4XICA

Antphd with 15bp di-thioate modified dna duplex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
59
structure length
59
Chain Sequence
KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeotic protein antennapedia
publication title Entropic Enhancement of Protein-DNA Affinity by Oxygen-to-Sulfur Substitution in DNA Phosphate.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulator/dna
total genus 24
structure length 59
sequence length 59
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xicA00
1G2HA 5DTDA 2GM4A 5F08A 2HOTA 3MKLA 3Q3SA 5J3LA 3BR6A 3ZOBA 3HOZJ 2TCTA 3PO3J 2L7FP 5FKMA 1IRZA 1GUUA 1MSFC 1RKTA 3ZQFA 4IEJA 1TWGJ 2OF7A 1MBJA 2ECBA 2NVTJ 2K40A 3Q0UA 1W0TA 4MIMA 1JTYA 2O8KA 4Y52J 4A69C 1QPIA 3IH2A 1YRNA 2XPVA 3A01B 2KT0A 1GV5A 1VI0A 2E2IJ 1ETQA 2M2EA 1WH5A 3FKIJ 3Q0VA 1MSEC 3IV5A 1JKOC 2WAQN 1EF4A 2ZB9A 5IYDJ 3HEFA 3BR1A 3BTLA 4GFBA 1JUMA 2Y9YA 3MVPA 5FKKA 1RPWA 1NK2P 3JRDA 3HGGA 4EEFG 2M34A 2AHQA 1HCRA 5GPCA 2OPTA 2MG4A 2EH3A 2Y9ZA 1ETYA 3GTOJ 1BJZA 1H89C 2M8GX 2Y0SN 2CQQA 1JUPA 2NOGA 4A3EJ 2ME0A 2JK3A 2NVYJ 3A02A 1HF0A 2ID3A 3TW6A 4X1EA 2VUMJ 5GP9A 2NVXJ 1Y1VJ 1I3QJ 3ZQGA 2E1OA 4DW6A 1A6IA 2EBIA 1ZKGA 3BTCA 3IH4A 1P7JA 2Y2ZA 5E3NA 1MBKA 5F0FA 1I50J 4DZPA 4MO7A 1TWCJ 1XC5A 4AUXA 1HLVA 5FLVA 1ZGWA 3HOYJ 3FISA 1JGGA 3JREA 2VKVA 1GT0C 1ZQ3P 2X9DA 3HM5A 3Q0WA 1ZK8A 5IP6A 3S1RJ 2X6OA 1RKWA 1NTCA 3BR5A 3HBLA 2XB0X 5J1RA 4DYRA 4D7MA 3TW7A 1POGA 5BNGA 1GDTA 1PUFA 4B4CA 4D5CA 3DCFA 5EG0B 1IDYA 1OJLA 4A3KJ 3H3VK 1OFCX 4AC0A 3G1MA 3B6CA 2JJ7A 1QVUA 3WHBA 4AYBN 5IOZA 1Z77A 5IYBJ 2W48A 1ETOA 3CDLA 1AKHA 3LSRA 1VF9A 2JA7J 4HNVA 2D5VA 2LP0A 2RAEA 2XGDA 5M5XJ 3PM1A 2WB1N 1CQTA 4XIDA 1FEXA 5EGOB 3FK7A 1U8BA 4A3JJ 1AKHB 3A01A 4IHYA 2MSYA 1BA5A 3CQZJ 1RR7A 4V2GA 3LSGA 2DN0A 5M5YJ 2HOSA 1X2NA 2Y31A 1JJ8C 2K9SA 1LFUP 3F0CA 1TWHJ 4JYKA 2CRGA 2G0EA 3RKQA 2E2HJ 3I4MJ 1A5JA 5C4XJ 3LOCA 5K7FA 4M3EA 1IV6A 4A3IJ 1WCMJ 2LKXA 1FIPA 3JRFA 1U9OA 2LR8A 5HODA 2EZIA 3TEDA 1ETWA 1MBEA 1APLC 3BTJA 2L0KA 4D5FA 2DMPA 3S1QJ 2B63J 3O8HA 1ZTRA 1LE8B 1GV2A 4M3BA 1VFCA 1MH4A 1TWAJ 2I10A 2L9RA 3DEWA 2IBDA 3ZQIA 1SANA 3GTPJ 4C2MJ 4XRSA 2FX0A 3W6VA 2DA3A 1BW6A 3GTJJ 4M3FA 2R5YA 3HOXJ 2NS8A 2IEKA 2XRLA 4MFEA 4DYCA 1AU7A 3SDGA 2EZLA 4CYCB 2YS9A 4DZJA 1XS9A 3GTLJ 1BL0A 2E2JJ 4NDLA 2HXIA 5EYRA 2YU9J 4B3AA 3BR0A 4W97A 4C3IJ 2R5YB 2IAIA 1X2MA 4D7NA 1JKRC 1FTZA 2TRTA 2DA5A 1TWFJ 4ABZA 3GTGJ 2MGQA 2EZKA 2E19A 1ITYA 1DU6A 2LY9A 1P7IA 2M0CA 2LFBA 3HKZN 3JRIA 2ME6A 1R9TJ 1ETXA 4JX6A 5M3MJ 5J1UA 5DS9A 3BG5A 1JT6A 5K7ZA 4MLOA 2FJ1A 4XRMA 1MBHA 1NK3P 4QTRA 2HOAA 4RDUA 1RETA 3MN2A 1B8IB 1TC3C 3C2BA 2JA6J 2PMZN 3K2AA 3CCYA 4FE7A 3BR3A 1MBGA 5EG0A 4M3DA 2JN6A 2H8RA 3ZQHA 1IC8A 2QCOA 5IP9J 4C3JJ 2CUFA 3FK6A 3S15J 3S1NJ 2XSDC 2LD5A 5C44J 2JMWA 3A03A 1JKPC 4BBRJ 1WH7A 2FD5A 5IOYA 2L7ZA 2X48A 1JTXA 3JR9A 4S0HB 1W0UA 3GBGA 2DA2A 3ZQCA 1AHDP 5EGOA 2LK2A 2XGEA 1IG7A 3SFIA 5C4JJ 4QSHA 4Y7NJ 2HYJA 4FCYA 3SJMA 2K9NA 2JA5J 3M3YJ 1LFBA 1UMQA 1B72B 3LSPA 5IP7J 3M4OJ 2DA7A 3QPSA 1ZR2A 5IYCJ 1O4XA 3K7AJ 1F36A 4A3CJ 4IHWA 2QF7A 2K9QA 5F27A 3CMYA 1HDPA 2HI3A 2H1KA 3S17J 2COBA 5F0CA 5E3MA 2HDDA 2VPRA 1JKQC 4IHVA 4UUSB 3D1NI 1GVDA 2CJJA 4A3BJ 1Z0XA 3BQZA 5EZHA 4FE4A 2R7ZJ 2LLKA 1SFOJ 2JA8J 2JWTA 5FKLA 2L7MP 5FKOA 2GBYA 4XRSG 2R0QC 2KDZA 3RQIA 5E3LA 3H0GJ 3OSGA 1T56A 2AO9A 1VNDA 1IJWC 2O7OA 3QQAA 5GPAA 4RBOA 3RZDJ 1LE8A 4M3GA 2R93J 4A3GJ 2M9HA 1JT0A 3HOUJ 1JUSA 4XK4A 1WPKA 3JRGA 3BQYA 3G1OA 3I4NJ 5JLXA 4J19A 3HDDA 2DMNA 4A3DJ 1XG1A 5C3EJ 2DA1A 4JX5A 4CYCA 3S14J 3NARA 5EEAA 1H8AC 3QPLA 2VI6A 2NS7A 1RESA 3L1PA 4BKXA 2DA6A 3JRBA 5IPAA 3ZQLA 4BY1J 2CU7A 3JRCA 1Y1WJ 1ZR4A 3JRAA 3S16J 1YRNB 3PO2J 2DA4A 3E7LA 5FLMJ 1FJLA 1UHSA 4C3HJ 2N8GA 3WHCA 3LNQA 2DMTA 1HOMA 4DYQA 3GTMJ 5K7HA 4QIWN 2O9LA 1Q1VA 5E3OA 2R92J 2MW8A 3BG9A 2XPUA 3TP0A 1HDDC 1K83J 5JLWA 1ETVA 4UUTA 3OSFA 3RZOJ 4A93J 2LVSA 4JX4A 4XICA 4BBSJ 3IH3A 1ENHA 5EDNA 1B8IA 2WV1A 2HQ5A 4IHXA 2ID6A 3FIWA 4B1RA 1FIAA 1JJ6C 2DMQA 2Y30A 1X58A 5EF6A 5F1JA 5EZGA 2ELKA 4FTHA 2CUEA 4BXXJ 3UKGA 3OOUA 3S1MJ 2HXOA 3HOVJ 4W1UA 1E3OC 1BW5A 1IDZA 1MH3A 4JP0A 5M5WJ 2P81A 4G12A 2DTZA 3HB9A 1IGNA 3HGYA 5M3FJ 1D5YA 1WGXA 4A3MJ 1WI3A 1QVTA 3B6AA 4FISA 3NAUA 4M6VA 5FKNA 1MNMC 2GLOA 1DU0A 1FTTA 3JRHA 3BT9A 1OCPA 2XPWA 3GTQJ 2DMUA 1OCTC 1ORKA 4X6AJ 1QRYA 2XB5A 1B72A 4L5EA 4BY7J 4V2FA 2EZHA 3HOWJ 3BG3A 2R5ZA 2YUSA 1U78A 1K61A 3BTIA 4MFDA 2FQ4A 5J1YA 3G1LA 1S7EA 2DJNA 1I6HJ 3S2DJ 4UUSA 4LOCA 3TP3A 1MBFA 9ANTA 4A3FJ 3GTKJ 2R5ZB 2CQXA 4I76A 5F04A 1IUFA 3S2HJ 3LSJA 3VPRA 2XGCA 3BR2A 1ETKA 3O8GA 3OIOA 2NVQJ 1PUFB 1T33A 1U9NA 1H88C 4A3LJ 5FJ8J 1UG2A 5F0HA 2EQRA 2ECCA 2VKEA 4I6ZA 1F43A 2LTPA
chains in the Genus database with same CATH superfamily
1I6XA 3U1KA 1QHHD 4MTEA 4RB3C 2EWNA 5B5EC 2LF8A 4I98B 2HYGD 4FASD 3MKLA 5J3LA 4BUPA 1FOWA 2QWWA 2JA2A 1R5HA 3LFKA 2TCTA 1IXRC 2QA4I 1Z3XA 5L3GA 5FKMA 1GUUA 3HUGB 2A05A 3FBIB 2Q2EB 2ISYA 2OF7A 1MBJA 3RKWA 2M4GA 2M0MA 2XKPA 2K40A 3Q0UA 5HLTA 4DOZA 5E1XA 2O8KA 5K5RA 2R7TA 4A69C 3JSOA 1FOKA 3I55I 3MKZA 2EB7A 1YRNA 1X4PA 2HVRA 1VI0A 3KZZA 2E2IJ 1ETQA 4M71A 4XRFA 3BCAA 1ZELA 2BY2A 3T8RA 3CO7C 1USSA 1WH5A 1BN5A 3IV5A 2WAQN 5HS8A 1KONA 3WE2A 4GFBA 2VOOA 3QYEA 1AOYA 3I4PA 1LFPA 1UG0A 2DDAA 4F3QA 1RPWA 1BIAA 3GLLA 2M8EA 3L2QA 2RNGA 3HGGA 4EEFG 2LC2A 1HCRA 5AONA 2Q8KA 1BI1A 2MH9A 2BY3A 5F64A 3K4NA 4XKVA 4L9VA 2VBWA 2H6CA 2XF7A 3JW4A 4YIRX 3ZMUA 1P6RA 4I09A 4B44A 3M1EA 1HF0A 2ID3A 4CCJA 1HKSA 1PP7U 2DW4A 1OCZH 4N0BA 1Z05A 2NVXJ 1Y1VJ 4A12A 4CDGA 5HDNA 2MC4A 5CQEA 3OYIA 5JHFA 3ERMA 3BOQA 1R23A 2E5NA 2JQ7A 4UUVA 5E3NA 4CZZA 4S04A 3G2BA 1MBKA 1MMDA 4IXAA 4UVBA 1B1BA 5F0FA 1JE8A 4KMFA 4MO7A 1DDNA 1ZGWA 4AIJA 1JGGA 5GAHJ 2O8XA 3JREA 3ELKA 1GT0C 3KYCB 1S7OA 4UVCA 5JVGF 3HM5A 2GIZA 3EUAA 3O3KA 3GZNB 5IP6A 1YJWI 2DOEA 2IVMA 4DYRA 3IAS2 1SFXA 4D7MA 3VYRB 2L2OA 4ON0A 1GDTA 5DV5A 2DJIA 1CF7B 3KLOA 1PUFA 2F5FA 1GXPA 2IGMA 2ZNYA 2XKOA 4LIUA 2ICWG 5EJCA 4CICA 2IT0A 4D5CA 3IC7A 5EG0B 1OJLA 1XB4A 5EEHA 3ABUA 3BP8A 4AC0A 4Z6YA 4JOMA 2JJ7A 4EM2A 3S8PA 2UXXA 5IT9Z 3L9FA 1IXSB 3V8LA 3ZP5A 1W7PA 4AIHA 4GGGA 2UZKA 4B48A 3MEXA 3LSRA 2P8TA 2MLKA 3FXQA 4HYEA 2KRCA 2CW7A 4PFOA 4BDYA 2RAEA 2VL8A 5LHIA 3FXLA 1CQTA 4Q4ZF 1HKQA 3DBHB 2RQPA 2JSPA 1NH3A 1LKXA 1Z9CA 4A3JJ 3OIQA 1IN5A 2MSYA 2F4OB 3CQZJ 3F8CA 4E7HA 2DFHA 1BA5A 1RR7A 2VIXA 1X2NA 2Y31A 2K9SA 2HKOA 2OTJI 1UCRA 3F0CA 4CA0A 2CRGA 2G0EA 3I4MJ 2F6CA 4C2TA 4BQNA 1T98A 4QPQA 2HVSA 4I7HA 4F52A 5BPIA 2CFOA 1MNDA 1D1CA 5GAGJ 3QPTA 1FIPA 3JRFA 1U9OA 5HODA 3BJAA 1K4SA 3WGIA 1T8IA 1ETWA 1XGSA 2QSGX 1T6SA 3PIPF 1S7AA 4FHTA 4XLNF 4ZDOA 3GYHX 3S1QJ 2IA1A 4BGDA 5K1YA 2B63J 1ZTRA 3E5XA 1LE8B 4RA2A 4M9SA 1GV2A 2HS5A 1VFCA 1REPC 3SHFA 1ZG3A 4E7SA 3OYNA 3ZMTA 3DF8A 2KP6A 1HC8A 3GTPJ 3F9KA 2FX0A 1Z21A 4G7OF 1H9TA 1BW6A 3GTJJ 3RIRA 4BL0B 3CJQB 2E34A 2NS8A 4CSWA 2UWMA 2QENA 1DPUA 4PJJA 1NG7A 2EZLA 2H94A 4CYCB 1PVEA 2YS9A 5LBQA 3GXOA 1MMNA 2CWEA 4PGHA 3HXLA 2QVOA 2E2JJ 3CP2A 2W24A 3DU6A 4NQWA 4B3AA 1KA8A 1G3WA 4C3IJ 3GX4X 2R5YB 2L9VA 3CD6I 2KJCA 3MAJA 2TRTA 3SZPA 2RVCA 2WAEA 2XAFA 3C2HA 2MGQA 5D5VB 3CCMI 5E17F 3OR2C 3D0SA 1DU6A 2ZMEB 1I39A 1YLFA 2RC4A 2GA1A 5M3MJ 2ZCWA 1JGSA 5J1UA 2OD5A 1SD7A 2NVUB 3WTUC 3CCJI 4IZZA 4HSTA 1NK3P 4QTRA 1S3JA 4HA8A 4WK8F 2OTLI 2L01A 4AIDA 3B02A 3DTKA 3LA2A 5CVVA 3AG4H 1B8IB 3K2AA 2UV1A 1MDMB 3LMMA 3RYPA 2EV0A 3L2VA 1IC8A 2DK5A 2CUFA 4MNUA 4ZH4F 3S1NJ 1IN8A 3LL7A 2MFZA 2DQRA 5ICGA 4F92B 3BJOA 1I1GA 1KU2A 1G8XA 4ENMA 4BBRJ 4B3XA 2YU3A 3MKWB 1XSDA 2X48A 4KIFA 3V7CA 1P4WA 1B9MA 4E7KA 2ELJA 2IA0A 3TO9A 2OZUA 3H5RA 1EH6A 2DA2A 2RGVA 1USTA 4XLCA 4I0BA 4AU7A 3VWBA 3P9KA 1W1WE 4QSHA 4Y7NJ 2HYJA 4FCYA 3SJMA 2JA5J 2CW8A 3M3YJ 1LFBA 3VOEA 3PSFA 3CCLI 2JUGA 5CQGA 5FFXA 3OYGA 2HR3A 4IX7A 2PI0A 2JZYA 4F91B 2COBA 5DEQA 4XOPA 4ENJA 2XAHA 2BGCA 1YIJI 2A5YB 4LLNA 5AIPA 1GVDA 4KT5C 2CJJA 1ZG5A 2FQ3A 2WY7Q 3CF5F 1LVAA 3BQZA 5EZHA 4FE4A 2VBXA 1SFOJ 2JA8J 1K6YA 3WU1B 2L7MP 4NBQA 