4XHJD

Ghgl of varicella-zoster virus in complex with human neutralizing antibodies.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
224
structure length
207
Chain Sequence
QVQLVQSGAEMKKPGASVKVSCKASGYTFIGYHLHWVRQAPGQGLEWMGWINPNSGETNYAQKFQDWVTMTRDTSINTAYMELRLRSDDTAVYYCARGGMTMVRGVMMDWGQGTLVTVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKRVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A site of varicella-zoster virus vulnerability identified by structural studies of neutralizing antibodies bound to the glycoprotein complex gHgL.
pubmed doi rcsb
source organism Human herpesvirus 3 strain oka vaccine
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein H
total genus 27
structure length 207
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xhjD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xhjD01
3UJTL 1FVEB 4TSCL 3FTGB 3EKCA 3VH8A 1EXUA 2VLLA 5J12B 5KSUB 2UUDH 3HC4L 5DJ6A 5J9PB 5F1SA 2DQTH 4RMRA 1HDMB 4FQ1H 4KKCC 3L6FA 2BRQA 3RWEA 4HBCL 1JGUL 1PLGL 1QYGL 1N8ZA 2RCSL 3DUHA 4UMGA 1XGUA 4LASH 2AK1H 3P73B 5AEAA 3ET9F 2GAZA 3TT1L 1LHZA 5E6IC 1FO0B 4KKBC 3V7AE 5I8OL 2WINB 3HKFA 4HHAA 3IYLW 3G5ZB 5GS2H 3MOBH 2I27N 2WQRA 3RGVB 3LZFH 4M9PA 4Q6YA 2GJJA 2ZUSA 1N4XL 43C9B 1S8DA 3U7AA 1QO3B 2NY1C 2AV1B 4JLRA 3TV3L 5EU4B 2EE2A 3SE9L 4OLWH 5C0GA 5C2UB 4JZOA 5IHLB 5FF6A 2YD2A 3LH2L 3CDGB 4I3GA 3MFGB 2ZCKL 1JPFB 1YMMB 4O4YH 3IAQA 4OM0H 4I0CC 3ULUD 1JNHB 3PUCA 1CIUA 3LSOB 1JYNA 4POZD 5LG1A 3C6LB 4IDJH 3KYKL 4YNYB 1WIUA 4F3FB 2R0ZL 5I8OH 1A64A 4DVBA 1IJ9A 4KZEL 4NUJA 3ARRA 1U8PA 3GIZH 4UV4H 2J5LC 2CLVA 4KJQC 3K74B 2H26A 3T2PA 1FE8H 3VXRA 3W39A 4TVSa 1G7JA 3MRPB 4FQCH 1T7ZA 1QFWM 4PJDB 2ICWB 2DD8H 1CGTA 2XWBB 5D7IA 3SDDC 1NFIA 5MENB 2G9HB 1ND0A 1FFNB 4TUJA 4P2QD 3MZTA 4DVRL 3EDKA 4G6FB 1T80A 3N9GL 4X4ME 4NZJA 1T2XA 5ETUB 3KPQA 1YEIH 4P0DA 3NABL 1XZ0A 3B43A 3C5ZD 1RUPH 3M17B 2JJVA 1NGWB 3D9AH 4K2UH 1H15B 3FKUS 2NNAA 4HS3A 1MPAL 1T7VA 3C8KB 2WUBL 1S9VB 5JW5B 1ZHNA 3GMQB 2DLTA 2VABB 3I2CH 5B39A 3QCVH 3FOMA 1G7MA 2XN9B 5EUKB 4I8DA 4KJPC 4Y19E 2Q86B 4YHKH 5C0CB 3V8CA 3E6FA 2E7LC 1WV7T 2FGWL 1J9CT 1BZ7B 2A77L 3JTSA 3QDMB 1JZ3A 2RGSA 3H3PH 1FFNA 3LPWA 4TUJB 4XAKE 3WE6B 1DQJA 1DVFD 1YN6A 3SKMA 4XNQA 5T5NF 4GBXD 1P2CA 4JQVA 1KXTB 4QRRD 1Q0XL 1P5UA 1ZEAH 1ZLUK 2CDEA 5I2IB 5I66B 2HJFB 2XTJB 2HAZA 3E1F1 3G6JA 1YEEL 3VRLF 4C56B 1JGDB 3W9DB 4KROB 1H5BC 5D93C 2L4OA 1Q38A 4P2OA 1S7XB 3U46A 1QQDA 4NFBA 2XQYK 3BSZH 4L4TB 2B20A 3MV01 4HUUB 3CUPB 1WWCA 4MA8H 4NM4L 3WXWH 7FABH 2VLJB 4MS8D 1LP9F 3AY4A 4MA1C 2Z31B 5E8PB 2UUDK 4KI5E 3W9EA 1ZA3B 1KGCE 4FRWA 2I26N 4GW1B 4JN1H 1QSEB 3CPLA 5E4EC 3FFDA 2NY5C 1TJIH 4XHJD 4XPGH 4HSQA 3PDOB 3PWLB 3T08A 1JPSL 1S3KH 4NHCH 4KQ4H 5JHDE 1HH9A 4XWOC 5DVMA 4XCCL 4YR6A 3BN9C 4L1DA 1YY9D 5EU5A 5FDWA 1YPZA 2CLRB 5C92A 5JXEC 5FKAA 3T77B 2PYEB 2WUCL 3MYJA 3O6MH 4ZFGL 3MXWH 5HGGS 2A77H 4JANA 4NPYA 5I66A 2AJYH 3BPNB 2ZUYA 1SBSL 3DOSA 3SGJC 5I75B 5FKPB 2P47B 2QQLH 1IAMA 2DMCA 2VTFA 2CKBH 3OB0K 2H9GB 4F57H 2EE9A 3HZKA 3ZT7A 4X98A 4WV1B 4KRPD 5I1HL 3X13A 3HNTH 2QHLA 5D5MA 4PJCA 5FYKL 3K8MA 5HDQL 3ARBC 3U7WH 4ZDHB 2Q8AL 3T2OA 1X5IA 4JZJB 1GC1H 4GSDL 1P9MA 5HVHC 4JY5H 2FZ3A 4GG6F 3A6BL 5BRZA 1OF2A 2PYFA 1T1WA 4OFDA 4P23A 3ARSA 2Z35B 3SKNA 4CW1A 3S35H 3CPLB 4R2GD 3EZJB 5D1XA 5TF0A 4UIKH 4X6EB 1TETH 3IXTB 1LD9B 1UWGH 1WT5A 2PR4L 4K8RC 4PJ9A 2IWGA 2G75A 3BH8A 5C08D 3HZVB 2ADJB 4X99A 1DVFC 1MNUL 5T1MA 2QLVB 4NZDA 1OAXL 4EVNB 3MPCA 5HDLA 5GGTA 3HG1A 3V6ZA 1K8DA 1UXSB 2Z31A 3LPFA 5TJWK 2IFFL 3CMGA 5D1ZD 1Y18A 4PRPD 4NC2B 5SWSB 4JFEB 2FGWH 2I60L 5AG8A 5A3IC 1T5WA 2G60L 4Z95H 4YHKL 4ZPTA 1OSZA 2BVPA 4F7EB 3WKMH 1V8HA 5JO5A 5I18L 1MCPL 4NNXB 1NGPH 4LU5L 5I6XC 1PKQB 5EFIB 4D9LL 4HIEA 4QRPA 3I3DA 3OKOB 2WUBH 1BFOB 2QADB 2EO9A 4CGTA 2ED7A 1FNGB 3RA7H 5EOCJ 2OLDA 4WFGE 3SJVE 2P48B 1LD9A 2YXMA 3J8F7 3ZT6A 1T0MB 4LP4A 2DI9A 2QADD 4D0CA 3OXRB 5FUZH 3VGDA 2DQGL 2XT1B 3BX7C 2V2WA 4Q74A 3UO1H 5C0JA 4NYLB 4G7YL 2YUVA 1S9WB 2FBJL 2HLAA 1LDPH 1BJ1J 4LSSL 4EI6A 3V6OE 2VB5A 3TZVC 3WIFA 1MHPL 1VKXB 2KQMA 4F15B 1BBJA 1QBBA 2ZCHL 1WAAA 1DEEA 3PL6A 5IJVB 1RJYB 3CCHB 3T2NH 3QCTL 4Q0XL 4JFPA 4M3KB 5TH2A 4JO3H 4MNGB 4X9IA 4RGNB 2NXZD 1C1EH 4TULL 3EO0A 4PGCA 1DBAH 3GBLA 1H8OA 3HE7D 3TF7C 1MFDH 4UINL 4X4ZA 3WLBB 1U8QB 3JWOC 4MNQD 1REIA 5I1IL 4RGOH 1C7SA 1FNGA 1P1ZB 1T21A 1Z9LA 5FM5O 2GY5A 4P3CH 3TPUA 1NMCB 2X4RA 3WNNA 4NRYB 3D3VD 3I84A 1NANH 5IB1A 3PIQA 2BXZA 3LQMA 2DM3A 4KKAD 1CFQA 1QP1A 4KY1L 4NQDA 1VGEH 5T5FH 2C7UB 5DJZB 3SGKA 4X6CB 5C0AA 4QRPB 4PPTA 3OXSB 1VDGA 2Z92B 3GSQB 1QFOA 2CJUH 5FA3A 3K3QA 3EIFA 2X4QA 2VN7A 4U6VH 2DQHH 3NGBC 3F7VB 4PRPE 5IMMB 1W8NA 4DJMA 2F54A 4L3EB 1TVDA 3PXHA 2XZAH 3NZHL 4M7JL 3JUYA 5EO1A 4C58B 5I17A 5FXCH 4OFYA 2NPLX 5DJCB 3V6FA 4O02H 4PJ7B 1KULA 4JAMB 1JNNH 3NCCB 2Q76B 2N1KA 2FCBA 4MHHG 4NQCD 1IGTA 3L3KB 3S96A 4L3ED 5CEZD 1KJ2A 4YPGA 1YNTB 4GBXA 1Y6KR 1D9KC 1JTTA 1KTLB 1W72A 5D7IE 2H8PA 2CUHA 3TFKD 4XBPB 2JJTA 1I9RL 1NLDL 5D6DA 5CIPB 1AE6L 4ODHL 4HUWB 1CICB 1JHTB 2FJFA 3E2HC 3RWIA 5F71A 2BY3A 1F13A 3RTQB 2VJXA 2B2XH 1VERA 4L3CB 2VDQL 1CICD 1FQ9C 4S1SL 