4XI8A

Crystal structure of the fic domain of bep5 protein (virb-translocated bartonella effector protein) from bartonella clarridgeiae
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
211
Chain Sequence
AHHHHHHMISFYGYTHFDGRTLKNKYGMQGKALQERCAYDLLQAMLNLRKEPLPEKFDSSYLKYLHQRLYEKMFEWAGCTCDTPFTFSDGTVTKVPINNKIKEGLKRIDQILAEKNNFQGLSRKEFIHEVSTVFILLNKIRPFMVGNKYVQRIFFEQIAEAAGHKLDFSVVTEKRMQFAIHAALSRGNITPMLHLFEDISNPEKVGILKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Bep5 protein (VirB-translocated Bartonella effector protein) from Bartonella clarridgeiae
rcsb
source organism Bartonella clarridgeiae (strain cip 104772 / 73)
molecule tags Protein binding
molecule keywords Bartonella effector protein (Bep) substrate of VirB T4SS
total genus 69
structure length 211
sequence length 217
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4xi8A00
5JFZA 2F6SA 4XI8A 4X2DA 3SE5A 3CUCA 3ZC7A 3ZLMA 3S6AA 5JJ6A 4LU4A 4N67A 4M16A 3SHGA 4ITRA 3N3UA 4NPSA 3ZCBA 5CKLA 4X2EA 3LETA 4U0SA 5CMTA 4U04A 2JK8A 3SN9A 4U0ZA 4U0UA 2G03A 5EU0A 5JJ7A 4PY3A 4U07A 5CGLA 4X2CA 4WGJA 5JFFA 2VZAA 2VY3A
chains in the Genus database with same CATH superfamily
5JFZA 2F6SA 4XI8A 4X2DA 3SE5A 3CUCA 3ZC7A 3ZLMA 3S6AA 5JJ6A 2NUNA 4LU4A 4N67A 4M16A 3SHGA 4ITRA 3N3UA 4NPSA 3ZCBA 2NUDA 5CKLA 4X2EA 3LETA 4U0SA 5CMTA 4U04A 2JK8A 1NH1A 3SN9A 4U0ZA 4U0UA 2G03A 5EU0A 5JJ7A 4PY3A 4U07A 5CGLA 4X2CA 4WGJA 5JFFA 2VZAA 2VY3A
chains in the Genus database with same CATH topology
5JFZA 2F6SA 4XI8A 4X2DA 3SE5A 3CUCA 3ZC7A 3ZLMA 3S6AA 5JJ6A 4LU4A 4N67A 4M16A 3SHGA 4ITRA 3N3UA 4NPSA 3ZCBA 5CKLA 4X2EA 3LETA 4U0SA 5CMTA 4U04A 2JK8A 3SN9A 4U0ZA 4U0UA 2G03A 5EU0A 5JJ7A 4PY3A 4U07A 5CGLA 4X2CA 4WGJA 5JFFA 2VZAA 2VY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JFZ A;  2F6S A;  4XI8 A;  4X2D A;  3SE5 A;  3CUC A;  3ZC7 A;  3ZLM A;  3S6A A;  5JJ6 A;  4LU4 A;  4N67 A;  4M16 A;  3SHG A;  4ITR A;  3N3U A;  4NPS A;  3ZCB A;  5CKL A;  4X2E A;  3LET A;  4U0S A;  5CMT A;  4U04 A;  2JK8 A;  3SN9 A;  4U0Z A;  4U0U A;  2G03 A;  5EU0 A;  5JJ7 A;  4PY3 A;  4U07 A;  5CGL A;  4X2C A;  4WGJ A;  5JFF A;  2VZA A;  2VY3 A; 
#chains in the Genus database with same CATH topology
 5JFZ A;  2F6S A;  4XI8 A;  4X2D A;  3SE5 A;  3CUC A;  3ZC7 A;  3ZLM A;  3S6A A;  5JJ6 A;  2NUN A;  4LU4 A;  4N67 A;  4M16 A;  3SHG A;  4ITR A;  3N3U A;  4NPS A;  3ZCB A;  2NUD A;  5CKL A;  4X2E A;  3LET A;  4U0S A;  5CMT A;  4U04 A;  2JK8 A;  1NH1 A;  3SN9 A;  4U0Z A;  4U0U A;  2G03 A;  5EU0 A;  5JJ7 A;  4PY3 A;  4U07 A;  5CGL A;  4X2C A;  4WGJ A;  5JFF A;  2VZA A;  2VY3 A; 
#chains in the Genus database with same CATH homology
 5JFZ A;  2F6S A;  4XI8 A;  4X2D A;  3SE5 A;  3CUC A;  3ZC7 A;  3ZLM A;  3S6A A;  5JJ6 A;  4LU4 A;  4N67 A;  4M16 A;  3SHG A;  4ITR A;  3N3U A;  4NPS A;  3ZCB A;  5CKL A;  4X2E A;  3LET A;  4U0S A;  5CMT A;  4U04 A;  2JK8 A;  3SN9 A;  4U0Z A;  4U0U A;  2G03 A;  5EU0 A;  5JJ7 A;  4PY3 A;  4U07 A;  5CGL A;  4X2C A;  4WGJ A;  5JFF A;  2VZA A;  2VY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...