5FKOA 2GBYA 1V55H 1S6LA 1XTAA 2KDZA 2F4IA 5E3LA 5IY5H 3OSGA 1T56A 1S8NA 3CC4I 5DDGA 3QQAA 1T39A 3RZDJ 3HPGA 4M9ZA 4BQAA 4A3GJ 2M9HA 1JT0A 4CGZA 2JT1A 4XLAA 3JRGA 1E3HA 4IRGA 5ILSA 3F8BA 3HDDA 2D45A 2MD0A 1UAAA 3FXRA 3A1YA 4HQEA 2KRFA 1V54H 2YPRA 3OYJA 2EINH 1BBYA 5LHHA 1XCVA 4CZCA 5CVRA 5IPAA 3ZQLA 2VKHA 1Y1WJ 4LMYA 3VYSB 2F2EA 2DT6A 2G7HA 1V5EA 1XMXA 3ML6A 4C3HJ 3LNQA 1HOMA 1Q1VA 4G9YA 3HSEA 1DUXC 3EDPA 4P96A 4YEJA 2DLLA 3IKTA 3K69A 1HDDC 2LBFA 4M6XA 4KIBA 3S93A 2COMA 3RZOJ 1IN6A 2DI3A 4N9HA 3IH3A 1KU7A 2M4KA 5JI6A 4RMNA 5ICFA 1ENHA 1KGSA 4A5MA 1HW5A 2HQ5A 2L9SA 2ID6A 2V7FA 4CYDA 4EQQA 4IHXA 1T38A 1TZLA 1L0OC 4IJAA 3OYHA 4HDVA 2PLYA 5EF6A 1D5VA 5F1JA 2KFDA 3N4MA 5EZGA 5D4SA 3UKGA 5TJJA 1Z67A 4M74A 3E97A 4HAMA 1GHCA 2P81A 5DD4A 2V4JC 4C30A 1VQ7I 5DM7F 2PJRA 4UB8C 3IWFA 4LB5A 3K10A 3K4MA 3AG2H 2XF5A 1WKMA 1O3SA 3WODF 3K4JA 3KP3A 3NAUA 1FT9A 3G73A 4M6VA 1MNMC 1UZCA 4MQVA 1OCPA 2EFWA 2DMUA 3JSPA 2D1VA 1GXQA 2ZNZA 2XB5A 3T5XA 1R36A 2PEXA 1X3UA 4Y13A 1B72A 2VXZA 3BG3A 1BIBA 2YUSA 1BJAA 1U5TC 1U78A 2DTRA 4II3A 2FNAA 1VZ0A 3FXKA 4OAYA 4S05A 3MCZA 3L2UA 4JBAA 4JQFA 5J1YA 4XONA 2O5RA 4ZTJA 2VXDA 1YW9A 4RAYA 4EV0A 4Q48A 3KP2A 5CYVA 4LOCA 3TP3A 1R4MB 2AS5F 4XM3A 4D1QA 3U1DA 2P5LC 4CO8A 2DPUA 2BY1A 5LRRA 3UR3C 4ZZLA 1ZRDA 1VQ5I 2X6WA 2XGCA 2V1DA 3OIOA 3R60A 4C9YA 4E7LA 4FQGA 1W5CC 2E36A 1U9NA 2XVCA 4O3MA 1FBQA 2L4MA 4IHTA 3GLXA 1F43A 3CCVI 3BPXA 4Y15A 4HOBA 4I6ZA 4UV9A 3PUFA 4BU2A 4YRVA 5AIQA 3WTZA 2GXBA 3HRTA 2BHYA 4D9JA 5A2QZ 3CCUI 1R71A 3F22A 5DTDA 1BC7C 4XNFA 5CKTA 1RUNA 5TRDA 1R58A 1Y8QB 2LKPA 3DTEA 3RI4A 3BG6A 3ZOBA 2AQEA 3PO3J 3SYTA 1RKTA 3ZQFA 3BZKA 1FPQA 3KP7A 2X85A 4WX9A 2VODA 4BHBA 1H9GA 1WJEA 1V3FA 2IPQX 5HDGA 1QPIA 2KKOA 1SFKA 3CZ6A 1T08B 3IAM2 2BYVE 3SEQA 4RM3A 4M6YA 2V1NA 2EA4A 2DFIA 2ZJ2A 5FROA 3K4BA 2M2EA 5FD6A 4RGXA 2HZTA 4ZDPA 2FU4A 2NNNA 3TBIA 2ZB9A 2R7WA 5IYDJ 1EF4A 3E6BA 2FA5A 3I59B 4PJNA 3HEFA 3BTLA 3DQVC 1JUMA 4IRIA 2O03A 1UB9A 4I2OA 1V5GA 3RQ4A 3ERED 3BWGA 4OU0A 4GCVA 5H20A 4RAFA 4HDUA 3CC7I 2R7VA 2AHQA 2QSFX 2OPTA 4DGWB 4AYBA 3LSKA 1WJBA 3T0YA 3J7YJ 1ETYA 2FE3A 3GTOJ 1H89C 2M8GX 2QQBA 1IRXA 1JUPA 1N77A 2W25A 3E5UA 4ESFA 1YHQI 3IRRA 1MMAA 2XUBA 1SD4A 3A02A 4P55A 3R6SA 1BOAA 1WFXA 2KIMA 4XLEA 3TW6A 2GA2A 1EH7A 1UFMA 2RQQA 3NEUA 1F5TA 3EUHA 5GP9A 1FLIA 2GWRA 4MGRA 3R4KA 3ZQGA 4OOIA 1X19A 2G9WA 1YJ9I 2OQRA 1LJ9A 2A6HF 2EBIA 3IH4A 2DYSH 2EILH 1IUYA 2KDOA 3E6MA 2FOKA 2R4GA 2V1XA 5LEJA 5D5WB 2W4SA 3E3VA 4AUXA 1HLVA 2XIGA 4RLFA 4CCLA 1C0WA 5LD2C 4A0ZA 2YX7A 4ENNA 3DLAA 3J81K 3GEZA 3I5UA 2NYXA 5H2FC 1IRGA 3E5QA 1UELB 3HSFA 1LUJB 4EATA 2X6OA 3PSIA 3BR5A 4GO1A 2BW3B 1ZREA 3TW7A 1POGA 2PQ8A 1EA3A 1KQ0A 5DCMA 3OWTA 2QM3A 2XROA 4KDPA 3SXYA 4I02A 4EJOA 5GTIC 4A3KJ 3H3VK 3SDBA 1OFCX 2VJJA 4BDZA 3OS1A 2WAFA 2Y0MA 3V4GA 3WHBA 2BY0A 1P2FA 4AYBN 5IOZA 3CP8A 4RB0A 1Z77A 2W48A 4I0AA 5D8LB 3AKZA 1HSJA 3TOBA 3H9QA 3ZPLA 4Z2YA 2BVMA 1KU3A 2DPDA 3CDLA 3DBLB 4CXFA 3LA7A 1JHFA 4X0GA 3FM5A 5HDKA 3GVAA 2BBYA 3ABTA 3OYDA 3MZHA 2JA7J 4G6DA 4XQFA 1IO2A 2XGDA 3MFKA 5M5XJ 2IS6A 1SFUA 3PM1A 1R4NB 2IRFG 4F7ZA 1FEXA 4HPQA 1YW7A 4HX4A 5EGOB 5E1ZB 4ENKA 1QO0D 3A01A 5HLHA 4KFCA 4WXCA 3LSGA 3SZTA 3QAHA 4B47A 2F5DA 3K9TA 1JJ8C 1R22A 1LFUP 1WJCA 2R7OA 3E6DA 4JYKA 4BEHA 2V79A 3RKQA 2E2HJ 3COAC 3R0JA 4PK4A 2DBBA 1A5JA 5J40A 4L18B 5C4XJ 3LOCA 5J8FA 3R61A 1Z7UA 1ZG1A 2R7DA 4M3EA 4Y33A 4Y3OA 3KZYA 3D5SC 3DKYA 1WCMJ 4LLLA 1NHAA 2MLGA 4YIIA 4KT6A 1BOBA 4RM2A 1YX5A 1MNEA 4YELA 4GDFA 3QOPA 3L2WA 5EEGA 2CUJA 1E17A 2IJLA 2CUZA 1G6NA 3H1CA 4AIKA 3CJTB 1TQIA 3V8KA 1SEUA 2I10A 4PJMA 3ZQ7A 3DEWA 1XPXA 2IBDA 1SANA 3WG7H 4XRSA 4I01A 2CSOA 3W6VA 3FXOA 2OQGA 4HX7A 2B9SA 2R5YA 2GOXB 2IEKA 1AU7A 1WJDA 3CLQA 1OLTA 1G59A 4CH7A 1P9QC 3FXJA 2HXIA 2ZMEA 3F8NA 2XHKA 3BR0A 4W97A 2V9KA 2M1BA 2QQAA 4R8HA 4PZJA 2IAIA 3HZJA 4D7NA 1K6OA 1JKRC 1U8RA 3A0BC 1FTZA 3WGGA 2GAUA 1TL8A 1KU9A 1UHWA 1SAUA 3GF2A 2CQNA 2QZ8A 4N4NB 3L00A 1R9TJ 4RB2C 2KIUA 3HJEA 1XX5A 3V8JA 1JT6A 5K7ZA 6PAXA 5KVRA 2FSWA 1QZZA 4HNUA 3JTGA 1JXSA 3VSKA 2R7QA 1QU3A 4XL9A 2JA6J 2Z3YA 3U9GA 4FE7A 1YO5C 2L02A 1T0FA 4M3DA 2H8RA 2XASA 3ZQHA 3CUQA 4KISA 2KISA 5IP9J 2D2WA 3CC2I 1BC8C 3S15J 2R7RA 1MJAA 5C44J 2QGUA 4EVIA 2JMWA 1XD7A 4KN4X 2WV0A 1WH7A 1FYKA 2L7ZA 5LLQA 1W0UA 5J47A 2P6SA 4XSXF 3GBGA 2HZDA 1GVJA 2HU9A 2K86A 3EETA 3F72A 1AHDP 2LOOA 1ERDA 3F6OA 4XKWA 1Z3YA 1FZPB 3ECHA 3SQNA 4HZFA 2K9NA 4AVPA 1WWXA 5LHGA 4IOAF 1U0JA 4XKBA 1UMQA 3GFJA 2X4HA 3BPVA 1U5TB 3LSPA 4G7HF 3A2KA 4P5OA 2DA7A 1ZR2A 2E1MB 2JVHA 1F36A 2CS3A 2KPMA 1N25A 3OYKA 5GADJ 1P4AA 3KLNA 3W2AA 1EV7A 3S17J 1RNLA 5E3MA 2M45A 2Z5UA 2P4WA 3HTUA 4PSXA 4UUSB 3D1NI 4XN0A 3GCMA 1FC3A 2HTSA 2Z9OA 4A3BJ 1Z0XA 1EKEA 1D0ZA 2LLKA 5D5XB 2HEOA 3PQKA 2DFFA 3RPUA 3REOA 2R0QC 1XGOA 3H0GJ 3VFZA 1VNDA 5ERIA 4M3GA 3NWTA 2NOJB 1DGRM 3HOUJ 1N75A 3U2RA 5L3CA 3PFYA 3KP5A 2A07F 2L4AA 3BQYA 4PJLA 5JLXA 3K6GA 4J19A 3HIFA 5KAIC 2X51A 4BE0A 5JVTA 2DMNA 3ABKH 3K2ZA 1VQOI 2PG4A 4DQ2A 3IWZA 2FXAA 2DA1A 2X1DA 3RJPA 1YQAA 5DYMA 3G71I 3S3MA 2O0YA 3S14J 3NARA 4ZZDA 4WCGA 3L1PA 5FLXK 4NC8A 1P92A 4C2UA 1SD6A 3JRCA 3K1MA 3CO6C 1OR7C 1TW3A 3S16J 3S3OA 1Z6RA 1YRNB 3PFIA 1YS6A 1QPMA 3E7LA 5FLMJ 2EK5A 1UHSA 3K70D 5J4VA 1D1BA 3K1PA 3OMYA 4DYQA 3GTMJ 2MA3A 1PDNC 3VDXA 1Y8RB 4QIWN 4OMZA 1R00A 2L5QA 3TMOA 1S9HA 2MW8A 4XLPF 1TW2A 3PQJA 2CO5A 3TP0A 3H36A 3KYLA 4XLFA 3OSFA 1MZBA 2GQQA 4JX4A 4XICA 4XBFA 1D8KA 3KIOA 5EDNA 2XDVA 1X3ZB 2QKLB 1JJ6C 4B8XA 3JAMZ 3MQ0A 4G8XA 2CUEA 4J00A 4BXXJ 2DODA 5H6QA 2WTEA 2O3FA 1QA6A 3CLOA 3OV8A 4FX4A 3HSRA 4HV5A 3S1MJ 4P1WA 2HKXA 5HVQC 5E8GA 1MH3A 1Z1DA 2R3SA 4JP0A 1M1EB 5M5WJ 3FXUA 1X4OA 1IGNA 2VPLA 2NRAC 2IXSA 3FHZA 1S29A 1KYZA 1A35A 4LFUA 4RGUA 4M72A 2ADUA 2GZWA 1J2XA 2VT3A 5F1RA 1DP7P 1ZGJA 2K3PA 1TTYA 4H4KC 4A0XA 2W57A 4LK0F 2LH9A 3JRHA 3BT9A 4ESBA 3G6EI 3P9CA 2XPWA 3GTQJ 2EIKH 2KIQA 1FOYA 5CLSA 4BY7J 1LEAA 1RZ4A 1F1ZA 3J80K 1EJ9A 4O6JA 3KP4A 5L3FA 4HF1A 4QWQA 3FWEA 1QZYA 1K61A 4NB5A 4D0PA 5D6FA 2VB6A 3G1LA 3PNYA 1AA7A 4ZYAA 2QUFA 1K78A 1I6HJ 2FBKA 4HF0A 5ILVA 3S2DJ 4O5VA 1MBFA 2FBIA 4KMUX 1W4MA 3PUBA 3GTKJ 4LGWA 2R5ZB 3AAFA 2IS4A 1WJ5A 1IUFA 2Z1DA 3GO5A 2CV0A 4G6TB 3M8EA 2GIVA 3BR2A 2XRNA 3O8GA 1H0MA 4HQMA 2V1UA 3QU3A 1PUFB 1JHHA 2A68F 2EV5A 4LITA 1BR4A 3FM3A 3CTAA 2VKEA 2ECCA 3WTYC 1SC7A 2JPBA 4X6AJ 4GYGA 3DKWA 1B59A 1BM9A 3IKVA 2IGKA 4RAGA 3BR6A 3EYYA 2PMUA 2OBPA 4XR6A 3FKJA 5D4RA 1MSFC 1N78A 2L9NA 4EJTA 4IEJA 3KEQA 4U7DA 4M73A 2ZFWA 2AQFA 1RI7A 3W3CA 2ZSIB 4L0YB 2NVTJ 1W0TA 4U0VA 1ZGAA 2CFXA 1VQNI 2PJPA 3HHGA 2KT0A 1MMSA 1SAXA 4XLHA 3VODA 2M87A 1O3RA 2HTJA 3DU5A 3FKIJ 3GZ6A 1MSEC 4ZYGA 5FO5A 1RIOH 1JKOC 5BMZA 3FBNB 2Y9YA 1E2XA 2M5WA 3K70C 1VQKI 1AWCA 2EFQA 2WY8Q 1NK2P 3LQQA 4H0EA 2CH0A 2EFOA 3LWFA 4LB6B 3VSLA 2XGXA 2ZC2A 5GPCA 2HPMA 2ZXHA 2JVGA 2Y9ZA 2HQAA 3BCBA 3H92A 2P6TA 4K2EA 2ZJPF 2CQQA 4ZC3A 4KA4A 2NOGA 4A3EJ 1X1PA 3H3UA 5CVJA 1ZAOA 2CV2A 1FYLA 1O7FA 2NVYJ 2JUCA 5FFZA 3LQRA 1IRFA 5KAFC 4LJZF 2FNPA 2OA4A 2WB1A 2VUMJ 3ROUA 4PCQA 3V42A 1DGWY 1E3PA 3ZN1A 1LQ1A 2IA2A 5HS7A 1R5GA 2E1OA 3CDIA 2BZTA 3Q9VA 4DW6A 1K79A 2A6EF 1ZKGA 2HNHA 1OPCA 4MTDA 4NQWB 3ESWB 5ICEA 1I50J 3C1DA 3RPQA 1XC5A 5FLVA 3HOYJ 4F55A 5TGTA 2BW3A 2VKVA 1ZQ3P 4EJUA 1J75A 3S2WA 2QQ8A 1B6AA 3KETA 3MWMA 3T1BA 2NS0A 2EFPA 2OCCH 3M1CA 1IXCA 3S1RJ 1L3LA 2M7AA 1NTCA 3HBLA 2XB0X 3BY6A 1VQPI 2E1MC 2WADA 1IZ1A 5BNGA 3A0HC 3FMSA 1X1CA 4U0WA 4B4CA 4GXOA 3DCFA 2L7KA 4RLQA 1IDYA 3AG1H 3DKXA 1FY7A 2LNBA 3K4CA 5DD8A 1BI3A 3B6CA 1QVUA 1XSVA 3ZMVA 1ZRCA 3O6BB 2V9PA 5HNFA 4EM1A 1YW8A 2VASA 3HG9A 3I3LA 3ONQA 1ETOA 2DK8A 1W7PD 3HUGA 3HOSA 2Q2EA 2V9VA 4YFNF 1ODDA 3HRMA 1MJBA 2ZXJA 2VOPA 4DIQA 4HNVA 4HLYA 3EUKL 2D5VA 1D8JA 2LP0A 2VQHA 1VQ4I 2WB1N 5CPRB 1I27A 1BI0A 2VQGA 4XIDA 3V7SA 4U7BA 1U8BA 1KZHA 5TISC 2XAJA 2P0WA 1AKHB 3SEZA 1D1AA 3KEYA 3M9AA 2HYFA 4GRIA 4V2GA 2DN0A 2QQ9A 3HKZA 3ZR8X 4BJ6C 5M5YJ 5IT9K 1R1UA 2OU2A 1HW1A 5BQTA 3W6KB 4FX0A 1LDJA 2KRHA 1GLNA 2JPCA 5KNLA 3TKYA 2LKSA 