2NY6D 3KDMB 3PG2A 3TWCL 2RFXA 1DCLA 3IDIA 1NAMB 1LO3L 4ZFOA 2JJWA 1UQSA 4WRLA 5FUCE 4LQFH 5IMKB 4JR9L 3VXPB 5L8KB 1RHHA 4XVSH 3RWHA 1L0QA 5ALCL 2J4WL 1LK3L 3WD5L 1KN4L 5EOTA 2FDBP 2WBJB 3KPOB 2BY2A 3TNMB 4QXGH 5EORL 5SWZA 2FEDD 4FQLL 4WNQA 3V5HA 3HRZA 1DN0A 1GGYA 1ZHBB 3MV7B 5IMMA 1VACA 4PBXA 1U8KA 3JV6A 1FJ1B 2K1MA 1YECL 3M1BB 1A1MB 2O26U 3S36H 2A6DA 5EZIL 5KJRH 1BECA 4I3RH 2NNAB 4UU9B 4LPYA 5HGDA 4RAVA 2IH1A 2YZ1A 5C9KA 4OZGB 3P77B 3BD5A 2PNDA 4KGJA 3NFSH 5C8JB 4IM8A 5C9JB 5IB3A 2BERA 4P57B 4DEPB 1II4E 4PREA 1T22B 1LO0H 4PRPA 3ULVF 1A4JB 4OZIE 3UTSB 4NKOA 3VFPA 4ZUTA 3ZZ1A 5CIPA 3H7LA 3PP3K 5FYJD 2X4PA 2J8UA 3VXUB 3LEXB 3QO0A 4P2QB 3T2QA 1B3JA 5CMAB 4XAKD 5J4MA 1OT2A 2ZUTA 2JJTC 1H5BA 4DZBA 3C9NA 2ILLA 3FOLB 4XPAH 3VW3L 4QLRA 1BZ7A 3JTSB 2LVCA 1YNKH 1U8OA 5ICXB 2F9BT 2PW1B 4JO2L 4R0LC 3GBML 1QEWB 4L8SB 3CMOH 5EFIA 1G7PA 3KXFE 3AY4C 1MCIA 4QXGL 3MLXH 5IQ9A 3O3EB 5TE6L 1E4XL 3CH1B 2VZSA 2H3NB 2UZIH 2OR9H 3KLDA 5I2IA 3U4BH 2IAMB 4BFEA 4RGMB 2ZOKB 5I71C 2A6IA 1RZ7L 2X09A 4OZGA 3K8KA 4C56A 1CICC 3PP4L 5EUOA 4RDQG 5E2UH 1RIHH 1EJOL 3SDCC 2QTEA 3N85L 3SO5A 1OGTA 4NHUA 3L5XH 4XC3L 43C9A 3RFZC 3O3BB 3KXFB 3BE1H 3O41A 4NN6C 1DFBH 4IOIA 1NGZA 1KV3A 1ZLWK 3BKCL 4KI5F 3MRRA 3HLAB 3JWOH 1WC7B 3LEXA 4CUCA 2APWA 5EOCL 5BS0A 1JMXA 4MCZA 4G6JL 1JRHL 4WUKL 5E56A 5EU5B 5GRJL 3ZKXB 2YHGA 2GAZB 3OKLA 5EO0A 1FFOB 1I7UB 4JO3L 4KRNA 2WINA 4HHAB 4WW2B 2DYPB 4NOBA 2BNUB 3HS0A 2PN5A 3QCTH 5IB3B 1RZJL 3HPLB 2QR0B 3HMXH 3AREA 1PZ5A 4G8IA 4WV1A 3WFCH 4K9EH 5KAQF 3RQ3A 4NC1C 5TDNA 4JPVH 2JK5A 2X4OA 1INDL 1UWXK 1Q9WB 1JPFA 1FC1A 3QWOA 3I6GB 1JF5A 1OGAB 3VFRB 2AP2A 1JN6B 2FJGA 2AEQL 2MFNA 2OTPA 2ICCA 4IOIB 4P2RE 4BUGA 3H9SE 3P0VH 4P4RA 5JA9A 1WC7A 4G6AD 3RVXD 4Y5VC 3S36X 4ZUUB 3X3GH 2MPAL 3REWB 1ZOXA 2Z93A 4OCRL 1JZ4A 3GHBH 3MV9A 4NWTL 1NEUA 2OX5A 1OP5K 2PYED 5FGCE 1Q9KB 2YD5A 1I8MB 1YC7A 3H6JA 3WS3A 1PYWA 2XZCH 3GHEL 4MCYB 5JQHC 5EWIL 1PDKA 3OKNB 4HPOH 4YFEA 1KENL 4G8FA 2AEIT 3RI5F 4J3XA 5DGQA 5I8KL 4UDTA 5ACLA 1NC2D 4PRBA 1QHPA 2VABA 4MAYD 4NO0A 2AJXL 3A67L 3DYPA 3EYVA 1DL7H 1J11A 3PWPB 1W72B 2Y25A 4J23A 4UB0H 5AZEH 3MLZL 3R4DA 1HQ4B 4LVNC 4X6DB 2VISB 3L5JA 3MV7D 5TQ0L 2CGRH 3QDMA 3MV9D 1KB5A 1NCAL 5CIPH 4R96A 1W0VA 5J13B 3OQ3B 1DQLH 1AY1H 1CGSH 4NFDA 2P45B 3CFEA 3LV3A 1GGIH 1YDPA 4OCYH 1CU4L 3RL1B 4EN3C 3R0MA 2FBJH 3C60B 3DMMC 3SDCB 1IC4L 3KDMA 4X6DE 4ZTOH 1X44A 4BZ1H 5CS7A 5B39G 3RNQA 4HK3N 3Q5TA 2GITB 3BWAA 1A9BA 3U2SA 4HIIA 1DVFB 2G5BA 3BOVA 1IM3B 1EO5A 3MLZH 3JV5A 1EJ6A 4WWKC 2AK4A 1JGLL 4JPWL 3ULVL 2Y36L 2W60B 1D7FA 2ZSWA 3H2WA 3PNWA 4Y2DA 3ZTNL 4YX2L 2YMXL 5EWIH 3RRQA 4QRQB 2NR6D 3QUYA 3TO2A 3VRIA 1MI5B 4GW4B 3MUJA 3PDOA 1G7IB 1MAJA 3WHE1 5LVEA 4QF1A 2X4SB 5JUEH 1T66C 3GKWL 3LS4L 5LGHH 1PSKH 4IRSB 5D2LB 2LQRA 3QJHA 4IRJB 1AO7A 4FQJL 2W0FB 4LSRH 4MJIA 5DURD 2DDQH 1RSFA 4ZTPL 1VFMA 4HJ0C 4FQIH 4M5ZL 4GRMA 1IAIH 1CDCA 1H3WM 2V9RA 1UJ3B 1JHKL 4H26A 1FNFA 3BT2L 3DARA 4Y19A 4DQOL 3GM8A 5SX5H 1JK8B 5F7EH 5AYUL 4JFFE 3DLQR 4NQDB 5F70A 3QH3B 1SVCP 4TQEH 1G7HB 3G08B 2ERJB 1YDPB 4POUB 4GBXC 1ZGLA 2I07B 1C16B 3IKKA 3VI4E 2PW1A 2YUXA 4ODSH 2E7LA 4ONFH 4DOHB 4I2XA 4PLJD 5JHLL 3QDME 2BVUA 3KJ4C 1FHGA 3L5WB 3ZDYE 4APQC 1U3JA 4WHCA 1KIRB 3FQRB 3NVQA 3U4EA 1MRDL 4FQQB 1NFKA 3T4YA 3VWJD 1EPFA 5EUOB 3GMNA 5K9JH 3X14A 4OUOA 4PR5A 1EBPA 4WW1B 1DFBL 4M5ZH 3KPSE 4NP4H 2J7LA 3WYRA 3E0GA 3V4VL 1MJJA 1XMWA 4OI8A 5BVJA 1KT2B 3MRRB 1ZV5A 4JKLA 1K2DA 2QKIB 4KMQA 4N0YH 1MVUB 4LMQI 4XXDB 2OR9L 2ITDA 2X4TB 3D18B 4MA8L 2JELL 1NCCL 4YFLF 3ARED 5I15L 3H3PL 5C0EB 3KPMA 3ARDB 4DVRH 3HE6C 2D7QA 1X4ZA 4WU7B 4X5LA 1OTTD 1Q9WA 3AVEA 1BOGB 1U2HA 2BSSA 3QEQA 4M6MH 4AQ1B 4Y16D 3C8DA 1JK8A 3F5WB 3VFGL 3WUWA 1X5HA 4DZ8B 3GRWH 4AEEA 4IIQB 1AGFA 2CKNA 3ZTJG 4ZTOL 1D5XB 4QTHB 1BD2A 4R8WH 3IDXH 4A6YB 4NBYB 3QIUA 3GB7B 4K9EC 5HY9A 5CCKL 3O81A 5ANMA 2A73B 2E5EA 2IMMA 3MRQA 1FYTD 3H3BC 3BH9B 1RUKL 1QLRB 4M6NL 1FJ1A 1F45A 3T3MF 4ETQA 4XPFL 1HNFA 3WN5A 3GSRA 4AT6B 2Z93B 5GS0D 5E00B 4JFED 2J8UE 5TQ0H 2A0LC 3TZVB 1SVZA 3T0EA 2FX9L 3P9LB 5J12C 3AS2A 1YY8A 2DDQL 4QEGA 1JIBA 1KJ3H 4D3CH 4PRAB 4BFIA 1FNAA 3QPXL 1LO4L 5I8KH 2W0PA 4HGWA 1UZ8A 3QXAA 2VISA 1N2RB 1X7QB 3CFCL 1CXKA 4QGYA 2EXWD 1OAKH 4R97B 2VXVL 4G3YL 4OUUB 2BSTB 2MSPA 3D85D 3HMWL 3BESR 5CINH 3CU7A 2J5LB 3X3FH 1IEBA 4P48A 4P2YA 5MHSD 1U2CA 4Q97A 3GSQA 3HUJA 1QTYT 4LVOC 3H0TB 1WIPA 3HZMA 2JB6B 4AEHH 2MHAA 4YFDB 4BSWA 4GRLD 4OD2B 3ROOB 4JFDA 2I9LB 3BQUB 2WBKA 4AL8H 3ULUC 3IFNH 3RBGA 4K71B 2BZDA 4Y0GA 1VA9A 4PTTB 3ZDYF 5CJXC 4AENA 5L9DH 4MQXC 1NGZB 3TZVD 3G5VB 5AUMB 4RAUA 4NOFA 4NQVB 3VXRE 3RHWF 3OTTA 1JTOA 3NN8A 1P7KB 5KSVA 1EVTC 4KZDL 1NCAH 4KFZC 2P42B 3RL2B 3H9SA 3NA4A 4R6UA 2YWYA 1KFAL 5MI0C 5I8CA 2AK1L 1A6VH 3TA3A 3GSRB 1KLFA 4UIMB 2WBWB 3TV3H 1JRHH 4WUKH 4M62H 1XEDA 1KLUB 3UTTA 1QBAA 2BNUA 3HS0B 1K8DB 1UXSA 3WFHB 4GG6B 5D1QA 3D2UA 3GMRB 4U6HA 1UJ3A 1KC5H 4BFIB 2XN9E 3QO1B 4ZMAT 4IRJA 4RISH 1MWAA 3UYOD 4M7KL 1RD6A 35C8H 4JFOB 5C0CE 3H9YA 2APFA 2IG2L 3R0NA 4K8RH 1OM3H 4XZUB 2Y4SA 4I9WE 3RVXC 2R1YA 1XF4B 1GGBH 3HAEG 3QXTA 1NMAH 2OL3A 1FL6B 3ARBB 4KKNA 5TDOB 4Y4KB 4KQ3L 2XY2A 4UV7L 