L 5C8JB 3QUMH 1KGCD 2VDOL 3ZE2E 1OAUL 1PZ5A 3NTCL 2X4UB 4JO3L 2ED8A 3KPNA 4YPJA 4PY7A 4PRHA 3QEQE 2E8YA 2HP4A 5E94A 3UAJC 3VFUB 1KLGA 4G5ZH 3TF7C 4PRIB 4NC2B 1JZ4A 1YEJL 1AR2A 4OSUH 5T3XE 2OJEB 3DYPA 1D5BA 4BA8A 1G6VK 2DRUA 3C09B 3EFDH 4YO0B 2WAHA 3S36X 4K3EH 4RGMB 2GW5A 1OOAA 2J7LA 2BY3A 3ARFB 5T1MB 2J88H 2IG2H 2F5AL 3O4OC 1AXSB 3MMEB 4JFPA 5DZNA 1D9KC 4JG1H 1ORSB 2D03H 2QHRL 1OP5K 5ID1B 1YQ2A 4RWHA 2OP4H 5D7LE 3O2DA 3SJVE 3ARGD 5JQ6H 5A16B 2DQEL 2DLGA 2L0DA 1EAPA 3OAYH 1MCWM 3T2NH 1WGOA 1E28B 1S3KH 3HNVL 3C60C 1NEZA 4OLUL 1TIUA 4QRRB 4X6CA 5F8QC 5C0GB 2NY5H 1Z5LB 1D6EA 3V4UL 1QRND 2FX7L 3PJSA 4XMKH 2V7NA 4WV1B 5CBAA 5F7EL 1SM3L 3MBEB 1GRWA 1YPZF 3FQRB 5D6CA 3B8YA 4WI2A 1JPSL 2H2SC 5CEZD 5GS1B 5CD3B 3K7UA 3KLAB 1T89A 3QWOB 5DMIL 4PRDB 1Y6KR 2ADIA 3OKDB 5I1IL 1IKFL 1E4XL 1T5WA 4F7CA 3W11D 1QLFA 4L3ED 4XCYB 1JYWA 3BH9A 4ZNEE 2GJ6B 2APXA 1UJ3C 4RAUB 25C8H 1JJUA 5T3ZH 1CG9A 2VDKH 2ZSWA 1V05A 1V8HA 1CFVH 4JN1H 3MLWL 4QOKA 2CKBL 4FOMA 2O61B 4KK9D 4M1GH 5D1XC 1A9EB 5C1MB 1QRNA 4Y2OA 4X8XA 1RVFL 2CUHA 3VGAB 4NKDA 3QULB 4S10A 4UUJB 1HXYB 5E8NA 2NPLX 1D7FA 1DVFB 1MJUL 1SVCP 1RAMA 5IB3B 1P7QA 1KXQE 1C5BL 1NMBH 3SPVB 4O2FB 3KPLA 1J0KA 3H7BA 1G84A 1I3GH 5DZLA 3VD9A 3ESUF 3QNYB 1HCVA 4ORGA 5C08A 3FHAA 3MGTA 4HT1L 2DBLH 3NCEB 3VGFA 5B3JF 2FJGA 2LU3A 1DBKL 4H1LB 2R69H 1FYTD 4TPRL 1YEDA 1P5UA 3MUHL 1L0QA 4OFDA 1LNUA 1DEEB 1XF4A 1I1AC 4DK6A 4L3EA 3IKCA 5DR5L 2YXMA 1X5ZA 4K8RH 4M6NH 5IOPA 4MJ4A 2FATH 4Z77B 3QIWA 5DRNA 2DQFB 4XNZB 2R23A 2HFTA 3DX7B 1RURL 4ONFL 5AUMB 2DF3A 1CT8A 3VFPA 1GGIH 5B39B 4LCWE 4XWOC 5FV2A 3UBXI 4OLWL 2EC9U 2P43B 4JLRA 1BX2A 1EJ6A 2JCCB 3LKRB 1AD0B 4YWGL 3G5VA 3LKSA 2PXYD 4O02L 1T6VN 4U0RB 5HI4D 4XT1C 5LJYH 4HUVB 4K55A 2X4OB 3SDXF 2EEBA 4MZ2A 1QSEA 