1ZN2A 2EA2A 3RPUD 2E1CA 2AXLA 2CQ7A 5K7FA 3OYAA 3LAJA 3C3WA 3I54A 1UJ8A 2E1NA 1B9NA 3WTSC 2IP2A 4NC7A 2UUZA 3QPHA 1R1VA 2HPIA 2HOEA 1QZEA 2F4MB 5B66C 3FZVA 1A36A 1APLC 2CMPA 2XC7A 1TLHB 2DMPA 2ZJRF 3QU6A 4MHGA 1TQPA 2KIFA 2X1CA 3IRQA 1TWAJ 3X2QH 1X1AA 3ZQIA 2IW5A 3PNTA 4HEA2 4C2MJ 3O2PE 5B1AH 2ZBKA 4AWXB 4M3FA 4MFEA 3RTRA 4MEYF 5E1WA 3SDGA 1U6GA 1WJAA 3JTHA 3ZMZA 3OYMA 4NDLA 5EYRA 2DT5A 3BG7A 1X2MA 2ZXIA 3OS0A 1JI8A 2E35A 2L54A 4ABZA 5JR3A 3GTGJ 2VE8A 3Q9SA 4PDKA 1LDKB 5CVUA 4ZJZA 1HQCA 3BC8A 4ESJA 3N05A 3VB2A 2V26A 2EZKA 2VQCA 1ITYA 2M30A 4UXNA 1W36D 1I3AA 3HKZN 3JRIA 2ME6A 1ETXA 2LBFB 3M8FA 5DS9A 2L3DA 2CG4A 1STZA 4MLOA 2FJ1A 4XRMA 4L9NA 1MBHA 1J59A 4RDUA 2IS2A 1HA8A 2RNJA 1CF7A 2QBYB 1YYVA 3MN2A 2A61A 1TC3C 3IUOA 3KEOA 3CCYA 3J80Z 1J7KA 3BR3A 1RRJA 1W5SA 1XMKA 4PGGA 5EG0A 2G7UA 1ZLJA 4BS9A 5KCMA 2QCOA 3QP5A 4C3JJ 2Y69H 3MZ8A 4XN3A 4OIOF 2A3SA 1A04A 2GOMA 2LD5A 3CUQC 1SVOA 3QYFA 4WXHA 1FYMA 1WSUA 3A03A 3GFLA 3H9GA 3A4CA 1SFEA 1VQLI 1X3WB 1ZARA 4WF2A 3BDDA 2E71A 2DT7B 4DBQA 4RGSA 5L3BA 3AFHA 2W00A 1JTXA 3GWZA 4KICA 1LDDA 4S0HB 3JR9A 1U5TA 2ZO4A 3MD2A 3TDUC 3WG9A 3B73A 1Z7LA 3ZRGA 2PFBA 2CGPA 3OL3A 1CGPA 4LG3A 5D8KB 4HSRA 1IG7A 4OAZA 1XN7A 1BR2A 2VC0A 3SFIA 2HGCA 5C4JJ 3GFMA 4L5IA 2ELHA 1B72B 3NRVA 1A31A 3QPSA 1WVRA 1OCRH 5IYCJ 2STTA 4LLGF 1ZYRF 5F27A 3CMYA 1HDPA 2FEZA 3QWLA 4NUBA 3WTTC 1KQ9A 5F0CA 1FBUA 4IO9F 2LDUA 2HDDA 2R7FA 4BQOA 1JKQC 2M7BA 3F21A 4IHVA 3FXMA 4FT8A 2H6BA 4WWCA 4UY8I 3FMQA 1J09A 3BZCA 1QHGA 1ZRFA 2V6CA 2R7XA 2I8DA 4YIFA 2JWTA 2QKMB 3E1SA 5FKLA 2BEOA 4XRSG 3VYTB 3RQIA 5J4YA 3S3NA 4ZYHA 2AO9A 4EJVA 2O7OA 4RBOA 1LE8A 3T8TA 5ILUA 1PUEE 3KP6A 1HW2A 3CDHA 4XK4A 1XGMA 4Y4RA 1YFHA 5FGMA 2F48A 3OYBA 3I0TA 2DFEA 4A3DJ 5BPDA 4P9FA 3K4LA 2EIJH 4JX5A 4Q47A 2VBYA 1UHMA 4CYCA 2K9MA 2FMLA 5EEAA 1YI2I 3QPLA 2YX4A 2VI6A 2NS7A 3LSIA 1RESA 4R79A 4BKXA 2DA6A 3LFUA 3C2GA 4UHTA 4BY1J 1OYWA 1YX3A 1A6QA 2F5CA 3PO2J 1D0XA 5FRMA 1FBSA 2N8GA 3WHCA 2DO7A 1U2WA 2BVLA 3WGHA 3BROA 4RB1A 5E3OA 2K4BA 3EPZA 4ZTFA 2XPUA 1K83J 2X6XA 5J6XA 1R49A 3DTIA 1ONVA 3GW2A 4DBRA 1QNTA 3V7RA 4A93J 2H09A 1FWZA 5GAEJ 4BBSJ 1X1DA 1FNNA 4BJ5C 1MKMA 5J8CA 4ZYDA 1B8IA 4B1RA 1MDMA 2AXTC 3IHUA 2CV1A 1TNSA 2DMQA 1W36C 4ZYEA 1VTNC 1DP3A 2ELKA 4NC6A 1R6RA 1YG2A 3CJRB 4UV8A 4KITB 3HC7A 3OOUA 2HXOA 4W1UA 1BI2A 1E3OC 1IDZA 1I1SA 2XAGA 2K85A 2DTZA 3HB9A 5M3FJ 1D5YA 2DCEA 4N4OB 1RUOA 3ECOA 1WI3A 1HSTA 2RKHA 3B6AA 3DPUA 4U0YA 5FD5A 1LEBA 2LYCA 4PUSA 3TO6A 2ISZA 2Z99A 3P5JA 1FTTA 2BV6A 3NWSA 3GFIA 2IGNA 1HXDA 4U87A 1ORKA 3W2VA 3S32A 3F23A 1DPRA 4XORA 4LD5A 3VEPA 4L5EA 3CCRI 4V2FA 4G94A 1P4XA 2EZHA 2R5ZA 1D0YA 4YG2F 3HPHA 3WE3A 4P9UA 4EJWA 4RGRA 4HNTA 4MFDA 1LB2A 2FQ4A 1T2KA 3H35A 4EGZA 2IGOA 1IW7F 2YSRA 2PBIA 2W85A 2GXAA 3I58A 2DJNA 1OCCH 5LGUA 5K5QA 3OS2A 3RKYA 4A3FJ 3M7GA 1LNWA 4LG0B 2Y75A 4I76A 1IN4A 3M07A 1FX7A 4IL6C 3ZXSA 1XCBA 1NG6A 2OC6A 2K3FA 2KQRA 1IN7A 1G3TA 3D5RC 3L7WA 2WC2A 1BR1A 3LSJA 2Y0SA 5DCMB 3VPRA 1ETKA 2NVQJ 4FETA 2PN6A 2W82A 4BE2A 3EQLF 4JK1X 4KUMA 4MQ9F 2DAOA 1H88C 4A3LJ 5F0HA 5ICCA 5LRSA 1VQ9I 2I5UA 1G2HA 1D3YA 1WHUA 2K27A 1KYWA 1S5LC 2VLAA 5F08A 2HOTA 2GM4A 3Q3SA 4PSWA 3HOZJ 1O3QA 4IPAA 2L7FP 4J01A 1IRZA 4KIGA 1MW7A 4TV7A 3JCUC 4CCMA 1TWGJ 4LK1F 4HG2A 2VC1A 3ISPA 2MH2A 2QSHX 3PJRA 2ECBA 5E8IA 3MZYA 4MIMA 1JTYA 1J0RA 1HBXG 1IF1A 4Y52J 1K4TA 4CUGA 3GUDA 3IH2A 4KYWA 2VJ4A 5A2QK 2XPVA 3A01B 2K4JA 2LF7A 1YITI 2R7UA 1GV5A 2RV8A 1TQMA 1O57A 2LG4A 4F93B 2E60A 4OIRF 5HLGA 2PMHA 3CJNA 1DQUA 3Q0VA 4EM0B 1ZLKA 4NHJA 4BEHB 2NNYA 2EJRA 2OZ6A 4M9XA 4G6QA 1O3TA 1J9IA 1F4KA 3DP7A 3BR1A 2CW0F 3H5NA 5DUKA 3C18A 2FF4A 3MVPA 3OYFA 5FKKA 3UNGC 3OYCA 1YTYA 3QYBA 4GYIA 2F5EA 5ED4A 3JRDA 3EYIA 1XMAA 3IL2A 2FMYA 2M34A 1OKRA 2RREA 1J5YA 4PJ0C 2Z2SB 2MG4A 3ASOH 4A0YA 2EH3A 4A6DA 2KJBA 2MD5A 1BJZA 2R7SA 5KK1A 3CMEI 1R7JA 2MYSA 2PX9A 4PFPA 3ULQB 2Y0SN 3CUOA 4BACA 2KHMA 3KZIC 4E7IA 3M8JA 2ME0A 2Q0OA 2CQKA 4A6EA 4HX8A 2JK3A 2K5CA 4X1EA 1Y56A 3J81Z 3ABMH 3OYEA 4MEXF 4HF2A 1IV8A 4L0ZB 5E20A 3L2CA 1I3QJ 2H1LA 5HLIA 4YFKF 3CCSI 4IOCF 3CF2A 1A6IA 4UNOA 3BTCA 2EPFA 2DYRH 1P7JA 2OUMA 2Y2ZA 2KZGA 4OINF 4UB6C 2A6TA 2VJ5A 2KZVA 4DZPA 4OIPF 1TWCJ 2F5VA 2QYOA 3FISA 2HVQA 2JSCA 3W6JB 3J7ZI 2ZJQF 2ZKZA 5HOOA 2JRMA 2X9DA 1HKTA 2BXZA 2OCEA 3FF5A 1YIOA 3TQNA 3Q0WA 4EMSA 3RDIA 1ZK8A 2CYYA 4LIVA 1FSEA 1RKWA 2W7NA 1VQ8I 1LVKA 5L3DA 5J1RA 1SMTA 1PYVA 2HQNA 1I5ZA 2J5PA 3FDYA 2UXNA 2ZFUA 3RSNA 1PJRA 5K5OA 3HOTA 2K7LA 4OWRB 3F8FA 3ZMDA 3ZQQA 3CUQB 5D6EA 3G1MA 5LGNA 1XSXA 5B1BH 3AL0C 3FHNA 4AVZA 4B43A 5IYBJ 4BXUA 1FP1D 4B09A 3C7JA 3I56I 4E7JA 2Q1ZB 2LSOA 1AKHA 1ZHFA 3DPTA 4BJTA 1VF9A 3PIOF 3I53A 1SVLA 4OIQF 4L9JA 3P7NA 1RR8C 1Z6TA 3ABLH 2QEXI 3H9JA 3FK7A 1W7PB 2H8WA 4NNJA 5D5UB 5E79C 4IHYA 1G4DA 3WU0A 4BH9A 2E7XA 4E4HA 5HNHA 4WXDA 2HOSA 1ACIA 2DU9A 4II2A 2EV6A 5E18F 3LSMA 4ASNA 1TWHJ 5F6FA 4ANJA 4IF4A 2JRTA 3K0LA 1OQYA 3PL8A 1OYIA 2VN2A 3K1NA 3I59A 3I64A 2ZSHB 4YFXF 2NAZA 3LA3A 4ETSA 2VT2A 4EGYA 3OR1C 3SZGA 2PMZA 1OYYA 5FRNA 2KMUA 1IV6A 4A3IJ 4IKFA 2LKXA 2O61A 5LFAA 4HBLA 2LR8A 2EZIA 3TEDA 1MBEA 3D5LA 3RKXA 3BTJA 2L0KA 4A5NA 1MJ9A 2W1OA 4N9IA 4D5FA 3GMEA 1SMYF 1MD0A 4BHPA 1WI9A 2X0LA 3O8HA 3E0JB 1LPQA 3CCQI 3TGNA 4M3BA 4E7ZA 2Z16A 1MH4A 3ASNH 2VQLA 2L9RA 1G3SA 2QLZA 2ZXWH 1Y0NA 3CMMA 4QLCU 4HW0A 1OR7A 2VKDA 3DWLE 1TBXA 2DA3A 4ZDLA 3J7AO 2HDWA 5L3EA 4BNCA 3HHHA 2BOLA 2K9LA 3LSHA 4CHUA 4IHSA 3HOXJ 3J7AY 1R5ID 2XAQA 2XRLA 4DYCA 5BS6A 3SFZA 2STWA 2WBMA 1XGNA 4DZJA 1XS9A 2ESNA 2P5KA 3GTLJ 5FB2A 1BL0A 4IRHA 3TDZC 5JHUA 2YU9J 1Y6IA 2RDPA 2DOFA 2DXIA 3BZ6A 1MGTA 2Z33A 4R1HA 2ACJA 2DA5A 1TWFJ 2RN7A 3EUHC 3R0AA 2NXNB 2OV7A 2E19A 1FP2A 2QBYA 2LY9A 3DLLF 1P7IA 2M0CA 2LFBA 1YS7A 3ZN0A 4DJAA 3DFGA 2E5ZA 5LGTA 3E6CC 4JX6A 3BG5A 3QODA 4U88A 2BE5F 2JTVA 2LRDA 1ULYA 2X6YA 3U21A 2HOAA 4HRIA 4RS8A 2MBFA 4KNYA 1RETA 1MMGA 2HQRA 1RC9A 2PMZN 3C2BA 2IS1A 2VONA 1MBGA 1SVMA 3BJ6A 2JN6A 3KE2A 1VQMI 3FK6A 3DV8A 4BXFA 3L2RA 2V6EA 1E0EA 2D1HA 3OIPA 2XSDC 2P7CB 1YE9A 1OMIA 2DDBA 1JKPC 3LSTA 1Y0UA 1X1BA 2B0LA 1FOXA 2FD5A 5IOYA 3GZ5A 4XMYA 4OMYA 1QBJA 2HWVA 3ZMSA 3OYLA 2LY2A 2Y48A 1ON1A 1QQIA 3ZQCA 5EGOA 2LK2A 4IQJA 2J5OA 2P5VA 2XGEA 4RAZA 3CESA 3LAPA 1KQ8A 2EFNA 3Q5FA 1S72I 1OISA 3I71A 2MC3A 5IP7J 3M4OJ 3G3ZA 4V19K 4BAYA 5HS9A 1O4XA 3K7AJ 4A3CJ 4IHWA 2QF7A 2K9QA 3MKYB 4CCNA 2HI3A 3WTVC 2H1KA 5DM6F 3HL2A 2VPRA 4A2UA 4HLXA 5KHDA 1K78B 2FBHA 3HYIA 3QOEA 1XDSA 5DCFA 3CMAI 2C6YA 1FMVA 1ON2A 2R7ZJ 2KLOA 4AM3A 1WRJA 3HRSA 5H6RA 1U3EM 1IJWC 5LEKA 3TOAA 3VYUB 5FLXZ 5GPAA 2R93J 3L09A 4CCOA 1FMWA 1JUSA 3RCOA 3KCCA 2X1EA 1W5TA 1WPKA 3DBRB 3KPHA 2VE9A 3QRFF 2MABA 3G1OA 3W2WA 1O7LA 3I4NJ 1K7AA 4L9TA 2DOAA 2A69F 4BYYA 2LY1A 3KX2A 1XG1A 5C3EJ 1EH8A 2XF6A 4I99C 4IQ4A 4E70A 4Q5SF 5CVIA 1Z91A 1SD5A 1H8AC 3ZCOA 3OL4A 3DEUA 3HRUA 5JFRA 3K4KA 3NQOA 3JRBA 1Y39A 3H3ZA 2CU7A 2OJED 3TO7A 4ITVA 2LMDA 1ZH5A 3KFWX 2HFHA 3JRAA 2KL4A 1ZR4A 1G3YA 1OCOH 5CJ9A 2DA4A 3RYRA 3WTWC 1FJLA 4G7ZF 1WZ2A 3H5AA 4DNCA 2DMTA 2XAUA 1T95A 5K7HA 2O9LA 1IAWA 3IP4B 4CCKA 2R92J 3BG9A 2YR2A 5JLWA 3TL4X 3FX3A 2ZMEC 3QP6A 1ETVA 4UUTA 2XSJC 1TNTA 2LVSA 2VBZA 1WJFA 4IVNA 1V5FA 2GXGA 2W84A 2O6GE 2WV1A 2FRHA 3MMYB 3OY9A 3FIWA 3I9V2 1FIAA 4QPOA 1V4RA 2Y30A 1X58A 2ETHA 4FTHA 1Q1HA 1VQ6I 5B3SH 5GTHC 2H27A 1YJNI 3PNVA 2WA0A 4KJZA 3HOVJ 1BW5A 2VJIA 4G12A 3HGYA 2P7VB 1WGXA 4XOTA 2FOWA 3F3XA 4A3MJ 2BXYA 2E7WA 1T0FC 3AG3H 1R1TA 4KN7X 1QVTA 3DPLC 4FISA 3P9IA 3BLYA 4BHCA 4E6KG 3F8MA 2FUG2 3OOPA 4Y17A 1TT5B 2ESHA 2DQLA 5FKNA 3WU2C 2GLOA 3JAMK 1F9NA 1DU0A 3HTSB 3G4SI 2PJRB 4XKCA 5DUIA 2XV4S 1OCTC 3DXJF 1MIJA 3N97A 5BOXA 1QRYA 3KYDB 2WAQA 3HOWJ 4LG0A 4UVAA 5IT3A 1B4AA 3BTIA 2A5WA 2TDXA 2B7EA 1YOVB 2WWYA 2EIMH 1QGPA 2BHZA 3CCEI 2HDCA 1WQ2A 1S7EA 2LREA 4L5JA 3F6VA 4BQQA 4HV6A 4XSZF 4UUSA 1TT0A 3FMRA 4AD9A 4BE1A 9ANTA 2CQXA 1XDUA 1PP8F 5F04A 3ZGKA 3H0DA 3S2HJ 2K02A 2OAZA 3WTXC 3DEEA 1T33A 1TP4A 5FJ8J 2M3AA 1UG2A 1FSHA 2EQRA 3AL0B 2LTPA
chains in the Genus database with same CATH topology