1NBQA 1ZE3C 2EDLA 2NY7H 4UT9L 3DSFH 3ARVA 4GG6E 5AWNH 2V5SA 4X7TA 3D39A 2XIDA 1ZANH 4PJEB 3IFNL 2XTJE 4OD2A 5FYJU 4OIAA 1S7QA 1AI1H 4UIMA 1C16A 4UV7H 3VWJB 4YXLL 3TBYB 3C09C 1MRFH 4XPAL 3MCKA 2BVOB 3NMEA 3S5LG 1JPTL 5GJSL 1FO0A 2CDFB 3Q1SH 1XCTB 5T3ZL 5I0DA 3DO7A 4UDTB 3T4YB 3HMXL 1G1CA 1S7TB 5FHAL 1B4JH 5D1QC 1MLBA 2Y5TA 4K3JL 2ZCHH 4WNQB 3V5HB 1RZFL 3MC0A 4E42A 3UBXG 5IQ7H 2R2HB 1YMMA 4CVXA 3VCLA 3VD9A 2GUOB 3G6AA 3BP6B 4YHYB 5F44A 1MFEL 1IQDB 4PJ5B 2OMBA 3GSOB 4X6DA 1KEGH 3BKCH 4JZNA 1CR9L 3VXOA 5HHOA 3DXAB 5B3JF 1MJJB 3HUJE 3DYMA 5CJQL 5GS1C 4PJFA 1BQHG 2IH3B 1T3FA 3TJEL 4QHMB 4JFXA 1VPOH 3AB0B 1T22A 5T1LB 4M7LH 4E41D 1HN1A 1G6RA 3CH1A 3C60A 5KSBA 4U1HB 1I3GH 2KQNA 2C3XA 3BXNA 2IPUK 3NCBB 3DX8A 3QPQD 5IUSA 1JWUB 2J4WH 4PS4H 2CQVA 4PGDA 4AZ8A 3U2SB 4TSAH 1SMAA 5DO2D 3T0WA 1JGEA 2A38A 3GJFK 1AQKL 1OL0A 2DOCA 4HAGA 3W11D 1KF9B 4ZAKA 1TCRA 2Z35A 2YOCA 1ADQH 4J3SA 2Y7QA 1H3PH 4FQXC 1U8IB 4X6EA 1CGWA 2P5WB 3WBDA 4PJCE 2AERT 2PYFB 5FGSA 4JHAL 1ORSA 5HVWA 2B2XL 3MFFA 2F15A 1S9VA 2YEZB 3D25B 3O2WH 1JNLH 4UT6H 4JM2C 1KPRB 1JYXA 2CO6B 1CI5A 4AK1A 4X5XA 4LHUD 3WEXA 3T1FA 3NOIA 4R2GC 4P2OC 4QXUH 3FONB 3RIFF 4S0TD 5KZCB 1X7QA 1FNEA 1PZ5B 4PRNB 4ZSOB 2J2ZA 4AIZB 5JO5B 4LF3A 5LXGL 1QOKA 2OJZL 2VXSH 1NKOA 4NZTL 3QI9D 1YNLL 5C0BE 1QRNE 4JRYE 1XF3B 1ODAA 5DJYB 1BWMA 1FFOA 5D1ZC 1F3DH 4MB3A 4LRIC 1G9ML 1EERB 3QP3A 3RNKB 1IC7L 2MJWA 5E94A 5DD1L 4U7MA 4K94L 2WUCH 3O6ML 4ZFGH 3OR6A 3ZT5A 4ZD3H 4XCEA 4CRPA 1EO7A 1A14L 2E6JA 4YWGL 2L7JA 2NY1B 3ULUE 3KLHC 4D94A 4Z77B 1FSKC 3VWKD 2XA3A 2BVYA 3K2MC 3CD4A 1FAIL 5TQ2H 4U6TA 1B0RA 3SJVA 5JZ7D 3NCEB 5EZJA 4EI6B 4DQOH 3J7HA 2UYLB 3PWLA 5IB4B 4LFHG 1OD9A 1CK0H 1DZBA 1RMFL 3QPQC 1G0DA 2C3VB 3MFFB 1UADC 2X4TA 2WANA 1D6VH 4P23C 2RIKA 1VEPA 1YYLH 3GSVB 4L4VE 3STLA 4PJAF 5I1KL 1AR2A 3SKOA 5HSFA 1X5LA 3P0YH 4RWYL 2X4NA 1IAII 4DKDC 1FDLL 3OX8A 2DRUA 4AEIL 3QUXA 2FB4H 2ZOLA 4WY7H 1IMHC 5IK3B 5F7MC 5C0EA 4LHJB 4XGZB 4KKLC 1EEYB 4ELMB 2P24A 5C0AB 3G5XA 1J1PH 3S3SA 5DJXB 5HYSA 1KYOK 3BT2H 1NBYB 4X7TB 5GQBA 5IM7A 5GS0C 2W59A 1ZHLA 3RAJH 1KPUB 4P2RA 2FHCA 4PJ5D 3QCVL 4BH7B 2Q20A 1LILA 1S9XA 1MPAH 3HZVA 3R06B 1BM3H 4YHYC 2E9IA 2CXKA 1BEYH 5AYUH 5JW4R 1Z3GL 5DQJB 2EH7H 3B5TA 5MEND 1U8JB 4NM8L 1YEIL 4QHKI 3VGAB 3VXNB 5D7IB 2XG5A 3WV0A 1NGQL 4DGYL 1N7ML 2Y36H 5JPNB 3QUXC 4OLVH 3BQUC 4XVTH 2VLKA 3B6SA 5E5MA 4EN3A 3T8XB 5DD5H 1MI5D 1H8NA 1EEYA 2XQBL 2VC2H 4ELMA 1PKQA 5HPOA 3LQZA 3CVIH 4YAQB 3CFBB 1NCTA 3VWKC 3MA9L 1ZTXL 2F58L 5FYKU 4OCSL 4R90L 2HT3C 4D8PA 2YN3A 4JY6B 4TRPL 3AC0A 5EZLB 1IEBB 4Y1AE 1Z3GH 3ARFB 3BKJH 1IGYB 1Q9LA 4U05A 3OX8B 1CU4H 5D7IF 5FCUH 4XPBH 3MRNB 3UAJD 4AENB 3V5KB 5HDOA 3V0VA 4QYOB 3MACH 4RBPH 4HFWA 4U2YA 1F6AB 3RVUD 4HFUL 4JGUA 3MMEA 4RRPG 5C0CA 1YN7B 2W0KA 2EDHA 5A1AA 1YPZF 5C3LD 3I6GA 1TPXC 2YXFA 4DCQA 3VFMB 3BZFA 3L95A 2CDGB 4L1HA 2AJYL 4LAQH 5J1AB 1IRAY 3MBEB 4OCMC 3IFLL 5DMKA 3VE0B 5E99L 1RAMA 2CRMA 3HPJB 4TRPH 4PY7B 5BO1L 3G6DH 1EVUA 4HDIB 4N0UE 4RAVB 4BQCA 3A0OA 1CYGA 4A6YL 5IV2B 1ZTXH 4R26L 1XGPB 3WS3B 2P4AB 4P4KB 4ZO8A 4MA7H 5IVXA 1ORSB 2VQUA 1MVFA 2HTKD 3AS0A 4PRHD 4LPWA 4OZIB 2ATPB 3PV6B 4HKJA 5IB1B 3LEYL 4NFCA 1DANU 1CVRA 5DK0B 3DX9B 1OAXH 1TENA 4WO4A 3KPMB 3VXUA 4FXGA 4BZ2H 1C8PA 2A1WL 1HSBA 1AHWC 1FORL 4XP6L 4NWUL 3SBWA 3NPSC 4NKIL 5M95B 1HXYA 1UWXH 4ZSOA 5FA3B 5CD5D 5D2LE 1AR1D 1MVUA 4Q9RL 2KUTA 3MX0A 5CLTA 5DZNA 5CEZL 1Q9LB 1RZ7H 1WT5C 3WKNA 3O3EA 1NC2A 3L9RB 4Z18A 4DN4L 1PBYA 1M1SA 3OAYK 5ILTL 4HDIA 2ADFH 5E9DD 3IDMA 5IB2A 2F54B 5F7NC 3QUZD 3DO7B 4QRSA 1AXSB 5DJ0A 5GS1B 1HHKB 1QD0A 5I1JL 3JBG7 4MB4A 1KTLA 3E3QE 1SYSA 2FL5A 5GGRA 1DLFL 1IGFL 2AJSH 3U0TB 1C5BH 2ATPA 4HKJB 1C12A 3S96B 1ZA6B 1NBZB 5JNYB 3DROA 1FH5L 1V7NH 3U1SL 2OTWA 4PJXF 2UWEE 5FOJA 1DLHB 2EEBA 4PJ5A 4GW5B 1I9JL 5INCA 2EH8L 3ARXA 1PX4A 3GSNA 2OL3L 1GZQA 3EDJA 2OM5A 4ETQB 5SWZE 4POZC 3BEVA 4G5ZH 2VDRL 3MLSL 4DUVA 5HTSA 4JFXB 1CK0L 4N0RA 1XF5B 3NFSL 3N06B 3DUSB 1CN4A 1BD2E 4OF0A 4XB7A 4KKCD 4PJFB 3KPSB 1INQA 4ZXBA 3F65A 2DQFA 1R3KA 4QXTA 3D1MC 5C09D 3QNYA 4N0UA 3QA3A 3D3VB 1UZ8B 3P9MB 5MEQA 2R29H 4Z5RB 1RUQH 5E5UB 3D2UD 4C56D 2ZOLB 4X7CC 5KSUA 2JIXB 4YHPB 1FCGA 2HTKC 4PP1D 1E4XH 2SEBB 5I9QB 3MRFB 1BFOA 3BW9B 4YDLB 1NAKH 4N1HB 4PJAA 2XXMB 1I9JH 1IC7H 2GHWB 3MA7A 2HLFC 2IH1B 4Y8DC 3S35X 1HILB 1I9IH 4PJBF 3ZO0A 4PJ8B 3V4PL 2AAVA 2BMKB 1J8HD 2AXGB 1RV6X 3SDXB 3VFOA 4NC0B 2VR5A 1T1XA 2P46B 4GRWE 5C2BL 4PTTA 3TT3L 5EZIH 3RVTD 5E8NB 3NFNA 4E5XA 1KPRA 2X1QA 2XICA 2A74A 4PRIB 3T1FB 3TH2T 5CEYB 3N1PC 1CE1H 4P46B 4PJ9C 4MWFA 5CJ8A 4ODHH 1RUPL 2GCYB 4W6XB 3TCXA 1U3HA 4GKSB 1RZFH 1PJ9A 5CD5C 4N9GA 1FL6A 3ARBA 4GXVH 1OW0C 1T7WA 2DQCL 3DTXA 1UKSA 3DGGA 1GPOH 3G04B 4FQPA 4NKIH 4R96B 1MHEA 5E2TH 5BW7C 4QXTB 3DSNA 4J4PC 2O5YL 4D8PB 4BZ2L 4G43B 4Z0XB 1QR1A 2VWEE 3VGGA 4TSAL 4PGZA 4ZXBC 5E8EA 2QQNL 2VC2L 5IQ9B 2VQTA 5IW6A 1QSVA 4LVNB 4JJ5A 3KPLB 3OZ9H 1DVFA 2G5BB 4YHML 5TGBB 1YYMH 4P99A 1ZLWH 3HI6L 3GIVB 2A74B 4JO4H 4MXVE 4KMTH 4V1DA 4Y89A 5GRUL 4MZ2A 1XCQA 4PB0H 5EBWB 1H0DB 5AZ2H 4PJEA 4UQ3A 1EA9C 5DHXB 4Z7NF 4LLMB 4X4XB 4P3CL 4N9OB 1KBGL 3PGDA 2Q8BH 1JNNL 5C0DA 1NFDF 3QJHB 4O5LL 