4D2NA 1PW3A 1A6VH 3CDFA 3BKJL 2VDOH 3ARBC 5DGQA 5EO0B 3MJ6A 3BDYL 5HDBE 1A6ZB 1CWVA 2OTPA 3FB6A 4PLKC 2V2XB 5IBLD 1FYTA 3ZDYE 1A3LL 4D94A 2EKSB 5B8CC 1OF2A 4MAUL 1P1ZB 1V7NL 2APVA 3G08A 3RI5K 4JZOB 1RZ8B 4LPTA 3ARSA 4PLOB 1MFCL 4E41B 1KELL 5I8OH 3MNWB 2HJFB 5LGHL 3O3AA 3P9LB 2PO6D 1N6VA 2N4IA 3U4EB 4PV8A 2DM3A 2BNRE 3RX8A 1PLGL 4PUBH 5BMFH 2WP3T 3OQ3B 4NWTH 1F97A 4C83A 2B39A 4XAKD 5DURD 1RSFA 4DQOH 2PXYA 5C0AA 3KS0H 3I75B 2DLHA 1RZIA 4LBEB 4WUUB 1EVTC 5FHBH 1MCEA 3GI8L 2VZSA 3RL1A 1SJXA 5JR1L 3U7AA 2VDML 1AQDB 3SE9L 5GXBB 1BGXH 2CXGA 3I9GH 1XAUA 2W65B 2HJKA 4X7SH 4MNGA 3E6HB 1N3NA 2FDBP 5I30L 1JZ8A 4N1CA 4H20H 1H0DA 1WIPA 4HS6A 5F6HJ 5IVXA 4XVJH 5F7EH 4Z7NF 3KAAA 5CEYB 4YPGA 3QFJE 1P69B 2XWBA 3WO4C 2JJTA 5TE7H 5EIVA 3W9EA 1L7IL 2XN9D 4H25A 3RGVC 2YRZA 4Y4FD 1QVOB 2A6JB 3SE8L 1HI6B 4G80B 3QRFM 1IKFH 5C0DA 1IEBB 1Y6NR 3EOTL 4XMLH 2Z4QB 1JK8A 3X14A 4GBXB 3DNKA 4Y7MA 2AQ3A 2R9HC 2H3NB 5FDWB 3LRSA 2E7CA 4DWHA 5D2NA 4NM8H 3MLWH 5DRWA 3KLSA 1LK3H 3MR9A 1A7NH 2GCYB 4ONGH 1FGNL 4AIXA 3E2HC 3BT2L 2HKHL 1DSFH 5HHOE 2C5DC 3TZVB 43CAB 1PG7H 4IRSB 1ORQB 1ZHKA 2FB4L 2KKQA 2X4PA 4PJXE 5JW5A 4YDLC 1JPFB 2XIDA 1K4CA 4UQ3B 1KG0A 1JCKA 1LK2B 1ZANL 2IADB 3MC0A 4WHCA 1RMFL 3FOMB 5JHDB 1Q9KB 2EXWD 3SE3A 5JIKA 5GGUB 3C08L 2R1XB 1O0VA 2XZCL 3ARUA 3MV11 2NLJB 2P5WB 1OD9A 4XMPH 1DBKH 1OSZA 3PE9A 3F7RA 4OAWA 4MA3A 4ZOAA 3BKML 4X0KB 1EPFA 1NCCL 4ERSH 1W8NA 1DBBL 1ERNA 4CL7A 4OBRA 1KNOB 5HYQB 4X6DA 1KBGL 2XRAL 4GG6B 5KG9A 4OV5A 4KHXH 3QDGD 1JI2A 4P9HC 3RY6C 4B7IA 4ONFH 1ZOXA 1CIUA 4Z7UB 2F58L 4YGAB 3DVGB 1LO0L 1BJ1J 1CZ8H 4KI5F 2YK1H 1A7RH 2MHAA 3EOYG 3HA0A 4YWGH 3STLB 3IETB 1U3HC 2E6PA 5DVKA 3G6DH 4FFVD 4HX1A 3OJ2C 4G6AC 2D7QA 4KKAC 5HD8D 4RX4D 4QRPE 2JB6A 2W38A 4CBPA 5L0QC 3ZHDA 