1G2HA 5DTDA 2GM4A 5F08A 2HOTA 3MKLA 3Q3SA 5J3LA 3BR6A 3ZOBA 3HOZJ 2TCTA 3PO3J 2L7FP 5FKMA 1IRZA 1GUUA 1MSFC 1RKTA 3ZQFA 4IEJA 1TWGJ 2OF7A 1MBJA 2ECBA 2NVTJ 2K40A 3Q0UA 1W0TA 4MIMA 1JTYA 2O8KA 4Y52J 4A69C 1QPIA 3IH2A 1YRNA 2XPVA 3A01B 2KT0A 1GV5A 1VI0A 2E2IJ 1ETQA 2M2EA 1WH5A 3FKIJ 3Q0VA 1MSEC 3IV5A 1JKOC 2WAQN 1EF4A 2ZB9A 5IYDJ 3HEFA 3BR1A 3BTLA 4GFBA 1JUMA 2Y9YA 3MVPA 5FKKA 1RPWA 1NK2P 3JRDA 3HGGA 4EEFG 2M34A 2AHQA 1HCRA 5GPCA 2OPTA 2MG4A 2EH3A 2Y9ZA 1ETYA 3GTOJ 1BJZA 1H89C 2M8GX 2Y0SN 2CQQA 1JUPA 2NOGA 4A3EJ 2ME0A 2JK3A 2NVYJ 3A02A 1HF0A 2ID3A 3TW6A 4X1EA 2VUMJ 5GP9A 2NVXJ 1Y1VJ 1I3QJ 3ZQGA 2E1OA 4DW6A 1A6IA 2EBIA 1ZKGA 3BTCA 3IH4A 1P7JA 2Y2ZA 5E3NA 1MBKA 5F0FA 1I50J 4DZPA 4MO7A 1TWCJ 1XC5A 4AUXA 1HLVA 5FLVA 1ZGWA 3HOYJ 3FISA 1JGGA 3JREA 2VKVA 1GT0C 1ZQ3P 2X9DA 3HM5A 3Q0WA 1ZK8A 5IP6A 3S1RJ 2X6OA 1RKWA 1NTCA 3BR5A 3HBLA 2XB0X 5J1RA 4DYRA 4D7MA 3TW7A 1POGA 5BNGA 1GDTA 1PUFA 4B4CA 4D5CA 3DCFA 5EG0B 1IDYA 1OJLA 4A3KJ 3H3VK 1OFCX 4AC0A 3G1MA 3B6CA 2JJ7A 1QVUA 3WHBA 4AYBN 5IOZA 1Z77A 5IYBJ 2W48A 1ETOA 3CDLA 1AKHA 3LSRA 1VF9A 2JA7J 4HNVA 2D5VA 2LP0A 2RAEA 2XGDA 5M5XJ 3PM1A 2WB1N 1CQTA 4XIDA 1FEXA 5EGOB 3FK7A 1U8BA 4A3JJ 1AKHB 3A01A 4IHYA 2MSYA 1BA5A 3CQZJ 1RR7A 4V2GA 3LSGA 2DN0A 5M5YJ 2HOSA 1X2NA 2Y31A 1JJ8C 2K9SA 1LFUP 3F0CA 1TWHJ 4JYKA 2CRGA 2G0EA 3RKQA 2E2HJ 3I4MJ 1A5JA 5C4XJ 3LOCA 5K7FA 4M3EA 1IV6A 4A3IJ 1WCMJ 2LKXA 1FIPA 3JRFA 1U9OA 2LR8A 5HODA 2EZIA 3TEDA 1ETWA 1MBEA 1APLC 3BTJA 2L0KA 4D5FA 2DMPA 3S1QJ 2B63J 3O8HA 1ZTRA 1LE8B 1GV2A 4M3BA 1VFCA 1MH4A 1TWAJ 2I10A 2L9RA 3DEWA 2IBDA 3ZQIA 1SANA 3GTPJ 4C2MJ 4XRSA 2FX0A 3W6VA 2DA3A 1BW6A 3GTJJ 4M3FA 2R5YA 3HOXJ 2NS8A 2IEKA 2XRLA 4MFEA 4DYCA 1AU7A 3SDGA 2EZLA 4CYCB 2YS9A 4DZJA 1XS9A 3GTLJ 1BL0A 2E2JJ 4NDLA 2HXIA 5EYRA 2YU9J 4B3AA 3BR0A 4W97A 4C3IJ 2R5YB 2IAIA 1X2MA 4D7NA 1JKRC 1FTZA 2TRTA 2DA5A 1TWFJ 4ABZA 3GTGJ 2MGQA 2EZKA 2E19A 1ITYA 1DU6A 2LY9A 1P7IA 2M0CA 2LFBA 3HKZN 3JRIA 2ME6A 1R9TJ 1ETXA 4JX6A 5M3MJ 5J1UA 5DS9A 3BG5A 1JT6A 5K7ZA 4MLOA 2FJ1A 4XRMA 1MBHA 1NK3P 4QTRA 2HOAA 4RDUA 1RETA 3MN2A 1B8IB 1TC3C 3C2BA 2JA6J 2PMZN 3K2AA 3CCYA 4FE7A 3BR3A 1MBGA 5EG0A 4M3DA 2JN6A 2H8RA 3ZQHA 1IC8A 2QCOA 5IP9J 4C3JJ 2CUFA 3FK6A 3S15J 3S1NJ 2XSDC 2LD5A 5C44J 2JMWA 3A03A 1JKPC 4BBRJ 1WH7A 2FD5A 5IOYA 2L7ZA 2X48A 1JTXA 3JR9A 4S0HB 1W0UA 3GBGA 2DA2A 3ZQCA 1AHDP 5EGOA 2LK2A 2XGEA 1IG7A 3SFIA 5C4JJ 4QSHA 4Y7NJ 2HYJA 4FCYA 3SJMA 2K9NA 2JA5J 3M3YJ 1LFBA 1UMQA 1B72B 3LSPA 5IP7J 3M4OJ 2DA7A 3QPSA 1ZR2A 5IYCJ 1O4XA 3K7AJ 1F36A 4A3CJ 4IHWA 2QF7A 2K9QA 5F27A 3CMYA 1HDPA 2HI3A 2H1KA 3S17J 2COBA 5F0CA 5E3MA 2HDDA 2VPRA 1JKQC 4IHVA 4UUSB 3D1NI 1GVDA 2CJJA 4A3BJ 1Z0XA 3BQZA 5EZHA 4FE4A 2R7ZJ 2LLKA 1SFOJ 2JA8J 2JWTA 5FKLA 2L7MP 5FKOA 2GBYA 4XRSG 2R0QC 2KDZA 3RQIA 5E3LA 3H0GJ 3OSGA 1T56A 2AO9A 1VNDA 1IJWC 2O7OA 3QQAA 5GPAA 4RBOA 3RZDJ 1LE8A 4M3GA 2R93J 4A3GJ 2M9HA 1JT0A 3HOUJ 1JUSA 4XK4A 1WPKA 3JRGA 3BQYA 3G1OA 3I4NJ 5JLXA 4J19A 3HDDA 2DMNA 4A3DJ 1XG1A 5C3EJ 2DA1A 4JX5A 4CYCA 3S14J 3NARA 5EEAA 1H8AC 3QPLA 2VI6A 2NS7A 1RESA 3L1PA 4BKXA 2DA6A 3JRBA 5IPAA 3ZQLA 4BY1J 2CU7A 3JRCA 1Y1WJ 1ZR4A 3JRAA 3S16J 1YRNB 3PO2J 2DA4A 3E7LA 5FLMJ 1FJLA 1UHSA 4C3HJ 2N8GA 3WHCA 3LNQA 2DMTA 1HOMA 4DYQA 3GTMJ 5K7HA 4QIWN 2O9LA 1Q1VA 5E3OA 2R92J 2MW8A 3BG9A 2XPUA 3TP0A 1HDDC 1K83J 5JLWA 1ETVA 4UUTA 3OSFA 3RZOJ 4A93J 2LVSA 4JX4A 4XICA 4BBSJ 3IH3A 1ENHA 5EDNA 1B8IA 2WV1A 2HQ5A 4IHXA 2ID6A 3FIWA 4B1RA 1FIAA 1JJ6C 2DMQA 2Y30A 1X58A 5EF6A 5F1JA 5EZGA 2ELKA 4FTHA 2CUEA 4BXXJ 3UKGA 3OOUA 3S1MJ 2HXOA 3HOVJ 4W1UA 1E3OC 1BW5A 1IDZA 1MH3A 4JP0A 5M5WJ 2P81A 4G12A 2DTZA 3HB9A 1IGNA 3HGYA 5M3FJ 1D5YA 1WGXA 4A3MJ 1WI3A 1QVTA 3B6AA 4FISA 3NAUA 4M6VA 5FKNA 1MNMC 2GLOA 1DU0A 1FTTA 3JRHA 3BT9A 1OCPA 2XPWA 3GTQJ 2DMUA 1OCTC 1ORKA 4X6AJ 1QRYA 2XB5A 1B72A 4L5EA 4BY7J 4V2FA 2EZHA 3HOWJ 3BG3A 2R5ZA 2YUSA 1U78A 1K61A 3BTIA 4MFDA 2FQ4A 5J1YA 3G1LA 1S7EA 2DJNA 1I6HJ 3S2DJ 4UUSA 4LOCA 3TP3A 1MBFA 9ANTA 4A3FJ 3GTKJ 2R5ZB 2CQXA 4I76A 5F04A 1IUFA 3S2HJ 3LSJA 3VPRA 2XGCA 3BR2A 1ETKA 3O8GA 3OIOA 2NVQJ 1PUFB 1T33A 1U9NA 1H88C 4A3LJ 5FJ8J 1UG2A 5F0HA 2EQRA 2ECCA 2VKEA 4I6ZA 1F43A 2LTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2H A;  5DTD A;  2GM4 A;  5F08 A;  2HOT A;  3MKL A;  3Q3S A;  5J3L A;  3BR6 A;  3ZOB A;  3HOZ J;  2TCT A;  3PO3 J;  2L7F P;  5FKM A;  1IRZ A;  1GUU A;  1MSF C;  1RKT A;  3ZQF A;  4IEJ A;  1TWG J;  2OF7 A;  1MBJ A;  2ECB A;  2NVT J;  2K40 A;  3Q0U A;  1W0T A;  4MIM A;  1JTY A;  2O8K A;  4Y52 J;  4A69 C;  1QPI A;  3IH2 A;  1YRN A;  2XPV A;  3A01 B;  2KT0 A;  1GV5 A;  1VI0 A;  2E2I J;  1ETQ A;  2M2E A;  1WH5 A;  3FKI J;  3Q0V A;  1MSE C;  3IV5 A;  1JKO C;  2WAQ N;  1EF4 A;  2ZB9 A;  5IYD J;  3HEF A;  3BR1 A;  3BTL A;  4GFB A;  1JUM A;  2Y9Y A;  3MVP A;  5FKK A;  1RPW A;  1NK2 P;  3JRD A;  3HGG A;  4EEF G;  2M34 A;  2AHQ A;  1HCR A;  5GPC A;  2OPT A;  2MG4 A;  2EH3 A;  2Y9Z A;  1ETY A;  3GTO J;  1BJZ A;  1H89 C;  2M8G X;  2Y0S N;  2CQQ A;  1JUP A;  2NOG A;  4A3E J;  2ME0 A;  2JK3 A;  2NVY J;  3A02 A;  1HF0 A;  2ID3 A;  3TW6 A;  4X1E A;  2VUM J;  5GP9 A;  2NVX J;  1Y1V J;  1I3Q J;  3ZQG A;  2E1O A;  4DW6 A;  1A6I A;  2EBI A;  1ZKG A;  3BTC A;  3IH4 A;  1P7J A;  2Y2Z A;  5E3N A;  1MBK A;  5F0F A;  1I50 J;  4DZP A;  4MO7 A;  1TWC J;  1XC5 A;  4AUX A;  1HLV A;  5FLV A;  1ZGW A;  3HOY J;  3FIS A;  1JGG A;  3JRE A;  2VKV A;  1GT0 C;  1ZQ3 P;  2X9D A;  3HM5 A;  3Q0W A;  1ZK8 A;  5IP6 A;  3S1R J;  2X6O A;  1RKW A;  1NTC A;  3BR5 A;  3HBL A;  2XB0 X;  5J1R A;  4DYR A;  4D7M A;  3TW7 A;  1POG A;  5BNG A;  1GDT A;  1PUF A;  4B4C A;  4D5C A;  3DCF A;  5EG0 B;  1IDY A;  1OJL A;  4A3K J;  3H3V K;  1OFC X;  4AC0 A;  3G1M A;  3B6C A;  2JJ7 A;  1QVU A;  3WHB A;  4AYB N;  5IOZ A;  1Z77 A;  5IYB J;  2W48 A;  1ETO A;  3CDL A;  1AKH A;  3LSR A;  1VF9 A;  2JA7 J;  4HNV A;  2D5V A;  2LP0 A;  2RAE A;  2XGD A;  5M5X J;  3PM1 A;  2WB1 N;  1CQT A;  4XID A;  1FEX A;  5EGO B;  3FK7 A;  1U8B A;  4A3J J;  1AKH B;  3A01 A;  4IHY A;  2MSY A;  1BA5 A;  3CQZ J;  1RR7 A;  4V2G A;  3LSG A;  2DN0 A;  5M5Y J;  2HOS A;  1X2N A;  2Y31 A;  1JJ8 C;  2K9S A;  1LFU P;  3F0C A;  1TWH J;  4JYK A;  2CRG A;  2G0E A;  3RKQ A;  2E2H J;  3I4M J;  1A5J A;  5C4X J;  3LOC A;  5K7F A;  4M3E A;  1IV6 A;  4A3I J;  1WCM J;  2LKX A;  1FIP A;  3JRF A;  1U9O A;  2LR8 A;  5HOD A;  2EZI A;  3TED A;  1ETW A;  1MBE A;  1APL C;  3BTJ A;  2L0K A;  4D5F A;  2DMP A;  3S1Q J;  2B63 J;  3O8H A;  1ZTR A;  1LE8 B;  1GV2 A;  4M3B A;  1VFC A;  1MH4 A;  1TWA J;  2I10 A;  2L9R A;  3DEW A;  2IBD A;  3ZQI A;  1SAN A;  3GTP J;  4C2M J;  4XRS A;  2FX0 A;  3W6V A;  2DA3 A;  1BW6 A;  3GTJ J;  4M3F A;  2R5Y A;  3HOX J;  2NS8 A;  2IEK A;  2XRL A;  4MFE A;  4DYC A;  1AU7 A;  3SDG A;  2EZL A;  4CYC B;  2YS9 A;  4DZJ A;  1XS9 A;  3GTL J;  1BL0 A;  2E2J J;  4NDL A;  2HXI A;  5EYR A;  2YU9 J;  4B3A A;  3BR0 A;  4W97 A;  4C3I J;  2R5Y B;  2IAI A;  1X2M A;  4D7N A;  1JKR C;  1FTZ A;  2TRT A;  2DA5 A;  1TWF J;  4ABZ A;  3GTG J;  2MGQ A;  2EZK A;  2E19 A;  1ITY A;  1DU6 A;  2LY9 A;  1P7I A;  2M0C A;  2LFB A;  3HKZ N;  3JRI A;  2ME6 A;  1R9T J;  1ETX A;  4JX6 A;  5M3M J;  5J1U A;  5DS9 A;  3BG5 A;  1JT6 A;  5K7Z A;  4MLO A;  2FJ1 A;  4XRM A;  1MBH A;  1NK3 P;  4QTR A;  2HOA A;  4RDU A;  1RET A;  3MN2 A;  1B8I B;  1TC3 C;  3C2B A;  2JA6 J;  2PMZ N;  3K2A A;  3CCY A;  4FE7 A;  3BR3 A;  1MBG A;  5EG0 A;  4M3D A;  2JN6 A;  2H8R A;  3ZQH A;  1IC8 A;  2QCO A;  5IP9 J;  4C3J J;  2CUF A;  3FK6 A;  3S15 J;  3S1N J;  2XSD C;  2LD5 A;  5C44 J;  2JMW A;  3A03 A;  1JKP C;  4BBR J;  1WH7 A;  2FD5 A;  5IOY A;  2L7Z A;  2X48 A;  1JTX A;  3JR9 A;  4S0H B;  1W0U A;  3GBG A;  2DA2 A;  3ZQC A;  1AHD P;  5EGO A;  2LK2 A;  2XGE A;  1IG7 A;  3SFI A;  5C4J J;  4QSH A;  4Y7N J;  2HYJ A;  4FCY A;  3SJM A;  2K9N A;  2JA5 J;  3M3Y J;  1LFB A;  1UMQ A;  1B72 B;  3LSP A;  5IP7 J;  3M4O J;  2DA7 A;  3QPS A;  1ZR2 A;  5IYC J;  1O4X A;  3K7A J;  1F36 A;  4A3C J;  4IHW A;  2QF7 A;  2K9Q A;  5F27 A;  3CMY A;  1HDP A;  2HI3 A;  2H1K A;  3S17 J;  2COB A;  5F0C A;  5E3M A;  2HDD A;  2VPR A;  1JKQ C;  4IHV A;  4UUS B;  3D1N I;  1GVD A;  2CJJ A;  4A3B J;  1Z0X A;  3BQZ A;  5EZH A;  4FE4 A;  2R7Z J;  2LLK A;  1SFO J;  2JA8 J;  2JWT A;  5FKL A;  2L7M P;  5FKO A;  2GBY A;  4XRS G;  2R0Q C;  2KDZ A;  3RQI A;  5E3L A;  3H0G J;  3OSG A;  1T56 A;  2AO9 A;  1VND A;  1IJW C;  2O7O A;  3QQA A;  5GPA A;  4RBO A;  3RZD J;  1LE8 A;  4M3G A;  2R93 J;  4A3G J;  2M9H A;  1JT0 A;  3HOU J;  1JUS A;  4XK4 A;  1WPK A;  3JRG A;  3BQY A;  3G1O A;  3I4N J;  5JLX A;  4J19 A;  3HDD A;  2DMN A;  4A3D J;  1XG1 A;  5C3E J;  2DA1 A;  4JX5 A;  4CYC A;  3S14 J;  3NAR A;  5EEA A;  1H8A C;  3QPL A;  2VI6 A;  2NS7 A;  1RES A;  3L1P A;  4BKX A;  2DA6 A;  3JRB A;  5IPA A;  3ZQL A;  4BY1 J;  2CU7 A;  3JRC A;  1Y1W J;  1ZR4 A;  3JRA A;  3S16 J;  1YRN B;  3PO2 J;  2DA4 A;  3E7L A;  5FLM J;  1FJL A;  1UHS A;  4C3H J;  2N8G A;  3WHC A;  3LNQ A;  2DMT A;  1HOM A;  4DYQ A;  3GTM J;  5K7H A;  4QIW N;  2O9L A;  1Q1V A;  5E3O A;  2R92 J;  2MW8 A;  3BG9 A;  2XPU A;  3TP0 A;  1HDD C;  1K83 J;  5JLW A;  1ETV A;  4UUT A;  3OSF A;  3RZO J;  4A93 J;  2LVS A;  4JX4 A;  4XIC A;  4BBS J;  3IH3 A;  1ENH A;  5EDN A;  1B8I A;  2WV1 A;  2HQ5 A;  4IHX A;  2ID6 A;  3FIW A;  4B1R A;  1FIA A;  1JJ6 C;  2DMQ A;  2Y30 A;  1X58 A;  5EF6 A;  5F1J A;  5EZG A;  2ELK A;  4FTH A;  2CUE A;  4BXX J;  3UKG A;  3OOU A;  3S1M J;  2HXO A;  3HOV J;  4W1U A;  1E3O C;  1BW5 A;  1IDZ A;  1MH3 A;  4JP0 A;  5M5W J;  2P81 A;  4G12 A;  2DTZ A;  3HB9 A;  1IGN A;  3HGY A;  5M3F J;  1D5Y A;  1WGX A;  4A3M J;  1WI3 A;  1QVT A;  3B6A A;  4FIS A;  3NAU A;  4M6V A;  5FKN A;  1MNM C;  2GLO A;  1DU0 A;  1FTT A;  3JRH A;  3BT9 A;  1OCP A;  2XPW A;  3GTQ J;  2DMU A;  1OCT C;  1ORK A;  4X6A J;  1QRY A;  2XB5 A;  1B72 A;  4L5E A;  4BY7 J;  4V2F A;  2EZH A;  3HOW J;  3BG3 A;  2R5Z A;  2YUS A;  1U78 A;  1K61 A;  3BTI A;  4MFD A;  2FQ4 A;  5J1Y A;  3G1L A;  1S7E A;  2DJN A;  1I6H J;  3S2D J;  4UUS A;  4LOC A;  3TP3 A;  1MBF A;  9ANT A;  4A3F J;  3GTK J;  2R5Z B;  2CQX A;  4I76 A;  5F04 A;  1IUF A;  3S2H J;  3LSJ A;  3VPR A;  2XGC A;  3BR2 A;  1ETK A;  3O8G A;  3OIO A;  2NVQ J;  1PUF B;  1T33 A;  1U9N A;  1H88 C;  4A3L J;  5FJ8 J;  1UG2 A;  5F0H A;  2EQR A;  2ECC A;  2VKE A;  4I6Z A;  1F43 A;  2LTP A; 
#chains in the Genus database with same CATH topology
 1I6X A;  3U1K A;  1QHH D;  4MTE A;  4RB3 C;  2EWN A;  5B5E C;  2LF8 A;  4I98 B;  2HYG D;  4FAS D;  3MKL A;  5J3L A;  4BUP A;  1FOW A;  2QWW A;  2JA2 A;  1R5H A;  3LFK A;  2TCT A;  1IXR C;  2QA4 I;  1Z3X A;  5L3G A;  5FKM A;  1GUU A;  3HUG B;  2A05 A;  3FBI B;  2Q2E B;  2ISY A;  2OF7 A;  1MBJ A;  3RKW A;  2M4G A;  2M0M A;  2XKP A;  2K40 A;  3Q0U A;  5HLT A;  4DOZ A;  5E1X A;  2O8K A;  5K5R A;  2R7T A;  4A69 C;  3JSO A;  1FOK A;  3I55 I;  3MKZ A;  2EB7 A;  1YRN A;  1X4P A;  2HVR A;  1VI0 A;  3KZZ A;  2E2I J;  1ETQ A;  4M71 A;  4XRF A;  3BCA A;  1ZEL A;  2BY2 A;  3T8R A;  3CO7 C;  1USS A;  1WH5 A;  1BN5 A;  3IV5 A;  2WAQ N;  5HS8 A;  1KON A;  3WE2 A;  4GFB A;  2VOO A;  3QYE A;  1AOY A;  3I4P A;  1LFP A;  1UG0 A;  2DDA A;  4F3Q A;  1RPW A;  1BIA A;  3GLL A;  2M8E A;  3L2Q A;  2RNG A;  3HGG A;  4EEF G;  2LC2 A;  1HCR A;  5AON A;  2Q8K A;  1BI1 A;  2MH9 A;  2BY3 A;  5F64 A;  3K4N A;  4XKV A;  4L9V A;  2VBW A;  2H6C A;  2XF7 A;  3JW4 A;  4YIR X;  3ZMU A;  1P6R A;  4I09 A;  4B44 A;  3M1E A;  1HF0 A;  2ID3 A;  4CCJ A;  1HKS A;  1PP7 U;  2DW4 A;  1OCZ H;  4N0B A;  1Z05 A;  2NVX J;  1Y1V J;  4A12 A;  4CDG A;  5HDN A;  2MC4 A;  5CQE A;  3OYI A;  5JHF A;  3ERM A;  3BOQ A;  1R23 A;  2E5N A;  2JQ7 A;  4UUV A;  5E3N A;  4CZZ A;  4S04 A;  3G2B A;  1MBK A;  1MMD A;  4IXA A;  4UVB A;  1B1B A;  5F0F A;  1JE8 A;  4KMF A;  4MO7 A;  1DDN A;  1ZGW A;  4AIJ A;  1JGG A;  5GAH J;  2O8X A;  3JRE A;  3ELK A;  1GT0 C;  3KYC B;  1S7O A;  4UVC A;  5JVG F;  3HM5 A;  2GIZ A;  3EUA A;  3O3K A;  3GZN B;  5IP6 A;  1YJW I;  2DOE A;  2IVM A;  4DYR A;  3IAS 2;  1SFX A;  4D7M A;  3VYR B;  2L2O A;  4ON0 A;  1GDT A;  5DV5 A;  2DJI A;  1CF7 B;  3KLO A;  1PUF A;  2F5F A;  1GXP A;  2IGM A;  2ZNY A;  2XKO A;  4LIU A;  2ICW G;  5EJC A;  4CIC A;  2IT0 A;  4D5C A;  3IC7 A;  5EG0 B;  1OJL A;  1XB4 A;  5EEH A;  3ABU A;  3BP8 A;  4AC0 A;  4Z6Y A;  4JOM A;  2JJ7 A;  4EM2 A;  3S8P A;  2UXX A;  5IT9 Z;  3L9F A;  1IXS B;  3V8L A;  3ZP5 A;  1W7P A;  4AIH A;  4GGG A;  2UZK A;  4B48 A;  3MEX A;  3LSR A;  2P8T A;  2MLK A;  3FXQ A;  4HYE A;  2KRC A;  2CW7 A;  4PFO A;  4BDY A;  2RAE A;  2VL8 A;  5LHI A;  3FXL A;  1CQT A;  4Q4Z F;  1HKQ A;  3DBH B;  2RQP A;  2JSP A;  1NH3 A;  1LKX A;  1Z9C A;  4A3J J;  3OIQ A;  1IN5 A;  2MSY A;  2F4O B;  3CQZ J;  3F8C A;  4E7H A;  2DFH A;  1BA5 A;  1RR7 A;  2VIX A;  1X2N A;  2Y31 A;  2K9S A;  2HKO A;  2OTJ I;  1UCR A;  3F0C A;  4CA0 A;  2CRG A;  2G0E A;  3I4M J;  2F6C A;  4C2T A;  4BQN A;  1T98 A;  4QPQ A;  2HVS A;  4I7H A;  4F52 A;  5BPI A;  2CFO A;  1MND A;  1D1C A;  5GAG J;  3QPT A;  1FIP A;  3JRF A;  1U9O A;  5HOD A;  3BJA A;  1K4S A;  3WGI A;  1T8I A;  1ETW A;  1XGS A;  2QSG X;  1T6S A;  3PIP F;  1S7A A;  4FHT A;  4XLN F;  4ZDO A;  3GYH X;  3S1Q J;  2IA1 A;  4BGD A;  5K1Y A;  2B63 J;  1ZTR A;  3E5X A;  1LE8 B;  4RA2 A;  4M9S A;  1GV2 A;  2HS5 A;  1VFC A;  1REP C;  3SHF A;  1ZG3 A;  4E7S A;  3OYN A;  3ZMT A;  3DF8 A;  2KP6 A;  1HC8 A;  3GTP J;  3F9K A;  2FX0 A;  1Z21 A;  4G7O F;  1H9T A;  1BW6 A;  3GTJ J;  3RIR A;  4BL0 B;  3CJQ B;  2E34 A;  2NS8 A;  4CSW A;  2UWM A;  2QEN A;  1DPU A;  4PJJ A;  1NG7 A;  2EZL A;  2H94 A;  4CYC B;  1PVE A;  2YS9 A;  5LBQ A;  3GXO A;  1MMN A;  2CWE A;  4PGH A;  3HXL A;  2QVO A;  2E2J J;  3CP2 A;  2W24 A;  3DU6 A;  4NQW A;  4B3A A;  1KA8 A;  1G3W A;  4C3I J;  3GX4 X;  2R5Y B;  2L9V A;  3CD6 I;  2KJC A;  3MAJ A;  2TRT A;  3SZP A;  2RVC A;  2WAE A;  2XAF A;  3C2H A;  2MGQ A;  5D5V B;  3CCM I;  5E17 F;  3OR2 C;  3D0S A;  1DU6 A;  2ZME B;  1I39 A;  1YLF A;  2RC4 A;  2GA1 A;  5M3M J;  2ZCW A;  1JGS A;  5J1U A;  2OD5 A;  1SD7 A;  2NVU B;  3WTU C;  3CCJ I;  4IZZ A;  4HST A;  1NK3 P;  4QTR A;  1S3J A;  4HA8 A;  4WK8 F;  2OTL I;  2L01 A;  4AID A;  3B02 A;  3DTK A;  3LA2 A;  5CVV A;  3AG4 H;  1B8I B;  3K2A A;  2UV1 A;  1MDM B;  3LMM A;  3RYP A;  2EV0 A;  3L2V A;  1IC8 A;  2DK5 A;  2CUF A;  4MNU A;  4ZH4 F;  3S1N J;  1IN8 A;  3LL7 A;  2MFZ A;  2DQR A;  5ICG A;  4F92 B;  3BJO A;  1I1G A;  1KU2 A;  1G8X A;  4ENM A;  4BBR J;  4B3X A;  2YU3 A;  3MKW B;  1XSD A;  2X48 A;  4KIF A;  3V7C A;  1P4W A;  1B9M A;  4E7K A;  2ELJ A;  2IA0 A;  3TO9 A;  2OZU A;  3H5R A;  1EH6 A;  2DA2 A;  2RGV A;  1UST A;  4XLC A;  4I0B A;  4AU7 A;  3VWB A;  3P9K A;  1W1W E;  4QSH A;  4Y7N J;  2HYJ A;  4FCY A;  3SJM A;  2JA5 J;  2CW8 A;  3M3Y J;  1LFB A;  3VOE A;  3PSF A;  3CCL I;  2JUG A;  5CQG A;  5FFX A;  3OYG A;  2HR3 A;  4IX7 A;  2PI0 A;  2JZY A;  4F91 B;  2COB A;  5DEQ A;  4XOP A;  4ENJ A;  2XAH A;  2BGC A;  1YIJ I;  2A5Y B;  4LLN A;  5AIP A;  1GVD A;  4KT5 C;  2CJJ A;  1ZG5 A;  2FQ3 A;  2WY7 Q;  3CF5 F;  1LVA A;  3BQZ A;  5EZH A;  4FE4 A;  2VBX A;  1SFO J;  2JA8 J;  1K6Y A;  3WU1 B;  2L7M P;  4NBQ A;  5FKO A;  2GBY A;  1V55 H;  1S6L A;  1XTA A;  2KDZ A;  2F4I A;  5E3L A;  5IY5 H;  3OSG A;  1T56 A;  1S8N A;  3CC4 I;  5DDG A;  3QQA A;  1T39 A;  3RZD J;  3HPG A;  4M9Z A;  4BQA A;  4A3G J;  2M9H A;  1JT0 A;  4CGZ A;  2JT1 A;  4XLA A;  3JRG A;  1E3H A;  4IRG A;  5ILS A;  3F8B A;  3HDD A;  2D45 A;  2MD0 A;  1UAA A;  3FXR A;  3A1Y A;  4HQE A;  2KRF A;  1V54 H;  2YPR A;  3OYJ A;  2EIN H;  1BBY A;  5LHH A;  1XCV A;  4CZC A;  5CVR A;  5IPA A;  3ZQL A;  2VKH A;  1Y1W J;  4LMY A;  3VYS B;  2F2E A;  2DT6 A;  2G7H A;  1V5E A;  1XMX A;  3ML6 A;  4C3H J;  3LNQ A;  1HOM A;  1Q1V A;  