1EEZB 2BDNL 1X6LA 3TCLB 5IP4A 4QF1B 2VAAB 4DKAA 5HGBB 1C1EL 3PJSB 4OB5H 5E08L 5AD0A 5DHVA 5IVNA 2WQ8A 1MLBB 3MRLB 3HMXA 2E27H 1WBYA 3MQIA 5CP3A 3IDNB 1S7VA 2AGJL 4E41E 4Y19B 5T1KA 5FO7B 3PWJB 5JQ6H 1K5NB 1EMTH 4WUUB 4WI5A 1EV2E 4YQXH 5GJSH 1AO7E 3RWIB 5FYJH 1NDGB 4JFYB 1YN6B 2JF1A 4PG9B 4R4BB 4OFPA 5E2WH 5ACZA 1T0PB 3FMGH 3CVIL 3D85A 4OKVA 1I7RA 3ZDXE 5EIIB 4MJ2A 4DOHE 1GGTA 1RUMH 3EJYC 2YD1A 1S9XB 4K8RD 4Y5VA 3MLRH 4JVPA 5GRYA 4JFQA 3MBXL 5JPMA 3KYOA 4OGYL 3RGHA 4ONGL 5FCSH 1R24A 5F7KC 1F5WA 1E27B 1ZMYA 4LEOA 5HVHB 4PJIF 3KPNB 1S7VB 5GGRB 3PHQB 4U6XA 4G8FB 4I77H 1CCZA 3MLPA 3W2DL 1K5NA 3GI9L 1U8LB 5HI4C 1A14H 3IU4H 4XWGL 3FO1A 5JTWA 3T8XA 2ZNWA 4HXBL 2EDFA 4E9LA 1P5VA 3VA2C 1CF8H 3IDGA 1HYRC 1D5IH 3BPNC 1A7BA 5H37H 5MERA 2X5PA 3DYOA 4X6CF 3QXUA 1NAMH 4ZYKB 4ZPVA 4WENB 4OV5A 4LCCA 2PUQT 5J6GA 4MSWB 1U6AH 1HH9B 4KDTC 5BRZE 3LV3B 4XXDA 3MRPA 1AGBB 4FZ8H 1OTUC 2Z31D 1JYVA 1J5OL 3SY0B 2APVA 1Q1JL 1NC4A 3OR6B 4J8RA 4ZUTB 5C71A 2ICWA 3SQOL 1NUNB 1UVQB 1WZMA 5LXGH 5D7KD 5LWYL 3QI9B 5E8OB 3P4MB 1GZPA 2BOCA 1T2QL 3IDXL 5INDA 3SPVA 1IGML 3TO4C 4CAGA 4N5EC 2BFVH 3QXDB 2HMIC 1TZGL 2EKJA 1QACA 1WFNA 2V6HA 4WW2C 3LKSA 3C5ZA 2FSEA 3WXVL 3M17A 3DUUA 4XXCC 4PV9B 3GM0A 1U3ZA 5CZVL 2YSSB 4UUJA 1H15A 1ULVA 2G75B 1KNOA 3LS5H 5D8JL 3RZWA 5GSVA 3BP5B 3BIAX 2Q76A 3Q5YA 2OQJA 4LQ1A 1OCWL 5SWSD 5C7XL 1IBGL 1TVBB 1HILA 5DMIL 1XIWD 1GHFH 2CLZA 2YRPA 2ADGA 4XCCH 1IZKA 2I24N 5D2LA 2FRGP 3SHSA 3SE4A 4U1NA 5GGTH 1A7NH 2FH8A 2VLME 5HHOD 1EUUA 3O3BA 4HGKC 4NN5B 1A1OB 3V0WH 3QAZC 1BVKA 4JG0L 5IVXE 2IAMC 5LWYH 5A40E 4C55A 1G9MH 4HZLB 1YMMD 1NLBL 1RJLA 4CL7A 2JCCE 1LEKB 3IETA 2W38A 3FCTA 3C5ZB 3E2HB 3QDJE 1WAAE 4F37F 3EJYD 1FIEA 4UAOB 3QYCA 5CUSL 5HHNB 4Z7VF 1T0MA 1BFVH 5LGJB 5GS2D 1PZUB 3EZ8A 4NYLA 4KV5E 4JRYB 3WIHA 4HCRL 3IVKA 2YD6A 2WBJA 2X4OB 3JVGA 1QUNA 3W5MA 2NY6C 4WHTA 4IS6B 3FTGA 5TF1H 3VH8B 2W92A 4F8QA 1DLHA 1XGTB 2MTPA 1OTUD 4URTB 4FXKA 2XA8H 3NZ8A 3ARDD 3GIVA 3WNPA 2JELH 5IOPA 1CD1B 5F7YC 5BV7C 2DWEB 2DM4A 1MREH 5CSZB 4W6YB 3R06A 1BQHB 5ALBL 3TO4D 1SJVA 5L2KD 3TCLA 4NCDA 4XCYA 4I77L 1UCTA 1TJIL 1F3RB 2UVEA 2EDTA 3CJJA 3HZYA 3NCMA 3GK8L 2DM2A 2DQUH 1WISA 3O6LL 4X5XB 5JDSA 2Z8RA 3AGVA 3FONA 4GAGL 3TO4B 5T33H 3O8XD 1NMAL 3RJQB 1UB5A 3DIFA 2DQIL 2HT2D 3U7YL 4PGBA 2OL3B 1JWSA 1F6AA 3L3OB 1KJVA 3RUGA 1I8KB 2FX8L 4MXQD 1IC5L 4RX4A 3MRMA 1D5IL 1MUJA 3UTZB 3BH9A 4N0CC 2NXYC 3IU4L 2Z92A 3S37L 1M71A 1A6WL 1ZGLP 4KRMB 2AJ3B 4AH2A 1U8PB 1UM6H 1A6VL 4BSJA 4PY7A 1G6VK 3MRQB 4X7SL 5GZOC 2JJSA 2XRAH 3PQYD 1YMME 2A2QT 2GJ6E 5F6IB 1CLYH 5LBSL 3VFOB 1A9BB 1KB5L 4L8DB 3MNZB 1UM4H 3F6LA 1WCBB 4OF5A 4Z7UF 2VZOA 5HJ3A 4XH2B 5D7LD 3VA6A 2IMNA 4Y4HA 1WWAX 2PTTA 3WUZA 3NFPA 3DVIA 4YPGB 4RA3A 3X11A 2Z91A 4PGBB 3ARUA 3EOAA 3P4NA 3CZFB 1BAFH 3NIGE 4XMPL 1KG0B 2V7HB 4U31A 5GRVL 4U1KA 4IRJD 3MRCA 5FYJL 3L3DB 3C87A 1CDUA 4M8QA 3JXAA 1Q72H 1CDIA 4RQQB 4R9HA 4GXVL 3KPSD 3HAEA 2R0ZH 5K33A 3ARGB 2MHAB 2VXVH 4G3YH 1TPXB 4KRLB 5ISZB 5I19H 5TGBA 1JHLH 1QR1B 2JE8A 3KPOA 5E24E 3RVUC 4O4YL 3GBNH 2AEQH 5KSAD 5FB8B 2XZQH 4CJ0A 4Y88A 3SCMD 1K6QH 4Y1AB 1KBGH 4KDWA 1E4WH 4RAUB 4Z7UA 1JF6A 2M1KA 4PJHB 3CFKB 4RCAA 5DD3H 5K59F 5T3XE 2P5WE 4UTAL 1IAOB 1N6VA 1RZIA 4PJBB 4YK4C 4HLJA 5CGTA 3IU3A 2IBBA 3S98A 1CLYL 3ULVE 3FN9A 5DQJA 4GXUN 2OP4H 3TJHC 1J0HA 2FECI 1J8HB 1U95A 3W11C 1F4YH 5D1QB 3CNKA 4MVBD 4MCYA 3LH2H 4R8WL 4RQQA 5E6IA 4FQQA 5LJYH 2XQYG 1O0VA 1VB9A 3TT3H 4X0KB 2W07A 4YXKH 5IMOB 3NTCL 4U6YA 3DVNB 4C56E 2P8PA 5KANG 3N85H 2PCPB 4R4NC 4ODXA 1TZIA 2IALA 1NAKL 1E6OH 1T04A 3CFEB 3MGTB 5IVOA 1SMOA 5ELIA 1IM9D 5DF0A 4AG4H 2ID5A 5IB5B 3DPBA 4GXUM 2H1PH 1CIDA 2UZXB 4Q9QH 3FCTB 4QXWA 1OARL 2EDNA 2H45A 3BD4A 4PJDF 2DQEH 2AI0H 4LKXA 2H32H 3L3KA 2VXTH 5GGVL 4WEBL 3RWJB 1X9QA 4NQCE 2H9GA 1EX0A 3TBWA 2FIRT 3MODL 4LPXA 1H3GA 5JIPA 4HUVB 2W9DL 4GAYA 5F96L 4BQ6A 3ZHLA 4HF5H 5JHDB 5C2BH 3VW3H 2EC9U 3G9AB 3WO3B 1VESA 3MRDA 4KK6C 1RY7B 2D2OA 1N6UA 4WEMB 2RBLA 5BOPA 2C4FU 3RJDA 2XRAL 5MI0B 3WFEL 5CCKH 2DYPD 1BQUA 3H42L 4P5TB 3MA7B 1J1XH 1X5ZA 4XC1L 4BH8B 4JM2B 1NCDH 3HI5L 1A9EA 4UBDC 2O61A 1FAKT 3O2DL 4ZUSB 3SKOB 3S9DB 3B5HA 4EUPG 1A6UH 4HMEA 3SY0A 4M6ML 3ESVF 3L3JA 3LRSA 4MQTB 4NN7C 5IW3A 3LB6D 3OGCB 3HZYB 3UTTE 4MAUH 4NZRL 1BZQK 4WFGD 5GSRA 1HSBB 5CEYA 3QIUD 2NTSP 3WMSA 3QUMB 1AP2B 2Q86A 4M93B 1O7SA 3BZEB 4KI5C 3QXDA 1F3JB 4NWUH 2W9EL 4XNYL 4JVUA 2A1WH 2DIBA 1QBLL 5GGSB 1OGAE 5CBAB 2PTVA 1MH5A 2O5XL 2WP3O 4G5ZL 1UACL 1KPUA 4P2RB 1BGXL 1B2WH 1BWWA 4XNQB 4PLKC 1EEUA 3GI8H 4DN3H 5D2LF 3KLSA 3G04A 4Q9RH 1A1MA 4MS8C 4ZUUA 1EAPA 3TESA 3U0WL 1NEZB 4RMTA 5JR1H 1U42A 4R26H 5HHVL 2K9UA 2OK0H 4EUPA 5TE7L 2BVQB 4PY8I 4XHJC 1A7PL 3RY4A 2DIJA 3F8UB 3LCYA 4PTUB 4FABH 4EIGB 5IHZB 3LS5L 5D2NC 4B0MM 2YPLD 4XI5D 2VE6A 3EYVB 2VDML 2FEEI 2IPUG 3WJLA 2P8LB 4DFIA 5MEOB 4RFNB 1JZ7A 1O5DT 3LN4B 5KS9A 4PRNA 5I30L 1FSKB 4OZHF 3FB7B 1U3YA 1IC4H 3D39D 5CUSH 1VEMA 3QJFB 5E99H 5BV7B 4U0QB 4L29B 3D48R 3ARGD 3VWJC 3RY6A 2XWJA 2QHRH 3PWUA 2Z4QB 2EYTB 2F53A 1K6QL 4G8GD 1YPZE 4GJTB 1G6RL 4WTZG 4LRNL 2D9QB 4QTIL 2AV7A 1JHKH 4ODWB 1X5GA 2IC2A 1MCJA 1T03H 2WSKA 4C54A 4PJDA 1Y0LA 1YEGH 