4XICA

Antphd with 15bp di-thioate modified dna duplex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
b'KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeotic protein antennapedia
publication title Entropic Enhancement of Protein-DNA Affinity by Oxygen-to-Sulfur Substitution in DNA Phosphate.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulator/dna
total genus 24
structure length 59
sequence length 59
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xicA00
2FD5A 3O8HA 5E3OA 1IDYA 3NARA 3QPLA 2WV1A 2X6OA 1H88C 3G1LA 1HDPA 5M5WJ 2AO9A 4L5EA 5F08A 5J1YA 3IH2A 2DMPA 4XIDA 5FLVA 1VI0A 2CJJA 5E3MA 1NK2P 2LTPA 2LFBA 3BR5A 1O4XA 2XSDC 4AUXA 5FKOA 3RKQA 3SDGA 3Q0VA 3HOWJ 3OSGA 1Y1WJ 3WHCA 2L9RA 4A3FJ 3S1QJ 3GTMJ 1F36A 2M9HA 2XB0X 1LFUP 2HOSA 3S2DJ 3B6CA 3JRCA 2O8KA 2P81A 4MIMA 3G1OA 5M5YJ 2CUFA 3BR2A 4MFDA 1HLVA 2O7OA 1MH4A 3BTCA 3FK6A 4W1UA 3ZOBA 5E3NA 3IH4A 1E3OC 1Y1VJ 1ETWA 1UG2A 2GBYA 5IYBJ 1ETXA 2WAQN 3MKLA 4A3MJ 3JRHA 3GTOJ 1RKTA 4FISA 2LLKA 3HKZN 3LOCA 5EGOA 5EG0A 3HOXJ 1D5YA 1HCRA 1AU7A 1HDDC 2JA6J 3BTJA 5F0CA 3BT9A 3HBLA 1JJ6C 5J1RA 5J3LA 2OPTA 2VKVA 4BBRJ 1MBFA 2DA7A 4V2GA 5IOYA 4LOCA 1I50J 2DA5A 2CQXA 2JWTA 1MBGA 4B3AA 5EGOB 5EG0B 5FKKA 3TEDA 3S1MJ 1X2MA 4S0HB 4B1RA 3LSPA 1K83J 4XK4A 2HI3A 3PM1A 2I10A 1B72A 2DA2A 1OCPA 1HF0A 1BL0A 2ECBA 2LVSA 2FX0A 5M3FJ 2MGQA 5GPAA 3Q0WA 5J1UA 5IP7J 3HOVJ 1A5JA 3O8GA 5EYRA 3D1NI 1H89C 4BY7J 2JA8J 2B63J 1B72B 3HB9A 1TWAJ 3C2BA 1QRYA 2ECCA 3HGYA 5EZGA 1GV2A 2L7FP 1TWCJ 5FJ8J 1VNDA 5F1JA 1X58A 1SANA 2LY9A 1NK3P 1JUSA 1U9OA 3A03A 3S2HJ 4JX4A 1ETVA 1FTTA 3RZOJ 1F43A 1X2NA 4A93J 2DTZA 1ZTRA 5BNGA 1IGNA 3FKIJ 2LD5A 1WI3A 1RKWA 2TRTA 1Z77A 1JJ8C 2FQ4A 1SFOJ 3ZQCA 2HYJA 4MLOA 2O9LA 2KT0A 3OIOA 4IHVA 1QVTA 1POGA 1ETKA 3BR6A 4W97A 3WHBA 3ZQGA 4GFBA 3S1NJ 3GTPJ 3K2AA 3MN2A 3VPRA 1FIPA 5JLXA 5M5XJ 3QPSA 1MBHA 3S17J 3HDDA 2VUMJ 3BR3A 4Y7NJ 3I4MJ 3B6AA 3JRFA 3K7AJ 1WCMJ 1W0UA 4AYBN 2DMUA 2CQQA 1FTZA 3HGGA 1TC3C 1G2HA 1GVDA 4EEFG 1R9TJ 3BR1A 4FCYA 4JYKA 3DCFA 4A3BJ 4G12A 1TWFJ 2HXIA 2XGCA 5C4XJ 1U78A 3H3VK 2R92J 3LSRA 2DMNA 3SJMA 3LSJA 2E1OA 4UUSA 2XGEA 4D7MA 2FJ1A 5FKNA 2M34A 3H0GJ 1ZR2A 5EF6A 1FJLA 4D7NA 5GPCA 3BG5A 3GTGJ 3TP3A 3E7LA 1JUPA 2K9QA 3JR9A 4BXXJ 1WH7A 4UUSB 4M3EA 1WPKA 2RAEA 4XRSA 2E2HJ 2L7ZA 2R5ZA 5F04A 5GP9A 4C3HJ 1RESA 2OF7A 3FISA 4XICA 4C2MJ 4DYRA 2ID6A 4IHYA 3ZQIA 3LNQA 1DU6A 4C3JJ 2HXOA 4DYQA 3SFIA 1OCTC 3L1PA 2X9DA 1T56A 2R5ZB 2YU9J 4C3IJ 2DJNA 3OSFA 2M2EA 3IV5A 2EH3A 1QVUA 2AHQA 5HODA 3JRBA 3BTIA 2E2JJ 2NVXJ 2NS7A 3BQZA 1QPIA 1A6IA 2R0QC 4M3GA 1JUMA 1ZR4A 2COBA 4BKXA 2L7MP 1BJZA 2MSYA 4FE7A 2IEKA 3A02A 3CQZJ 2JA5J 2TCTA 2PMZN 2QCOA 3CDLA 4AC0A 1ZQ3P 4DW6A 1BA5A 2R5YA 4J19A 4M3FA 3TW6A 3ZQHA 1ETQA 1LFBA 4JX6A 5F0FA 3UKGA 1JKRC 1ETOA 3JRAA 2NOGA 1UMQA 2Y2ZA 2R5YB 2GLOA 1K61A 2K9NA 2DMTA 1JKPC 1S7EA 4M3BA 5F0HA 3RQIA 4D5FA 5EEAA 3PO2J 5JLWA 1I6HJ 1CQTA 2IAIA 1ZGWA 1XC5A 4MFEA 3PO3J 1IG7A 3RZDJ 2ZB9A 1XG1A 2R93J 2DMQA 1FEXA 4FE4A 4A3CJ 2HOTA 4A3GJ 1VFCA 1VF9A 1ITYA 1MSEC 1MBKA 4RDUA 1JT6A 3BG9A 3M4OJ 4B4CA 3LSGA 4Y52J 3HOYJ 5DS9A 3ZQLA 2ME0A 3QQAA 4FTHA 2MW8A 4CYCA 3GTQJ 1B8IA 3JRGA 5EDNA 5IOZA 4A3EJ 2R7ZJ 2JMWA 1JT0A 1ETYA 1TWHJ 4I6ZA 2W48A 2Y9YA 2NS8A 4D5CA 1Z0XA 4A3LJ 3HOUJ 2WB1N 4QSHA 1H8AC 2K40A 2VI6A 4CYCB 4I76A 4BY1J 1B8IB 4X6AJ 1XS9A 2JK3A 2YUSA 2DN0A 3BG3A 5IPAA 2HDDA 2JA7J 3BQYA 4A3IJ 3BR0A 1Q1VA 1IJWC 2JJ7A 3A01A 2ID3A 4RBOA 3JREA 2Y9ZA 4HNVA 1GUUA 4XRMA 5F27A 3F0CA 2LP0A 2M8GX 1MNMC 3MVPA 2GM4A 3FK7A 2CUEA 1T33A 1MBEA 5M3MJ 2E2IJ 3A01B 1IRZA 4XRSG 2VKEA 5FKLA 5IP6A 4DZJA 3GTKJ 2XPWA 2NVYJ 3G1MA 2XPVA 5IYDJ 2D5VA 1JKOC 5K7FA 1P7IA 2X48A 3CMYA 5E3LA 5FLMJ 1ENHA 3S15J 2HOAA 3Q0UA 3S1RJ 3GBGA 1IV6A 2NVQJ 2XGDA 5C44J 1TWGJ 3TP0A 3HEFA 4A69C 1RETA 2XRLA 2Y30A 2MG4A 1MSFC 1WH5A 2HQ5A 1JKQC 1GDTA 1RR7A 2K9SA 2EZIA 4ABZA 2DA4A 2N8GA 1LE8A 3S14J 1JTYA 3I4NJ 2DA6A 2YS9A 2XB5A 3GTJJ 2KDZA 1GV5A 3GTLJ 1U9NA 2Y31A 2IBDA 2DA1A 1OFCX 2NVTJ 4M6VA 4MO7A 3W6VA 1YRNA 2EQRA 1GT0C 1ORKA 1LE8B 2LK2A 1I3QJ 4A3JJ 3FIWA 3HOZJ 4QTRA 3IH3A 5K7ZA 2G0EA 4IHXA 1JTXA 3DEWA 2H1KA 2L0KA 1HOMA 2EZLA 2QF7A 4DZPA 1BW5A 1ZKGA 1MH3A 1YRNB 2EZKA 1JGGA 2EBIA 1DU0A 2E19A 4JP0A 4X1EA 1APLC 1AHDP 1OJLA 2ME6A 1WGXA 3CCYA 4NDLA 2LKXA 1NTCA 4QIWN 4IHWA 4V2FA 4A3KJ 2EZHA 5DTDA 4IEJA 3M3YJ 4M3DA 3OOUA 1PUFA 2LR8A 2ELKA 3BTLA 2M0CA 1W0TA 1IDZA 3HM5A 5IP9J 4JX5A 2CRGA 2DA3A 4DYCA 1UHSA 2VPRA 3ZQFA 1PUFB 9ANTA 3S16J 3TW7A 4BBSJ 2XPUA 4UUTA 1MBJA 3Q3SA 1IC8A 4A3DJ 5IYCJ 1P7JA 2CU7A 1AKHA 1FIAA 1RPWA 3NAUA 5FKMA 5K7HA 3JRDA 3JRIA 1EF4A 1BW6A 5EZHA 1IUFA 1AKHB 2Y0SN 1ZK8A 5C3EJ 5C4JJ 2H8RA 1U8BA 2JN6A
chains in the Genus database with same CATH superfamily
3KEOA 4U7BA 2H8WA 2LF8A 2VXDA 2QUFA 1LEAA 3ZMDA 4ZDPA 1KQ8A 1H88C 2ZXJA 2IGNA 4D1QA 1D1AA 2DOAA 3TBIA 1HDPA 3RIRA 5M5WJ 4XLFA 3H92A 3LA2A 3M07A 3P9IA 2GQQA 2CJJA 3DP7A 1DQUA 4LJZF 1NK2P 1LUJB 2F4IA 2NVUB 4PK4A 3BR5A 2L5QA 1O4XA 4LB5A 2JSCA 3NWTA 2CV2A 4AUXA 1LJ9A 1X1BA 2PEXA 3HOWJ 3OSGA 1Y1WJ 1ON1A 3FHZA 1LVAA 2M30A 3ABLH 1XPXA 3BG7A 3H3ZA 3O2PE 1TLHB 3B6CA 3KIOA 3G1OA 3MZHA 2CUFA 1BOBA 2VC0A 2O7OA 1A04A 5D5VB 4BACA 3CTAA 4HSTA 2DYRH 4HA8A 2R7UA 5CQGA 2CV1A 2QQ8A 2ZKZA 5E3NA 4KIBA 1BBYA 2HVQA 1R00A 3REOA 4N4NB 1E3OC 3G71I 3JCUC 1Z21A 2MABA 2WV0A 5K5OA 3CDIA 3WTSC 4PJ0C 1D0XA 4NUBA 3T8RA 4FISA 3UNGC 2FEZA 4CCNA 3LOCA 1YW8A 5J40A 4BQOA 1JJ6C 4MEYF 5J1RA 3A1YA 2VKVA 1BN5A 3DKXA 1MBFA 1USSA 2DK8A 2OV7A 4RLQA 2Z3YA 4J00A 3U1KA 2LREA 3Q9VA 3MKYB 2FBKA 2JWTA 1YJNI 2UV1A 1QNTA 5EGOB 5CVUA 2DW4A 1S29A 1KU9A 2BY0A 4PJJA 1K83J 4XK4A 4HZFA 2A3SA 1DP3A 2MH2A 3FBIB 2FMLA 2E1CA 2JPCA 2FX0A 5M3FJ 3ULQB 2LH9A 5J1UA 1J2XA 2KDOA 2BY1A 2GA2A 4II2A 2ZMEB 1PP7U 3OYJA 2VJ5A 4FX4A 5DM6F 2JA8J 2X4HA 1B72B 2F2EA 3OYHA 2MLGA 2O5RA 4E7HA 4AIDA 5FGMA 1GV2A 2JVGA 2GIZA 1SANA 2QEXI 2WAFA 3GLXA 1K4TA 3HSRA 1JUSA 2KFDA 2P7VB 1SAXA 1T38A 4E7JA 3V7CA 3QPTA 1SD6A 2GIVA 4BYYA 1F43A 3ZCOA 5CKTA 3WU2C 2LNBA 1H9GA 5BNGA 1VZ0A 1IGNA 2KRFA 2TRTA 3C2GA 4IXAA 3L2RA 4YIFA 3MCZA 1SFOJ 2HU9A 1MIJA 2PJPA 2O9LA 3TDUC 4CCJA 4E7IA 4IHVA 1QBJA 2XF7A 5E18F 4KN7X 1GHCA 4N9IA 4PUSA 2B9SA 1IUYA 5JLXA 3QPSA 4OIQF 3S3MA 2EFNA 5DCMA 2BZTA 5E20A 3RYPA 2CUJA 2VJ4A 3I4MJ 3K7AJ 4XNFA 4LITA 4XLAA 4AYBN 2M7AA 5LHIA 3DTKA 2BVLA 3OYNA 3SEZA 2F4OB 2NNNA 1ZREA 5AIPA 3PNVA 4L0YB 1MMSA 2EB7A 3W2WA 1HXDA 4A3BJ 3LA3A 4G7HF 3WGHA 4BL0B 5A2QK 5C4XJ 1U78A 3H3VK 2VL8A 3LSRA 3H9QA 2DMNA 2A6TA 1DGWY 3JTHA 3F8NA 4YRVA 3SJMA 3VFZA 2XGEA 4IRHA 1W5TA 3AAFA 3M1CA 1I27A 5DCFA 3SQNA 1IO2A 1R1TA 2F48A 2K9QA 5J8CA 4BXXJ 4M3EA 2QKMB 4DBRA 4OIRF 4IX7A 1IN8A 5D4SA 2E2HJ 5B66C 2W24A 1WJFA 3DBRB 3LQRA 3CJRB 3QU6A 2EIMH 3DEUA 4C3HJ 2X1DA 1RESA 3CO6C 4DYRA 2ID6A 1MMAA 2K86A 3ZQIA 1DU6A 3ZGKA 4C3JJ 2RNJA 2HXOA 2Q1ZB 3SHFA 4DYQA 2Z16A 1A31A 3CC7I 3JSOA 2E7XA 5GADJ 2Q2EA 2OQRA 2YU9J 2DJNA 4HYEA 3V8LA 3OSFA 4P9FA 2E36A 1LB2A 3WTTC 2BOLA 3HUGA 3H9GA 3KEQA 3GVAA 2E2JJ 2NVXJ 2JT1A 4XLNF 3WE3A 1W1WE 4GYGA 2GXGA 1XMAA 3BQZA 5DEQA 3JAMK 1LEBA 1MJBA 1XMKA 1Y6IA 3QAHA 3OYCA 4C2TA 3CQZJ 2IEKA 4FE7A 1Y8QB 3K4MA 1T39A 2ESNA 2FBIA 1IN6A 5HVQC 3CDLA 1MMDA 4IQJA 3CC4I 1ZQ3P 1V5FA 4GGGA 2K85A 5BS6A 4EATA 4KN4X 2A5WA 3TDZC 3KP6A 3RJPA 2NYXA 4JX6A 4BQQA 3CMEI 4DNCA 1BC7C 2O03A 3C1DA 4YG2F 3N4MA 3V42A 5KAIC 2JQ7A 2QM3A 2IT0A 2R5YB 3RCOA 3TMOA 2GA1A 2DMTA 3VYRB 2M1BA 3CLQA 3RQIA 1RC9A 2CWEA 3IKTA 3PO2J 2GOMA 1I6HJ 1R36A 3OMYA 3W6KB 4BEHA 2AS5F 4Z2YA 3HSEA 1U6GA 2KIQA 3ABKH 3BJAA 3GFLA 1I5ZA 2X6YA 1XG1A 2HYGD 3ABTA 2DMQA 4UHTA 4YEJA 4B48A 1IXCA 1FEXA 4A3CJ 1MMGA 3CCUI 1VQ4I 1BR2A 4MQ9F 1BI2A 4LK0F 3OYLA 1ZRFA 3M4OJ 3LSGA 1UG0A 3HHGA 3L00A 3ZQLA 4O6JA 1K78B 2DCEA 3PFYA 1YTYA 4CYCA 2BGCA 5AIQA 1B8IA 2X51A 2XSJC 2EILH 2L9NA 3PSIA 2MD0A 1JT0A 1ETYA 1EA3A 1TWHJ 2XKOA 4LLGF 2W48A 2Y9YA 5FD5A 1VQ6I 1L0OC 1Z0XA 2VXZA 4QSHA 1D3YA 2V9PA 2LBFA 4M9SA 1R5HA 4HF0A 4EQQA 4AVPA 4ESBA 2ZXIA 5L3DA 4B09A 1BI3A 1B4AA 1MNEA 5IPAA 4HV6A 3I71A 3CUQA 2JJ7A 1AOYA 2A68F 3RTRA 2RREA 3JREA 4CHUA 3ONQA 4XRMA 1WZ2A 2LP0A 1FOKA 2M8GX 3WG7H 1MNMC 4L9JA 5E79C 2IPQX 3D0SA 2F5VA 5FLXZ 2IRFG 2CUEA 4JOMA 3FXJA 1T33A 5DYMA 3S3OA 3H1CA 1T2KA 2VKEA 2Z2SB 1FSHA 4XLPF 5KK1A 5IYDJ 2D5VA 2KRHA 5CVRA 5K7FA 1P7IA 2NNYA 2M4KA 4NC7A 1TTYA 5E3LA 2DXIA 3BG6A 4XOTA 2QLZA 4NQWA 1J5YA 4XLEA 2F4MB 3ZR8X 2NVQJ 5C44J 3KP3A 1F1ZA 4MTDA 3HEFA 5B3SH 1MZBA 5CVIA 4A0YA 3BZ6A 1OMIA 2Y30A 1V55H 2MG4A 3S93A 2P5LC 1WH5A 3AG3H 3L2UA 4ZYHA 4ABZA 5JI6A 1ZLKA 2N8GA 4AIHA 1VQNI 4YIIA 4F7ZA 2DA6A 3MZYA 2YS9A 2KDZA 1ONVA 3UR3C 4A6DA 4N4OB 2ZJQF 3WTZA 1SEUA 4IRIA 2DA1A 1OFCX 2I8DA 2KPMA 2PN6A 1YRNA 2EQRA 1Y0UA 4EJUA 2LK2A 2YX4A 2RC4A 3TO6A 2GAUA 1JTXA 