1NKOA 2AJYH 2R2EA 5M94B 4G42B 1FN4A 1IC7L 5ALCH 1IT9H 4NNYB 3CCHB 1YUHB 4P2RA 1G6RH 4ZSOE 5JZ7C 5KS9A 1IGFH 4MAUH 4JO2L 5ICYB 4OGZA 3KPMB 1KELH 2H1PH 2VLRA 3PL6C 2FJFA 1N8ZB 5BVJA 2AVGA 1CDBA 4YHYB 5TPWH 1HWGB 2XNAB 1N59B 4ZFFB 5MEND 4OM0H 3KNBA 5DJZA 1PLGH 5FYLH 1R24B 4HMCA 4BSWA 3G5YB 4ELMB 3JUZA 4V1DE 4M8QB 4Z8FH 3SDDC 4GQ9H 5T5FL 1NMCB 3Q5OA 2DIJA 5EUOB 4LLDA 4CMMA 1MCPH 1TVHB 5C9JA 4ZPTB 1RZFL 2CK2A 4WWKC 3CD4A 2C3GA 5GZOC 1T04A 5FGRA 3DI3B 3A0OA 5BZDB 2DQJL 5JDSB 2IPKA 3L3DB 5EO1A 3RX7A 4NBZB 4YHPB 1DLHB 5FUZL 5FYJH 2NNAA 4ZD3L 2ESVA 4W70A 1NEZG 3MRDB 3O3UN 1KC5H 3KPSA 4Q0XH 3HG1E 4Z0XB 3QZWB 1YY8A 5JLZA 4MVBC 2EICA 3MLSL 4PJAF 4EJ1C 4QHMA 3F5WA 1VGEL 4YFLI 1CLZL 3U6RB 2QQKL 1XCTA 2GTZA 1INEH 1CFBA 4R90L 4XBPB 1PYWA 5I6XC 4NCC2 3NCBB 4ODXA 3EFFA 3IYLW 4G7VH 1AFVL 1EGJA 3VXNA 1ZLVK 1C7SA 3QPXL 5ADPH 2E9JA 2HWZL 4X5LA 3AUVA 1G7IA 2IFFH 1LO5A 1ZLSL 4XTRC 3TIEA 3TJHC 4EI6A 1UJ3B 3MCG1 4U4BA 1DQQA 4HUUB 3PIQB 5I1LA 4PGEB 5JUEL 4J6RL 4L4TD 1LP9E 2XY1A 5GRWA 3HMXL 4KQ4L 2UV3A 5D1XB 4MNHB 4BQ6A 3DPBA 2DM2A 2M26A 5I1EL 5ACMA 3WXWL 5ACZB 2FR4A 5D7IE 3BMVA 4S1DC 3O6FC 1JWUA 5KW9L 4XVTH 4EI5B 1I9RL 2VR9A 1R3HB 2HA1A 2IBGA 1QPXA 1ZANH 2ITCA 1S7RA 1IL1B 5LQBL 3MNZB 5DS8A 1ES0A 5IROC 1XGTB 1LO2H 4RZCB 4Q6IC 4OZGA 2CLVB 2XZCH 1N5AB 3HUJF 4ODHL 4G8GB 3UZEA 1IVLA 1I1AB 3L7FA 3VXQB 2EIBA 1AXTH 1CVSC 1NGXA 1CI5A 3W2DH 2UZIH 2BOCA 1AKJB 5DTFA 4OCNC 2F74B 1RUKH 5I15L 4QXTB 5H35A 4RGOL 5D2LB 4GKNB 1N26A 4LQFL 5KVEH 5L2KA 5CGYD 4PJBA 5AG9A 4X99A 5FB8A 5EU3B 5IVNA 1VGKB 3D3VD 1OCWH 3SKMA 1LD9B 1RZJC 2F58H 3EJYD 3MV9B 5E95B 4R4BB 4PP1D 1HH6B 5MEOB 3HNSL 3WIIH 1QFOA 4G8EA 4J3UA 5F7LB 1J0HA 1T66C 2FSEB 3ARBB 2XV6B 4TNWK 3MREB 4FQJL 2Q8BH 1F6FB 1JV5A 2EDDA 2WP3O 2QADB 5JW4R 