1YUHB 1CTOA 1CGYA 1F58H 4APQD 4LHQB 3RX8A 4CDGC 5I76B 1ZLSL 3KHQA 2XNAB 3MO1B 2JJUA 3T0VA 4H25B 4PG9A 2K7PA 1D5XA 4QTHA 2RHEA 4JKKA 4MJIE 3V7AG 1OPGH 1FN4A 4JFZL 3GHEH 3VE0A 1U91B 3G6DL 4L3AA 3UTTD 4MNQA 5C7XH 1N5AB 5DYOB 5IBTL 5DJAA 1KJMA 1G7QA 5DRWB 2NX5B 3QFJA 1IKFH 3MBEA 3VD7A 4YBQD 1HHIA 5D72L 3O2VH 5CSZA 5DA0B 3U9PH 3VDBA 1UXWB 2QV2A 1P84J 3GSNL 1G9NL 2YC1B 5J6HA 4MJIB 1N7MH 5D1XC 1PD6A 4QRPE 5HYJA 1YQ2A 3UMTA 4HFUH 4L9LC 4HXAH 4LLWA 1I7ZA 1UM4L 4XBEH 1IC1A 2NY0B 5F21B 4Z7WF 5KVEH 3O6FA 4Q0XH 3RWFA 1L7TH 1T2QH 2QSTA 1ZT1B 5FUOH 2DLFL 2E9WA 1ERNA 3FZUC 4ALAL 4JDZA 4DW2H 3GSWB 5CJXA 1A7RH 4UT7H 4NQDE 2E7CA 4MX7B 3FT2B 3OB8A 4R90H 4O9HL 1JFQH 2NY5H 3CVHB 3Q6FA 4Y5XA 5ESVB 3RWEB 3P2TA 2CGRL 5FOBA 3T09A 2VDLL 4GMSL 5IBLD 4PRHB 3WJJA 3WIHH 4O58H 4OFIA 1YYLL 1S7RA 3GJFH 5JOFA 1JWMB 4JB9H 5DSCB 2DQHL 4C83A 4GMSH 4N8VA 1CXLA 2DI7A 1I8MA 5FK9B 2DF3A 1Y0LB 3O9WD 1U41A 2F19H 4OJFH 4FMFA 1FZOA 2ZG1A 4H0HB 4YBHA 2DQDL 4IDLA 2OJEA 3MCG1 5EOTB 1EAJA 1C5CL 4JG1H 4L9LA 3BMWA 3T0ED 5ENWA 2J6EH 4QOKB 1FAIH 2ITCB 5DA4A 5HYFA 4NWTH 1T83A 1KIRA 3FQRA 3U4EB 5C07B 1KOAA 2WK2A 3BUTA 1UH4A 1QSFB 1DUZA 3I75A 4LLDB 2LFGA 1A1NA 1DQQB 3SDAB 3IKCA 4LSQH 1FG2A 4BFBD 2CD0A 4HZLA 3ARGC 1MWAH 4ZG1A 1FFRA 3I02B 1CGXA 3WNKA 1P6AB 3RWCB 4EKXA 2NY3B 3CFDA 4I3SH 5EZOH 1NEZG 5BVJB 2PYEA 1T03L 1G0XA 4JRXE 2MOVA 3PJSA 1A3QA 3B2VL 4QTIH 5GSRB 5FGBC 4DAGL 5ITBH 3QQ3B 4WU7A 4M61A 3ILPB 1WWBX 5GZNC 3QFJE 2B0SL 3P3YA 1FGNH 2GT9A 2VQ1B 5DUPH 1VSCA 1RZJH 3GSWA 3VFMA 3WDHA 4D9QE 3KPTA 1LEGB 2YA0A 3H7BB 2IQAB 3B3IA 3ARQA 1P4BH 4MDIA 1MHHA 2MCG1 4QOKA 4HKBB 1IEHA 5ETUA 5BRZB 5I1HH 5E4EB 4HUMB 5IFAH 4HWBA 3E6HA 2NY2C 3QHZL 3RNKA 4PGJA 5DD0L 3S88H 1N5YH 3ZKMD 4EDWH 4LVHB 2UVFA 3SDXE 5A2LH 4I1NB 5E00A 3GMMB 1WEJH 2OXGA 4HS3B 1WBZB 2IAMA 1P4IL 5IWLC 4FZEH 5A2IH 5E2UL 1HQRA 5D2NE 1QLRA 1T7XA 1ADQL 3ARWA 5EOQL 2HG5A 5F93C 1R24B 3O6KL 3VXMD 4NO5B 3O45A 1QVOA 4XNMA 4N8CH 1U9KA 2P8LA 4CN6A 4JHZA 2AS5M 1ZLVK 4LSPL 1YYML 5H94B 1JPGB 4JY4B 3CU1A 3NZ8B 3EHBC 2R2CA 4KWUA 3ZE0F 1BGXH 4XP5H 4FXGB 4XVSL 1DDHB 3EBAA 4PJIB 1KJVB 3RUGB 4BELD 1U8HA 5B8CC 2AEPL 1R3HB 2EDWA 1G6RH 2LTQB 2I07A 3TJEH 1PKOA 5CEXB 4F9PA 2QHRL 1A4KA 2R9HD 1Q9OB 5C6TL 4JFDD 4R7NA 1AGBA 4JCLA 2H26B 2BFVL 2XWJB 1EHXA 4MQ7A 1I1AD 1NDMB 3AAZB 1HEZA 4HKZB 4TPRL 1MFEH 5KSBB 1U8MB 4PJIE 2Q8AH 1QFUL 1LK2B 2VKWA 5JHDA 2HKHH 2Q3AA 3MZGB 1OLZA 4XGZA 4JFDB 3SQOH 3PQYE 2DLGA 2PO6B 4IOFD 4X83A 5IQ7L 2W9EH 5DRZA 1VKXA 4JKPL 1MF2H 4HT1H 2WWMC 3H42H 1JL8A 4XNXL 4J4PD 2Z8WC 1N5AA 5DYOA 5EO9A 1NAML 5L88H 3U1SH 5BV7H 3KPRD 3GO1L 4GFTB 4M93C 4ENEC 4LLMA 2I25N 3MRKA 2R1XA 3EW3B 4HWEL 4HF5L 1UH3A 4HIXL 2FIKA 3INUL 4UNTA 5I1JH 3GI9H 4P5KA 3QULB 2X89D 3HCVB 1E6JL 2HG5B 5E6ID 4TOYH 5FYLD 1R0AL 4JREC 4WI9A 1UH2A 4GG6A 2EDYA 3VFTA 5J11C 1OAUL 3QUZB 4HS8L 3D9AL 3N1GC 4HULB 5SX4H 5C3TA 1YZZA 3C08H 4OGYH 2F74A 2DQFB 5HGBA 4LLVA 3RY6C 3V6OC 5ERWA 2R29L 4TVPD 2EYSA 2FHFA 3QSKB 5D5MF 1I1YB 5BQ7B 3QO1A 4UAOC 2IG2H 1OM3L 3TWCH 4JFHE 1N59B 5I1EH 2R2BB 1MFBL 1ZT1A 1NCNA 1AGFB 4ORGB 1OB1B 3QRGH 2ARWA 4YDVB 4DUXA 3U79A 4WUUA 4X80H 3DETC 1J86A 4M43H 4O2EA 3NTCH 4YDLC 3D0VB 3KAAA 4M62L 5AWNL 3OF6A 4ODVL 1ACYL 4PJEE 3C60D 2Y07L 5EIIA 3ARFA 1A47A 2R39A 1M6OA 2XFXB 3HI5H 3CK0L 3MUGB 4MDJB 1VENA 5F88A 1HH6B 2FX7L 1CFBA 2EH8H 3T0BA 3QIBB 4JRYA 1MFCL 3O8XA 4GOSA 4KZEH 2CDFA 4Z9KB 4CJ1A 1JF1B 3KS0J 4X4YB 2AGJH 4AYFA 2R56H 3U0PA 5DUMH 3L3GA 2X9YA 2X42A 3Q1SL 3BPLB 1CXHA 5HVGB 3QZWG 4PJEF 1FYHB 4N90E 4JE4B 1FP5A 4YXKL 1OGTB 4FN0A 4NHUB 5F1NB 4R4FL 5ECJE 5DS8B 3AFLA 1TZHB 3QAZB 3S3JA 1I1CA 1YEHH 4DKEH 5GGVH 5BZDA 4G9FB 1HWGB 4PJXA 1FG2B 4BQBA 3HPJA 1G7LB 3ETBF 4U6VL 3JUZA 5H37G 2NW2A 1J0KA 1MHCA 4DUWA 3LD8C 5CKAA 1U3HB 4GKSA 2VLMD 5ICZB 1G7IA 5CWSA 3K2UL 4FNLH 3ALWA 4AG4L 3QR2A 1TZIB 2IALB 3S3PA 4LLQA 1T3FB 4MYWB 4P9ML 5F9JB 3GSOA 2R9HC 4IRSA 2VDKL 3QUZA 4Z0XA 2R0KH 1H3UA 3QZWA 1AGEB 1I1AC 1MIEH 5L2JA 4KTDH 3WL9A 2K3TA 4ZS7H 3SGEI 1BZ9B 2YUZA 5IR1B 1A7OH 1PVHA 3JV4B 1I3RA 1S78D 1KC5L 4X98B 2A9ML 4MD0A 4Q6IC 3WJJC 4RRPA 3GJFA 1LEGA 1N59A 4U1GC 5KBNC 4M61B 1J1OL 4W4NA 1W72L 4XRCB 1G6RB 5SWZD 2H2PC 1ZVHA 2DQTL 2ZUWA 3V52H 3EYSL 4L5FH 1VFBB 5IT2H 4U1LA 5D96B 4HJJH 3UTZA 1A7OL 1QBML 3CGTA 4HIHB 3CK0H 5DHYB 4U1JB 4P3WA 3VFSB 4NSKB 3HR6A 3WHE0 4MAYC 3MOQA 4MMXC 4PJAE 2PR4H 4CMMB 1XIWB 4Q9BA 4LGPB 1KIUA 5GGSY 1Q9KA 1JCKA 1QRNA 3T4AA 4P59L 4EVNA 1HNGA 2VYRE 3D87B 4UI2A 1UCBL 3L5WA 2DLIA 1QKZL 5FV2A 3ZYIA 2XI9A 1G9MC 5L2JB 1YEHL 2AV1A 4Q58C 1M7IA 5IEHA 1A6AA 4P3DA 1KTDA 3MJ9H 4JGMA 4ZPTB 4X7FC 3KNBB 4CN1A 2XWTA 4G9FA 3U36A 5M7QA 2Q7NA 1U58B 4NNXA 1AXTL 5D7SH 5DUML 1J8HE 1XIWC 1CXIA 1U8NA 1VFBA 3LKQA 3O9WC 4KUZL 1NDGA 4XMKH 2FX7H 1UM6L 2YKLL 4Y5XB 5ESVA 3C60C 3SN6N 4WWKD 4XBGA 2KZWA 1ZAGA 1PX3A 2Q7YA 3KPSA 1INQB 3BIKB 5GRXG 4ZXBB 4N0YL 5L88L 1ACZA 3O6LH 3PHSA 1KCUH 3ES6B 4M43L 1WLHA 2JCCA 3FB5B 1D6VL 5DT1L 1QSEE 3MMEB 1KCLA 4KDTA 2GK0B 4PUBL 2QEJA 2FO4A 1KXQE 3NIDE 3ZTJH 1FZOB 4HWBH 1LMKA 4DCQB 4JQVC 1JUFB 2PKDA 3ZE0E 4Y1AA 4K3HA 4FMKA 4KROD 4MAYB 3K81A 4FFWC 4DGVH 5IBUB 1VCAA 4Z7NE 4ELMF 2OBGA 2RR3A 4BSVB 1IVLA 