1W4MA 3VOEA 2EK5A 5KNLA 3OWTA 2K4JA 2VLAA 1HOMA 2B7EA 2EZLA 2O3FA 2FF4A 3U21A 3OR2C 1ACIA 1CGPA 1MH3A 1TBXA 4YFNF 1T95A 2A5YB 3ZMTA 2WB1A 4Y33A 3HRMA 4JP0A 3F23A 2XRNA 4OU0A 2D1VA 4AYBA 3HC7A 3PQKA 4Y15A 2PX9A 2VT2A 3TO7A 2LKXA 1OYIA 4IHWA 1WVRA 1HQCA 2CFOA 1KONA 2EZHA 3I0TA 1Z3XA 5DTDA 3IUOA 5ICFA 3CO7C 4LLNA 2PFBA 3C2HA 1WWXA 4M3DA 3BJ6A 3KP4A 4LD5A 3ISPA 4RAGA 1IDZA 3A0BC 3VEPA 1J09A 1HKTA 4GXOA 1ZRCA 4NB5A 1CF7B 3DPUA 4BAYA 1C0WA 3I53A 2FU4A 2XPUA 4WCGA 2BE5F 1IC8A 3FX3A 4XOPA 3FKJA 3D5LA 1AKHA 3M8FA 1FIAA 4K2EA 2L54A 2JRMA 3FXLA 3TOAA 3K9TA 1ZH5A 5L3BA 2XC7A 5JVGF 2XDVA 3BCAA 4MGRA 4YFKF 3JRDA 4KMUX 1BW6A 3DFGA 5C3EJ 1NG6A 3QODA 1U8BA 2DJIA 2JN6A 2A05A 2V1UA 2FD5A 4EJOA 1D0ZA 3BZKA 1OYYA 2G9WA 1TQMA 3RI4A 1HW5A 1U2WA 2VJJA 3KYDB 2BHYA 2K9LA 1BR4A 2HZTA 3CF2A 3F72A 3V7SA 2EV5A 1U3EM 3LFKA 3WG9A 4N0BA 2RV8A 4LIUA 5HNFA 1J59A 2HQAA 1VI0A 4HBLA 3T8TA 1FMWA 3OYBA 2LTPA 1WKMA 2XAQA 4OIPF 5CPRB 3RKQA 3BZCA 2VBXA 3WHCA 5LRRA 2C6YA 2MC3A 3TOBA 3O6BB 2XF6A 5HNHA 2O8KA 4XL9A 2P81A 4RM3A 4HNTA 3BR2A 2HKOA 1HLVA 4CA0A 2QA4I 3WTVC 3I54A 3BTCA 3AFHA 2K3PA 1REPC 2VE9A 2UWMA 3F6VA 4W1UA 3GW2A 4KA4A 3ZOBA 4IVNA 3I4PA 1Y1VJ 1ETWA 4PDKA 1UG2A 1NH3A 1D1CA 1ULYA 1W7PB 5IYBJ 1DUXC 3G4SI 3MKLA 1Y39A 5BMZA 5GTIC 3GTOJ 5E17F 3ECOA 4IOCF 1JHHA 2A69F 3K10A 1MD0A 2F6CA 3GZ5A 5EG0A 3OYMA 1D5YA 1HCRA 1X1DA 1AU7A 1HSTA 3HYIA 3S8PA 3KZIC 3BT9A 5DUIA 3HBLA 4OAYA 2DK5A 3I58A 4FQGA 5J3LA 3DV8A 4A2UA 3RQ4A 5IOYA 1I50J 2R7DA 2CQXA 1O3TA 1M1EB 1MBGA 4B3AA 1EH8A 3F8MA 5FKKA 3BOQA 3BWGA 3LSMA 2D45A 2CS3A 5IT3A 4KUMA 2E1NA 3LSHA 3F6OA 4LG3A 4N9HA 2Z1DA 2DFHA 2DA2A 2ECBA 2LVSA 2I5UA 1YX5A 2OCCH 3Q0WA 3V4GA 3VYSB 4UB6C 5L3CA 4HF2A 4BU2A 2K3FA 2MYSA 1JHFA 3E0JB 5EYRA 1U5TA 2V9VA 3H3UA 2HTJA 3E6BA 1F9NA 4U0VA 3C2BA 2NS0A 2QQBA 1SD5A 2JRTA 3ERMA 3HGYA 1IXRC 2KIMA 2L7FP 4KICA 3VSKA 4B8XA 4NNJA 4L5IA 2PMHA 4ENMA 2RDPA 2XGXA 2Y69H 5L3GA 2PJRB 3A03A 1XN7A 4KT5C 3E6MA 4JX4A 1ETVA 3OS2A 1YQAA 4E7ZA 4HV5A 1X2NA 1XCBA 2R7FA 5H6QA 2DTZA 2FNAA 4XSZF 5ILSA 3FKIJ 5TRDA 1ERDA 2H6CA 2W25A 1Z77A 1K79A 1DP7P 1UFMA 2FQ4A 5H2FC 4H4KC 5K5RA 3ZN1A 2HYJA 1Z9CA 2KT0A 4HSRA 1R58A 3CJQB 1POGA 1ETKA 2IA1A 1ON2A 3BR6A 3ZQGA 2HDWA 4GFBA 4LG0B 3HRSA 5LEJA 4UVBA 5EEGA 2HYFA 1V4RA 2M4GA 3HDDA 5L3FA 1J0RA 2HS5A 3BR3A 3B6AA 3JRFA 3I3LA 5FRNA 5LGUA 2EV0A 4AD9A 4NC8A 3IL2A 2V79A 2V6EA 2M3AA 1FTZA 2E60A 3BR1A 4FCYA 2JZYA 2R7TA 2WBMA 2P7CB 4ZDOA 4G12A 3M8JA 1TWFJ 2EJRA 1TT5B 1D0YA 2HVRA 3ZN0A 1HKQA 4GDFA 1AWCA 3IP4B 3LSJA 5CVVA 4D7MA 1TQIA 3ESWB 3BY6A 2R7OA 3J81Z 1WJDA 2FJ1A 5EJCA 3E5QA 1ZR2A 5CQEA 1I1GA 1FJLA 5D8LB 3TP3A 1SVLA 3E7LA 1JUPA 4UUSB 4E7LA 4X0GA 4ZZDA 2L7ZA 2D1HA 2RQPA 1YO5C 4FETA 1XSXA 2K4BA 5HLGA 3EUHC 5GP9A 3L9FA 4D0PA 3JW4A 4PZJA 4I98B 2OF7A 4A5NA 2WA0A 4QLCU 1R4NB 3SFIA 1OCTC 1P4WA 2ZMEC 2R5ZB 1S9HA 4HDVA 3I5UA 2M2EA 3IV5A 1TNTA 2OC6A 3JRBA 4CCLA 3R60A 1A6IA 3DLLF 2RNGA 1ZR4A 2COBA 1G3WA 4BKXA 2L7MP 3H5RA 3J80K 2V7FA 2MSYA 4F55A 1H9TA 2YU3A 3A02A 2JA5J 3FMSA 1OR7C 3HPGA 2KJCA 1HSJA 5CLSA 3K70D 4J19A 4M3FA 1EH7A 2BY3A 4M73A 5H20A 1EV7A 4KIGA 1YLFA 4MNUA 5F0FA 2R7WA 3CMMA 2P5VA 2P5KA 3KZYA 3OIQA 4ENNA 1QA6A 2Y2ZA 2CSOA 2GLOA 3U9GA 4F91B 1T08B 1S7EA 4M3BA 4D5FA 4M74A 1ZHFA 2CV0A 1V5EA 3RPQA 2V1DA 2IAIA 1ZGWA 2W7NA 1FOYA 4MFEA 2LMDA 1IG7A 2CO5A 3V8KA 2ZB9A 3RZDJ 4RGXA 3DTIA 4KNYA 3IWFA 2UXNA 1ZG1A 1QPMA 2X6WA 5ILVA 2ZBKA 3LSIA 2IS6A 1TT0A 3SZGA 1MBKA 4HLYA 4PGHA 1AA7A 4RDUA 2QSFX 4IF4A 3LL7A 2VPLA 4B3XA 1QHGA 3BG9A 2DBBA 4Y52J 5D4RA 3GEZA 3IC7A 2ME0A 4G6DA 1FP2A 1KQ0A 4PGGA 2ESHA 2EINH 3QQAA 1BM9A 4O5VA 1S8NA 4DQ2A 3JRGA 3MAJA 4E7SA 5GAGJ 1MNDA 5AONA 2Q8KA 1Z6RA 4QPQA 3J7YJ 4CUGA 2XIGA 4E7KA 2CW7A 4Q48A 3QRFF 2WB1N 1V3FA 2LF7A 4H0EA 4I76A 4B44A 4X6AJ 4F93B 3L2CA 2OD5A 1QO0D 5F6FA 2A07F 2JK3A 4IHSA 2DN0A 3BG3A 5IY5H 2HDDA 3BQYA 4A3IJ 3SYTA 4XN0A 1IJWC 3MQ0A 3A01A 4O3MA 2IP2A 4RBOA 2Y9ZA 3IAM2 1STZA 1GUUA 4OWRB 3F0CA 2V9KA 1A36A 2XAHA 2L9SA 4ENKA 2P6TA 4Y4RA 4Q5SF 3FZVA 2IVMA 5TISC 3OIPA 5B5EC 1W36D 2WY7Q 2DT5A 1W5SA 4LLLA 2VQGA 2E2IJ 1WJEA 1IRZA 4ENJA 4A12A 2JUCA 5IP6A 3R0JA 2DODA 1QZZA 3G1MA 1R49A 3R0AA 4AIJA 3SDBA 4U87A 1UB9A 3OY9A 1IRGA 4CICA 3FXRA 3CF5F 2COMA 2MBFA 2XF5A 3GLLA 1ENHA 4YELA 5B1AH 1W5CC 5EEHA 1LQ1A 3TP0A 1RETA 2XRLA 5HDKA 3IWZA 2VASA 1MSFC 2K9MA 2HQ5A 1JKQC 1GDTA 1RR7A 3HIFA 5IT9K 2EZIA 2HNHA 3T5XA 1LE8A 1LDDA 2VBYA 1VTNC 2QYOA 3U1DA 4XBFA 4AWXB 1ZG5A 2DQLA 2XB5A 4ZTFA 1B59A 3ZPLA 3GTLJ 4L9TA 1U9NA 1KGSA 1JGSA 1FNNA 2IBDA 4XKBA 2ZSHB 3FMRA 3F8CA 3G3ZA 2STTA 1IRXA 3BPXA 1Z6TA 3K4BA 4E4HA 1SC7A 3M7GA 2ISZA 1FOWA 4A3JJ 3G6EI 5K7ZA 1FC3A 2CMPA 4J01A 2YR2A 1UZCA 1T0FA 4CYDA 2H1KA 1MDMA 2L0KA 3VWBA 4DZPA 1BW5A 2M0MA 1ZKGA 5J6XA 2DO7A 4EM1A 2LY2A 2FBHA 2EZKA 4P55A 4M9ZA 1X19A 3E1SA 2O61A 3OYAA 4CO8A 3LA7A 4M6YA 2ME6A 3CCYA 3K2ZA 3LAJA 4BE0A 1I1SA 2E71A 5JHUA 4R8HA 1X3UA 4V2FA 3VODA 1G4DA 1G3SA 2R7QA 5F1RA 4M71A 3M3YJ 3OOUA 3L7WA 5DDGA 4A0XA 3GF2A 4NBQA 2ZSIB 5IP9J 1QU3A 2JSPA 3PUBA 4JX5A 3FM3A 4I0AA 4DGWB 4DYCA 2LOOA 1UAAA 4UV8A 1VQOI 1FBUA 1K6YA 2KISA 1PUFB 1WQ2A 3RKYA 2KL4A 2VONA 2CH0A 2ZJRF 1XGNA 3PIPF 4HX8A 1R1VA 3HHHA 4WXDA 1P7JA 5FRMA 4RMNA 6PAXA 1SD7A 4AM3A 3BPVA 3TQNA 1RPWA 2OTLI 2A61A 3NAUA 2QWWA 4I2OA 3K4JA 3HRUA 2ISYA 3ZMUA 1ZRDA 5ICGA 5ERIA 4CCOA 3JRIA 1EF4A 2ACJA 2W00A 2BW3B 5EZHA 3T0YA 1IUFA 2Y0SN 2X85A 1WI9A 1R22A 2DT7B 2QBYB 5BQTA 5BPIA 1J7KA 3F3XA 1YHQI 2VBWA 2K5CA 3C3WA 1J9IA 3QOPA 3KETA 1IDYA 2O8XA 2FRHA 3L09A 4PCQA 3FHNA 2X6OA 3GFMA 2R7SA 3G1LA 4ASNA 2YPRA 5J1YA 4L5EA 3N05A 2DMPA 4XIDA 1Y0NA 2HOEA 2EFWA 2K7LA 2G7UA 5FLVA 3WGIA 4XONA 1S72I 2LY1A 3I56I 4RAZA 4JK1X 5E3MA 3OYDA 3DTEA 5KCMA 3HXLA 2LFBA 3HOTA 4UUVA 3WE2A 2XSDC 1IZ1A 5FKOA 3Q0VA 4MQVA 2EIJH 4L5JA 2LKPA 4KJZA 3HSFA 4EVIA 2ZNYA 4A3FJ 3S1QJ 3GX4X 1F36A 2K02A 3EQLF 1WFXA 4L9NA 2HOSA 5HLTA 1Y56A 3K1NA 1WSUA 2MLKA 5M5YJ 3Q9SA 2IGOA 3JAMZ 3L2WA 1BI1A 1USTA 3DQVC 1IF1A 5HDNA 3WU1B 4HG2A 5H6RA 4OINF 4RA2A 5GAEJ 5JHFA 4OMZA 1ZGJA 5HLHA 1G3TA 1YW7A 4A3MJ 3JRHA 4UY8I 3GCMA 2CQKA 2XHKA 1ZN2A 3CD6I 4R1HA 4RB0A 3HKZN 5EGOA 3HOXJ 4RAFA 1HDDC 4U88A 5F0CA 4DIQA 4ZYAA 3FXOA 3M9AA 4UVCA 4E6KG 1FZPB 1R5ID 4RLFA 2DA7A 2Q0OA 4V2GA 4I01A 1L3LA 4LOCA 4EM2A 3CCLI 2AXLA 2FXAA 5DD8A 4F52A 2FOKA 3TEDA 3S1MJ 3QOEA 1X2MA 4S0HB 3WTXC 1YJ9I 1BI0A 2W85A 4B1RA 3FBNB 5ILUA 2FSWA 3LSPA 5J4VA 1PP8F 4C2UA 1MJAA 1B72A 3PNTA 1OCPA 3ZXSA 3K4NA 4ZH4F 5HS8A 1YI2I 1HF0A 2UZKA 3CMAI 2MGQA 5GPAA 2QQ9A 2GOXB 3MMYB 2L01A 5IP7J 4ESJA 2VODA 3HOVJ 5ED4A 4G6QA 1H89C 4RAYA 2VQHA 2MH9A 3HB9A 1FMVA 4U0WA 3EYIA 1QRYA 5E1ZB 1QZEA 1WJBA 2JUGA 3PQJA 3KCCA 1XGMA 3CCRI 1QZYA 4OOIA 3KYCB 1TWCJ 5FJ8J 5F1JA 1HC8A 1X58A 2VE8A 3LWFA 4RM2A 1XTAA 3LMMA 3BLYA 1NK3P 1U9OA 4P9UA 1UHWA 4KITB 1FTTA 1FT9A 2HPIA 2JPBA 2CG4A 2F5FA 3EDPA 3BP8A 1ZTRA 2V6CA 3G2BA 3ZQ7A 3AG4H 4CZZA 3P9CA 1WI3A 1RKWA 1X1PA 3L2VA 3GXOA 1X3WB 4BS9A 2NOJB 1LKXA 4MLOA 4GO1A 1K7AA 2JA2A 5FO5A 1BIAA 1S3JA 4HLXA 3TGNA 3WHBA 1R71A 5BOXA 1FBQA 4QWQA 1TW3A 3GTPJ 2UUZA 3K2AA 2E34A 1FIPA 3VPRA 3GFIA 1YG2A 5M5XJ 1MBHA 3S17J 4YFXF 3K4KA 4IKFA 1ZELA 3O3KA 2MD5A 2OTJI 2CQQA 3GO5A 1EJ9A 4EGYA 4EEFG 1R9TJ 3CCVI 3DCFA 2H94A 1QGPA 4II3A 2XGCA 1VQ7I 5HDGA 2LC2A 5DCMB 3EUAA 3IKVA 2Y0MA 4EMSA 4UXNA 1I3AA 2E1OA 1SAUA 3DPLC 4XKWA 4RB3C 2VN2A 3GMEA 2LDUA 3WTUC 1FSEA 5HLIA 2Z33A 5EF6A 3HPHA 1ZG3A 2X0LA 1SFKA 3KZZA 1SD4A 3GTGJ 4PJNA 1G59A 1DDNA 1P6RA 2LG4A 2RAEA 3CDHA 3P7NA 4A5MA 5LLQA 4BE2A 4XRSA 3CESA 5TGTA 1HW2A 1IXSB 3W2AA 3KEYA 2FMYA 4C2MJ 4OIOF 4IHYA 1BC8C 4I99C 3AG2H 3LSTA 2JVHA 3L1PA 3S32A 1PJRA 4C3IJ 1I6XA 4YIRX 1YIJI 2EH3A 1O7LA 1QVUA 5LBQA 4C9YA 3BTIA 3QYEA 2STWA 1QPIA 2NRAC 2ZC2A 2R0QC 2Q2EB 1PDNC 1BJZA 3SXYA 3LAPA 4EV0A 1U8RA 1Q1HA 1SMTA 4BHCA 2PMZN 3NEUA 2QCOA 5B1BH 2ETHA 2DFFA 2Y0SA 3HUGB 2R5YA 1R5GA 2CYYA 3WODF 2VQLA 4WWCA 1E17A 4PJLA 4LB6B 2CQ7A 3ZQHA 4XORA 1X4OA 1ETQA 4S04A 3K69A 4RS8A 1KQ9A 3CCJI 4ZYGA 1YS6A 2ZFWA 3CP8A 2EFOA 3UKGA 1JKRC 3JRAA 2NOGA 1IRFA 3W3CA 2K9NA 2LSOA 2XAFA 2HDCA 5D5WB 2FE3A 2KZGA 4E70A 1OCRH 1ZARA 2L4MA 3E3VA 5EEAA 3HRTA 1DPRA 2PQ8A 2HWVA 1T6SA 5FROA 3CP2A 1CQTA 2FOWA 3FMQA 3PO3J 3E5XA 3MZ8A 1V5GA 1KU7A 2R93J 1RNLA 4NHJA 1K78A 4KMFA 2HOTA 1S7AA 2VT3A 3CJNA 1YIOA 1VFCA 4Q47A 1VF9A 2GZWA 2HTSA 2OAZA 4HQMA 4B43A 4BEHB 1ITYA 2XUBA 1RUNA 3OYKA 4CCKA 4EGZA 2OA4A 2ZJPF 2XAUA 3PSFA 2HVSA 2R7XA 3R4KA 2RN7A 4ETSA 1D1BA 3OYIA 4HPQA 4HDUA 4FTHA 3CUQC 5D5XB 4WF2A 2KMUA 3MD2A 4BUPA 1IN7A 5IOZA 4A3EJ 3V7RA 4BJTA 4I0BA 4FHTA 4I6ZA 1QHHD 5TJJA 4FASD 4PFPA 2DOFA 2JTVA 3KYLA 1O3QA 3E6DA 4GRIA 2NS8A 4D5CA 1D8JA 1UHMA 3HOUJ 4UVAA 1H8AC 5LFAA 2K40A 2DOEA 4CYCB 4BY1J 2L2OA 3HKZA 1B8IB 4IOAF 1GLNA 1E0EA 3KFWX 4CDGA 