4G9Y A;  3HSE A;  1DUX C;  3EDP A;  4P96 A;  4YEJ A;  2DLL A;  3IKT A;  3K69 A;  1HDD C;  2LBF A;  4M6X A;  4KIB A;  3S93 A;  2COM A;  3RZO J;  1IN6 A;  2DI3 A;  4N9H A;  3IH3 A;  1KU7 A;  2M4K A;  5JI6 A;  4RMN A;  5ICF A;  1ENH A;  1KGS A;  4A5M A;  1HW5 A;  2HQ5 A;  2L9S A;  2ID6 A;  2V7F A;  4CYD A;  4EQQ A;  4IHX A;  1T38 A;  1TZL A;  1L0O C;  4IJA A;  3OYH A;  4HDV A;  2PLY A;  5EF6 A;  1D5V A;  5F1J A;  2KFD A;  3N4M A;  5EZG A;  5D4S A;  3UKG A;  5TJJ A;  1Z67 A;  4M74 A;  3E97 A;  4HAM A;  1GHC A;  2P81 A;  5DD4 A;  2V4J C;  4C30 A;  1VQ7 I;  5DM7 F;  2PJR A;  4UB8 C;  3IWF A;  4LB5 A;  3K10 A;  3K4M A;  3AG2 H;  2XF5 A;  1WKM A;  1O3S A;  3WOD F;  3K4J A;  3KP3 A;  3NAU A;  1FT9 A;  3G73 A;  4M6V A;  1MNM C;  1UZC A;  4MQV A;  1OCP A;  2EFW A;  2DMU A;  3JSP A;  2D1V A;  1GXQ A;  2ZNZ A;  2XB5 A;  3T5X A;  1R36 A;  2PEX A;  1X3U A;  4Y13 A;  1B72 A;  2VXZ A;  3BG3 A;  1BIB A;  2YUS A;  1BJA A;  1U5T C;  1U78 A;  2DTR A;  4II3 A;  2FNA A;  1VZ0 A;  3FXK A;  4OAY A;  4S05 A;  3MCZ A;  3L2U A;  4JBA A;  4JQF A;  5J1Y A;  4XON A;  2O5R A;  4ZTJ A;  2VXD A;  1YW9 A;  4RAY A;  4EV0 A;  4Q48 A;  3KP2 A;  5CYV A;  4LOC A;  3TP3 A;  1R4M B;  2AS5 F;  4XM3 A;  4D1Q A;  3U1D A;  2P5L C;  4CO8 A;  2DPU A;  2BY1 A;  5LRR A;  3UR3 C;  4ZZL A;  1ZRD A;  1VQ5 I;  2X6W A;  2XGC A;  2V1D A;  3OIO A;  3R60 A;  4C9Y A;  4E7L A;  4FQG A;  1W5C C;  2E36 A;  1U9N A;  2XVC A;  4O3M A;  1FBQ A;  2L4M A;  4IHT A;  3GLX A;  1F43 A;  3CCV I;  3BPX A;  4Y15 A;  4HOB A;  4I6Z A;  4UV9 A;  3PUF A;  4BU2 A;  4YRV A;  5AIQ A;  3WTZ A;  2GXB A;  3HRT A;  2BHY A;  4D9J A;  5A2Q Z;  3CCU I;  1R71 A;  3F22 A;  5DTD A;  1BC7 C;  4XNF A;  5CKT A;  1RUN A;  5TRD A;  1R58 A;  1Y8Q B;  2LKP A;  3DTE A;  3RI4 A;  3BG6 A;  3ZOB A;  2AQE A;  3PO3 J;  3SYT A;  1RKT A;  3ZQF A;  3BZK A;  1FPQ A;  3KP7 A;  2X85 A;  4WX9 A;  2VOD A;  4BHB A;  1H9G A;  1WJE A;  1V3F A;  2IPQ X;  5HDG A;  1QPI A;  2KKO A;  1SFK A;  3CZ6 A;  1T08 B;  3IAM 2;  2BYV E;  3SEQ A;  4RM3 A;  4M6Y A;  2V1N A;  2EA4 A;  2DFI A;  2ZJ2 A;  5FRO A;  3K4B A;  2M2E A;  5FD6 A;  4RGX A;  2HZT A;  4ZDP A;  2FU4 A;  2NNN A;  3TBI A;  2ZB9 A;  2R7W A;  5IYD J;  1EF4 A;  3E6B A;  2FA5 A;  3I59 B;  4PJN A;  3HEF A;  3BTL A;  3DQV C;  1JUM A;  4IRI A;  2O03 A;  1UB9 A;  4I2O A;  1V5G A;  3RQ4 A;  3ERE D;  3BWG A;  4OU0 A;  4GCV A;  5H20 A;  4RAF A;  4HDU A;  3CC7 I;  2R7V A;  2AHQ A;  2QSF X;  2OPT A;  4DGW B;  4AYB A;  3LSK A;  1WJB A;  3T0Y A;  3J7Y J;  1ETY A;  2FE3 A;  3GTO J;  1H89 C;  2M8G X;  2QQB A;  1IRX A;  1JUP A;  1N77 A;  2W25 A;  3E5U A;  4ESF A;  1YHQ I;  3IRR A;  1MMA A;  2XUB A;  1SD4 A;  3A02 A;  4P55 A;  3R6S A;  1BOA A;  1WFX A;  2KIM A;  4XLE A;  3TW6 A;  2GA2 A;  1EH7 A;  1UFM A;  2RQQ A;  3NEU A;  1F5T A;  3EUH A;  5GP9 A;  1FLI A;  2GWR A;  4MGR A;  3R4K A;  3ZQG A;  4OOI A;  1X19 A;  2G9W A;  1YJ9 I;  2OQR A;  1LJ9 A;  2A6H F;  2EBI A;  3IH4 A;  2DYS H;  2EIL H;  1IUY A;  2KDO A;  3E6M A;  2FOK A;  2R4G A;  2V1X A;  5LEJ A;  5D5W B;  2W4S A;  3E3V A;  4AUX A;  1HLV A;  2XIG A;  4RLF A;  4CCL A;  1C0W A;  5LD2 C;  4A0Z A;  2YX7 A;  4ENN A;  3DLA A;  3J81 K;  3GEZ A;  3I5U A;  2NYX A;  5H2F C;  1IRG A;  3E5Q A;  1UEL B;  3HSF A;  1LUJ B;  4EAT A;  2X6O A;  3PSI A;  3BR5 A;  4GO1 A;  2BW3 B;  1ZRE A;  3TW7 A;  1POG A;  2PQ8 A;  1EA3 A;  1KQ0 A;  5DCM A;  3OWT A;  2QM3 A;  2XRO A;  4KDP A;  3SXY A;  4I02 A;  4EJO A;  5GTI C;  4A3K J;  3H3V K;  3SDB A;  1OFC X;  2VJJ A;  4BDZ A;  3OS1 A;  2WAF A;  2Y0M A;  3V4G A;  3WHB A;  2BY0 A;  1P2F A;  4AYB N;  5IOZ A;  3CP8 A;  4RB0 A;  1Z77 A;  2W48 A;  4I0A A;  5D8L B;  3AKZ A;  1HSJ A;  3TOB A;  3H9Q A;  3ZPL A;  4Z2Y A;  2BVM A;  1KU3 A;  2DPD A;  3CDL A;  3DBL B;  4CXF A;  3LA7 A;  1JHF A;  4X0G A;  3FM5 A;  5HDK A;  3GVA A;  2BBY A;  3ABT A;  3OYD A;  3MZH A;  2JA7 J;  4G6D A;  4XQF A;  1IO2 A;  2XGD A;  3MFK A;  5M5X J;  2IS6 A;  1SFU A;  3PM1 A;  1R4N B;  2IRF G;  4F7Z A;  1FEX A;  4HPQ A;  1YW7 A;  4HX4 A;  5EGO B;  5E1Z B;  4ENK A;  1QO0 D;  3A01 A;  5HLH A;  4KFC A;  4WXC A;  3LSG A;  3SZT A;  3QAH A;  4B47 A;  2F5D A;  3K9T A;  1JJ8 C;  1R22 A;  1LFU P;  1WJC A;  2R7O A;  3E6D A;  4JYK A;  4BEH A;  2V79 A;  3RKQ A;  2E2H J;  3COA C;  3R0J A;  4PK4 A;  2DBB A;  1A5J A;  5J40 A;  4L18 B;  5C4X J;  3LOC A;  5J8F A;  3R61 A;  1Z7U A;  1ZG1 A;  2R7D A;  4M3E A;  4Y33 A;  4Y3O A;  3KZY A;  3D5S C;  3DKY A;  1WCM J;  4LLL A;  1NHA A;  2MLG A;  4YII A;  4KT6 A;  1BOB A;  4RM2 A;  1YX5 A;  1MNE A;  4YEL A;  4GDF A;  3QOP A;  3L2W A;  5EEG A;  2CUJ A;  1E17 A;  2IJL A;  2CUZ A;  1G6N A;  3H1C A;  4AIK A;  3CJT B;  1TQI A;  3V8K A;  1SEU A;  2I10 A;  4PJM A;  3ZQ7 A;  3DEW A;  1XPX A;  2IBD A;  1SAN A;  3WG7 H;  4XRS A;  4I01 A;  2CSO A;  3W6V A;  3FXO A;  2OQG A;  4HX7 A;  2B9S A;  2R5Y A;  2GOX B;  2IEK A;  1AU7 A;  1WJD A;  3CLQ A;  1OLT A;  1G59 A;  4CH7 A;  1P9Q C;  3FXJ A;  2HXI A;  2ZME A;  3F8N A;  2XHK A;  3BR0 A;  4W97 A;  2V9K A;  2M1B A;  2QQA A;  4R8H A;  4PZJ A;  2IAI A;  3HZJ A;  4D7N A;  1K6O A;  1JKR C;  1U8R A;  3A0B C;  1FTZ A;  3WGG A;  2GAU A;  1TL8 A;  1KU9 A;  1UHW A;  1SAU A;  3GF2 A;  2CQN A;  2QZ8 A;  4N4N B;  3L00 A;  1R9T J;  4RB2 C;  2KIU A;  3HJE A;  1XX5 A;  3V8J A;  1JT6 A;  5K7Z A;  6PAX A;  5KVR A;  2FSW A;  1QZZ A;  4HNU A;  3JTG A;  1JXS A;  3VSK A;  2R7Q A;  1QU3 A;  4XL9 A;  2JA6 J;  2Z3Y A;  3U9G A;  4FE7 A;  1YO5 C;  2L02 A;  1T0F A;  4M3D A;  2H8R A;  2XAS A;  3ZQH A;  3CUQ A;  4KIS A;  2KIS A;  5IP9 J;  2D2W A;  3CC2 I;  1BC8 C;  3S15 J;  2R7R A;  1MJA A;  5C44 J;  2QGU A;  4EVI A;  2JMW A;  1XD7 A;  4KN4 X;  2WV0 A;  1WH7 A;  1FYK A;  2L7Z A;  5LLQ A;  1W0U A;  5J47 A;  2P6S A;  4XSX F;  3GBG A;  2HZD A;  1GVJ A;  2HU9 A;  2K86 A;  3EET A;  3F72 A;  1AHD P;  2LOO A;  1ERD A;  3F6O A;  4XKW A;  1Z3Y A;  1FZP B;  3ECH A;  3SQN A;  4HZF A;  2K9N A;  4AVP A;  1WWX A;  5LHG A;  4IOA F;  1U0J A;  4XKB A;  1UMQ A;  3GFJ A;  2X4H A;  3BPV A;  1U5T B;  3LSP A;  4G7H F;  3A2K A;  4P5O A;  2DA7 A;  1ZR2 A;  2E1M B;  2JVH A;  1F36 A;  2CS3 A;  2KPM A;  1N25 A;  3OYK A;  5GAD J;  1P4A A;  3KLN A;  3W2A A;  1EV7 A;  3S17 J;  1RNL A;  5E3M A;  2M45 A;  2Z5U A;  2P4W A;  3HTU A;  4PSX A;  4UUS B;  3D1N I;  4XN0 A;  3GCM A;  1FC3 A;  2HTS A;  2Z9O A;  4A3B J;  1Z0X A;  1EKE A;  1D0Z A;  2LLK A;  5D5X B;  2HEO A;  3PQK A;  2DFF A;  3RPU A;  3REO A;  2R0Q C;  1XGO A;  3H0G J;  3VFZ A;  1VND A;  5ERI A;  4M3G A;  3NWT A;  2NOJ B;  1DGR M;  3HOU J;  1N75 A;  3U2R A;  5L3C A;  3PFY A;  3KP5 A;  2A07 F;  2L4A A;  3BQY A;  4PJL A;  5JLX A;  3K6G A;  4J19 A;  3HIF A;  5KAI C;  2X51 A;  4BE0 A;  5JVT A;  2DMN A;  3ABK H;  3K2Z A;  1VQO I;  2PG4 A;  4DQ2 A;  3IWZ A;  2FXA A;  2DA1 A;  2X1D A;  3RJP A;  1YQA A;  5DYM A;  3G71 I;  3S3M A;  2O0Y A;  3S14 J;  3NAR A;  4ZZD A;  4WCG A;  3L1P A;  5FLX K;  4NC8 A;  1P92 A;  4C2U A;  1SD6 A;  3JRC A;  3K1M A;  3CO6 C;  1OR7 C;  1TW3 A;  3S16 J;  3S3O A;  1Z6R A;  1YRN B;  3PFI A;  1YS6 A;  1QPM A;  3E7L A;  5FLM J;  2EK5 A;  1UHS A;  3K70 D;  5J4V A;  1D1B A;  3K1P A;  3OMY A;  4DYQ A;  3GTM J;  2MA3 A;  1PDN C;  3VDX A;  1Y8R B;  4QIW N;  4OMZ A;  1R00 A;  2L5Q A;  3TMO A;  1S9H A;  2MW8 A;  4XLP F;  1TW2 A;  3PQJ A;  2CO5 A;  3TP0 A;  3H36 A;  3KYL A;  4XLF A;  3OSF A;  1MZB A;  2GQQ A;  4JX4 A;  4XIC A;  4XBF A;  1D8K A;  3KIO A;  5EDN A;  2XDV A;  1X3Z B;  2QKL B;  1JJ6 C;  4B8X A;  3JAM Z;  3MQ0 A;  4G8X A;  2CUE A;  4J00 A;  4BXX J;  2DOD A;  5H6Q A;  2WTE A;  2O3F A;  1QA6 A;  3CLO A;  3OV8 A;  4FX4 A;  3HSR A;  4HV5 A;  3S1M J;  4P1W A;  2HKX A;  5HVQ C;  5E8G A;  1MH3 A;  1Z1D A;  2R3S A;  4JP0 A;  1M1E B;  5M5W J;  3FXU A;  1X4O A;  1IGN A;  2VPL A;  2NRA C;  2IXS A;  3FHZ A;  1S29 A;  1KYZ A;  1A35 A;  4LFU A;  4RGU A;  4M72 A;  2ADU