1IAIM 5ANMB 4HEPG 3RWDB 4ONFL 1CQYA 2ZWLT 2C9AA 1GXEA 5FM8A 4YWGH 4UBDD 4JRXD 3V4UH 2AXGA 4IJ3C 3SDXA 4ODBD 4Y7MA 1MEXL 4HWEH 2Q1EA 3EOBA 4PTUA 1P1ZA 1FG9C 5EU7E 3PGFH 1S5IH 4KTEH 1QHOA 3O6FD 1DBKH 5DHVH 5DK0A 3AREC 5B8CA 3GSVA 5F3HB 1ORQB 3VFTB 5ANME 4M7ZC 3SDDA 4LLYB 4W70A 4KVCL 4TUOB 1A22B 4PGDB 4OZFG 3SOBL 5CD3A 2GW5A 4HKBA 3V6BR 15C8L 2CR3A 3BYTA 1W8OA 1JGEB 1JN6A 3RPIB 2HKHL 4GAGH 3BWUC 3LKQB 2ERJC 5GHWL 2HVKA 5GS3A 4Y16A 5J3HC 1BFVL 5I6XB 4LCIL 2NW3B 5D2NA 4TQEL 2VITA 1ZGLB 3ZYJA 3ALPA 2BRRL 5JUEL 1LNUA 1WF5A 2YPVL 3VFWB 3NIFF 3F58H 1T89A 4TTGA 4NIKB 4OTXL 3ISWA 3OKEA 4M03A 4V1DD 1RZGB 1P7QB 1H9VA 4J6RH 2ZUUA 3BDYL 1FL3B 2NCMA 4PLJC 4EBQL 5I73C 2R8SH 3EFDH 1JUFA 2EDDA 1HQRB 1J0YA 1NGYA 1NBZA 4OM1H 5JNYA 3CDFA 3MCLH 5DVOA 3QG7H 1ORQA 3UC0L 3EUUA 4G8EA 4WJ5B 1PSKL 2HJLB 2OTWB 1WFTA 3LS4H 3MXVL 2FJHA 3GMPA 4MJ4A 3U9UA 3WIIL 1Q0XH 4N8CL 4XH2A 3EO9L 1YEJL 5C0CD 1QSEA 3RKPA 2NW2B 1SEBB 3CZJA 3LKPB 3BFOA 4AIXA 5BZDB 3I6KA 3VJ6A 1F90H 3H9ZA 3QIWB 4YAQA 4Z7WE 3UYRL 4U0RC 5HYQB 1OAYH 2E6QA 4RNRB 4ZQKA 2R4SL 4PRHA 3VG0H 3D5OF 3LQAL 3VXRB 4JANB 4NPYB 1JWMA 5T1LD 3K7UA 2YPLA 4X6DF 1NDMA 1R3IH 4ZTPH 3MACL 3MV8E 4FTVB 2GITA 1BOGA 1CR9H 2LE9A 4JHWL 5IMLB 5DQ9B 2WIMA 1WZ1L 1QKZH 1ND0B 3BRGC 4MD0B 4QXUL 3DVFA 1UA6L 4MX7A 2CO7B 4S1DC 4AJ0A 3T0AA 1FGNL 3T0EE 1KCSH 3MLVL 5HYJE 4XRCA 4Z7UB 1GHFL 3IDYB 2W60A 1JYWA 1CFTB 3RZCC 3IF1B 1H3XA 1IAOA 3MLWL 3NIGF 3QDHA 4M1CD 1M7DB 3P9WB 4O2CA 4KJPD 3DV6B 3IDJB 4LNRA 4MXWH 1ADQA 1JGLH 4I18C 3EYUL 3GHBL 2R1XB 2XKUA 4O9HH 1TQBB 2V2TA 3U48A 1P6FA 5B4MD 3T0EB 3TZVA 4Z7UE 4Y2OA 3B8SA 4OD1L 2DN7A 4Y5XC 4IRZH 3GUTB 2E7BA 5I1GL 5F9OH 5CHNB 2DKSA 1FE8L 4XBEL 3MREA 2FO1A 3VFVB 4KTDL 3K1KC 4IRSC 1EFXA 4M6OH 4KQ3H 1KTDB 3FB8A 3DIFB 1QZ1A 1UB5B 2H6PB 5DJ2A 3BP6A 1J10A 3WO4C 2JIXD 5M94B 1I8IA 4G80B 1HK6A 1GGBL 4LVHC 5D72H 1EMTL 4HC1A 3MGTA 3N50A 3DGGB 2BC4A 2XFXA 3VGHA 4EXPX 4OV5B 2JB6A 2HVJB 4WCYL 3CIQA 1T83C 4W4OA 4J7RA 2AJXH 3A67H 3FB5A 1AXIB 2ZPKL 2YR3A 4OD3H 4R4ND 4K9EL 3VXPA 1NCWH 1WCBA 3W2DH 3UBXA 4APQA 1AIFA 2HN7A 3IDMB 1A7RL 2XZCL 1F58L 2JJSC 3MNWB 3LHPH 4BQ8A 1DE4B 1J88A 3RWJA 2VLKD 4D9RE 3DXAE 4CNIA 4GAYB 3EJZD 4EN3B 1FVCA 2MWCA 3QDJD 4LPCA 4EOWL 4LSTH 2OR7A 3CZFA 1IEAB 3OAZK 4PJ9D 1XGQB 2D7NA 4KJWD 2NTFB 3BHBB 1KJMB 4Y8AA 5D7JA 3NFPB 3QXWA 3X11B 2RJMA 3R8BB 3CX5J 5EO0B 3IS1X 4O5LH 1C5DB 3P4NB 4G9DA 5C0BD 2V2TB 1Q8MA 1XH3B 2Y1VA 3D18A 3C5JB 1F11A 4Y1AD 3JWDC 1A9EB 4YDIH 4PJFE 5FEBA 3C8KA 1BJ1H 4NUGH 1YJDC 3EDDA 4XNMB 4LIQH 1LWRA 4LLYA 3D39E 3MREB 4HAFA 2UZYB 3AAZA 3BWAB 3MV8A 1ZT4A 3HI6H 4Z7VE 3NCFB 1PGRB 3WUWB 4LBEB 1JP5A 2AXHA 3MNWA 3QEUB 3FT2A 2VZVA 1TVHA 4MNHA 3QUMA 3L95B 4HEME 1XF1A 3BVNB 3RVTC 4OZGE 5E08H 4K3EH 2R0WL 1Q0YH 4ZUVB 1CFVL 2OK0L 4ERSL 3WNMA 2P49B 4OBSA 3QIUC 4HWZB 3D39B 1WQVT 1UWEH 3Q6GH 3VGEA 3TO2B 3VDCA 4P9HC 2HVJA 1Q9OA 5JMRA 3TVMC 4X6FA 1U92A 3IXTA 5EN2B 1FRGL 2EE3A 1UACH 2AJZA 2OMNA 2NXZB 1MY7A 3VI3E 2W0FA 3RDTC 3UX9B 4GT7A 1CZ8L 1QRNB 1L6XA 1IGJA 5CJOH 2YA1A 2ICES 4G7VL 4ZAKD 1Z0MA 3ZYOA 5KW9H 4F7MA 2D3VA 4P2OD 2VSDA 1DBKL 1E4XI 1KN4H 1OSZB 2BVPB 4OT1L 4F7EA 1GIGL 3M8OL 4CVUA 2GSIB 4OUUA 2F53E 3UCRA 3QJFA 3SDAA 2VIRB 5FIEA 2C3GA 2YD9A 3O2DH 3LKNB 5DD6B 2VR9A 4HG4K 1NCDL 5A2JH 1DBMH 3LKPA 2YS4A 5JXAH 3HCVA 1YPZB 2CLRA 3HR5A 2C4FT 5LGKA 4LCCB 5J6GB 1GPOL 4TNWF 1D5ZA 3D6GA 4WU5B 2HT4D 4K94C 5L8JB 5T1LA 3F12B 3HRPA 4I2XB 4PS4L 5I74B 2M26A 2EYTA 2F53B 2R69L 4OIIL 5GS1A 2FO4B 5DJDB 5DTFB 3QI9A 2AV7B 1CL7H 5K9OA 4HX1B 1WZLA 3KLHD 2QQKL 1RUQL 5ICYB 1LO3H 4WEBH 2D9CA 4NQEB 4X6CE 4PFEA 1BBJB 4L4VB 5IW1B 5J9PA 1XCQB 2X1OA 3BJLA 3MRBB 3EYQC 3OKYA 1JGVL 3WSQL 1G7QB 1YECH 1BFTA 1MCNA 4KHXH 4R0LB 3STZA 3DUUB 2Q87A 5DD0H 3S88L 2I5YL 4O02L 1MCWM 1U91A 3BEVB 5JW4Q 1LDSA 3S6CA 4KUZH 1AH1A 3N0PB 1EEZA 1WFOA 2EDJA 5D7LA 4LPUA 2YEZA 5JHLH 1F00I 1NGXA 5C0AE 4NQEE 3T77A 3Q3GB 4Y19D 3ZL4H 3CFIC 5FFLA 5ILTH 5C09A 2EDXA 4HH8A 2HH0H 4YJZL 1RK0A 2R1WB 4K3GA 4NKDB 2IADA 3KG5A 4JY4A 4E41B 4KPHH 2XKNA 3W0WB 3OKDB 1EFXB 1WGOA 5B8CB 1C08B 2DJ4A 3SGDI 3TA3D 1OW0A 5C6PB 3B2VH 1I8IB 3GSUA 3SDDB 4HBQA 2ESVE 4JZJA 2XZAL 4HKXB 2A6KB 4ISVB 4ZO6A 4L8BA 2VLRE 4IJ3B 4M48H 5I75C 2APTA 3MLUL 2CJUL 3VXTA 1F02I 3TVMD 2Y6SC 1DBAL 3EYFA 3AU1B 3OSKA 3RL1A 4OGXL 1UC6A 4KDVA 2B39A 4XCEB 3VWJA 1MLCB 2ZZUT 4GKNA 4LSTL 4KY1H 4XTRC 4PJXE 1I8LA 3EYSH 4D0CB 5K9OB 4RSVA 1CTNA 2J6EL 9CGTA 3UTPE 1XR9A 3ROLA 3PL6D 5ICYA 1KJ2B 3TN0D 4K3EL 4WHTB 4LDEB 2GJZB 4Y4KD 2R1WA 3QDJA 1NFIB 5MENA 3RKDC 4OZHB 2I9TA 4YO0A 4IMKA 4CVXB 5EBMA 4ZS7L 2NTFA 4U1JA 4GW1A 3HLAA 1FVCB 4GQPH 5A2FA 4Z7OE 4XVUD 1SY6H 1YMHA 2NR6C 2ITDB 3QQ9D 3QNZA 5L7XH 1MHEB 5KN5A 3QIWA 3EYQD 3ULSA 2ZKHH 4XNZC 4DKEL 1R5VB 3AU1A 3HPLA 2EZ0D 3BKJL 3EYOA 3MROA 4LLVB 3HUJF 5HGAA 3TH3T 4F2MB 3G9VA 1BJ8A 1AGDB 5JOPE 2VH5L 2XWTB 1KB5H 4JVWA 3WCYA 5FYLH 5SV4A 3MGAA 1NC4B 1IGCL 4OLUH 1MOEA 2R56L 3ARFD 4HKXA 2WLYA 3LAFA 1V3KA 1MHHB 2GEEA 3DVNA 5B38B 3NH7L 5DLMH 4UB0L 5AZEL 3Q5OA 4ZS6C 4O2CB 1RUAL 5FCUL 4N5UA 5C08E 2ICEA 5B4MC 2D03H 1F8TH 3M1BA 3GNMH 4LFHD 5CP7B 4ODVH 4GKNB 2EO1A 4JCMA 4XMLL 3P73A 1WBZA 3VU2A 4WCYH 5DJAB 3VFNA 4RFOL 