1A35A 1XMXA 3K4CA 2OZUA 4CCMA 2JA7J 4IHTA 2XAJA 2H1LA 2VKHA 3BR0A 1FP1D 2ELJA 2KJBA 3D5SC 2LBFB 3K6GA 2MC4A 2XKPA 3MVPA 2X1CA 1R6RA 3FK7A 4RGRA 3F22A 1B9MA 1MBEA 3CUQB 4LFUA 1MW7A 2KIUA 5LRSA 1YYVA 2RGVA 5DD4A 2KRCA 3BC8A 1IN4A 1E3HA 3GTKJ 2NVYJ 4ZTJA 2XPVA 4G7ZF 2X48A 4XSXF 3A2KA 1KYZA 1TW2A 3R6SA 3CMYA 4HRIA 1YITI 5FLMJ 3ROUA 5DUKA 3S15J 2PG4A 3M8EA 3MKWB 4G8XA 3GBGA 2XGDA 3R61A 1B6AA 1TWGJ 1ODDA 4G6TB 4A69C 3DBHB 2K27A 1Z67A 2FNPA 5DV5A 3JSPA 1XB4A 1OKRA 2VOPA 3ELKA 1X4PA 2QVOA 3IAS2 2BY2A 2DT6A 3ABUA 3DKWA 2K9SA 4NQWB 2V1NA 4WXHA 4ANJA 4EJTA 1WJ5A 3I4NJ 3MKZA 1Z91A 3ZMVA 3GTJJ 2NXNB 2QSHX 2Y31A 4BDYA 3AL0C 4ZDLA 2YX7A 2B0LA 1P9QC 2NVTJ 2W84A 2E35A 4MO7A 1WHUA 3W6VA 2DFEA 1ORKA 4PSXA 1I3QJ 3FIWA 3HOZJ 4QTRA 2X6XA 3J7ZI 2P8TA 1XCVA 1P92A 2G0EA 3AKZA 4IHXA 3J7AY 3HZJA 3DEWA 3SFZA 2IGKA 1MKMA 1YS7A 1N77A 2DQRA 5E8GA 2RQQA 2A6EF 3F8BA 1YRNB 2O0YA 1JGGA 2XASA 5J8FA 2HQRA 2ZFUA 2IS1A 2R7VA 2IA2A 4BH9A 5D5UB 2R3SA 4X1EA 4UB8C 1APLC 2HZDA 4Y3OA 2L9VA 2KLOA 2W82A 4NDLA 3L2QA 4XLCA 1N75A 1OPCA 3CCSI 2P6SA 4OAZA 1X1AA 2HPMA 2HEOA 2ZJ2A 5D6FA 3AL0B 1MGTA 2OU2A 1SFEA 1MJ9A 2BYVE 2LR8A 3BTLA 1CF7A 4M6XA 1W0TA 3OYFA 1JI8A 3HM5A 1Z7LA 1SMYF 2CRGA 3I59A 1XSDA 1XDSA 2ZNZA 2VPRA 2ZO4A 1E3PA 4L9VA 5K5QA 2KP6A 1TNSA 3S16J 1FPQA 2QENA 4UUTA 1R7JA 2VB6A 3Q3SA 4A3DJ 3DPTA 1ZLJA 1IN5A 1FBSA 5IYCJ 1K6OA 3VDXA 1R23A 3GYHX 4G7OF 2DYSH 3DWLE 4ZC3A 3CLOA 4A0ZA 4L18B 1S6LA 5FKMA 5K7HA 1PVEA 3A0HC 2A6HF 4CZCA 1B9NA 1O3RA 1LFPA 1YFHA 5E8IA 1AKHB 1W7PD 1ZK8A 1OQYA 1O7FA 3PIOF 2H8RA 4FX0A 4EJVA 3O8HA 5J4YA 1EH6A 3HTUA 1NHAA 5LHHA 4KFCA 3FXUA 2KKOA 5E3OA 3EETA 3QYBA 3P9KA 3FM5A 3KPHA 2ADUA 3NARA 2PMZA 3QPLA 2WV1A 1T98A 3A4CA 2AO9A 5LGTA 2PMUA 5F08A 3IH2A 3GZNB 4DJAA 3HL2A 1TQPA 2DU9A 2WAEA 4KT6A 2BXZA 2EV6A 2X1EA 4BQNA 4ZYDA 2QKLB 2IA0A 2FQ3A 2F5EA 1GVJA 3C7JA 1RZ4A 3SDGA 3WU0A 2M45A 3QYFA 2PI0A 5D8KB 2L9RA 1FWZA 2Z99A 4IJAA 3GTMJ 5J47A 2M9HA 4JBAA 2XB0X 3SZTA 1LFUP 2M87A 3S2DJ 3JRCA 4MIMA 2V1XA 1H0MA 4DBQA 2XV4S 1W7PA 4MFDA 4BGDA 2Y75A 3WGGA 1MH4A 3J80Z 2WY8Q 5LGNA 5FLXK 3FK6A 1OISA 1RI7A 3EYYA 5KHDA 2CGPA 4KIFA 3IH4A 4P1WA 2W1OA 1QQIA 4BHBA 2DLLA 1Z3YA 4U0YA 2GBYA 3KE2A 1ETXA 1HKSA 1I39A 4IO9F 5BPDA 2WAQN 1FYMA 1X1CA 5JFRA 1RKTA 5ICCA 4KYWA 2AXTC 2LLKA 1ZGAA 2AQFA 3K1MA 2E1MC 3WTYC 2JA6J 3BTJA 2R7RA 3QU3A 4F3QA 1YX3A 2WWYA 2OPTA 4BBRJ 5FFXA 3DXJF 3VYTB 2BEOA 3QWLA 4I7HA 4U7DA 2DA5A 1U5TC 2P0WA 3NQOA 4EM0B 2PLYA 4HF1A 3KLNA 5EG0B 1B1BA 3CC2I 1FYKA 3M1EA 3FXQA 4P96A 3B02A 3OOPA 5LHGA 3QP6A 2RKHA 3H36A 2HI3A 3KP7A 3CCEI 1K4SA 3CUOA 2I10A 3PM1A 4PFOA 4L0ZB 2VOOA 1BL0A 3OV8A 4HX7A 1Y8RB 2KZVA 1T8IA 1A5JA 3O8GA 3GFJA 4PJMA 4Z6YA 3PJRA 3D1NI 2PJRA 2E1MB 4BY7J 3VYUB 2B63J 2OCEA 1TWAJ 2ECCA 1JE8A 4AVZA 2IS4A 5EZGA 1VNDA 3MWMA 2QZ8A 2LY9A 1U5TB 3IHUA 4QPOA 5GAHJ 1F4KA 3E5UA 2EWNA 2QGUA 4ESFA 3S2HJ 3EUKL 4LGWA 5HS9A 3RZOJ 4HNUA 1LDJA 3RSNA 1SVOA 1E2XA 1FLIA 5CJ9A 4A93J 4WX9A 3K0LA 2BXYA 2DAOA 5A2QZ 2LD5A 5CYVA 4LG0A 3RYRA 4IZZA 3FXKA 3LQQA 1JJ8C 3RDIA 3RPUD 3KX2A 2OBPA 1VQLI 3CCQI 2GXBA 3ZQCA 2HFHA 1LNWA 3JTGA 3OIOA 3ZRGA 4BE1A 1QVTA 3ZP5A 4W97A 1OCZH 2Z5UA 3T1BA 2VKDA 1P4XA 3S1NJ 2LRDA 2EFQA 3MN2A 3DKYA 2EFPA 2VUMJ 4Y7NJ 3NWSA 1WCMJ 1W0UA 2DMUA 3DU5A 1SVMA 3E97A 2XROA 1HBXG 3HGGA 1TC3C 1G2HA 1TP4A 2WC2A 1GVDA 2WADA 1VQMI 2L02A 3F9KA 4JYKA 2V4JC 2HXIA 3PFIA 3P5JA 4UNOA 4CGZA 2R92J 2BHZA 3H35A 1SFXA 4KDPA 5IT9Z 4UUSA 4G9YA 2IGMA 5FKNA 2M34A 3H0GJ 3NRVA 1MMNA 4D7NA 3RPUA 1RIOH 4ZYEA 5GPCA 3BG5A 4ITVA 3BDDA 4NC6A 4I09A 3JR9A 1WH7A 2EIKH 1WPKA 2ZCWA 1VQ8I 3VSLA 4B47A 3SZPA 2GXAA 2CUZA 2R5ZA 4EJWA 4HOBA 5F04A 2E5NA 2EA2A 2NAZA 3GUDA 2W57A 2ZXHA 2IS2A 4XICA 3FISA 3BCBA 3KP2A 3LNQA 4BJ6C 4P5OA 3Q5FA 3I9V2 3IRRA 1D8KA 2HGCA 2X9DA 1T56A 2TDXA 4RGUA 1UELB 4XMYA 3VB2A 2W4SA 2AHQA 5HODA 4OMYA 3TO9A 2DPDA 3EUHA 2NS7A 1XDUA 4A6EA 4M3GA 1JUMA 3J7AO 2L4AA 2VC1A 3H5AA 4R79A 1KZHA 2TCTA 1JXSA 4XRFA 4AC0A 2F5CA 4AU7A 2UXXA 2MFZA 2ZMEA 4DW6A 1BA5A 2E7WA 3KP5A 4IL6C 3V8JA 2KIFA 2DDAA 3TW6A 1KA8A 3W6JB 3ASOH 1LFBA 3ERED 1DGRM 3FF5A 4BXUA 4JQFA 2Y48A 4XR6A 1ETOA 2H6BA 4IPAA 1XGSA 1UMQA 3OL4A 5JR3A 1K61A 1IAWA 3HJEA 3GWZA 2O6GE 5HOOA 1JKPC 3MFKA 5F0HA 1OR7A 4LMYA 2G7HA 3OS0A 5DM7F 3OYGA 4XLHA 3H5NA 2FA5A 3K70C 3ML6A 5JLWA 4S05A 3H0DA 3AG1H 4F92B 3OR1C 3BROA 3TL4X 2FUG2 2RVCA 4WK8F 1PUEE 4AIKA 1EKEA 1XC5A 5KVRA 2VJIA 3GZ6A 3FXMA 2DDBA 1VQ5I 4Y13A 4FE4A 1RR8C 1YW9A 2M5WA 4WXCA 1O3SA 4A3GJ 4XQFA 4CXFA 4GCVA 1MSEC 3U2RA 5D6EA 2VBZA 5FB2A 2DTRA 1JT6A 1TZLA 2CFXA 4B4CA 3SEQA 3HOYJ 5DS9A 2P4WA 3QPHA 4CH7A 2MA3A 2MW8A 2IXSA 3GTQJ 5LD2C 1OLTA 2R4GA 3I59B 5EDNA 3ZQQA 2ELHA 2R7ZJ 2JMWA 3F8FA 2WAQA 3S2WA 2H09A 4A3LJ 1O57A 2KHMA 2VI6A 4TV7A 4BXFA 4ON0A 4LK1F 1XS9A 1HA8A 2H27A 3RKXA 2YUSA 5JVTA 4C30A 2LYCA 3ASNH 3MEXA 1ZAOA 1Q1VA 1UJ8A 3I55I 4MHGA 2ID3A 1KYWA 3I64A 4HNVA 4Q4ZF 3OYEA 2HKXA 5F27A 3KLOA 4IRGA 4UV9A 5LEKA 1G6NA 2GM4A 3HG9A 3N97A 1YE9A 2D2WA 2QQAA 4M9XA 3E6CC 1XGOA 5M3MJ 2PBIA 1BJAA 2OZ6A 3A01B 3PNYA 4XRSG 1X3ZB 5FKLA 5CVJA 2HQNA 1TL8A 4DZJA 2XPWA 3PL8A 1D5VA 1JKOC 5ICEA 3DBLB 3K1PA 3LSKA 3ZMSA 1BIBA 1BOAA 2BV6A 2HOAA 1XSVA 1FX7A 2DFIA 3Q0UA 3S1RJ 1NG7A 2GWRA 2L7KA 3C18A 1IV6A 2F5DA 1W36C 3X2QH 4MTEA 1LPQA 1SFUA 1IW7F 4IQ4A 3D5RC 1BR1A 2DI3A 2IJLA 1YJWI 2L3DA 5GTHC 1ZYRF 4HX4A 2DA4A 1T0FC 4BHPA 4ZJZA 3S14J 1JTYA 3J81K 4PSWA 4XKCA 1PYVA 5K1YA 3CZ6A 4HAMA 2ICWG 1GV5A 3HTSB 2IW5A 1LDKB 3DU6A 4M72A 1OCCH 4ZZLA 4BQAA 1FYLA 4CSWA 1F5TA 2WTEA 3IRQA 3DEEA 2AQEA 3CJTB 2QSGX 3B73A 4M6VA 3S3NA 1N78A 3FWEA 1UCRA 1GT0C 1LE8B 3F21A 2LKSA 3IH3A 4GYIA 1P4AA 4DOZA 3W2VA 1U0JA 2XAGA 2KQRA 1WJCA 1XX5A 2OJED 3CCMI 2QF7A 4BDZA 2Z9OA 1J75A 2EBIA 2HR3A 3DF8A 5KAFC 1DU0A 2E19A 1Z1DA 1RRJA 1WJAA 1OJLA 4HW0A 1AHDP 2EA4A 3WTWC 2DPUA 1WGXA 1A6QA 2YSRA 2M8EA 2VQCA 1XD7A 1NTCA 3G73A 1MDMB 3EPZA 5E1XA 4QIWN 3TKYA 1KU2A 1P2FA 3OL3A 1KU3A 5E1WA 4LIVA 2CW8A 1LVKA 4A3KJ 4RB1A 4IEJA 1R1UA 4Y17A 1PUFA 3ABMH 2ELKA 3ZMZA 4KISA 1S5LC 1S7OA 2J5PA 2M0CA 4MEXF 2VIXA 4RB2C 2CW0F 3DLAA 1IV8A 2DA3A 2V26A 3K4LA 3OS1A 2E5ZA 1OYWA 1G8XA 4I02A 1WRJA 4FT8A 1DPUA 1UHSA 1R4MB 3ZQFA 1VQ9I 4BNCA 1G3YA 9ANTA 3LFUA 1FY7A 1Z7UA 1HW1A 3TW7A 4BBSJ 1FOXA 2BVMA 2XVCA 2OQGA 4XN3A 5L3EA 4V19K 1MBJA 2EPFA 3ECHA 3PUFA 4BJ5C 2J5OA 1VQKI 4G94A 2ZXWH 1OCOH 5F64A 4RGSA 2BW3A 2CU7A 1GXPA 1RUOA 3H9JA 2OUMA 3BJOA 5HS7A 3COAC 2QBYA 4D9JA 1Z05A 4HQEA 5FD6A 1YOVB 3RKWA 3FDYA 2CQNA 3HOSA 4XKVA 1N25A 3QP5A 2BBYA 4HEA2 1GXQA 5C4JJ 2M7BA 4XM3A 5FFZA 1VQPI 1V54H
chains in the Genus database with same CATH topology
2FD5A 3O8HA 5E3OA 1IDYA 3NARA 3QPLA 2WV1A 2X6OA 1H88C 3G1LA 1HDPA 5M5WJ 2AO9A 4L5EA 5F08A 5J1YA 3IH2A 2DMPA 4XIDA 5FLVA 1VI0A 2CJJA 5E3MA 1NK2P 2LTPA 2LFBA 3BR5A 1O4XA 2XSDC 4AUXA 5FKOA 3RKQA 3SDGA 3Q0VA 3HOWJ 3OSGA 1Y1WJ 3WHCA 2L9RA 4A3FJ 3S1QJ 3GTMJ 1F36A 2M9HA 2XB0X 1LFUP 2HOSA 3S2DJ 3B6CA 3JRCA 2O8KA 2P81A 4MIMA 3G1OA 5M5YJ 2CUFA 3BR2A 4MFDA 1HLVA 2O7OA 1MH4A 3BTCA 3FK6A 4W1UA 3ZOBA 5E3NA 3IH4A 1E3OC 1Y1VJ 1ETWA 1UG2A 2GBYA 5IYBJ 1ETXA 2WAQN 3MKLA 4A3MJ 3JRHA 3GTOJ 1RKTA 4FISA 2LLKA 3HKZN 3LOCA 5EGOA 5EG0A 3HOXJ 1D5YA 1HCRA 1AU7A 1HDDC 2JA6J 3BTJA 5F0CA 3BT9A 3HBLA 1JJ6C 5J1RA 5J3LA 2OPTA 2VKVA 4BBRJ 1MBFA 2DA7A 4V2GA 5IOYA 4LOCA 1I50J 2DA5A 2CQXA 2JWTA 1MBGA 4B3AA 5EGOB 5EG0B 5FKKA 3TEDA 3S1MJ 1X2MA 4S0HB 4B1RA 3LSPA 1K83J 4XK4A 2HI3A 3PM1A 2I10A 1B72A 2DA2A 1OCPA 1HF0A 1BL0A 2ECBA 2LVSA 2FX0A 5M3FJ 2MGQA 5GPAA 3Q0WA 5J1UA 5IP7J 3HOVJ 1A5JA 3O8GA 5EYRA 3D1NI 1H89C 4BY7J 2JA8J 2B63J 1B72B 3HB9A 1TWAJ 3C2BA 1QRYA 2ECCA 3HGYA 5EZGA 1GV2A 2L7FP 1TWCJ 5FJ8J 1VNDA 5F1JA 1X58A 1SANA 2LY9A 1NK3P 1JUSA 1U9OA 3A03A 3S2HJ 4JX4A 1ETVA 1FTTA 3RZOJ 1F43A 1X2NA 4A93J 2DTZA 1ZTRA 5BNGA 1IGNA 3FKIJ 2LD5A 1WI3A 1RKWA 2TRTA 1Z77A 1JJ8C 2FQ4A 1SFOJ 3ZQCA 2HYJA 4MLOA 2O9LA 2KT0A 3OIOA 4IHVA 1QVTA 1POGA 1ETKA 3BR6A 4W97A 3WHBA 3ZQGA 4GFBA 3S1NJ 3GTPJ 3K2AA 3MN2A 3VPRA 1FIPA 5JLXA 5M5XJ 3QPSA 1MBHA 3S17J 3HDDA 2VUMJ 3BR3A 4Y7NJ 3I4MJ 3B6AA 3JRFA 3K7AJ 1WCMJ 1W0UA 4AYBN 2DMUA 2CQQA 1FTZA 3HGGA 1TC3C 1G2HA 1GVDA 4EEFG 1R9TJ 3BR1A 4FCYA 4JYKA 3DCFA 4A3BJ 4G12A 1TWFJ 2HXIA 2XGCA 5C4XJ 1U78A 3H3VK 2R92J 3LSRA 2DMNA 3SJMA 3LSJA 2E1OA 4UUSA 2XGEA 4D7MA 2FJ1A 5FKNA 2M34A 3H0GJ 1ZR2A 5EF6A 1FJLA 4D7NA 5GPCA 3BG5A 3GTGJ 3TP3A 3E7LA 1JUPA 2K9QA 3JR9A 4BXXJ 1WH7A 4UUSB 4M3EA 1WPKA 2RAEA 4XRSA 2E2HJ 2L7ZA 2R5ZA 5F04A 5GP9A 4C3HJ 1RESA 2OF7A 3FISA 4XICA 4C2MJ 4DYRA 2ID6A 4IHYA 3ZQIA 3LNQA 1DU6A 4C3JJ 2HXOA 4DYQA 3SFIA 1OCTC 3L1PA 2X9DA 1T56A 2R5ZB 2YU9J 4C3IJ 2DJNA 3OSFA 2M2EA 3IV5A 2EH3A 1QVUA 2AHQA 5HODA 3JRBA 3BTIA 2E2JJ 2NVXJ 2NS7A 3BQZA 1QPIA 1A6IA 2R0QC 4M3GA 1JUMA 1ZR4A 2COBA 4BKXA 2L7MP 1BJZA 2MSYA 