1G0XA 4O58H 3C8HA 4Z6AT 3MA7B 5E2WH 3CSPA 5IMOB 1JWMB 5B8CB 4F37K 4TOYH 1OT2A 1D5MB 1CN4A 3ARRA 4JO2H 1ULVA 2EDYA 1ADQA 4P4KC 2P5ED 4YHML 3V9FA 1G9NL 1JF6A 1J8HB 3WUWA 3V2AR 2IPTH 5F9OH 3UTTD 2GSGB 1WFUA 5GSVB 2XA8L 4MMZC 3N06B 5CMAB 2ZUSA 2LU7A 1P9MC 1QSVA 4I5BA 4PJHF 4XBGA 5HPMA 2E8ZA 3GBLA 4P9HH 1CD0A 1BAFH 3NA9L 4JN2B 5DQ9B 4AL8L 5I1KL 1IAKA 2IBZX 1JN6B 1S7XB 3QI9C 2H45A 1N6QL 3RIAF 4BQ8A 1YPZA 2F54D 4D0BB 1FNEB 4GKSB 5D1ZC 3WFDH 3R8BB 3KG5A 4LARL 4JDZA 1IGTA 3QA3A 1QFWM 1GIGH 2EDRA 5D70H 1GC1C 5J1TC 1EBPA 2OTWB 3LQZB 1RUPH 2AXFB 3WIFA 1CGXA 1IGJA 1J1PL 3P4NA 4NZTL 2C1PB 1JRHH 1EJOL 5K9OB 1XR9B 2P5EA 1P4LB 1RJYB 4APQD 3DV4A 2D7MA 1PSKL 1VGEH 2BY0A 3BESR 4AEHH 4W6YB 1BVLA 1NAMH 3MRRB 3PV6A 4LEOB 4R90H 4F58L 3CFDB 3IJYA 1J05B 4XNMA 3UTTA 4POUB 4WI6A 1OQXA 2Z9TA 4OZIB 1BZ9A 1A5FL 1UWEL 4KROD 5TQ0L 5C2UB 5CUSH 4R2GB 1UB6A 4IIQA 1MPAL 3D0VA 3S9DB 3BP7A 4KI1A 3OKYA 2ZZUT 5ENWB 2Z8WC 3FRPA 4PJ9A 1NGPH 4DN4L 2RJMA 1BBJB 4KJWD 4TVPD 2EYRB 4GRWE 3TIDA 3FO1B 4BSVB 3WDHA 3E2HB 3QJFB 1NKRA 2C26A 4IMLA 2GK0B 5DI8A 5FYKU 3VFNB 3BP5A 5I1EH 3UTSD 3C6LC 4YAQB 3OGCA 4KY1H 1WK0A 1GC1L 5D93B 4APQA 3KYOA 4X5XA 3SBWC 4EDXB 1I9RH 5HI5D 3W39B 4WFHD 5E5MB 4M7LL 3CFCL 3BOVA 3IFNL 5BJTB 2CKBA 5LQBH 2CXKA 1U8IA 5JMOC 1TQBC 2HT3D 2NY1D 1UXWA 3MXWH 4OQ1A 2NY0C 4A2MA 5I1DB 4HH9A 4LCUA 3LOWA 2FD6L 4ZQKA 3FTGA 4MQ7A 5EU6E 3CJJA 4L4VD 3SDXA 4J4PD 1DE4A 2NZ9D 2Z35B 3DROB 1NJ9A 2DLEA 4JY5L 4MDIA 2WBJC 4X7CC 3ULVD 2R0ZH 5CSGA 2IALA 1IM3B 1SBSH 2YSSB 1ZHBA 1U8LB 1CE1L 1DDHB 5DVMA 1H3VA 5BW7A 3FMGL 2YBRB 4LP5A 4Y19A 3TPUA 1AGCB 4KJQD 4NQEE 3HPLA 2DKMA 2C7UA 3TT1L 1MI5A 5CGMA 1XF3B 3O3BA 3U4AA 4FQJH 3T08A 3VG0L 2VR4A 5MEQA 5DD6A 2EE2A 4NHUB 3B9KC 5CZXC 3MRFB 4YIQB 1A6TA 4M6ML 4N5EC 4E9LA 