4LCWD 2V2XB 3MLVH 1AXSA 2R4RL 2BVTA 5C9JA 1PYWB 3V9FA 1OAZH 3HG1B 4JY5L 4K7PH 4H0GA 2XQBH 2C4XA 1KJ3L 1R5VA 1WICA 4D3CL 4P9HL 4M9OA 1BD2D 1TCMA 5DMGD 1FNEB 2E8ZA 5EC1A 4N0FB 4AM0B 3PIQB 1CDYA 3RAJL 1BJMA 5H2BB 4ZFFA 1IKNA 1KJ2L 5TDOA 1WSST 3CX5K 1K4DB 1S7WB 4LCYB 5LBSH 5CD3B 5ID1A 1I1RA 1KG0A 3OAYH 3HN3A 1EIBA 1HOCA 1VFUA 2IBGA 2XTLA 4IRZL 5B38A 1IGIH 5F6HI 5ICZA 1BEYL 4YEFA 2ZNXA 3D85B 2DICA 1D5ZB 4YR6B 1A3LL 1U8HB 5I18H 1FO0L 2NXYD 3ZHDA 1BHGA 4NO0D 2G60H 4Z95L 3EYUH 3IETB 4NHCL 3VMOA 3VFGH 4X8JA 3B9VA 3EOYG 1S7RB 2UWEB 5EU6A 1RURH 3QCUH 3JTTA 4H8WL 5E5RB 5FKPA 1SJEB 3SO3B 1A2YA 1MF2L 4ONHB 2B8OT 3U6RA 3PQYB 2X10A 4PBVC 3RNQB 1MJ8H 3BPLC 3NPZB 1FZKA 5E7BA 2FEEL 4IS6A 5ADPH 4Y4KC 1R5IA 5JIHA 3BDYH 3VXMA 5C07A 1FFQA 3I50H 1T1YB 1X5AA 1BX2A 1MCRA 2XY1A 4WY7L 4OZFB 1F4WH 2EZ0C 1ZLVH 1AJ7L 1DUZB 4Z8FL 3BPOB 5KVMC 3PHOB 1RJZB 2V7NB 2VITB 2Y9RT 3H9SB 2FZ3B 3SEPA 3LMJL 3VGAC 5HHMD 4MNQE 1R3JA 1QSZA 3W81A 2AW2A 2UWEF 4GW4A 4DN3L 4GSDH 2NX5D 1NQBA 4ZPVB 5E9DA 2R4SH 4EUPB 5EU6D 3VMPA 2OTUA 1P7QA 1NJ9A 4YE4H 4ODTH 5BRZD 2EDBA 1QBLH 2QR0A 1D5MB 5JW5A 4Y4FC 2P1YA 3AMKA 2X44D 5GJTL 2BSED 2E9JA 5F7UA 1WBXA 4JO2H 1YEJH 4M02A 3QQ3A 5INDB 2VAJA 5KS9B 5DJ8A 1L0YA 2ZUQC 5IJKA 4X7EC 3MRMB 3KGRA 4RFEB 2VZ3A 1B0GA 4AEIH 1DN0B 2B5IB 3LIZH 1W2KT 4HPYH 4X5WB 2NZIA 4GRWB 3IFOB 2QSVA 3PGCA 4BZYA 4OZ4A 5BZWA 4MDIB 1ZVSA 2ZG3A 4ZD3L 1A7QH 1XGRA 4XC1H 5EN2A 1M6OB 1KNOB 3BPOC 3BRFA 2V5RA 2B4CL 3NCJH 5I0ZA 2BOBA 3KS0H 4UQ2A 5MHSE 1IE5A 2CRYA 3OHXB 4L4JA 4YHOH 2Y5EA 4FTVA 1I9EA 4ZNCD 5GGUA 2ZJSH 1R5IB 2ED8A 3S36L 1A6TB 4F7MB 2A9NH 3FFCE 3TFKC 2HJKA 1F97A 1SY6A 1B90A 4PRBB 4R97C 3CFJA 1HINH 4XBPA 3QG6B 1VEOA 4EN3D 3AM8A 2F53D 2FD6H 1K3ZA 4KVCH 3RU8L 3LQZB 4YHLH 1H5BB 1DEEB 3BGFB 1M7DA 3GZKA 2V7HA 3KR3L 2D7PA 2HFEB 3ZTNH 5HGHB 2LTQC 3VXRD 3TN0A 3K0WA 3V2AR 4I0PB 1IAKA 3ULVH 2BNQD 4FFZL 4JR9H 2B1HL 1ZVYA 4NGHL 1AGEA 5IBUG 3LQAC 3HNSL 3F62A 4U6HB 3MLYL 1AGDA 1FNSH 3RWFB 1B6UA 3D3VA 1KIQB 2R23B 3BKMH 1I85C 4JDVA 3VFVA 3DX8B 4XT1C 3EYOB 2Z8SA 2JK5B 4XB8A 4PLNC 4GS7C 3QDGA 1T66D 2H6PA 4Y5YC 5EZJB 4F9LC 3FJTA 4KK6D 4FA8A 1N6QL 1HDMA 4L8SC 3U30B 1CGSL 1I9RH 2AK4E 4XCNA 3W0WD 1NL0H 3KYNB 4YXHH 1LNUB 3CAFA 4CW1B 4K23L 4JRWA 4OM0L 1I7RB 1I7UA 3O4LA 4NJAL 1E4WL 5C0AD 2BXYA 3CFKA 3G5YB 3TIDB 3BH8B 1YJDL 4WUUE 3THMH 1YQVL 4WTZA 1VADA 2EDQA 4ALAH 1HHJB 2G2RB 4UDUB 3OKDA 5T3XL 1PEWA 43CAA 1EEQA 2VLJE 4FHBD 1YEFL 2Q3ZA 3KJ4B 2Y5TB 4NBXB 5H2BA 3TC9A 5EUOE 4ZFFB 5EUKA 3U30C 1OT1A 3PWVB 5ACMA 3QDMD 3H8NA 4TNWK 4HS6A 5E6IB 3DSFL 2R2HA 4I18A 3E6FB 2ESVD 1ITBB 1OB1A 5FHAH 3TT1H 1GYAA 2J1KA 3GGWB 4LLUB 2NY3C 4CADB 2AJUH 4GQ9H 3P4OB 5CBEB 2IBZX 4MLIA 3BVNA 1Z5LA 1U8OB 5ICXA 4BH7A 2CKBB 2AKRA 3FFCD 4CN4A 3DXAA 5HYQA 1HOCB 4FQ1L 2DJUA 5IF0A 1MFAH 1NC2B 3L9RA 1JZ6A 3L7EA 4ZFZB 2EIEA 1FFPB 1UT9A 3BZDA 4XP4L 5B38G 3UJTH 4Z78A 1F4AA 1S7UA 1T1ZA 1TDQA 5DRXA 3G5YA 3TIDA 1HIMH 3MRJB 4NQCA 1N4XH 4YK4B 1ETZB 4AIOA 1MQKH 1ZT7B 3CUPA 3O8XB 4HJJL 3MOBL 5H35A 4RGND 5IT2L 2NXZC 1C12B 3AUVA 2HFTA 5EBMB 3JSSA 4FQHA 3DI2B 2PTTB 4GKOA 4PB9H 3CSPA 1UM5H 4NZUH 2IGFL 3NAAL 4KJQD 2DJSA 2E27L 4J2XA 3PL6B 1BX2B 5DO2C 1JPTH 1ROWA 2FSEB 4HBCH 1OGAD 5CFHA 1AC6A 5HI4D 1QLFA 5IHBA 2OSLB 3I9GH 3QUKA 3F7QA 1FBIL 4LPTA 3QRGL 1YMHB 3MJ9A 4U1SB 3RIAK 2MKWA 5T1MB 2AXFB 5HD8C 1Z6JT 1SY6L 2P5ED 4X4MA 5F9JA 2GKIA 5IVXF 3MNVB 5GGQL 3MJ6A 2EIZB 2DI8A 3IJHA 1JVKA 3I3BA 3TPUB 3QZWB 3L3JB 5DMYA 4JFEE 3MUZ1 4OZIF 1EHLL 1XF2B 1TJGH 2D0HA 5I74C 1E4KA 4Z7VA 2N56A 4RA0C 3RPIA 4FABL 4PJCB 5CINL 4F2MA 3QWOB 2VN4A 1I1FB 3GK8H 5ITFA 1MCOL 2A0LD 4WFHD 3WKML 5TE7H 2QQNH 4A6YA 4J3OC 3BP4B 4ODUB 2C1PB 2CIKB 3O3AA 4UINH 4EUPH 5HY9B 4XP1H 1XIWA 4ETYA 4R7DA 3DBXB 1N8ZB 3PABA 1QLFB 32C2A 3KR3H 4O2FB 3DRQA 5C0IB 5KSAA 1RK1B 1OLLA 1SEQH 1G84A 1FPTL 1RU9L 3UBXI 2V2XA 3BI9X 3HE7B 5C0BB 1OAKL 2YK1H 5BXFA 3V6ZB 3OHXA 1E27A 5DK2A 4ZAKC 3V5DB 2ZCLL 5E70A 2ZJSL 1N2RA 2J6EA 3PV7A 1LO2H 4N0FA 5ESAB 2LAAA 3JWDH 3RBSA 5FYKH 4PJGF 2HWZH 2BHZA 3V0AC 5F97E 3HHRB 3SKJH 1PKQE 1WK0A 2HH0L 3REVA 3K4AA 2QSQA 4MNGE 4XBGB 4RGNE 2FWOB 3ZL4L 1TLKA 3MRGB 5ADOL 3FB7A 1WITA 3L3HB 2B1HH 4NGHH 3AROA 1CL7I 3B9DA 4WTWA 4FFZH 5DEZA 4WDIA 5EUOF 3C5SA 1NAMA 4PRID 3BIBX 3W39B 3TBVA 2HFFA 2R23A 2EC9T 2I5YH 4LARH 4MHHI 4P46D 2OCFD 5IG7A 3MV8B 4UTBL 5FAAA 3W0WA 1N64H 4YDJB 3GO1H 4K7FB 4NNPL 4RMUA 3FN3A 2WZPD 4KQ4L 1S3KL 1LE5A 2FD6L 1YY9C 3TNMA 1IM9A 3CDCA 1D5BA 3O0RL 2GK0A 4OLZL 5GJTH 4KKLD 2VXTL 5SX5K 4NQVA 3OJDA 3DVGA 1HZHL 4N5ED 5IFJB 3BKYH 3TYGH 1TNMA 2EEAA 1FNHA 4ZAKB 3HI1B 3RZCA 4WEUD 1QR4A 2I9TB 3E6HB 3S97C 3ZDXF 1N0XL 3O4LB 1U92B 1X5KA 2NX5E 5EU3B 2J8UF 2IANA 2VLKE 5IV2A 3F58L 4K7PY 5J8OA 1T6WA 5KVDL 2IPTH 5EU7C 1D5MA 5T1DL 4PJ7E 5D6CB 1RIUH 1T20B 1GGUA 3A6BH 1FZJB 5FA4B 3MLTB 4R3SA 1KLUA 4RMSA 4QY8B 1EO8H 4HJ0D 4F9PC 3G5ZA 2Q6WA 4NO5A 1HHIB 4ODSL 3S4SA 5DR5H 4G6MH 1MCBA 5DUPL 1DJSA 3FFCA 5T1KB 1TFHA 1K4CA 2X1XR 4YO0B 3HNTL 5A3ID 4LEXL 4UOW0 1MJ8L 2VLKB 4XAWL 4AMKH 3DO3A 4F57L 4NN7B 3O6FB 1KCRH 2OXHA 5FO8B 2W91A 1KPVB 3VRJA 1SJXA 4D0DB 2CH8A 1XGRB 4OCWL 4D0BA 1KN2H 1EAPB 1V3MA 2D7MA 3PGFL 1CZ8H 4LLQB 4TVPH 