4FE7A 2IEKA 3A02A 3CQZJ 2JA5J 2TCTA 2PMZN 2QCOA 3CDLA 4AC0A 1ZQ3P 4DW6A 1BA5A 2R5YA 4J19A 4M3FA 3TW6A 3ZQHA 1ETQA 1LFBA 4JX6A 5F0FA 3UKGA 1JKRC 1ETOA 3JRAA 2NOGA 1UMQA 2Y2ZA 2R5YB 2GLOA 1K61A 2K9NA 2DMTA 1JKPC 1S7EA 4M3BA 5F0HA 3RQIA 4D5FA 5EEAA 3PO2J 5JLWA 1I6HJ 1CQTA 2IAIA 1ZGWA 1XC5A 4MFEA 3PO3J 1IG7A 3RZDJ 2ZB9A 1XG1A 2R93J 2DMQA 1FEXA 4FE4A 4A3CJ 2HOTA 4A3GJ 1VFCA 1VF9A 1ITYA 1MSEC 1MBKA 4RDUA 1JT6A 3BG9A 3M4OJ 4B4CA 3LSGA 4Y52J 3HOYJ 5DS9A 3ZQLA 2ME0A 3QQAA 4FTHA 2MW8A 4CYCA 3GTQJ 1B8IA 3JRGA 5EDNA 5IOZA 4A3EJ 2R7ZJ 2JMWA 1JT0A 1ETYA 1TWHJ 4I6ZA 2W48A 2Y9YA 2NS8A 4D5CA 1Z0XA 4A3LJ 3HOUJ 2WB1N 4QSHA 1H8AC 2K40A 2VI6A 4CYCB 4I76A 4BY1J 1B8IB 4X6AJ 1XS9A 2JK3A 2YUSA 2DN0A 3BG3A 5IPAA 2HDDA 2JA7J 3BQYA 4A3IJ 3BR0A 1Q1VA 1IJWC 2JJ7A 3A01A 2ID3A 4RBOA 3JREA 2Y9ZA 4HNVA 1GUUA 4XRMA 5F27A 3F0CA 2LP0A 2M8GX 1MNMC 3MVPA 2GM4A 3FK7A 2CUEA 1T33A 1MBEA 5M3MJ 2E2IJ 3A01B 1IRZA 4XRSG 2VKEA 5FKLA 5IP6A 4DZJA 3GTKJ 2XPWA 2NVYJ 3G1MA 2XPVA 5IYDJ 2D5VA 1JKOC 5K7FA 1P7IA 2X48A 3CMYA 5E3LA 5FLMJ 1ENHA 3S15J 2HOAA 3Q0UA 3S1RJ 3GBGA 1IV6A 2NVQJ 2XGDA 5C44J 1TWGJ 3TP0A 3HEFA 4A69C 1RETA 2XRLA 2Y30A 2MG4A 1MSFC 1WH5A 2HQ5A 1JKQC 1GDTA 1RR7A 2K9SA 2EZIA 4ABZA 2DA4A 2N8GA 1LE8A 3S14J 1JTYA 3I4NJ 2DA6A 2YS9A 2XB5A 3GTJJ 2KDZA 1GV5A 3GTLJ 1U9NA 2Y31A 2IBDA 2DA1A 1OFCX 2NVTJ 4M6VA 4MO7A 3W6VA 1YRNA 2EQRA 1GT0C 1ORKA 1LE8B 2LK2A 1I3QJ 4A3JJ 3FIWA 3HOZJ 4QTRA 3IH3A 5K7ZA 2G0EA 4IHXA 1JTXA 3DEWA 2H1KA 2L0KA 1HOMA 2EZLA 2QF7A 4DZPA 1BW5A 1ZKGA 1MH3A 1YRNB 2EZKA 1JGGA 2EBIA 1DU0A 2E19A 4JP0A 4X1EA 1APLC 1AHDP 1OJLA 2ME6A 1WGXA 3CCYA 4NDLA 2LKXA 1NTCA 4QIWN 4IHWA 4V2FA 4A3KJ 2EZHA 5DTDA 4IEJA 3M3YJ 4M3DA 3OOUA 1PUFA 2LR8A 2ELKA 3BTLA 2M0CA 1W0TA 1IDZA 3HM5A 5IP9J 4JX5A 2CRGA 2DA3A 4DYCA 1UHSA 2VPRA 3ZQFA 1PUFB 9ANTA 3S16J 3TW7A 4BBSJ 2XPUA 4UUTA 1MBJA 3Q3SA 1IC8A 4A3DJ 5IYCJ 1P7JA 2CU7A 1AKHA 1FIAA 1RPWA 3NAUA 5FKMA 5K7HA 3JRDA 3JRIA 1EF4A 1BW6A 5EZHA 1IUFA 1AKHB 2Y0SN 1ZK8A 5C3EJ 5C4JJ 2H8RA 1U8BA 2JN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD5 A;  3O8H A;  5E3O A;  1IDY A;  3NAR A;  3QPL A;  2WV1 A;  2X6O A;  1H88 C;  3G1L A;  1HDP A;  5M5W J;  2AO9 A;  4L5E A;  5F08 A;  5J1Y A;  3IH2 A;  2DMP A;  4XID A;  5FLV A;  1VI0 A;  2CJJ A;  5E3M A;  1NK2 P;  2LTP A;  2LFB A;  3BR5 A;  1O4X A;  2XSD C;  4AUX A;  5FKO A;  3RKQ A;  3SDG A;  3Q0V A;  3HOW J;  3OSG A;  1Y1W J;  3WHC A;  2L9R A;  4A3F J;  3S1Q J;  3GTM J;  1F36 A;  2M9H A;  2XB0 X;  1LFU P;  2HOS A;  3S2D J;  3B6C A;  3JRC A;  2O8K A;  2P81 A;  4MIM A;  3G1O A;  5M5Y J;  2CUF A;  3BR2 A;  4MFD A;  1HLV A;  2O7O A;  1MH4 A;  3BTC A;  3FK6 A;  4W1U A;  3ZOB A;  5E3N A;  3IH4 A;  1E3O C;  1Y1V J;  1ETW A;  1UG2 A;  2GBY A;  5IYB J;  1ETX A;  2WAQ N;  3MKL A;  4A3M J;  3JRH A;  3GTO J;  1RKT A;  4FIS A;  2LLK A;  3HKZ N;  3LOC A;  5EGO A;  5EG0 A;  3HOX J;  1D5Y A;  1HCR A;  1AU7 A;  1HDD C;  2JA6 J;  3BTJ A;  5F0C A;  3BT9 A;  3HBL A;  1JJ6 C;  5J1R A;  5J3L A;  2OPT A;  2VKV A;  4BBR J;  1MBF A;  2DA7 A;  4V2G A;  5IOY A;  4LOC A;  1I50 J;  2DA5 A;  2CQX A;  2JWT A;  1MBG A;  4B3A A;  5EGO B;  5EG0 B;  5FKK A;  3TED A;  3S1M J;  1X2M A;  4S0H B;  4B1R A;  3LSP A;  1K83 J;  4XK4 A;  2HI3 A;  3PM1 A;  2I10 A;  1B72 A;  2DA2 A;  1OCP A;  1HF0 A;  1BL0 A;  2ECB A;  2LVS A;  2FX0 A;  5M3F J;  2MGQ A;  5GPA A;  3Q0W A;  5J1U A;  5IP7 J;  3HOV J;  1A5J A;  3O8G A;  5EYR A;  3D1N I;  1H89 C;  4BY7 J;  2JA8 J;  2B63 J;  1B72 B;  3HB9 A;  1TWA J;  3C2B A;  1QRY A;  2ECC A;  3HGY A;  5EZG A;  1GV2 A;  2L7F P;  1TWC J;  5FJ8 J;  1VND A;  5F1J A;  1X58 A;  1SAN A;  2LY9 A;  1NK3 P;  1JUS A;  1U9O A;  3A03 A;  3S2H J;  4JX4 A;  1ETV A;  1FTT A;  3RZO J;  1F43 A;  1X2N A;  4A93 J;  2DTZ A;  1ZTR A;  5BNG A;  1IGN A;  3FKI J;  2LD5 A;  1WI3 A;  1RKW A;  2TRT A;  1Z77 A;  1JJ8 C;  2FQ4 A;  1SFO J;  3ZQC A;  2HYJ A;  4MLO A;  2O9L A;  2KT0 A;  3OIO A;  4IHV A;  1QVT A;  1POG A;  1ETK A;  3BR6 A;  4W97 A;  3WHB A;  3ZQG A;  4GFB A;  3S1N J;  3GTP J;  3K2A A;  3MN2 A;  3VPR A;  1FIP A;  5JLX A;  5M5X J;  3QPS A;  1MBH A;  3S17 J;  3HDD A;  2VUM J;  3BR3 A;  4Y7N J;  3I4M J;  3B6A A;  3JRF A;  3K7A J;  1WCM J;  1W0U A;  4AYB N;  2DMU A;  2CQQ A;  1FTZ A;  3HGG A;  1TC3 C;  1G2H A;  1GVD A;  4EEF G;  1R9T J;  3BR1 A;  4FCY A;  4JYK A;  3DCF A;  4A3B J;  4G12 A;  1TWF J;  2HXI A;  2XGC A;  5C4X J;  1U78 A;  3H3V K;  2R92 J;  3LSR A;  2DMN A;  3SJM A;  3LSJ A;  2E1O A;  4UUS A;  2XGE A;  4D7M A;  2FJ1 A;  5FKN A;  2M34 A;  3H0G J;  1ZR2 A;  5EF6 A;  1FJL A;  4D7N A;  5GPC A;  3BG5 A;  3GTG J;  3TP3 A;  3E7L A;  1JUP A;  2K9Q A;  3JR9 A;  4BXX J;  1WH7 A;  4UUS B;  4M3E A;  1WPK A;  2RAE A;  4XRS A;  2E2H J;  2L7Z A;  2R5Z A;  5F04 A;  5GP9 A;  4C3H J;  1RES A;  2OF7 A;  3FIS A;  4XIC A;  4C2M J;  4DYR A;  2ID6 A;  4IHY A;  3ZQI A;  3LNQ A;  1DU6 A;  4C3J J;  2HXO A;  4DYQ A;  3SFI A;  1OCT C;  3L1P A;  2X9D A;  1T56 A;  2R5Z B;  2YU9 J;  4C3I J;  2DJN A;  3OSF A;  2M2E A;  3IV5 A;  2EH3 A;  1QVU A;  2AHQ A;  5HOD A;  3JRB A;  3BTI A;  2E2J J;  2NVX J;  2NS7 A;  3BQZ A;  1QPI A;  1A6I A;  2R0Q C;  4M3G A;  1JUM A;  1ZR4 A;  2COB A;  4BKX A;  2L7M P;  1BJZ A;  2MSY A;  4FE7 A;  2IEK A;  3A02 A;  3CQZ J;  2JA5 J;  2TCT A;  2PMZ N;  2QCO A;  3CDL A;  4AC0 A;  1ZQ3 P;  4DW6 A;  1BA5 A;  2R5Y A;  4J19 A;  4M3F A;  3TW6 A;  3ZQH A;  1ETQ A;  1LFB A;  4JX6 A;  5F0F A;  3UKG A;  1JKR C;  1ETO A;  3JRA A;  2NOG A;  1UMQ A;  2Y2Z A;  2R5Y B;  2GLO A;  1K61 A;  2K9N A;  2DMT A;  1JKP C;  1S7E A;  4M3B A;  5F0H A;  3RQI A;  4D5F A;  5EEA A;  3PO2 J;  5JLW A;  1I6H J;  1CQT A;  2IAI A;  1ZGW A;  1XC5 A;  4MFE A;  3PO3 J;  1IG7 A;  3RZD J;  2ZB9 A;  1XG1 A;  2R93 J;  2DMQ A;  1FEX A;  4FE4 A;  4A3C J;  2HOT A;  4A3G J;  1VFC A;  1VF9 A;  1ITY A;  1MSE C;  1MBK A;  4RDU A;  1JT6 A;  3BG9 A;  3M4O J;  4B4C A;  3LSG A;  4Y52 J;  3HOY J;  5DS9 A;  3ZQL A;  2ME0 A;  3QQA A;  4FTH A;  2MW8 A;  4CYC A;  3GTQ J;  1B8I A;  3JRG A;  5EDN A;  5IOZ A;  4A3E J;  2R7Z J;  2JMW A;  1JT0 A;  1ETY A;  1TWH J;  4I6Z A;  2W48 A;  2Y9Y A;  2NS8 A;  4D5C A;  1Z0X A;  4A3L J;  3HOU J;  2WB1 N;  4QSH A;  1H8A C;  2K40 A;  2VI6 A;  4CYC B;  4I76 A;  4BY1 J;  1B8I B;  4X6A J;  1XS9 A;  2JK3 A;  2YUS A;  2DN0 A;  3BG3 A;  5IPA A;  2HDD A;  2JA7 J;  3BQY A;  4A3I J;  3BR0 A;  1Q1V A;  1IJW C;  2JJ7 A;  3A01 A;  2ID3 A;  4RBO A;  3JRE A;  2Y9Z A;  4HNV A;  1GUU A;  4XRM A;  5F27 A;  3F0C A;  2LP0 A;  2M8G X;  1MNM C;  3MVP A;  2GM4 A;  3FK7 A;  2CUE A;  1T33 A;  1MBE A;  5M3M J;  2E2I J;  3A01 B;  1IRZ A;  4XRS G;  2VKE A;  5FKL A;  5IP6 A;  4DZJ A;  3GTK J;  2XPW A;  2NVY J;  3G1M A;  2XPV A;  5IYD J;  2D5V A;  1JKO C;  5K7F A;  1P7I A;  2X48 A;  3CMY A;  5E3L A;  5FLM J;  1ENH A;  3S15 J;  2HOA A;  3Q0U A;  3S1R J;  3GBG A;  1IV6 A;  2NVQ J;  2XGD A;  5C44 J;  1TWG J;  3TP0 A;  3HEF A;  4A69 C;  1RET A;  2XRL A;  2Y30 A;  2MG4 A;  1MSF C;  1WH5 A;  2HQ5 A;  1JKQ C;  1GDT A;  1RR7 A;  2K9S A;  2EZI A;  4ABZ A;  2DA4 A;  2N8G A;  1LE8 A;  3S14 J;  1JTY A;  3I4N J;  2DA6 A;  2YS9 A;  2XB5 A;  3GTJ J;  2KDZ A;  1GV5 A;  3GTL J;  1U9N A;  2Y31 A;  2IBD A;  2DA1 A;  1OFC X;  2NVT J;  4M6V A;  4MO7 A;  3W6V A;  1YRN A;  2EQR A;  1GT0 C;  1ORK A;  1LE8 B;  2LK2 A;  1I3Q J;  4A3J J;  3FIW A;  3HOZ J;  4QTR A;  3IH3 A;  5K7Z A;  2G0E A;  4IHX A;  1JTX A;  3DEW A;  2H1K A;  2L0K A;  1HOM A;  2EZL A;  2QF7 A;  4DZP A;  1BW5 A;  1ZKG A;  1MH3 A;  1YRN B;  2EZK A;  1JGG A;  2EBI A;  1DU0 A;  2E19 A;  4JP0 A;  4X1E A;  1APL C;  1AHD P;  1OJL A;  2ME6 A;  1WGX A;  3CCY A;  4NDL A;  2LKX A;  1NTC A;  4QIW N;  4IHW A;  4V2F A;  4A3K J;  2EZH A;  5DTD A;  4IEJ A;  3M3Y J;  4M3D A;  3OOU A;  1PUF A;  2LR8 A;  2ELK A;  3BTL A;  2M0C A;  1W0T A;  1IDZ A;  3HM5 A;  5IP9 J;  4JX5 A;  2CRG A;  2DA3 A;  4DYC A;  1UHS A;  2VPR A;  3ZQF A;  1PUF B;  9ANT A;  3S16 J;  3TW7 A;  4BBS J;  2XPU A;  4UUT A;  1MBJ A;  3Q3S A;  1IC8 A;  4A3D J;  5IYC J;  1P7J A;  2CU7 A;  1AKH A;  1FIA A;  1RPW A;  3NAU A;  5FKM A;  5K7H A;  3JRD A;  3JRI A;  1EF4 A;  1BW6 A;  5EZH A;  1IUF A;  1AKH B;  2Y0S N;  1ZK8 A;  5C3E J;  5C4J J;  2H8R A;  1U8B A;  2JN6 A; 
#chains in the Genus database with same CATH topology