2OLDA 1HQ4A 3WHXB 4HXAH 1NAMB 3SE4A 3EYOA 3KYNA 3T0AA 2J4WH 3FT3A 5BS0B 4H88L 4NUJA 2APFA 4IOSD 3AB0C 1OGTA 2RFXA 4JKLA 5KAQG 4FQXD 4N9OB 5FO7A 1MCJA 1M6OA 3IGAA 4G6FB 4WNQA 4P2QD 5EBMB 4DKAA 2XZQH 4LL9A 2F5BH 3LD8C 2UZYB 4ZO9A 3Q1SH 4YDJB 5HPOA 3IFLH 5B38A 3RA7H 3DRTB 3DXAB 2IQ9L 4YEEA 5INDB 3C9NA 3SDDB 2ZUYA 2BX5A 3CMOH 4JJHA 1FRGH 1YMMD 4OM1L 2GSIB 3MOQA 3N85H 4JQVC 5IHUL 2NXZB 1QFWH 1BLNA 4PGZA 2E9BA 2I26N 2AAVA 1NMAL 3U0TA 5LBSL 4R7NB 5T33H 3G6AB 1RZJH 4JRXA 4I0KA 1SJHA 3QIUB 3HC4H 4BH8A 3W0WB 2UYLA 3QBTB 4YK4C 2HKFH 1A3RH 4R0LC 5DA4A 3DYMA 5SX5H 4CW1A 2DQIL 3UC0H 3HI1A 4HFWA 2XOTA 2NW2B 4ZPVA 1GXEA 1CD1A 3LMJH 4PJ5E 5D1QA 4HWBL 1B88A 3OZ9H 1A47A 5EU4A 2ZUVA 1KXVC 5GJSL 3BP6B 4PREA 2X70B 1WWBX 3U0PA 2BJMH 1PSKH 1QLEL 2NX5B 5CS7A 3DUUA 1QBBA 4XNXL 5ICXA 4AM0B 4YH6A 5I6XB 1ZT4B 2XKNA 3WSQH 2EH8H 4Y1AE 2PW1B 3LIZL 3HE7D 3DO7B 2QSQA 3TCXA 4W68A 1CXIA 3CLFL 3P3YA 3L5XL 5D6DC 1K2DB 2GTWB 1XGQB 3EYUH 4BZ1L 4KI5D 4LCCB 2OTUA 2A73B 2VZOA 2JJSA 5DWUL 3DVFA 1FGVL 3QG7L 1A02N 3S34L 4U6HB 3OKOB 3QT2A 3VCLB 1FO0B 3EOAB 3KPRE 1PJ9A 1T2QH 4MNQB 3KDMB 1KTDB 3ZDXF 4HZLB 1X7QB 1A8JH 1NUNB 5I2IA 3WIHL 5KSUB 1MJ7H 4XAWL 1NUFA 3E3QE 3KJ4B 1B0RB 5CLWA 4ZDHB 3U36B 1K8DB 1GC1H 4OZHF 2P48B 4JFQB 2PKDA 3C87A 4M7LH 1NBYB 3CFCH 3QJHA 3BISA 4Q6IB 2Y6SC 5KSAC 4IOFC 2YA0A 1T1XA 3HE7A 1IFHH 5GZND 1IAII 1I85A 5EWIH 4ZFZB 4XNQA 5JPNA 1HSAB 2XYCA 5FAAA 1X4YA 2QSVA 1AGEB 3BGFC 4FZ8L 2PYEA 3QDJD 2FD6H 5F97E 4KC3B 5I16B 2ZPKL 3QEQB 3C5ZC 3OAUL 2VISB 2J8UB 3QXVA 3V5KA 1NDGA 3OKKB 4W6WB 3VFOA 4M48H 3HE6D 4BYHA 3BGMA 4OF8A 4Z7QE 2UY6A 4JJ5B 1WZMA 1S7WB 4JFXB 3T2QA 2IANE 3UTZA 1K3ZA 1QBLH 1W0VA 3DX9A 2WWKT 3C6SA 4M1DL 1UQSB 2H6PA 4G6KL 1X4XA 2RCSH 3T0WA 4HV8B 1A4JB 1BJ8A 4J3SA 4QLRA 4TUJA 