1KLGB 3CVHL 1IAIL 4NRZB 3OPZL 3LRGA 4XWGH 1WEJL 3C5SB 4L3EA 4BSWB 4DVBB 5J56B 2DL9A 5E1AB 3AM8C 5F7HA 5DJCA 3L7EB 4JDTL 3BQUA 1A6TA 3D69B 3GKWH 3Q6GL 1BF8A 4HC1L 3GBNL 4L4TA 2V2WB 1LE5B 2IQ9H 5D4QA 5J1TC 5DVNA 3UBXB 3H9HB 1GVIA 1DQDL 3PHQA 1QSFA 5CEZE 4D9QD 2V5MA 4HG4J 3ARDC 1U93A 4N9GB 3HA0A 5DT1H 3ZE2E 4O58L 5HHQB 3FMGL 4Y2DC 2NQCA 3DTXB 4KVNL 3W5NA 1K8IA 3C5JA 4NUGL 5D7JB 2WWMD 3EO0B 4PGCB 5HHOE 4ZYKA 3QQ9C 3FAXA 4IRJC 4JRXB 3TLRA 4LCCC 5BO1H 1HYSC 1RUAH 4YX2H 4HMDA 1CD0A 4K3DH 3WFHA 2ATKA 4X8XA 4P46C 3AREB 2CPCA 4PD4K 4PV8B 1GGIL 1OVZA 3QDGB 4XX1E 4Z5RA 4LBEA 4OCLC 2YPLB 2FNBA 5IMOA 3PQYA 3HNVH 1IQWH 2GFBB 5C0RH 5ID0B 2V9QA 1FIGL 2BCKB 4GRWF 1G9NH 4KJYA 2C26A 3T04D 4XPBL 5JIIA 1AR1C 1T04B 2D0FA 1UCBH 3T3PE 2QL1A 2ZPKH 4HV8A 5L0QB 4XVJH 3HNVL 2DBLH 3F6IA 3MGOA 5HHME 1UEYA 2J8OA 4JB9L 1K8IB 2O93L 4PYGA 4XMLH 3I6LD 4X99B 3BDBA 4JO4L 3SJVD 1GOFA 1MIML 3ARYA 2VRAA 3RTQC 4DK3A 4OZGF 2RCSH 4K3DL 1JGUH 5FO7A 3EOTL 4GMTL 4Z7QE 3DMMA 5SWQA 5F1IA 3O2DA 2XACC 4WW1A 4P4KC 4LAJH 2O5YH 5CHNA 3FT4A 5FYLL 2DQUL 3DMMD 3P4OA 4FQCL 3QB7C 4HS6B 4BZ1L 1BBDL 5KVEL 3Q6FB 4ESKA 3ULUF 1XR8A 5K9QI 3R8QA 1INDH 4HXAL 2HP4A 1FVDB 4DFHA 4OD1H 4OSUL 4QHKJ 5KN5B 2DQJL 3BEWA 4M4PA 3GSXA 2WV3A 3L3DA 4TVPL 1NGWA 2QSCL 4MQ7B 2W1NA 2BC4B 3HC3H 4XP9H 3LRSB 2GTZA 4HV8B 1IKNC 1NSNL 1BQLH 5JHDD 5KTEH 5TQ2L 5GRWA 4LSVL 3V5KA 5F72S 3LRHA 2OJEB 1N26A 1RHHB 3RWHB 4H1LB 4FFYH 3FOMB 3FHAA 4U3HA 5FHBL 1J1PL 5ENWB 1ES0A 5A16A 3OJDB 2BCKA 2YA2A 4ZOEA 3ORJA 4FQXA 1P4LB 2VXUH 4U6XB 3B2UD 1FCCA 2V5TA 1XGQA 4WGVB 1DE4A 3LZFL 3VD4A 3QG6A 1BD2B 4P5MA 1X5XA 1U8KB 5DD1H 3WNLA 1S78C 4YC2C 2IANB 3V8OA 1JPSH 2IPTL 1EJOH 5HVFB 25C8H 3K1DA 2AVGA 4NKMB 1CLCA 5HPMA 2A83B 4XAWH 1U3HD 3MRKB 1OAQH 2XG4A 4U4BA 4UOJA 4U7SA 1Z9OA 3LVEA 4TUKL 1C5DA 4G9DB 5FGCB 3SE8H 3PXJA 3DETD 3W9DA 3IJYB 5DEFB 3IJHB 4Q6IB 4LGSB 2UZIL 5EULV 4RBPK 2GTZB 5JA8B 1Z9MA 5K9QG 1PQZB 1NGYB 5IEKA 1KUMA 2LABA 5KVGH 4NKOB 1QO3A 2AQ2A 3VFPB 2NLJB 1A7NL 2DIAA 3ZKXC 1DBBL 2B5IC 4AMKL 1JWSB 4BFGA 5C0GB 1CL7L 4NKQB 1CDGA 4E41A 5DMIH 2ESVB 2F54D 4LVEA 4D0DA 1XR8B 1ZA3A 4N90D 4CMHB 3QG7L 3LD8B 4RGMC 5I71B 1ZEAL 4MJ6A 5IM7B 1TVHB 4MNHB 1OTSD 4L4TD 4RZCA 5MEPA 1I75A 1SM3L 3LSOA 4NBZB 3PWNA 4J6RL 4OIBA 5JXAL 3MLXL 3TBSB 5ADOH 3WXVH 4OFKA 3HZMB 3GMMA 2VDNH 5KS9E 4NRZA 5J89A 3TBYA 4F80A 4HZAA 2ADIB 5JR1L 3SDCA 3U0WH 1FH5H 1M05B 2W0LA 2ORBL 3ULUL 4UTBH 3BZ4A 1DLFH 1IGFH 1JGVH 3SDCD 3BE1L 1CE6A 3U0TA 3C2SA 3QFDA 1OD7A 4UILL 2IJ0C 2KDGA 4JKPH 1V7MH 3EO1B 4KV5F 5FUCC 1AKJB 1S9YA 4G9FE 3KYNA 3ARPA 4LMQE 2H1PL 3UZQA 5CJQH 4OI7A 1GGCL 4QRQA 1LEKA 2NX5A 1NMBL 3ZHKA 1LK3H 3WD5H 2R2EA 5ALCH 5TH2B 4YUEL 5F9DC 4I3RL 1CFNB 1F6LL 2DLEA 3N9GH 2P5EA 4E0RA 1BMGA 4XPHH 1FC2D 3BO8B 3WS6A 2GQHA 1Q0YL 4ZFOL 2ADJA 1J0ZA 4CVWA 1U8MA 3LKRB 5DFVD 2Y72A 1YC8A 3QBTB 3QUXB 4XVUC 5JIKA 3RI5K 1ONQB 2ATKB 4HD9A 4KGLA 3GMOB 3T3PF 3HE6D 1HKLL 3DVGB 5T3ZH 2BHUA 4NO2B 3SPVB 1F42A 5C0FA 2FBOJ 2XOTA 3HI1A 3RZCB 2HVKB 2BY0A 2J3SA 5BW7A 5HXMA 3B9KD 4MA1B 4U33A 4G7VH 4UNVA 5I73B 3BUYA 2AJVL 3S5LB 3FO2A 2ZSWB 4FZEL 3PNWB 4Y2DB 1BVZA 5D1ZB 3MRBA 1FBIH 3IFLH 4GO6B 1FZMB 5EPMB 1UG9A 2NY7L 4JM2D 3TP4A 4PJ8A 2IPKB 4QY8A 3KXFD 2F54E 5CILH 1VFOA 4GQ9L 1CFNA 5GGUB 1A3RH 1AO7B 3NBNA 2M2DA 3TGXA 4XMKL 1U8JA 4NNYB 4M7JH 4I0PD 4ERSH 2CK0L 3KYMB 3SDYH 1YA5A 2X41A 5IEHB 2PTUA 4M7KH 5IK3A 2CXGA 4XI5C 2HJLA 4L8CA 2UY7A 1YEFH 3KPNA 3FRPG 2JTDA 4N8PA 1NH6A 4GRLC 3GKZA 3QFJD 2XTJC 3FT3A 1M7IB 5CP3H 3QQ4B 3QUZC 4NO2A 4M6AA 1OQXA 5GISH 5FYKE 1HHGA 2NY0C 4LQFL 5E0QA 5E6ZA 2OZ4H 3UPAA 1I1FA 3TN0B 2DAVA 1YJDH 3THML 4Q7DA 2EC8A 3QNXA 1KT2A 4YXLH 4NQTA 3EYFB 1KFAH 3OKOA 4L3CA 1UM5L 4YDIL 4KROC 4PY8J 1FVDA 3GFUA 4HGMA 2JKXA 3PABB 5C07E 2KH2B 1BIHA 4QRSB 3QIWC 4KAQL 5GIRA 4I48A 5IW6B 1DQML 5D7JD 1NLDH 3EDEA 5BS0D 2D4DA 1R6VA 3VFUB 2XZZA 2D7OA 2BOCB 2BP3A 4YIQA 4MGXA 5F9OL 3W82A 1A2YB 4ONHA 4K8RL 3BKML 3FRPA 3B3IB 1J87A 4LSDA 2BNQA 5DK2B 5DFVC 1C5CH 2H2SD 3NPSB 1J1OH 1EHNA 4GW5A 5INCB 4FQXB 2FEDC 4P5TA 3UP1A 2Y7QB 3S37H 3QUYB 5I8EA 3QFJB 1LDPL 1ZGLM 1U93B 4QRRA 4YUEH 3BGMA 3IJYA 3HMWH 5EZLA 4S1DD 3UJIH 4P4KA 1MSPA 4KI1A 2DBLL 4BYHA 2PYEE 5C8JA 5GGVY 3P11L 4QRTB 1R3KB 1ZHNB 3SDAD 1BQSA 1GAFH 3D2UB 2GJ6D 4WDIB 1U36A 1WBXB 2CIIB 4NRXA 3Q48A 4PRIE 3IDNA 3FO9A 4O00A 3TBVB 5GIRB 1RZ8B 3OKMA 1HXYB 1CFQB 2DLFH 1JPST 2V5YA 4G7YH 3VH8G 4CADA 3MLYH 2VZ1A 3MRIA 2DQGH 3F7PC 3CVHA 5DI8B 2WWKO 1X6NA 2CDGA 2G5RA 3B9KC 3V4PH 5DJYA 5D2NB 2CR6A 3FB6A 2NW3A 4M7ZB 3VG0L 4PJHA 4EDXA 5ALBH 3KWWA 1CDJA 4LHUA 1UKQA 1RZIB 4PJBA 5EDXA 3RA7L 1A6ZB 5EC2A 2BOBB 1FFPA 3U9PL 4N8VB 1MAML 2PXYD 2OI9B 5TE4H 2ZSVB 5IVZB 1T1ZB 3TIEB 5JDJA 5I17B 1HKLH 1SYVA 3X3FL 1BIIB 3T2NL 4I48B 5IVXB 1AIFB 2HN7B 2KBGA 4HIJB 3MLWH 3P9LA 1XCTA 2ADIA 5EC1B 2EECA 1H8SA 2PO6A 3OKNA 3BQUD 3EFFA 3OKEB 4PIRF 4BKLB 1MHPH 2HLAB 2H32B 4XPHL 4NO0B 1S9YB 3B6SB 2IFFH 3UDWA 2PW2A 5EG6C 4IRSD 1NMBH 1JHTA 4JHWH 2DWEA 1IT9L 2QADC 4YE4L 1W0WA 1WTLA 4H8WC 3RIFK 3UTPD 2EYRA 1IZJA 3BAEL 1CFSA 1KACB 4OAWB 1R0AH 3OMZA 1H3TA 4UIKL 3WHXA 5E03A 3SE4C 3VI4F 4UILH 4JPKH 3MNVA 4NN6B 4NP4L 5HYEA 1BREA 3OPZH 3FO0L </