 3KEO A;  4U7B A;  2H8W A;  2LF8 A;  2VXD A;  2QUF A;  1LEA A;  3ZMD A;  4ZDP A;  1KQ8 A;  1H88 C;  2ZXJ A;  2IGN A;  4D1Q A;  1D1A A;  2DOA A;  3TBI A;  1HDP A;  3RIR A;  5M5W J;  4XLF A;  3H92 A;  3LA2 A;  3M07 A;  3P9I A;  2GQQ A;  2CJJ A;  3DP7 A;  1DQU A;  4LJZ F;  1NK2 P;  1LUJ B;  2F4I A;  2NVU B;  4PK4 A;  3BR5 A;  2L5Q A;  1O4X A;  4LB5 A;  2JSC A;  3NWT A;  2CV2 A;  4AUX A;  1LJ9 A;  1X1B A;  2PEX A;  3HOW J;  3OSG A;  1Y1W J;  1ON1 A;  3FHZ A;  1LVA A;  2M30 A;  3ABL H;  1XPX A;  3BG7 A;  3H3Z A;  3O2P E;  1TLH B;  3B6C A;  3KIO A;  3G1O A;  3MZH A;  2CUF A;  1BOB A;  2VC0 A;  2O7O A;  1A04 A;  5D5V B;  4BAC A;  3CTA A;  4HST A;  2DYR H;  4HA8 A;  2R7U A;  5CQG A;  2CV1 A;  2QQ8 A;  2ZKZ A;  5E3N A;  4KIB A;  1BBY A;  2HVQ A;  1R00 A;  3REO A;  4N4N B;  1E3O C;  3G71 I;  3JCU C;  1Z21 A;  2MAB A;  2WV0 A;  5K5O A;  3CDI A;  3WTS C;  4PJ0 C;  1D0X A;  4NUB A;  3T8R A;  4FIS A;  3UNG C;  2FEZ A;  4CCN A;  3LOC A;  1YW8 A;  5J40 A;  4BQO A;  1JJ6 C;  4MEY F;  5J1R A;  3A1Y A;  2VKV A;  1BN5 A;  3DKX A;  1MBF A;  1USS A;  2DK8 A;  2OV7 A;  4RLQ A;  2Z3Y A;  4J00 A;  3U1K A;  2LRE A;  3Q9V A;  3MKY B;  2FBK A;  2JWT A;  1YJN I;  2UV1 A;  1QNT A;  5EGO B;  5CVU A;  2DW4 A;  1S29 A;  1KU9 A;  2BY0 A;  4PJJ A;  1K83 J;  4XK4 A;  4HZF A;  2A3S A;  1DP3 A;  2MH2 A;  3FBI B;  2FML A;  2E1C A;  2JPC A;  2FX0 A;  5M3F J;  3ULQ B;  2LH9 A;  5J1U A;  1J2X A;  2KDO A;  2BY1 A;  2GA2 A;  4II2 A;  2ZME B;  1PP7 U;  3OYJ A;  2VJ5 A;  4FX4 A;  5DM6 F;  2JA8 J;  2X4H A;  1B72 B;  2F2E A;  3OYH A;  2MLG A;  2O5R A;  4E7H A;  4AID A;  5FGM A;  1GV2 A;  2JVG A;  2GIZ A;  1SAN A;  2QEX I;  2WAF A;  3GLX A;  1K4T A;  3HSR A;  1JUS A;  2KFD A;  2P7V B;  1SAX A;  1T38 A;  4E7J A;  3V7C A;  3QPT A;  1SD6 A;  2GIV A;  4BYY A;  1F43 A;  3ZCO A;  5CKT A;  3WU2 C;  2LNB A;  1H9G A;  5BNG A;  1VZ0 A;  1IGN A;  2KRF A;  2TRT A;  3C2G A;  4IXA A;  3L2R A;  4YIF A;  3MCZ A;  1SFO J;  2HU9 A;  1MIJ A;  2PJP A;  2O9L A;  3TDU C;  4CCJ A;  4E7I A;  4IHV A;  1QBJ A;  2XF7 A;  5E18 F;  4KN7 X;  1GHC A;  4N9I A;  4PUS A;  2B9S A;  1IUY A;  5JLX A;  3QPS A;  4OIQ F;  3S3M A;  2EFN A;  5DCM A;  2BZT A;  5E20 A;  3RYP A;  2CUJ A;  2VJ4 A;  3I4M J;  3K7A J;  4XNF A;  4LIT A;  4XLA A;  4AYB N;  2M7A A;  5LHI A;  3DTK A;  2BVL A;  3OYN A;  3SEZ A;  2F4O B;  2NNN A;  1ZRE A;  5AIP A;  3PNV A;  4L0Y B;  1MMS A;  2EB7 A;  3W2W A;  1HXD A;  4A3B J;  3LA3 A;  4G7H F;  3WGH A;  4BL0 B;  5A2Q K;  5C4X J;  1U78 A;  3H3V K;  2VL8 A;  3LSR A;  3H9Q A;  2DMN A;  2A6T A;  1DGW Y;  3JTH A;  3F8N A;  4YRV A;  3SJM A;  3VFZ A;  2XGE A;  4IRH A;  1W5T A;  3AAF A;  3M1C A;  1I27 A;  5DCF A;  3SQN A;  1IO2 A;  1R1T A;  2F48 A;  2K9Q A;  5J8C A;  4BXX J;  4M3E A;  2QKM B;  4DBR A;  4OIR F;  4IX7 A;  1IN8 A;  5D4S A;  2E2H J;  5B66 C;  2W24 A;  1WJF A;  3DBR B;  3LQR A;  3CJR B;  3QU6 A;  2EIM H;  3DEU A;  4C3H J;  2X1D A;  1RES A;  3CO6 C;  4DYR A;  2ID6 A;  1MMA A;  2K86 A;  3ZQI A;  1DU6 A;  3ZGK A;  4C3J J;  2RNJ A;  2HXO A;  2Q1Z B;  3SHF A;  4DYQ A;  2Z16 A;  1A31 A;  3CC7 I;  3JSO A;  2E7X A;  5GAD J;  2Q2E A;  2OQR A;  2YU9 J;  2DJN A;  4HYE A;  3V8L A;  3OSF A;  4P9F A;  2E36 A;  1LB2 A;  3WTT C;  2BOL A;  3HUG A;  3H9G A;  3KEQ A;  3GVA A;  2E2J J;  2NVX J;  2JT1 A;  4XLN F;  3WE3 A;  1W1W E;  4GYG A;  2GXG A;  1XMA A;  3BQZ A;  5DEQ A;  3JAM K;  1LEB A;  1MJB A;  1XMK A;  1Y6I A;  3QAH A;  3OYC A;  4C2T A;  3CQZ J;  2IEK A;  4FE7 A;  1Y8Q B;  3K4M A;  1T39 A;  2ESN A;  2FBI A;  1IN6 A;  5HVQ C;  3CDL A;  1MMD A;  4IQJ A;  3CC4 I;  1ZQ3 P;  1V5F A;  4GGG A;  2K85 A;  5BS6 A;  4EAT A;  4KN4 X;  2A5W A;  3TDZ C;  3KP6 A;  3RJP A;  2NYX A;  4JX6 A;  4BQQ A;  3CME I;  4DNC A;  1BC7 C;  2O03 A;  3C1D A;  4YG2 F;  3N4M A;  3V42 A;  5KAI C;  2JQ7 A;  2QM3 A;  2IT0 A;  2R5Y B;  3RCO A;  3TMO A;  2GA1 A;  2DMT A;  3VYR B;  2M1B A;  3CLQ A;  3RQI A;  1RC9 A;  2CWE A;  3IKT A;  3PO2 J;  2GOM A;  1I6H J;  1R36 A;  3OMY A;  3W6K B;  4BEH A;  2AS5 F;  4Z2Y A;  3HSE A;  1U6G A;  2KIQ A;  3ABK H;  3BJA A;  3GFL A;  1I5Z A;  2X6Y A;  1XG1 A;  2HYG D;  3ABT A;  2DMQ A;  4UHT A;  4YEJ A;  4B48 A;  1IXC A;  1FEX A;  4A3C J;  1MMG A;  3CCU I;  1VQ4 I;  1BR2 A;  4MQ9 F;  1BI2 A;  4LK0 F;  3OYL A;  1ZRF A;  3M4O J;  3LSG A;  1UG0 A;  3HHG A;  3L00 A;  3ZQL A;  4O6J A;  1K78 B;  2DCE A;  3PFY A;  1YTY A;  4CYC A;  2BGC A;  5AIQ A;  1B8I A;  2X51 A;  2XSJ C;  2EIL H;  2L9N A;  3PSI A;  2MD0 A;  1JT0 A;  1ETY A;  1EA3 A;  1TWH J;  2XKO A;  4LLG F;  2W48 A;  2Y9Y A;  5FD5 A;  1VQ6 I;  1L0O C;  1Z0X A;  2VXZ A;  4QSH A;  1D3Y A;  2V9P A;  2LBF A;  4M9S A;  1R5H A;  4HF0 A;  4EQQ A;  4AVP A;  4ESB A;  2ZXI A;  5L3D A;  4B09 A;  1BI3 A;  1B4A A;  1MNE A;  5IPA A;  4HV6 A;  3I71 A;  3CUQ A;  2JJ7 A;  1AOY A;  2A68 F;  3RTR A;  2RRE A;  3JRE A;  4CHU A;  3ONQ A;  4XRM A;  1WZ2 A;  2LP0 A;  1FOK A;  2M8G X;  3WG7 H;  1MNM C;  4L9J A;  5E79 C;  2IPQ X;  3D0S A;  2F5V A;  5FLX Z;  2IRF G;  2CUE A;  4JOM A;  3FXJ A;  1T33 A;  5DYM A;  3S3O A;  3H1C A;  1T2K A;  2VKE A;  2Z2S B;  1FSH A;  4XLP F;  5KK1 A;  5IYD J;  2D5V A;  2KRH A;  5CVR A;  5K7F A;  1P7I A;  2NNY A;  2M4K A;  4NC7 A;  1TTY A;  5E3L A;  2DXI A;  3BG6 A;  4XOT A;  2QLZ A;  4NQW A;  1J5Y A;  4XLE A;  2F4M B;  3ZR8 X;  2NVQ J;  5C44 J;  3KP3 A;  1F1Z A;  4MTD A;  3HEF A;  5B3S H;  1MZB A;  5CVI A;  4A0Y A;  3BZ6 A;  1OMI A;  2Y30 A;  1V55 H;  2MG4 A;  3S93 A;  2P5L C;  1WH5 A;  3AG3 H;  3L2U A;  4ZYH A;  4ABZ A;  5JI6 A;  1ZLK A;  2N8G A;  4AIH A;  1VQN I;  4YII A;  4F7Z A;  2DA6 A;  3MZY A;  2YS9 A;  2KDZ A;  1ONV A;  3UR3 C;  4A6D A;  4N4O B;  2ZJQ F;  3WTZ A;  1SEU A;  4IRI A;  2DA1 A;  1OFC X;  2I8D A;  2KPM A;  2PN6 A;  1YRN A;  2EQR A;  1Y0U A;  4EJU A;  2LK2 A;  2YX4 A;  2RC4 A;  3TO6 A;  2GAU A;  1JTX A;  1W4M A;  3VOE A;  2EK5 A;  5KNL A;  3OWT A;  2K4J A;  2VLA A;  1HOM A;  2B7E A;  2EZL A;  2O3F A;  2FF4 A;  3U21 A;  3OR2 C;  1ACI A;  1CGP A;  1MH3 A;  1TBX A;  4YFN F;  1T95 A;  2A5Y B;  3ZMT A;  2WB1 A;  4Y33 A;  3HRM A;  4JP0 A;  3F23 A;  2XRN A;  4OU0 A;  2D1V A;  4AYB A;  3HC7 A;  3PQK A;  4Y15 A;  2PX9 A;  2VT2 A;  3TO7 A;  2LKX A;  1OYI A;  4IHW A;  1WVR A;  1HQC A;  2CFO A;  1KON A;  2EZH A;  3I0T A;  1Z3X A;  5DTD A;  3IUO A;  5ICF A;  3CO7 C;  4LLN A;  2PFB A;  3C2H A;  1WWX A;  4M3D A;  3BJ6 A;  3KP4 A;  4LD5 A;  3ISP A;  4RAG A;  1IDZ A;  3A0B C;  3VEP A;  1J09 A;  1HKT A;  4GXO A;  1ZRC A;  4NB5 A;  1CF7 B;  3DPU A;  4BAY A;  1C0W A;  3I53 A;  2FU4 A;  2XPU A;  4WCG A;  2BE5 F;  1IC8 A;  3FX3 A;  4XOP A;  3FKJ A;  3D5L A;  1AKH A;  3M8F A;  1FIA A;  4K2E A;  2L54 A;  2JRM A;  3FXL A;  3TOA A;  3K9T A;  1ZH5 A;  5L3B A;  2XC7 A;  5JVG F;  2XDV A;  3BCA A;  4MGR A;  4YFK F;  3JRD A;  4KMU X;  1BW6 A;  3DFG A;  5C3E J;  1NG6 A;  3QOD A;  1U8B A;  2DJI A;  2JN6 A;  2A05 A;  2V1U A;  2FD5 A;  4EJO A;  1D0Z A;  3BZK A;  1OYY A;  2G9W A;  1TQM A;  3RI4 A;  1HW5 A;  1U2W A;  2VJJ A;  3KYD B;  2BHY A;  2K9L A;  1BR4 A;  2HZT A;  3CF2 A;  3F72 A;  3V7S A;  2EV5 A;  1U3E M;  3LFK A;  3WG9 A;  4N0B A;  2RV8 A;  4LIU A;  5HNF A;  1J59 A;  2HQA A;  1VI0 A;  4HBL A;  3T8T A;  1FMW A;  3OYB A;  2LTP A;  1WKM A;  2XAQ A;  4OIP F;  5CPR B;  3RKQ A;  3BZC A;  2VBX A;  3WHC A;  5LRR A;  2C6Y A;  2MC3 A;  3TOB A;  3O6B B;  2XF6 A;  5HNH A;  2O8K A;  4XL9 A;  2P81 A;  4RM3 A;  4HNT A;  3BR2 A;  2HKO A;  1HLV A;  4CA0 A;  2QA4 I;  3WTV C;  3I54 A;  3BTC A;  3AFH A;  2K3P A;  1REP C;  2VE9 A;  2UWM A;  3F6V A;  4W1U A;  3GW2 A;  4KA4 A;  3ZOB A;  4IVN A;  3I4P A;  1Y1V J;  1ETW A;  4PDK A;  1UG2 A;  1NH3 A;  1D1C A;  1ULY A;  1W7P B;  5IYB J;  1DUX C;  3G4S I;  3MKL A;  1Y39 A;  5BMZ A;  5GTI C;  3GTO J;  5E17 F;  3ECO A;  4IOC F;  1JHH A;  2A69 F;  3K10 A;  1MD0 A;  2F6C A;  3GZ5 A;  5EG0 A;  3OYM A;  1D5Y A;  1HCR A;  1X1D A;  1AU7 A;  1HST A;  3HYI A;  3S8P A;  3KZI C;  3BT9 A;  5DUI A;  3HBL A;  4OAY A;  2DK5 A;  3I58 A;  4FQG A;  5J3L A;  3DV8 A;  4A2U A;  3RQ4 A;  5IOY A;  1I50 J;  2R7D A;  2CQX A;  1O3T A;  1M1E B;  1MBG A;  4B3A A;  1EH8 A;  3F8M A;  5FKK A;  3BOQ A;  3BWG A;  3LSM A;  2D45 A;  2CS3 A;  5IT3 A;  4KUM A;  2E1N A;  3LSH A;  3F6O A;  4LG3 A;  4N9H A;  2Z1D A;  2DFH A;  2DA2 A;  2ECB A;  2LVS A;  2I5U A;  1YX5 A;  2OCC H;  3Q0W A;  3V4G A;  3VYS B;  4UB6 C;  5L3C A;  4HF2 A;  4BU2 A;  2K3F A;  2MYS A;  1JHF A;  3E0J B;  5EYR A;  1U5T A;  2V9V A;  3H3U A;  2HTJ A;  3E6B A;  1F9N A;  4U0V A;  3C2B A;  2NS0 A;  2QQB A;  1SD5 A;  2JRT A;  3ERM A;  3HGY A;  1IXR C;  2KIM A;  2L7F P;  4KIC A;  3VSK A;  4B8X A;  4NNJ A;  4L5I A;  2PMH A;  4ENM A;  2RDP A;  2XGX A;  2Y69 H;  5L3G A;  2PJR B;  3A03 A;  1XN7 A;  4KT5 C;  3E6M A;  4JX4 A;  1ETV A;  3OS2 A;  1YQA A;  4E7Z A;  4HV5 A;  1X2N A;  1XCB A;  2R7F A;  5H6Q A;  2DTZ A;  2FNA A;  4XSZ F;  5ILS A;  3FKI J;  5TRD A;  1ERD A;  2H6C A;  2W25 A;  1Z77 A;  1K79 A;  1DP7 P;  1UFM A;  2FQ4 A;  5H2F C;  4H4K C;  5K5R A;  3ZN1 A;  2HYJ A;  1Z9C A;  2KT0 A;  4HSR A;  1R58 A;  3CJQ B;  1POG A;  1ETK A;  2IA1 A;  1ON2 A;  3BR6 A;  3ZQG A;  2HDW A;  4GFB A;  4LG0 B;  3HRS A;  5LEJ A;  4UVB A;  5EEG A;  2HYF A;  1V4R A;  2M4G A;  3HDD A;  5L3F A;  1J0R A;  2HS5 A;  3BR3 A;  3B6A A;  3JRF A;  3I3L A;  5FRN A;  5LGU A;  2EV0 A;  4AD9 A;  4NC8 A;  3IL2 A;  2V79 A;  2V6E A;  2M3A A;  1FTZ A;  2E60 A;  3BR1 A;  4FCY A;  2JZY A;  2R7T A;  2WBM A;  2P7C B;  4ZDO A;  4G12 A;  3M8J A;  1TWF J;  2EJR A;  1TT5 B;  1D0Y A;  2HVR A;  3ZN0 A;  1HKQ A;  4GDF A;  1AWC A;  3IP4 B;  3LSJ A;  5CVV A;  4D7M A;  1TQI A;  3ESW B;  3BY6 A;  2R7O A;  3J81 Z;  1WJD A;  2FJ1 A;  5EJC A;  3E5Q A;  1ZR2 A;  5CQE A;  1I1G A;  1FJL A;  5D8L B;  3TP3 A;  1SVL A;  3E7L A;  1JUP A;  4UUS B;  4E7L A;  4X0G A;  4ZZD A;  2L7Z A;  2D1H A;  2RQP A;  1YO5 C;  4FET A;  1XSX A;  2K4B A;  5HLG A;  3EUH C;  5GP9 A;  3L9F A;  4D0P A;  3JW4 A;  4PZJ A;  4I98 B;  2OF7 A;  4A5N A;  2WA0 A;  4QLC U;  1R4N B;  3SFI A;  1OCT C;  1P4W A;  2ZME C;  2R5Z B;  1S9H A;  4HDV A;  3I5U A;  2M2E A;  3IV5 A;  1TNT A;  2OC6 A;  3JRB A;  4CCL A;  3R60 A;  1A6I A;  3DLL F;  2RNG A;  1ZR4 A;  2COB A;  1G3W A;  4BKX A;  2L7M P;  3H5R A;  3J80 K;  2V7F A;  2MSY A;  4F55 A;  1H9T A;  2YU3 A;  3A02 A;  2JA5 J;  3FMS A;  1OR7 C;  3HPG A;  2KJC A;  1HSJ A;  5CLS A;  3K70 D;  4J19 A;  4M3F A;  1EH7 A;  2BY3 A;  4M73 A;  5H20 A;  1EV7 A;  4KIG A;  1YLF A;  4MNU A;  5F0F A;  2R7W A;  3CMM A;  2P5V A;  2P5K A;  3KZY A;  3OIQ A;  4ENN A;  1QA6 A;  2Y2Z A;  2CSO A;  2GLO A;  3U9G A;  4F91 B;  1T08 B;  1S7E A;  4M3B A;  4D5F A;  4M74 A;  1ZHF A;  2CV0 A;  1V5E A;  3RPQ A;  2V1D A;  2IAI A;  1ZGW A;  2W7N A;  1FOY A;  4MFE A;  2LMD A;  1IG7 A;  2CO5 A;  3V8K A;  2ZB9 A;  3RZD J;  4RGX A;  3DTI A;  4KNY A;  3IWF A;  2UXN A;  1ZG1 A;  1QPM A;  2X6W A;  5ILV A;  2ZBK A;  3LSI A;  2IS6 A;  1TT0 A;  3SZG A;  1MBK A;  4HLY A;  4PGH A;  1AA7 A;  4RDU A;  2QSF X;  4IF4 A;  3LL7 A;  2VPL A;  4B3X A;  1QHG A;  3BG9 A;  2DBB A;  4Y52 J;  5D4R A;  3GEZ A;  3IC7 A;  2ME0 A;  4G6D A;  1FP2 A;  1KQ0 A;  4PGG A;  2ESH A;  2EIN H;  3QQA A;  1BM9 A;  4O5V A;  1S8N A;  4DQ2 A;  3JRG A;  3MAJ A;  4E7S A;  5GAG J;  1MND A;  5AON A;  2Q8K A;  1Z6R A;  4QPQ A;  3J7Y J;  4CUG A;  2XIG A;  4E7K A;  2CW7 A;  4Q48 A;  3QRF F;  2WB1 N;  1V3F A;  2LF7 A;  4H0E A;  4I76 A;  4B44 A;  4X6A J;  4F93 B;  3L2C A;  2OD5 A;  1QO0 D;  5F6F A;  2A07 F;  2JK3 A;  4IHS A;  2DN0 A;  3BG3 A;  5IY5 H;  2HDD A;  3BQY A;  4A3I J;  3SYT A;  4XN0 A;  1IJW C;  3MQ0 A;  3A01 A;  4O3M A;  2IP2 A;  4RBO A;  2Y9Z A;  3IAM 2;  1STZ A;  1GUU A;  4OWR B;  3F0C A;  2V9K A;  1A36 A;  2XAH A;  2L9S A;  4ENK A;  2P6T A;  4Y4R A;  4Q5S F;  3FZV A;  2IVM A;  5TIS C;  3OIP A;  5B5E C;  1W36 D;  2WY7 Q;  2DT5 A;  1W5S A;  4LLL A;  2VQG A;  2E2I J;  1WJE A;  1IRZ A;  4ENJ A;  4A12 A;  2JUC A;  5IP6 A;  3R0J A;  2DOD A;  1QZZ A;  3G1M A;  1R49 A;  3R0A A;  4AIJ A;  3SDB A;  4U87 A;  1UB9 A;  3OY9 A;  1IRG A;  4CIC A;  3FXR A;  3CF5 F;  2COM A;  2MBF A;  2XF5 A;  3GLL A;  1ENH A;  4YEL A;  5B1A H;  1W5C C;  5EEH A;  1LQ1 A;  3TP0 A;  1RET A;  2XRL A;  5HDK A;  3IWZ A;  2VAS A;  1MSF C;  2K9M A;  2HQ5 A;  1JKQ C;  1GDT A;  1RR7 A;  3HIF A;  5IT9 K;  2EZI A;  2HNH A;  3T5X A;  1LE8 A;  1LDD A;  2VBY A;  1VTN C;  2QYO A;  3U1D A;  4XBF A;  4AWX B;  1ZG5 A;  2DQL A;  2XB5 A;  4ZTF A;  1B59 A;  3ZPL A;  3GTL J;  4L9T A;  1U9N A;  1KGS A;  1JGS A;  1FNN A;  2IBD A;  4XKB A;  2ZSH B;  3FMR A;  3F8C A;  3G3Z A;  2STT A;  1IRX A;  3BPX A;  1Z6T A;  3K4B A;  4E4H A;  1SC7 A;  3M7G A;  2ISZ A;  1FOW A;  4A3J J;  3G6E I;  5K7Z A;  1FC3 A;  2CMP A;  4J01 A;  2YR2 A;  1UZC A;  1T0F A;  4CYD A;  2H1K A;  1MDM A;  2L0K A;  3VWB A;  4DZP A;  1BW5 A;  2M0M A;  1ZKG A;  5J6X A;  2DO7 A;  4EM1 A;  2LY2 A;  2FBH A;  2EZK A;  4P55 A;  4M9Z A;  1X19 A;  3E1S A;  2O61 A;  3OYA A;  4CO8 A;  3LA7 A;  4M6Y A;  2ME6 A;  3CCY A;  3K2Z A;  3LAJ A;  4BE0 A;  1I1S A;  2E71 A;  5JHU A;  4R8H A;  1X3U A;  4V2F A;  3VOD A;  1G4D A;  1G3S A;  2R7Q A;  5F1R A;  4M71 A;  3M3Y J;  3OOU A;  3L7W A;  5DDG A;  4A0X A;  3GF2 A;  4NBQ A;  2ZSI B;  5IP9 J;  1QU3 A;  2JSP A;  3PUB A;  4JX5 A;  3FM3 A;  4I0A A;  4DGW B;  4DYC A;  2LOO A;  1UAA A;  4UV8 A;  1VQO I;  1FBU A;  1K6Y A;  2KIS A;  1PUF B;  1WQ2 A;  3RKY A;  2KL4 A;  2VON A;  2CH0 A;  2ZJR F;  1XGN A;  3PIP F;  4HX8 A;  1R1V A;  3HHH A;  4WXD A;  1P7J A;  5FRM A;  4RMN A;  6PAX A;  1SD7 A;  4AM3 A;  3BPV A;  3TQN A;  1RPW A;  2OTL I;  2A61 A;  3NAU A;  2QWW A;  4I2O A;  3K4J A;  3HRU A;  2ISY A;  3ZMU A;  1ZRD A;  5ICG A;  5ERI A;  4CCO A;  3JRI A;  1EF4 A;  2ACJ A;  2W00 A;  2BW3 B;  5EZH A;  3T0Y A;  1IUF A;  2Y0S N;  2X85 A;  1WI9 A;  1R22 A;  2DT7 B;  2QBY B;  5BQT A;  5BPI A;  1J7K A;  3F3X A;  1YHQ I;  2VBW A;  2K5C A;  3C3W A;  1J9I A;  3QOP A;  3KET A;  1IDY A;  2O8X A;  2FRH A;  3L09 A;  4PCQ A;  3FHN A;  2X6O A;  3GFM A;  2R7S A;  3G1L A;  4ASN A;  2YPR A;  5J1Y A;  4L5E A;  3N05 A;  2DMP A;  4XID A;  1Y0N A;  2HOE A;  2EFW A;  2K7L A;  2G7U A;  5FLV A;  3WGI A;  4XON A;  1S72 I;  2LY1 A;  3I56 I;  4RAZ A;  4JK1 X;  5E3M A;  3OYD A;  3DTE A;  5KCM A;  3HXL A;  2LFB A;  3HOT A;  4UUV A;  3WE2 A;  2XSD C;  1IZ1 A;  5FKO A;  3Q0V A;  4MQV A;  2EIJ H;  4L5J A;  2LKP A;  4KJZ A;  3HSF A;  4EVI A;  2ZNY A;  4A3F J;  3S1Q J;  3GX4 X;  1F36 A;  2K02 A;  3EQL F;  1WFX A;  4L9N A;  2HOS A;  5HLT A;  1Y56 A;  3K1N A;  1WSU A;  2MLK A;  5M5Y J;  3Q9S A;  2IGO A;  3JAM Z;  3L2W A;  1BI1 A;  1UST A;  3DQV C;  1IF1 A;  5HDN A;  3WU1 B;  4HG2 A;  5H6R A;  4OIN F;  4RA2 A;  5GAE J;  5JHF A;  4OMZ A;  1ZGJ A;  5HLH A;  1G3T A;  1YW7 A;  4A3M J;  3JRH A;  4UY8 I;  3GCM A;  2CQK A;  2XHK A;  1ZN2 A;  3CD6 I;  4R1H A;  4RB0 A;  3HKZ N;  5EGO A;  3HOX J;  4RAF A;  1HDD C;  4U88 A;  5F0C A;  4DIQ A;  4ZYA A;  3FXO A;  3M9A A;  4UVC A;  4E6K G;  1FZP B;  1R5I D;  4RLF A;  2DA7 A;  2Q0O A;  4V2G A;  4I01 A;  1L3L A;  4LOC A;  4EM2 A;  3CCL I;  2AXL A;  2FXA A;  5DD8 A;  4F52 A;  2FOK A;  3TED A;  3S1M J;  3QOE A;  1X2M A;  4S0H B;  3WTX C;  1YJ9 I;  1BI0 A;  2W85 A;  4B1R A;  3FBN B;  5ILU A;  2FSW A;  3LSP A;  5J4V A;  1PP8 F;  4C2U A;  1MJA A;  1B72 A;  3PNT A;  1OCP A;  3ZXS A;  3K4N A;  4ZH4 F;  5HS8 A;  1YI2 I;  1HF0 A;  2UZK A;  3CMA I;  2MGQ A;  5GPA A;  2QQ9 A;  2GOX B;  3MMY B;  2L01 A;  5IP7 J;  4ESJ A;  2VOD A;  3HOV J;  5ED4 A;  4G6Q A;  1H89 C;  4RAY A;  2VQH A;  2MH9 A;  3HB9 A;  1FMV A;  4U0W A;  3EYI A;  1QRY A;  5E1Z B;  1QZE A;  1WJB A;  2JUG A;  3PQJ A;  3KCC A;  1XGM A;  3CCR I;  1QZY A;  4OOI A;  3KYC B;  1TWC J;  5FJ8 J;  5F1J A;  1HC8 A;  1X58 A;  2VE8 A;  3LWF A;  4RM2 A;  1XTA A;  3LMM A;  3BLY A;  1NK3 P;  1U9O A;  4P9U A;  1UHW A;  4KIT B;  1FTT A;  1FT9 A;  2HPI A;  2JPB A;  2CG4 A;  2F5F A;  3EDP A;  3BP8 A;  1ZTR A;  2V6C A;  3G2B A;  3ZQ7 A;  3AG4 H;  4CZZ A;  3P9C A;  1WI3 A;  1RKW A;  1X1P A;  3L2V A;  3GXO A;  1X3W B;  4BS9 A;  2NOJ B;  1LKX A;  4MLO A;  4GO1 A;  1K7A A;  2JA2 A;  5FO5 A;  1BIA A;  1S3J A;  4HLX A;  3TGN A;  3WHB A;  1R71 A;  5BOX A;  1FBQ A;  4QWQ A;  1TW3 A;  3GTP J;  2UUZ A;  3K2A A;  2E34 A;  1FIP A;  3VPR A;  3GFI A;  1YG2 A;  5M5X J;  1MBH A;  3S17 J;  4YFX F;  3K4K A;  4IKF A;  1ZEL A;  3O3K A;  2MD5 A;  2OTJ I;  2CQQ A;  3GO5 A;  1EJ9 A;  4EGY A;  4EEF G;  1R9T J;  3CCV I;  3DCF A;  2H94 A;  1QGP A;  4II3 A;  2XGC A;  1VQ7 I;  5HDG A;  2LC2 A;  5DCM B;  3EUA A;  3IKV A;  2Y0M A;  4EMS A;  4UXN A;  1I3A A;  2E1O A;  1SAU A;  3DPL C;  4XKW A;  4RB3 C;  2VN2 A;  3GME A;  2LDU A;  3WTU C;  1FSE A;  5HLI A;  2Z33 A;  5EF6 A;  3HPH A;  1ZG3 A;  2X0L A;  1SFK A;  3KZZ A;  1SD4 A;  3GTG J;  4PJN A;  1G59 A;  1DDN A;  1P6R A;  2LG4 A;  2RAE A;  3CDH A;  3P7N A;  4A5M A;  5LLQ A;  4BE2 A;  4XRS A;  3CES A;  5TGT A;  1HW2 A;  1IXS B;  3W2A A;  3KEY A;  2FMY A;  4C2M J;  4OIO F;  4IHY A;  1BC8 C;  4I99 C;  3AG2 H;  3LST A;  2JVH A;  3L1P A;  3S32 A;  1PJR A;  4C3I J;  1I6X A;  4YIR X;  1YIJ I;  2EH3 A;  1O7L A;  1QVU A;  5LBQ A;  4C9Y A;  3BTI A;  3QYE A;  2STW A;  1QPI A;  2NRA C;  2ZC2 A;  2R0Q C;  2Q2E B;  1PDN C;  1BJZ A;  3SXY A;  3LAP A;  4EV0 A;  1U8R A;  1Q1H A;  1SMT A;  4BHC A;  2PMZ N;  3NEU A;  2QCO A;  5B1B H;  2ETH A;  2DFF A;  2Y0S A;  3HUG B;  2R5Y A;  1R5G A;  2CYY A;  3WOD F;  2VQL A;  4WWC A;  1E17 A;  4PJL