A;  2GZW A;  1J2X A;  2VT3 A;  5F1R A;  1DP7 P;  1ZGJ A;  2K3P A;  1TTY A;  4H4K C;  4A0X A;  2W57 A;  4LK0 F;  2LH9 A;  3JRH A;  3BT9 A;  4ESB A;  3G6E I;  3P9C A;  2XPW A;  3GTQ J;  2EIK H;  2KIQ A;  1FOY A;  5CLS A;  4BY7 J;  1LEA A;  1RZ4 A;  1F1Z A;  3J80 K;  1EJ9 A;  4O6J A;  3KP4 A;  5L3F A;  4HF1 A;  4QWQ A;  3FWE A;  1QZY A;  1K61 A;  4NB5 A;  4D0P A;  5D6F A;  2VB6 A;  3G1L A;  3PNY A;  1AA7 A;  4ZYA A;  2QUF A;  1K78 A;  1I6H J;  2FBK A;  4HF0 A;  5ILV A;  3S2D J;  4O5V A;  1MBF A;  2FBI A;  4KMU X;  1W4M A;  3PUB A;  3GTK J;  4LGW A;  2R5Z B;  3AAF A;  2IS4 A;  1WJ5 A;  1IUF A;  2Z1D A;  3GO5 A;  2CV0 A;  4G6T B;  3M8E A;  2GIV A;  3BR2 A;  2XRN A;  3O8G A;  1H0M A;  4HQM A;  2V1U A;  3QU3 A;  1PUF B;  1JHH A;  2A68 F;  2EV5 A;  4LIT A;  1BR4 A;  3FM3 A;  3CTA A;  2VKE A;  2ECC A;  3WTY C;  1SC7 A;  2JPB A;  4X6A J;  4GYG A;  3DKW A;  1B59 A;  1BM9 A;  3IKV A;  2IGK A;  4RAG A;  3BR6 A;  3EYY A;  2PMU A;  2OBP A;  4XR6 A;  3FKJ A;  5D4R A;  1MSF C;  1N78 A;  2L9N A;  4EJT A;  4IEJ A;  3KEQ A;  4U7D A;  4M73 A;  2ZFW A;  2AQF A;  1RI7 A;  3W3C A;  2ZSI B;  4L0Y B;  2NVT J;  1W0T A;  4U0V A;  1ZGA A;  2CFX A;  1VQN I;  2PJP A;  3HHG A;  2KT0 A;  1MMS A;  1SAX A;  4XLH A;  3VOD A;  2M87 A;  1O3R A;  2HTJ A;  3DU5 A;  3FKI J;  3GZ6 A;  1MSE C;  4ZYG A;  5FO5 A;  1RIO H;  1JKO C;  5BMZ A;  3FBN B;  2Y9Y A;  1E2X A;  2M5W A;  3K70 C;  1VQK I;  1AWC A;  2EFQ A;  2WY8 Q;  1NK2 P;  3LQQ A;  4H0E A;  2CH0 A;  2EFO A;  3LWF A;  4LB6 B;  3VSL A;  2XGX A;  2ZC2 A;  5GPC A;  2HPM A;  2ZXH A;  2JVG A;  2Y9Z A;  2HQA A;  3BCB A;  3H92 A;  2P6T A;  4K2E A;  2ZJP F;  2CQQ A;  4ZC3 A;  4KA4 A;  2NOG A;  4A3E J;  1X1P A;  3H3U A;  5CVJ A;  1ZAO A;  2CV2 A;  1FYL A;  1O7F A;  2NVY J;  2JUC A;  5FFZ A;  3LQR A;  1IRF A;  5KAF C;  4LJZ F;  2FNP A;  2OA4 A;  2WB1 A;  2VUM J;  3ROU A;  4PCQ A;  3V42 A;  1DGW Y;  1E3P A;  3ZN1 A;  1LQ1 A;  2IA2 A;  5HS7 A;  1R5G A;  2E1O A;  3CDI A;  2BZT A;  3Q9V A;  4DW6 A;  1K79 A;  2A6E F;  1ZKG A;  2HNH A;  1OPC A;  4MTD A;  4NQW B;  3ESW B;  5ICE A;  1I50 J;  3C1D A;  3RPQ A;  1XC5 A;  5FLV A;  3HOY J;  4F55 A;  5TGT A;  2BW3 A;  2VKV A;  1ZQ3 P;  4EJU A;  1J75 A;  3S2W A;  2QQ8 A;  1B6A A;  3KET A;  3MWM A;  3T1B A;  2NS0 A;  2EFP A;  2OCC H;  3M1C A;  1IXC A;  3S1R J;  1L3L A;  2M7A A;  1NTC A;  3HBL A;  2XB0 X;  3BY6 A;  1VQP I;  2E1M C;  2WAD A;  1IZ1 A;  5BNG A;  3A0H C;  3FMS A;  1X1C A;  4U0W A;  4B4C A;  4GXO A;  3DCF A;  2L7K A;  4RLQ A;  1IDY A;  3AG1 H;  3DKX A;  1FY7 A;  2LNB A;  3K4C A;  5DD8 A;  1BI3 A;  3B6C A;  1QVU A;  1XSV A;  3ZMV A;  1ZRC A;  3O6B B;  2V9P A;  5HNF A;  4EM1 A;  1YW8 A;  2VAS A;  3HG9 A;  3I3L A;  3ONQ A;  1ETO A;  2DK8 A;  1W7P D;  3HUG A;  3HOS A;  2Q2E A;  2V9V A;  4YFN F;  1ODD A;  3HRM A;  1MJB A;  2ZXJ A;  2VOP A;  4DIQ A;  4HNV A;  4HLY A;  3EUK L;  2D5V A;  1D8J A;  2LP0 A;  2VQH A;  1VQ4 I;  2WB1 N;  5CPR B;  1I27 A;  1BI0 A;  2VQG A;  4XID A;  3V7S A;  4U7B A;  1U8B A;  1KZH A;  5TIS C;  2XAJ A;  2P0W A;  1AKH B;  3SEZ A;  1D1A A;  3KEY A;  3M9A A;  2HYF A;  4GRI A;  4V2G A;  2DN0 A;  2QQ9 A;  3HKZ A;  3ZR8 X;  4BJ6 C;  5M5Y J;  5IT9 K;  1R1U A;  2OU2 A;  1HW1 A;  5BQT A;  3W6K B;  4FX0 A;  1LDJ A;  2KRH A;  1GLN A;  2JPC A;  5KNL A;  3TKY A;  2LKS A;  1ZN2 A;  2EA2 A;  3RPU D;  2E1C A;  2AXL A;  2CQ7 A;  5K7F A;  3OYA A;  3LAJ A;  3C3W A;  3I54 A;  1UJ8 A;  2E1N A;  1B9N A;  3WTS C;  2IP2 A;  4NC7 A;  2UUZ A;  3QPH A;  1R1V A;  2HPI A;  2HOE A;  1QZE A;  2F4M B;  5B66 C;  3FZV A;  1A36 A;  1APL C;  2CMP A;  2XC7 A;  1TLH B;  2DMP A;  2ZJR F;  3QU6 A;  4MHG A;  1TQP A;  2KIF A;  2X1C A;  3IRQ A;  1TWA J;  3X2Q H;  1X1A A;  3ZQI A;  2IW5 A;  3PNT A;  4HEA 2;  4C2M J;  3O2P E;  5B1A H;  2ZBK A;  4AWX B;  4M3F A;  4MFE A;  3RTR A;  4MEY F;  5E1W A;  3SDG A;  1U6G A;  1WJA A;  3JTH A;  3ZMZ A;  3OYM A;  4NDL A;  5EYR A;  2DT5 A;  3BG7 A;  1X2M A;  2ZXI A;  3OS0 A;  1JI8 A;  2E35 A;  2L54 A;  4ABZ A;  5JR3 A;  3GTG J;  2VE8 A;  3Q9S A;  4PDK A;  1LDK B;  5CVU A;  4ZJZ A;  1HQC A;  3BC8 A;  4ESJ A;  3N05 A;  3VB2 A;  2V26 A;  2EZK A;  2VQC A;  1ITY A;  2M30 A;  4UXN A;  1W36 D;  1I3A A;  3HKZ N;  3JRI A;  2ME6 A;  1ETX A;  2LBF B;  3M8F A;  5DS9 A;  2L3D A;  2CG4 A;  1STZ A;  4MLO A;  2FJ1 A;  4XRM A;  4L9N A;  1MBH A;  1J59 A;  4RDU A;  2IS2 A;  1HA8 A;  2RNJ A;  1CF7 A;  2QBY B;  1YYV A;  3MN2 A;  2A61 A;  1TC3 C;  3IUO A;  3KEO A;  3CCY A;  3J80 Z;  1J7K A;  3BR3 A;  1RRJ A;  1W5S A;  1XMK A;  4PGG A;  5EG0 A;  2G7U A;  1ZLJ A;  4BS9 A;  5KCM A;  2QCO A;  3QP5 A;  4C3J J;  2Y69 H;  3MZ8 A;  4XN3 A;  4OIO F;  2A3S A;  1A04 A;  2GOM A;  2LD5 A;  3CUQ C;  1SVO A;  3QYF A;  4WXH A;  1FYM A;  1WSU A;  3A03 A;  3GFL A;  3H9G A;  3A4C A;  1SFE A;  1VQL I;  1X3W B;  1ZAR A;  4WF2 A;  3BDD A;  2E71 A;  2DT7 B;  4DBQ A;  4RGS A;  5L3B A;  3AFH A;  2W00 A;  1JTX A;  3GWZ A;  4KIC A;  1LDD A;  4S0H B;  3JR9 A;  1U5T A;  2ZO4 A;  3MD2 A;  3TDU C;  3WG9 A;  3B73 A;  1Z7L A;  3ZRG A;  2PFB A;  2CGP A;  3OL3 A;  1CGP A;  4LG3 A;  5D8K B;  4HSR A;  1IG7 A;  4OAZ A;  1XN7 A;  1BR2 A;  2VC0 A;  3SFI A;  2HGC A;  5C4J J;  3GFM A;  4L5I A;  2ELH A;  1B72 B;  3NRV A;  1A31 A;  3QPS A;  1WVR A;  1OCR H;  5IYC J;  2STT A;  4LLG F;  1ZYR F;  5F27 A;  3CMY A;  1HDP A;  2FEZ A;  3QWL A;  4NUB A;  3WTT C;  1KQ9 A;  5F0C A;  1FBU A;  4IO9 F;  2LDU A;  2HDD A;  2R7F A;  4BQO A;  1JKQ C;  2M7B A;  3F21 A;  4IHV A;  3FXM A;  4FT8 A;  2H6B A;  4WWC A;  4UY8 I;  3FMQ A;  1J09 A;  3BZC A;  1QHG A;  1ZRF A;  2V6C A;  2R7X A;  2I8D A;  4YIF A;  2JWT A;  2QKM B;  3E1S A;  5FKL A;  2BEO A;  4XRS G;  3VYT B;  3RQI A;  5J4Y A;  3S3N A;  4ZYH A;  2AO9 A;  4EJV A;  2O7O A;  4RBO A;  1LE8 A;  3T8T A;  5ILU A;  1PUE E;  3KP6 A;  1HW2 A;  3CDH A;  4XK4 A;  1XGM A;  4Y4R A;  1YFH A;  5FGM A;  2F48 A;  3OYB A;  3I0T A;  2DFE A;  4A3D J;  5BPD A;  4P9F A;  3K4L A;  2EIJ H;  4JX5 A;  4Q47 A;  2VBY A;  1UHM A;  4CYC A;  2K9M A;  2FML A;  5EEA A;  1YI2 I;  3QPL A;  2YX4 A;  2VI6 A;  2NS7 A;  3LSI A;  1RES A;  4R79 A;  4BKX A;  2DA6 A;  3LFU A;  3C2G A;  4UHT A;  4BY1 J;  1OYW A;  1YX3 A;  1A6Q A;  2F5C A;  3PO2 J;  1D0X A;  5FRM A;  1FBS A;  2N8G A;  3WHC A;  2DO7 A;  1U2W A;  2BVL A;  3WGH A;  3BRO A;  4RB1 A;  5E3O A;  2K4B A;  3EPZ A;  4ZTF A;  2XPU A;  1K83 J;  2X6X A;  5J6X A;  1R49 A;  3DTI A;  1ONV A;  3GW2 A;  4DBR A;  1QNT A;  3V7R A;  4A93 J;  2H09 A;  1FWZ A;  5GAE J;  4BBS J;  1X1D A;  1FNN A;  4BJ5 C;  1MKM A;  5J8C A;  4ZYD A;  1B8I A;  4B1R A;  1MDM A;  2AXT C;  3IHU A;  2CV1 A;  1TNS A;  2DMQ A;  1W36 C;  4ZYE A;  1VTN C;  1DP3 A;  2ELK A;  4NC6 A;  1R6R A;  1YG2 A;  3CJR B;  4UV8 A;  4KIT B;  3HC7 A;  3OOU A;  2HXO A;  4W1U A;  1BI2 A;  1E3O C;  1IDZ A;  1I1S A;  2XAG A;  2K85 A;  2DTZ A;  3HB9 A;  5M3F J;  1D5Y A;  2DCE A;  4N4O B;  1RUO A;  3ECO A;  1WI3 A;  1HST A;  2RKH A;  3B6A A;  3DPU A;  4U0Y A;  5FD5 A;  1LEB A;  2LYC A;  4PUS A;  3TO6 A;  2ISZ A;  2Z99 A;  3P5J A;  1FTT A;  2BV6 A;  3NWS A;  3GFI A;  2IGN A;  1HXD A;  4U87 A;  1ORK A;  3W2V A;  3S32 A;  3F23 A;  1DPR A;  4XOR A;  4LD5 A;  3VEP A;  4L5E A;  3CCR I;  4V2F A;  4G94 A;  1P4X A;  2EZH A;  2R5Z A;  1D0Y A;  4YG2 F;  3HPH A;  3WE3 A;  4P9U A;  4EJW A;  4RGR A;  4HNT A;  4MFD A;  1LB2 A;  2FQ4 A;  1T2K A;  3H35 A;  4EGZ A;  2IGO A;  1IW7 F;  2YSR A;  2PBI A;  2W85 A;  2GXA A;  3I58 A;  2DJN A;  1OCC H;  5LGU A;  5K5Q A;  3OS2 A;  3RKY A;  4A3F J;  3M7G A;  1LNW A;  4LG0 B;  2Y75 A;  4I76 A;  1IN4 A;  3M07 A;  1FX7 A;  4IL6 C;  3ZXS A;  1XCB A;  1NG6 A;  2OC6 A;  2K3F A;  2KQR A;  1IN7 A;  1G3T A;  3D5R C;  3L7W A;  2WC2 A;  1BR1 A;  3LSJ A;  2Y0S A;  5DCM B;  3VPR A;  1ETK A;  2NVQ J;  4FET A;  2PN6 A;  2W82 A;  4BE2 A;  3EQL F;  4JK1 X;  4KUM A;  4MQ9 F;  2DAO A;  1H88 C;  4A3L