1PKQA 3MA9H 3IFOB 4KKCC 1YY9C 4EUPA 1ZGLP 3PHOB 4PG2A 3RWIB 1CU4H 5D7LB 3P4MB 5DD1L 3SJVB 3C5SB 3DRQA 2KQMA 3VRLF 4OB5L 3OTTA 1U42A 1JNNH 5EOTA 1MF2H 1AGBA 2DM7A 5EA0L 1MHHA 5ELIA 1NFDF 1W8OA 3P73B 4I0PB 3V6ZA 4J8RA 5KVFH 3RZCA 3MUGA 1FFPB 2BNQA 2O5ZL 3B2UC 3GJFK 4JAMA 3GB7B 4ODVL 2DTSA 4WDIB 4O4YH 4L4TE 4U1KB 5EORL 1UH3A 3WUWG 4LHJB 2G60L 4ENED 5J1AA 1MAKA 4OM1H 2X9WA 1HHGB 3QHTC 4M7JH 2DDQH 1G7HA 2MCG1 4MWFB 2BSSA 3FOLB 3QI9B 1NMAH 3BKYL 3PQYE 4HKXA 4RFOH 5FOJA 4OLZL 2Y1VA 3LS5H 4PJAA 3EW3B 2COQA 2HH0H 3GMPB 5E6ID 5IMMA 1DL7L 4XCEB 1UYWL 4C56D 2E9IA 2YPLE 3MRKA 4XX1G 3JXAA 4KK8C 5DD0L 5IQ9B 3CFKB 3RWFA 1GZPA 1KEML 1RI8A 1IC5H 1HHJB 2D0FA 4KHTL 4NQDD 1WF5A 4ODWB 2WIIA 4OLYL 5CJXA 3VRIA 4Q9BA 5M7QA 3L1OH 3GSNA 2AJUH 3DSNA 1UWXH 4RFEB 4Y8DC 4PJFE 3QUZB 2W92A 1R5VA 1V7MH 1QLEH 5ESAA 2RR3A 5L6YL 3GUTA 4G9FB 5ITFA 3RNKB 3D3VE 4GRLC 3NN8B 1JYXA 3ILPA 4XHJC 1CE6A 5D96B 1C8PA 5E8DL 2MNUA 5D8JL 1XH3A 3VW3L 4GAFB 3MRBA 1XMWA 5EU5A 3IXAB 5A43C 4MAYA 2VN4A 5HDOA 2W91A 3WFBH 4ZAKD 4N0FA 2Y4SA 3ZT5A 1MCNA 4YHNA 1N0XH 5E6IA 3QUYC 3S4SB 2R0LL 1EEZA 4Y5VA 2NW3B 3QNXA 4F7TB 1FGVH 3FRPG 4OCWL 3QG7H 5D7SH 3S34H 1JWSB 3CLEH 4QF1A 4AG4H 3QXDB 4P5TA 4BUGA 5EOCJ 1QR4A 3LS4L 4JB9L 5E7BA 1XGRA 3HUJA 3BD3A 4NQDA 2BY2A 3C6LB 3D85A 4KJPD 3K4AA 1C08A 2HVJA 4JFHE 5DFTA 3U0WH 3V6BR 4LCWB 3DMMB 1DQML 3QH3B 4OCYH 5DEZA 1A7OH 5F9JB 4HBQA 5E4IA 2P44B 3HMXA 1RZ7L 1CVRA 1FP5A 1D5ZB 1UB5A 2P47B 2OK0H 2Z31A 1IEAB 2VYRE 4ODUB 4N90D 4Z7WE 5K9KB 4EIZC 5CD5D 3V6OE 1NBQA 3GIZL 3EO1A 5IT2H 3VRJA 5DJ8B 1FPTL 1DUYA 5HYSA 4URTB 4L8SC 3LQMA 4ZAKA 4YGVB 1I7TA 1JGUH 5H2BA 3TA3C 1I8KB 3RBGA 3OMZA 2YA2A 2FHFA 5EFIB 1U8HA 2EYTA 4AQ1B 2YS4A 1L0XA 4LASH 2WBJB 2IMNA 5E8OB 4I18A 1FFQA 3M1BA 4YQXL 1UKQA 1FL5B 3THM