A;  4LB6 B;  2CQ7 A;  3ZQH A;  4XOR A;  1X4O A;  1ETQ A;  4S04 A;  3K69 A;  4RS8 A;  1KQ9 A;  3CCJ I;  4ZYG A;  1YS6 A;  2ZFW A;  3CP8 A;  2EFO A;  3UKG A;  1JKR C;  3JRA A;  2NOG A;  1IRF A;  3W3C A;  2K9N A;  2LSO A;  2XAF A;  2HDC A;  5D5W B;  2FE3 A;  2KZG A;  4E70 A;  1OCR H;  1ZAR A;  2L4M A;  3E3V A;  5EEA A;  3HRT A;  1DPR A;  2PQ8 A;  2HWV A;  1T6S A;  5FRO A;  3CP2 A;  1CQT A;  2FOW A;  3FMQ A;  3PO3 J;  3E5X A;  3MZ8 A;  1V5G A;  1KU7 A;  2R93 J;  1RNL A;  4NHJ A;  1K78 A;  4KMF A;  2HOT A;  1S7A A;  2VT3 A;  3CJN A;  1YIO A;  1VFC A;  4Q47 A;  1VF9 A;  2GZW A;  2HTS A;  2OAZ A;  4HQM A;  4B43 A;  4BEH B;  1ITY A;  2XUB A;  1RUN A;  3OYK A;  4CCK A;  4EGZ A;  2OA4 A;  2ZJP F;  2XAU A;  3PSF A;  2HVS A;  2R7X A;  3R4K A;  2RN7 A;  4ETS A;  1D1B A;  3OYI A;  4HPQ A;  4HDU A;  4FTH A;  3CUQ C;  5D5X B;  4WF2 A;  2KMU A;  3MD2 A;  4BUP A;  1IN7 A;  5IOZ A;  4A3E J;  3V7R A;  4BJT A;  4I0B A;  4FHT A;  4I6Z A;  1QHH D;  5TJJ A;  4FAS D;  4PFP A;  2DOF A;  2JTV A;  3KYL A;  1O3Q A;  3E6D A;  4GRI A;  2NS8 A;  4D5C A;  1D8J A;  1UHM A;  3HOU J;  4UVA A;  1H8A C;  5LFA A;  2K40 A;  2DOE A;  4CYC B;  4BY1 J;  2L2O A;  3HKZ A;  1B8I B;  4IOA F;  1GLN A;  1E0E A;  3KFW X;  4CDG A;  1A35 A;  1XMX A;  3K4C A;  2OZU A;  4CCM A;  2JA7 J;  4IHT A;  2XAJ A;  2H1L A;  2VKH A;  3BR0 A;  1FP1 D;  2ELJ A;  2KJB A;  3D5S C;  2LBF B;  3K6G A;  2MC4 A;  2XKP A;  3MVP A;  2X1C A;  1R6R A;  3FK7 A;  4RGR A;  3F22 A;  1B9M A;  1MBE A;  3CUQ B;  4LFU A;  1MW7 A;  2KIU A;  5LRS A;  1YYV A;  2RGV A;  5DD4 A;  2KRC A;  3BC8 A;  1IN4 A;  1E3H A;  3GTK J;  2NVY J;  4ZTJ A;  2XPV A;  4G7Z F;  2X48 A;  4XSX F;  3A2K A;  1KYZ A;  1TW2 A;  3R6S A;  3CMY A;  4HRI A;  1YIT I;  5FLM J;  3ROU A;  5DUK A;  3S15 J;  2PG4 A;  3M8E A;  3MKW B;  4G8X A;  3GBG A;  2XGD A;  3R61 A;  1B6A A;  1TWG J;  1ODD A;  4G6T B;  4A69 C;  3DBH B;  2K27 A;  1Z67 A;  2FNP A;  5DV5 A;  3JSP A;  1XB4 A;  1OKR A;  2VOP A;  3ELK A;  1X4P A;  2QVO A;  3IAS 2;  2BY2 A;  2DT6 A;  3ABU A;  3DKW A;  2K9S A;  4NQW B;  2V1N A;  4WXH A;  4ANJ A;  4EJT A;  1WJ5 A;  3I4N J;  3MKZ A;  1Z91 A;  3ZMV A;  3GTJ J;  2NXN B;  2QSH X;  2Y31 A;  4BDY A;  3AL0 C;  4ZDL A;  2YX7 A;  2B0L A;  1P9Q C;  2NVT J;  2W84 A;  2E35 A;  4MO7 A;  1WHU A;  3W6V A;  2DFE A;  1ORK A;  4PSX A;  1I3Q J;  3FIW A;  3HOZ J;  4QTR A;  2X6X A;  3J7Z I;  2P8T A;  1XCV A;  1P92 A;  2G0E A;  3AKZ A;  4IHX A;  3J7A Y;  3HZJ A;  3DEW A;  3SFZ A;  2IGK A;  1MKM A;  1YS7 A;  1N77 A;  2DQR A;  5E8G A;  2RQQ A;  2A6E F;  3F8B A;  1YRN B;  2O0Y A;  1JGG A;  2XAS A;  5J8F A;  2HQR A;  2ZFU A;  2IS1 A;  2R7V A;  2IA2 A;  4BH9 A;  5D5U B;  2R3S A;  4X1E A;  4UB8 C;  1APL C;  2HZD A;  4Y3O A;  2L9V A;  2KLO A;  2W82 A;  4NDL A;  3L2Q A;  4XLC A;  1N75 A;  1OPC A;  3CCS I;  2P6S A;  4OAZ A;  1X1A A;  2HPM A;  2HEO A;  2ZJ2 A;  5D6F A;  3AL0 B;  1MGT A;  2OU2 A;  1SFE A;  1MJ9 A;  2BYV E;  2LR8 A;  3BTL A;  1CF7 A;  4M6X A;  1W0T A;  3OYF A;  1JI8 A;  3HM5 A;  1Z7L A;  1SMY F;  2CRG A;  3I59 A;  1XSD A;  1XDS A;  2ZNZ A;  2VPR A;  2ZO4 A;  1E3P A;  4L9V A;  5K5Q A;  2KP6 A;  1TNS A;  3S16 J;  1FPQ A;  2QEN A;  4UUT A;  1R7J A;  2VB6 A;  3Q3S A;  4A3D J;  3DPT A;  1ZLJ A;  1IN5 A;  1FBS A;  5IYC J;  1K6O A;  3VDX A;  1R23 A;  3GYH X;  4G7O F;  2DYS H;  3DWL E;  4ZC3 A;  3CLO A;  4A0Z A;  4L18 B;  1S6L A;  5FKM A;  5K7H A;  1PVE A;  3A0H C;  2A6H F;  4CZC A;  1B9N A;  1O3R A;  1LFP A;  1YFH A;  5E8I A;  1AKH B;  1W7P D;  1ZK8 A;  1OQY A;  1O7F A;  3PIO F;  2H8R A;  4FX0 A;  4EJV A;  3O8H A;  5J4Y A;  1EH6 A;  3HTU A;  1NHA A;  5LHH A;  4KFC A;  3FXU A;  2KKO A;  5E3O A;  3EET A;  3QYB A;  3P9K A;  3FM5 A;  3KPH A;  2ADU A;  3NAR A;  2PMZ A;  3QPL A;  2WV1 A;  1T98 A;  3A4C A;  2AO9 A;  5LGT A;  2PMU A;  5F08 A;  3IH2 A;  3GZN B;  4DJA A;  3HL2 A;  1TQP A;  2DU9 A;  2WAE A;  4KT6 A;  2BXZ A;  2EV6 A;  2X1E A;  4BQN A;  4ZYD A;  2QKL B;  2IA0 A;  2FQ3 A;  2F5E A;  1GVJ A;  3C7J A;  1RZ4 A;  3SDG A;  3WU0 A;  2M45 A;  3QYF A;  2PI0 A;  5D8K B;  2L9R A;  1FWZ A;  2Z99 A;  4IJA A;  3GTM J;  5J47 A;  2M9H A;  4JBA A;  2XB0 X;  3SZT A;  1LFU P;  2M87 A;  3S2D J;  3JRC A;  4MIM A;  2V1X A;  1H0M A;  4DBQ A;  2XV4 S;  1W7P A;  4MFD A;  4BGD A;  2Y75 A;  3WGG A;  1MH4 A;  3J80 Z;  2WY8 Q;  5LGN A;  5FLX K;  3FK6 A;  1OIS A;  1RI7 A;  3EYY A;  5KHD A;  2CGP A;  4KIF A;  3IH4 A;  4P1W A;  2W1O A;  1QQI A;  4BHB A;  2DLL A;  1Z3Y A;  4U0Y A;  2GBY A;  3KE2 A;  1ETX A;  1HKS A;  1I39 A;  4IO9 F;  5BPD A;  2WAQ N;  1FYM A;  1X1C A;  5JFR A;  1RKT A;  5ICC A;  4KYW A;  2AXT C;  2LLK A;  1ZGA A;  2AQF A;  3K1M A;  2E1M C;  3WTY C;  2JA6 J;  3BTJ A;  2R7R A;  3QU3 A;  4F3Q A;  1YX3 A;  2WWY A;  2OPT A;  4BBR J;  5FFX A;  3DXJ F;  3VYT B;  2BEO A;  3QWL A;  4I7H A;  4U7D A;  2DA5 A;  1U5T C;  2P0W A;  3NQO A;  4EM0 B;  2PLY A;  4HF1 A;  3KLN A;  5EG0 B;  1B1B A;  3CC2 I;  1FYK A;  3M1E A;  3FXQ A;  4P96 A;  3B02 A;  3OOP A;  5LHG A;  3QP6 A;  2RKH A;  3H36 A;  2HI3 A;  3KP7 A;  3CCE I;  1K4S A;  3CUO A;  2I10 A;  3PM1 A;  4PFO A;  4L0Z B;  2VOO A;  1BL0 A;  3OV8 A;  4HX7 A;  1Y8R B;  2KZV A;  1T8I A;  1A5J A;  3O8G A;  3GFJ A;  4PJM A;  4Z6Y A;  3PJR A;  3D1N I;  2PJR A;  2E1M B;  4BY7 J;  3VYU B;  2B63 J;  2OCE A;  1TWA J;  2ECC A;  1JE8 A;  4AVZ A;  2IS4 A;  5EZG A;  1VND A;  3MWM A;  2QZ8 A;  2LY9 A;  1U5T B;  3IHU A;  4QPO A;  5GAH J;  1F4K A;  3E5U A;  2EWN A;  2QGU A;  4ESF A;  3S2H J;  3EUK L;  4LGW A;  5HS9 A;  3RZO J;  4HNU A;  1LDJ A;  3RSN A;  1SVO A;  1E2X A;  1FLI A;  5CJ9 A;  4A93 J;  4WX9 A;  3K0L A;  2BXY A;  2DAO A;  5A2Q Z;  2LD5 A;  5CYV A;  4LG0 A;  3RYR A;  4IZZ A;  3FXK A;  3LQQ A;  1JJ8 C;  3RDI A;  3RPU D;  3KX2 A;  2OBP A;  1VQL I;  3CCQ I;  2GXB A;  3ZQC A;  2HFH A;  1LNW A;  3JTG A;  3OIO A;  3ZRG A;  4BE1 A;  1QVT A;  3ZP5 A;  4W97 A;  1OCZ H;  2Z5U A;  3T1B A;  2VKD A;  1P4X A;  3S1N J;  2LRD A;  2EFQ A;  3MN2 A;  3DKY A;  2EFP A;  2VUM J;  4Y7N J;  3NWS A;  1WCM J;  1W0U A;  2DMU A;  3DU5 A;  1SVM A;  3E97 A;  2XRO A;  1HBX G;  3HGG A;  1TC3 C;  1G2H A;  1TP4 A;  2WC2 A;  1GVD A;  2WAD A;  1VQM I;  2L02 A;  3F9K A;  4JYK A;  2V4J C;  2HXI A;  3PFI A;  3P5J A;  4UNO A;  4CGZ A;  2R92 J;  2BHZ A;  3H35 A;  1SFX A;  4KDP A;  5IT9 Z;  4UUS A;  4G9Y A;  2IGM A;  5FKN A;  2M34 A;  3H0G J;  3NRV A;  1MMN A;  4D7N A;  3RPU A;  1RIO H;  4ZYE A;  5GPC A;  3BG5 A;  4ITV A;  3BDD A;  4NC6 A;  4I09 A;  3JR9 A;  1WH7 A;  2EIK H;  1WPK A;  2ZCW A;  1VQ8 I;  3VSL A;  4B47 A;  3SZP A;  2GXA A;  2CUZ A;  2R5Z A;  4EJW A;  4HOB A;  5F04 A;  2E5N A;  2EA2 A;  2NAZ A;  3GUD A;  2W57 A;  2ZXH A;  2IS2 A;  4XIC A;  3FIS A;  3BCB A;  3KP2 A;  3LNQ A;  4BJ6 C;  4P5O A;  3Q5F A;  3I9V 2;  3IRR A;  1D8K A;  2HGC A;  2X9D A;  1T56 A;  2TDX A;  4RGU A;  1UEL B;  4XMY A;  3VB2 A;  2W4S A;  2AHQ A;  5HOD A;  4OMY A;  3TO9 A;  2DPD A;  3EUH A;  2NS7 A;  1XDU A;  4A6E A;  4M3G A;  1JUM A;  3J7A O;  2L4A A;  2VC1 A;  3H5A A;  4R79 A;  1KZH A;  2TCT A;  1JXS A;  4XRF A;  4AC0 A;  2F5C A;  4AU7 A;  2UXX A;  2MFZ A;  2ZME A;  4DW6 A;  1BA5 A;  2E7W A;  3KP5 A;  4IL6 C;  3V8J A;  2KIF A;  2DDA A;  3TW6 A;  1KA8 A;  3W6J B;  3ASO H;  1LFB A;  3ERE D;  1DGR M;  3FF5 A;  4BXU A;  4JQF A;  2Y48 A;  4XR6 A;  1ETO A;  2H6B A;  4IPA A;  1XGS A;  1UMQ A;  3OL4 A;  5JR3 A;  1K61 A;  1IAW A;  3HJE A;  3GWZ A;  2O6G E;  5HOO A;  1JKP C;  3MFK A;  5F0H A;  1OR7 A;  4LMY A;  2G7H A;  3OS0 A;  5DM7 F;  3OYG A;  4XLH A;  3H5N A;  2FA5 A;  3K70 C;  3ML6 A;  5JLW A;  4S05 A;  3H0D A;  3AG1 H;  4F92 B;  3OR1 C;  3BRO A;  3TL4 X;  2FUG 2;  2RVC A;  4WK8 F;  1PUE E;  4AIK A;  1EKE A;  1XC5 A;  5KVR A;  2VJI A;  3GZ6 A;  3FXM A;  2DDB A;  1VQ5 I;  4Y13 A;  4FE4 A;  1RR8 C;  1YW9 A;  2M5W A;  4WXC A;  1O3S A;  4A3G J;  4XQF A;  4CXF A;  4GCV A;  1MSE C;  3U2R A;  5D6E A;  2VBZ A;  5FB2 A;  2DTR A;  1JT6 A;  1TZL A;  2CFX A;  4B4C A;  3SEQ A;  3HOY J;  5DS9 A;  2P4W A;  3QPH A;  4CH7 A;  2MA3 A;  2MW8 A;  2IXS A;  3GTQ J;  5LD2 C;  1OLT A;  2R4G A;  3I59 B;  5EDN A;  3ZQQ A;  2ELH A;  2R7Z J;  2JMW A;  3F8F A;  2WAQ A;  3S2W A;  2H09 A;  4A3L J;  1O57 A;  2KHM A;  2VI6 A;  4TV7 A;  4BXF A;  4ON0 A;  4LK1 F;  1XS9 A;  1HA8 A;  2H27 A;  3RKX A;  2YUS A;  5JVT A;  4C30 A;  2LYC A;  3ASN H;  3MEX A;  1ZAO A;  1Q1V A;  1UJ8 A;  3I55 I;  4MHG A;  2ID3 A;  1KYW A;  3I64 A;  4HNV A;  4Q4Z F;  3OYE A;  2HKX A;  5F27 A;  3KLO A;  4IRG A;  4UV9 A;  5LEK A;  1G6N A;  2GM4 A;  3HG9 A;  3N97 A;  1YE9 A;  2D2W A;  2QQA A;  4M9X A;  3E6C C;  1XGO A;  5M3M J;  2PBI A;  1BJA A;  2OZ6 A;  3A01 B;  3PNY A;  4XRS G;  1X3Z B;  5FKL A;  5CVJ A;  2HQN A;  1TL8 A;  4DZJ A;  2XPW A;  3PL8 A;  1D5V A;  1JKO C;  5ICE A;  3DBL B;  3K1P A;  3LSK A;  3ZMS A;  1BIB A;  1BOA A;  2BV6 A;  2HOA A;  1XSV A;  1FX7 A;  2DFI A;  3Q0U A;  3S1R J;  1NG7 A;  2GWR A;  2L7K A;  3C18 A;  1IV6 A;  2F5D A;  1W36 C;  3X2Q H;  4MTE A;  1LPQ A;  1SFU A;  1IW7 F;  4IQ4 A;  3D5R C;  1BR1 A;  2DI3 A;  2IJL A;  1YJW I;  2L3D A;  5GTH C;  1ZYR F;  4HX4 A;  2DA4 A;  1T0F C;  4BHP A;  4ZJZ A;  3S14 J;  1JTY A;  3J81 K;  4PSW A;  4XKC A;  1PYV A;  5K1Y A;  3CZ6 A;  4HAM A;  2ICW G;  1GV5 A;  3HTS B;  2IW5 A;  1LDK B;  3DU6 A;  4M72 A;  1OCC H;  4ZZL A;  4BQA A;  1FYL A;  4CSW A;  1F5T A;  2WTE A;  3IRQ A;  3DEE A;  2AQE A;  3CJT B;  2QSG X;  3B73 A;  4M6V A;  3S3N A;  1N78 A;  3FWE A;  1UCR A;  1GT0 C;  1LE8 B;  3F21 A;  2LKS A;  3IH3 A;  4GYI A;  1P4A A;  4DOZ A;  3W2V A;  1U0J A;  2XAG A;  2KQR A;  1WJC A;  1XX5 A;  2OJE D;  3CCM I;  2QF7 A;  4BDZ A;  2Z9O A;  1J75 A;  2EBI A;  2HR3 A;  3DF8 A;  5KAF C;  1DU0 A;  2E19 A;  1Z1D A;  1RRJ A;  1WJA A;  1OJL A;  4HW0 A;  1AHD P;  2EA4 A;  3WTW C;  2DPU A;  1WGX A;  1A6Q A;  2YSR A;  2M8E A;  2VQC A;  1XD7 A;  1NTC A;  3G73 A;  1MDM B;  3EPZ A;  5E1X A;  4QIW N;  3TKY A;  1KU2 A;  1P2F A;  3OL3 A;  1KU3 A;  5E1W A;  4LIV A;  2CW8 A;  1LVK A;  4A3K J;  4RB1 A;  4IEJ A;  1R1U A;  4Y17 A;  1PUF A;  3ABM H;  2ELK A;  3ZMZ A;  4KIS A;  1S5L C;  1S7O A;  2J5P A;  2M0C A;  4MEX F;  2VIX A;  4RB2 C;  2CW0 F;  3DLA A;  1IV8 A;  2DA3 A;  2V26 A;  3K4L A;  3OS1 A;  2E5Z A;  1OYW A;  1G8X A;  4I02 A;  1WRJ A;  4FT8 A;  1DPU A;  1UHS A;  1R4M B;  3ZQF A;  1VQ9 I;  4BNC A;  1G3Y A;  9ANT A;  3LFU A;  1FY7 A;  1Z7U A;  1HW1 A;  3TW7 A;  4BBS J;  1FOX A;  2BVM A;  2XVC A;  2OQG A;  4XN3 A;  5L3E A;  4V19 K;  1MBJ A;  2EPF A;  3ECH A;  3PUF A;  4BJ5 C;  2J5O A;  1VQK I;  4G94 A;  2ZXW H;  1OCO H;  5F64 A;  4RGS A;  2BW3 A;  2CU7 A;  1GXP A;  1RUO A;  3H9J A;  2OUM A;  3BJO A;  5HS7 A;  3COA C;  2QBY A;  4D9J A;  1Z05 A;  4HQE A;  5FD6 A;  1YOV B;  3RKW A;  3FDY A;  2CQN A;  3HOS A;  4XKV A;  1N25 A;  3QP5 A;  2BBY A;  4HEA 2;  1GXQ A;  5C4J J;  2M7B A;  4XM3 A;  5FFZ A;  1VQP I;  1V54 H; 
#chains in the Genus database with same CATH homology
 2FD5 A;  3O8H A;  5E3O A;  1IDY A;  3NAR A;  3QPL A;  2WV1 A;  2X6O A;  1H88 C;  3G1L A;  1HDP A;  5M5W J;  2AO9 A;  4L5E A;  5F08 A;  5J1Y A;  3IH2 A;  2DMP A;  4XID A;  5FLV A;  1VI0 A;  2CJJ A;  5E3M A;  1NK2 P;  2LTP A;  2LFB A;  3BR5 A;  1O4X A;  2XSD C;  4AUX A;  5FKO A;  3RKQ A;  3SDG A;  3Q0V A;  3HOW J;  3OSG A;  1Y1W J;  3WHC A;  2L9R A;  4A3F J;  3S1Q J;  3GTM J;  1F36 A;  2M9H A;  2XB0 X;  1LFU P;  2HOS A;  3S2D J;  3B6C A;  3JRC A;  2O8K A;  2P81 A;  4MIM A;  3G1O A;  5M5Y J;  2CUF A;  3BR2 A;  4MFD A;  1HLV A;  2O7O A;  1MH4 A;  3BTC A;  3FK6 A;  4W1U A;  3ZOB A;  5E3N A;  3IH4 A;  1E3O C;  1Y1V J;  1ETW A;  1UG2 A;  2GBY A;  5IYB J;  1ETX A;  2WAQ N;  3MKL A;  4A3M J;  3JRH A;  3GTO J;  1RKT A;  4FIS A;  2LLK A;  3HKZ N;  3LOC A;  5EGO A;  5EG0 A;  3HOX J;  1D5Y A;  1HCR A;  1AU7 A;  1HDD C;  2JA6 J;  3BTJ A;  5F0C A;  3BT9 A;  3HBL A;  1JJ6 C;  5J1R A;  5J3L A;  2OPT A;  2VKV A;  4BBR J;  1MBF A;  2DA7 A;  4V2G A;  5IOY A;  4LOC A;  1I50 J;  2DA5 A;  2CQX A;  2JWT A;  1MBG A;  4B3A A;  5EGO B;  5EG0 B;  5FKK A;  3TED A;  3S1M J;  1X2M A;  4S0H B;  4B1R A;  3LSP A;  1K83 J;  4XK4 A;  2HI3 A;  3PM1 A;  2I10 A;  1B72 A;  2DA2 A;  1OCP A;  1HF0 A;  1BL0 A;  2ECB A;  2LVS A;  2FX0 A;  5M3F J;  2MGQ A;  5GPA A;  3Q0W A;  5J1U A;  5IP7 J;  3HOV J;  1A5J A;  3O8G A;  5EYR A;  3D1N I;  1H89 C;  4BY7 J;  2JA8 J;  2B63 J;  1B72 B;  3HB9 A;  1TWA J;  3C2B A;  1QRY A;  2ECC A;  3HGY A;  5EZG A;  1GV2 A;  2L7F P;  1TWC J;  5FJ8 J;  1VND A;  5F1J A;  1X58 A;  1SAN A;  2LY9 A;  1NK3 P;  1JUS A;  1U9O A;  3A03 A;  3S2H J;  4JX4 A;  1ETV A;  1FTT A;  3RZO J;  1F43 A;  1X2N A;  4A93 J;  2DTZ A;  1ZTR A;  5BNG A;  1IGN A;  3FKI J;  2LD5 A;  1WI3 A;  1RKW A;  2TRT A;  1Z77 A;  1JJ8 C;  2FQ4 A;  1SFO J;  3ZQC A;  2HYJ A;  4MLO A;  2O9L A;  2KT0 A;  3OIO A;  4IHV A;  1QVT A;  1POG A;  1ETK A;  3BR6 A;  4W97 A;  3WHB A;  3ZQG A;  4GFB A;  3S1N J;  3GTP J;  3K2A A;  3MN2 A;  3VPR A;  1FIP A;  5JLX A;  5M5X J;  3QPS A;  1MBH A;  3S17 J;  3HDD A;  2VUM J;  3BR3 A;  4Y7N J;  3I4M J;  3B6A A;  3JRF A;  3K7A J;  1WCM J;  1W0U A;  4AYB N;  2DMU A;  2CQQ A;  1FTZ A;  3HGG A;  1TC3 C;  1G2H A;  1GVD A;  4EEF G;  1R9T J;  3BR1 A;  4FCY A;  4JYK A;  3DCF A;  4A3B J;  4G12 A;  1TWF J;  2HXI A;  2XGC A;  5C4X J;  1U78 A;  3H3V K;  2R92 J;  3LSR A;  2DMN A;  3SJM A;  3LSJ A;  2E1O A;  4UUS A;  2XGE A;  4D7M A;  2FJ1 A;  5FKN A;  2M34 A;  3H0G J;  1ZR2 A;  5EF6 A;  1FJL A;  4D7N A;  5GPC A;  3BG5 A;  3GTG J;  3TP3 A;  3E7L A;  1JUP A;  2K9Q A;  3JR9 A;  4BXX J;  1WH7 A;  4UUS B;  4M3E A;  1WPK A;  2RAE A;  4XRS A;  2E2H J;  2L7Z A;  2R5Z A;  5F04 A;  5GP9 A;  4C3H J;  1RES A;  2OF7 A;  3FIS A;  4XIC A;  4C2M J;  4DYR A;  2ID6 A;  4IHY A;  3ZQI A;  3LNQ A;  1DU6 A;  4C3J J;  2HXO A;  4DYQ A;  3SFI A;  1OCT C;  3L1P A;  2X9D A;  1T56 A;  2R5Z B;  2YU9 J;  4C3I J;  2DJN A;  3OSF A;  2M2E A;  3IV5 A;  2EH3 A;  1QVU A;  2AHQ A;  5HOD A;  3JRB A;  3BTI A;  2E2J J;  2NVX J;  2NS7 A;  3BQZ A;  1QPI A;  1A6I A;  2R0Q C;  4M3G A;  1JUM A;  1ZR4 A;  2COB A;  4BKX A;  2L7M P;  1BJZ A;  2MSY A;  4FE7 A;  2IEK A;  3A02 A;  3CQZ J;  2JA5 J;  2TCT A;  2PMZ N;  2QCO A;  3CDL A;  4AC0 A;  1ZQ3 P;  4DW6 A;  1BA5 A;  2R5Y A;  4J19 A;  4M3F A;  3TW6 A;  3ZQH A;  1ETQ A;  1LFB A;  4JX6 A;  5F0F A;  3UKG A;  1JKR C;  1ETO A;  3JRA A;  2NOG A;  1UMQ A;  2Y2Z A;  2R5Y B;  2GLO A;  1K61 A;  2K9N A;  2DMT A;  1JKP C;  1S7E A;  4M3B A;  5F0H A;  3RQI A;  4D5F A;  5EEA A;  3PO2 J;  5JLW A;  1I6H J;  1CQT A;  2IAI A;  1ZGW A;  1XC5 A;  4MFE A;  3PO3 J;  1IG7 A;  3RZD J;  2ZB9 A;  1XG1 A;  2R93 J;  2DMQ A;  1FEX A;  4FE4 A;  4A3C J;  2HOT A;  4A3G J;  1VFC A;  1VF9 A;  1ITY A;  1MSE C;  1MBK A;  4RDU A;  1JT6 A;  3BG9 A;  3M4O J;  4B4C A;  3LSG A;  4Y52 J;  3HOY J;  5DS9 A;  3ZQL A;  2ME0 A;  3QQA A;  4FTH A;  2MW8 A;  4CYC A;  3GTQ J;  1B8I A;  3JRG A;  5EDN A;  5IOZ A;  4A3E J;  2R7Z J;  2JMW A;  1JT0 A;  1ETY A;  1TWH J;  4I6Z A;  2W48 A;  2Y9Y A;  2NS8 A;  4D5C A;  1Z0X A;  4A3L J;  3HOU J;  2WB1 N;  4QSH A;  1H8A C;  2K40 A;  2VI6 A;  4CYC B;  4I76 A;  4BY1 J;  1B8I B;  4X6A J;  1XS9 A;  2JK3 A;  2YUS A;  2DN0 A;  3BG3 A;  5IPA A;  2HDD A;  2JA7 J;  3BQY A;  4A3I J;  3BR0 A;  1Q1V A;  1IJW C;  2JJ7 A;  3A01 A;  2ID3 A;  4RBO A;  3JRE A;  2Y9Z A;  4HNV A;  1GUU A;  4XRM A;  5F27 A;  3F0C A;  2LP0 A;  2M8G X;  1MNM C;  3MVP A;  2GM4 A;  3FK7 A;  2CUE A;  1T33 A;  1MBE A;  5M3M J;  2E2I J;  3A01 B;  1IRZ A;  4XRS G;  2VKE A;  5FKL A;  5IP6 A;  4DZJ A;  3GTK J;  2XPW A;  2NVY J;  3G1M A;  2XPV A;  5IYD J;  2D5V A;  1JKO C;  5K7F A;  1P7I A;  2X48 A;  3CMY A;  5E3L A;  5FLM J;  1ENH A;  3S15 J;  2HOA A;  3Q0U A;  3S1R J;  3GBG A;  1IV6 A;  2NVQ J;  2XGD A;  5C44 J;  1TWG J;  3TP0 A;  3HEF A;  4A69 C;  1RET A;  2XRL A;  2Y30 A;  2MG4 A;  1MSF C;  1WH5 A;  2HQ5 A;  1JKQ C;  1GDT A;  1RR7 A;  2K9S A;  2EZI A;  4ABZ A;  2DA4 A;  2N8G A;  1LE8 A;  3S14 J;  1JTY A;  3I4N J;  2DA6 A;  2YS9 A;  2XB5 A;  3GTJ J;  2KDZ A;  1GV5 A;  3GTL J;  1U9N A;  2Y31 A;  2IBD A;  2DA1 A;  1OFC X;  2NVT J;  4M6V A;  4MO7 A;  3W6V A;  1YRN A;  2EQR A;  1GT0 C;  1ORK A;  1LE8 B;  2LK2 A;  1I3Q J;  4A3J J;  3FIW A;  3HOZ J;  4QTR A;  3IH3 A;  5K7Z A;  2G0E A;  4IHX A;  1JTX A;  3DEW A;  2H1K A;  2L0K A;  1HOM A;  2EZL A;  2QF7 A;  4DZP A;  1BW5 A;  1ZKG A;  1MH3 A;  1YRN B;  2EZK A;  1JGG A;  2EBI A;  1DU0 A;  2E19 A;  4JP0 A;  4X1E A;  1APL C;  1AHD P;  1OJL A;  2ME6 A;  1WGX A;  3CCY A;  4NDL A;  2LKX A;  1NTC A;  4QIW N;  4IHW A;  4V2F A;  4A3K J;  2EZH A;  5DTD A;  4IEJ A;  3M3Y J;  4M3D A;  3OOU A;  1PUF A;  2LR8 A;  2ELK A;  3BTL A;  2M0C A;  1W0T A;  1IDZ A;  3HM5 A;  5IP9 J;  4JX5 A;  2CRG A;  2DA3 A;  4DYC A;  1UHS A;  2VPR A;  3ZQF A;  1PUF B;  9ANT A;  3S16 J;  3TW7 A;  4BBS J;  2XPU A;  4UUT A;  1MBJ A;  3Q3S A;  1IC8 A;  4A3D J;  5IYC J;  1P7J A;  2CU7 A;  1AKH A;  1FIA A;  1RPW A;  3NAU A;  5FKM A;  5K7H A;  3JRD A;  3JRI A;  1EF4 A;  1BW6 A;  5EZH A;  1IUF A;  1AKH B;  2Y0S N;  1ZK8 A;  5C3E J;  5C4J J;  2H8R A;  1U8B A;  2JN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...