J;  5F0H A;  5ICC A;  5LRS A;  1VQ9 I;  2I5U A;  1G2H A;  1D3Y A;  1WHU A;  2K27 A;  1KYW A;  1S5L C;  2VLA A;  5F08 A;  2HOT A;  2GM4 A;  3Q3S A;  4PSW A;  3HOZ J;  1O3Q A;  4IPA A;  2L7F P;  4J01 A;  1IRZ A;  4KIG A;  1MW7 A;  4TV7 A;  3JCU C;  4CCM A;  1TWG J;  4LK1 F;  4HG2 A;  2VC1 A;  3ISP A;  2MH2 A;  2QSH X;  3PJR A;  2ECB A;  5E8I A;  3MZY A;  4MIM A;  1JTY A;  1J0R A;  1HBX G;  1IF1 A;  4Y52 J;  1K4T A;  4CUG A;  3GUD A;  3IH2 A;  4KYW A;  2VJ4 A;  5A2Q K;  2XPV A;  3A01 B;  2K4J A;  2LF7 A;  1YIT I;  2R7U A;  1GV5 A;  2RV8 A;  1TQM A;  1O57 A;  2LG4 A;  4F93 B;  2E60 A;  4OIR F;  5HLG A;  2PMH A;  3CJN A;  1DQU A;  3Q0V A;  4EM0 B;  1ZLK A;  4NHJ A;  4BEH B;  2NNY A;  2EJR A;  2OZ6 A;  4M9X A;  4G6Q A;  1O3T A;  1J9I A;  1F4K A;  3DP7 A;  3BR1 A;  2CW0 F;  3H5N A;  5DUK A;  3C18 A;  2FF4 A;  3MVP A;  3OYF A;  5FKK A;  3UNG C;  3OYC A;  1YTY A;  3QYB A;  4GYI A;  2F5E A;  5ED4 A;  3JRD A;  3EYI A;  1XMA A;  3IL2 A;  2FMY A;  2M34 A;  1OKR A;  2RRE A;  1J5Y A;  4PJ0 C;  2Z2S B;  2MG4 A;  3ASO H;  4A0Y A;  2EH3 A;  4A6D A;  2KJB A;  2MD5 A;  1BJZ A;  2R7S A;  5KK1 A;  3CME I;  1R7J A;  2MYS A;  2PX9 A;  4PFP A;  3ULQ B;  2Y0S N;  3CUO A;  4BAC A;  2KHM A;  3KZI C;  4E7I A;  3M8J A;  2ME0 A;  2Q0O A;  2CQK A;  4A6E A;  4HX8 A;  2JK3 A;  2K5C A;  4X1E A;  1Y56 A;  3J81 Z;  3ABM H;  3OYE A;  4MEX F;  4HF2 A;  1IV8 A;  4L0Z B;  5E20 A;  3L2C A;  1I3Q J;  2H1L A;  5HLI A;  4YFK F;  3CCS I;  4IOC F;  3CF2 A;  1A6I A;  4UNO A;  3BTC A;  2EPF A;  2DYR H;  1P7J A;  2OUM A;  2Y2Z A;  2KZG A;  4OIN F;  4UB6 C;  2A6T A;  2VJ5 A;  2KZV A;  4DZP A;  4OIP F;  1TWC J;  2F5V A;  2QYO A;  3FIS A;  2HVQ A;  2JSC A;  3W6J B;  3J7Z I;  2ZJQ F;  2ZKZ A;  5HOO A;  2JRM A;  2X9D A;  1HKT A;  2BXZ A;  2OCE A;  3FF5 A;  1YIO A;  3TQN A;  3Q0W A;  4EMS A;  3RDI A;  1ZK8 A;  2CYY A;  4LIV A;  1FSE A;  1RKW A;  2W7N A;  1VQ8 I;  1LVK A;  5L3D A;  5J1R A;  1SMT A;  1PYV A;  2HQN A;  1I5Z A;  2J5P A;  3FDY A;  2UXN A;  2ZFU A;  3RSN A;  1PJR A;  5K5O A;  3HOT A;  2K7L A;  4OWR B;  3F8F A;  3ZMD A;  3ZQQ A;  3CUQ B;  5D6E A;  3G1M A;  5LGN A;  1XSX A;  5B1B H;  3AL0 C;  3FHN A;  4AVZ A;  4B43 A;  5IYB J;  4BXU A;  1FP1 D;  4B09 A;  3C7J A;  3I56 I;  4E7J A;  2Q1Z B;  2LSO A;  1AKH A;  1ZHF A;  3DPT A;  4BJT A;  1VF9 A;  3PIO F;  3I53 A;  1SVL A;  4OIQ F;  4L9J A;  3P7N A;  1RR8 C;  1Z6T A;  3ABL H;  2QEX I;  3H9J A;  3FK7 A;  1W7P B;  2H8W A;  4NNJ A;  5D5U B;  5E79 C;  4IHY A;  1G4D A;  3WU0 A;  4BH9 A;  2E7X A;  4E4H A;  5HNH A;  4WXD A;  2HOS A;  1ACI A;  2DU9 A;  4II2 A;  2EV6 A;  5E18 F;  3LSM A;  4ASN A;  1TWH J;  5F6F A;  4ANJ A;  4IF4 A;  2JRT A;  3K0L A;  1OQY A;  3PL8 A;  1OYI A;  2VN2 A;  3K1N A;  3I59 A;  3I64 A;  2ZSH B;  4YFX F;  2NAZ A;  3LA3 A;  4ETS A;  2VT2 A;  4EGY A;  3OR1 C;  3SZG A;  2PMZ A;  1OYY A;  5FRN A;  2KMU A;  1IV6 A;  4A3I J;  4IKF A;  2LKX A;  2O61 A;  5LFA A;  4HBL A;  2LR8 A;  2EZI A;  3TED A;  1MBE A;  3D5L A;  3RKX A;  3BTJ A;  2L0K A;  4A5N A;  1MJ9 A;  2W1O A;  4N9I A;  4D5F A;  3GME A;  1SMY F;  1MD0 A;  4BHP A;  1WI9 A;  2X0L A;  3O8H A;  3E0J B;  1LPQ A;  3CCQ I;  3TGN A;  4M3B A;  4E7Z A;  2Z16 A;  1MH4 A;  3ASN H;  2VQL A;  2L9R A;  1G3S A;  2QLZ A;  2ZXW H;  1Y0N A;  3CMM A;  4QLC U;  4HW0 A;  1OR7 A;  2VKD A;  3DWL E;  1TBX A;  2DA3 A;  4ZDL A;  3J7A O;  2HDW A;  5L3E A;  4BNC A;  3HHH A;  2BOL A;  2K9L A;  3LSH A;  4CHU A;  4IHS A;  3HOX J;  3J7A Y;  1R5I D;  2XAQ A;  2XRL A;  4DYC A;  5BS6 A;  3SFZ A;  2STW A;  2WBM A;  1XGN A;  4DZJ A;  1XS9 A;  2ESN A;  2P5K A;  3GTL J;  5FB2 A;  1BL0 A;  4IRH A;  3TDZ C;  5JHU A;  2YU9 J;  1Y6I A;  2RDP A;  2DOF A;  2DXI A;  3BZ6 A;  1MGT A;  2Z33 A;  4R1H A;  2ACJ A;  2DA5 A;  1TWF J;  2RN7 A;  3EUH C;  3R0A A;  2NXN B;  2OV7 A;  2E19 A;  1FP2 A;  2QBY A;  2LY9 A;  3DLL F;  1P7I A;  2M0C A;  2LFB A;  1YS7 A;  3ZN0 A;  4DJA A;  3DFG A;  2E5Z A;  5LGT A;  3E6C C;  4JX6 A;  3BG5 A;  3QOD A;  4U88 A;  2BE5 F;  2JTV A;  2LRD A;  1ULY A;  2X6Y A;  3U21 A;  2HOA A;  4HRI A;  4RS8 A;  2MBF A;  4KNY A;  1RET A;  1MMG A;  2HQR A;  1RC9 A;  2PMZ N;  3C2B A;  2IS1 A;  2VON A;  1MBG A;  1SVM A;  3BJ6 A;  2JN6 A;  3KE2 A;  1VQM I;  3FK6 A;  3DV8 A;  4BXF A;  3L2R A;  2V6E A;  1E0E A;  2D1H A;  3OIP A;  2XSD C;  2P7C B;  1YE9 A;  1OMI A;  2DDB A;  1JKP C;  3LST A;  1Y0U A;  1X1B A;  2B0L A;  1FOX A;  2FD5 A;  5IOY A;  3GZ5 A;  4XMY A;  4OMY A;  1QBJ A;  2HWV A;  3ZMS A;  3OYL A;  2LY2 A;  2Y48 A;  1ON1 A;  1QQI A;  3ZQC A;  5EGO A;  2LK2 A;  4IQJ A;  2J5O A;  2P5V A;  2XGE A;  4RAZ A;  3CES A;  3LAP A;  1KQ8 A;  2EFN A;  3Q5F A;  1S72 I;  1OIS A;  3I71 A;  2MC3 A;  5IP7 J;  3M4O J;  3G3Z A;  4V19 K;  4BAY A;  5HS9 A;  1O4X A;  3K7A J;  4A3C J;  4IHW A;  2QF7 A;  2K9Q A;  3MKY B;  4CCN A;  2HI3 A;  3WTV C;  2H1K A;  5DM6 F;  3HL2 A;  2VPR A;  4A2U A;  4HLX A;  5KHD A;  1K78 B;  2FBH A;  3HYI A;  3QOE A;  1XDS A;  5DCF A;  3CMA I;  2C6Y A;  1FMV A;  1ON2 A;  2R7Z J;  2KLO A;  4AM3 A;  1WRJ A;  3HRS A;  5H6R A;  1U3E M;  1IJW C;  5LEK A;  3TOA A;  3VYU B;  5FLX Z;  5GPA A;  2R93 J;  3L09 A;  4CCO A;  1FMW A;  1JUS A;  3RCO A;  3KCC A;  2X1E A;  1W5T A;  1WPK A;  3DBR B;  3KPH A;  2VE9 A;  3QRF F;  2MAB A;  3G1O A;  3W2W A;  1O7L A;  3I4N J;  1K7A A;  4L9T A;  2DOA A;  2A69 F;  4BYY A;  2LY1 A;  3KX2 A;  1XG1 A;  5C3E J;  1EH8 A;  2XF6 A;  4I99 C;  4IQ4 A;  4E70 A;  4Q5S F;  5CVI A;  1Z91 A;  1SD5 A;  1H8A C;  3ZCO A;  3OL4 A;  3DEU A;  3HRU A;  5JFR A;  3K4K A;  3NQO A;  3JRB A;  1Y39 A;  3H3Z A;  2CU7 A;  2OJE D;  3TO7 A;  4ITV A;  2LMD A;  1ZH5 A;  3KFW X;  2HFH A;  3JRA A;  2KL4 A;  1ZR4 A;  1G3Y A;  1OCO H;  5CJ9 A;  2DA4 A;  3RYR A;  3WTW C;  1FJL A;  4G7Z F;  1WZ2 A;  3H5A A;  4DNC A;  2DMT A;  2XAU A;  1T95 A;  5K7H A;  2O9L A;  1IAW A;  3IP4 B;  4CCK A;  2R92 J;  3BG9 A;  2YR2 A;  5JLW A;  3TL4 X;  3FX3 A;  2ZME C;  3QP6 A;  1ETV A;  4UUT A;  2XSJ C;  1TNT A;  2LVS A;  2VBZ A;  1WJF A;  4IVN A;  1V5F A;  2GXG A;  2W84 A;  2O6G E;  2WV1 A;  2FRH A;  3MMY B;  3OY9 A;  3FIW A;  3I9V 2;  1FIA A;  4QPO A;  1V4R A;  2Y30 A;  1X58 A;  2ETH A;  4FTH A;  1Q1H A;  1VQ6 I;  5B3S H;  5GTH C;  2H27 A;  1YJN I;  3PNV A;  2WA0 A;  4KJZ A;  3HOV J;  1BW5 A;  2VJI A;  4G12 A;  3HGY A;  2P7V B;  1WGX A;  4XOT A;  2FOW A;  3F3X A;  4A3M J;  2BXY A;  2E7W A;  1T0F C;  3AG3 H;  1R1T A;  4KN7 X;  1QVT A;  3DPL C;  4FIS A;  3P9I A;  3BLY A;  4BHC A;  4E6K G;  3F8M A;  2FUG 2;  3OOP A;  4Y17 A;  1TT5 B;  2ESH A;  2DQL A;  5FKN A;  3WU2 C;  2GLO A;  3JAM K;  1F9N A;  1DU0 A;  3HTS B;  3G4S I;  2PJR B;  4XKC A;  5DUI A;  2XV4 S;  1OCT C;  3DXJ F;  1MIJ A;  3N97 A;  5BOX A;  1QRY A;  3KYD B;  2WAQ A;  3HOW J;  4LG0 A;  4UVA A;  5IT3 A;  1B4A A;  3BTI A;  2A5W A;  2TDX A;  2B7E A;  1YOV B;  2WWY A;  2EIM H;  1QGP A;  2BHZ A;  3CCE I;  2HDC A;  1WQ2 A;  1S7E A;  2LRE A;  4L5J A;  3F6V A;  4BQQ A;  4HV6 A;  4XSZ F;  4UUS A;  1TT0 A;  3FMR A;  4AD9 A;  4BE1 A;  9ANT A;  2CQX A;  1XDU A;  1PP8 F;  5F04 A;  3ZGK A;  3H0D A;  3S2H J;  2K02 A;  2OAZ A;  3WTX C;  3DEE A;  1T33 A;  1TP4 A;  5FJ8 J;  2M3A A;  1UG2 A;  1FSH A;  2EQR A;  3AL0 B;  2LTP A; 
#chains in the Genus database with same CATH homology
 1G2H A;  5DTD A;  2GM4 A;  5F08 A;  2HOT A;  3MKL A;  3Q3S A;  5J3L A;  3BR6 A;  3ZOB A;  3HOZ J;  2TCT A;  3PO3 J;  2L7F P;  5FKM A;  1IRZ A;  1GUU A;  1MSF C;  1RKT A;  3ZQF A;  4IEJ A;  1TWG J;  2OF7 A;  1MBJ A;  2ECB A;  2NVT J;  2K40 A;  3Q0U A;  1W0T A;  4MIM A;  1JTY A;  2O8K A;  4Y52 J;  4A69 C;  1QPI A;  3IH2 A;  1YRN A;  2XPV A;  3A01 B;  2KT0 A;  1GV5 A;  1VI0 A;  2E2I J;  1ETQ A;  2M2E A;  1WH5 A;  3FKI J;  3Q0V A;  1MSE C;  3IV5 A;  1JKO C;  2WAQ N;  1EF4 A;  2ZB9 A;  5IYD J;  3HEF A;  3BR1 A;  3BTL A;  4GFB A;  1JUM A;  2Y9Y A;  3MVP A;  5FKK A;  1RPW A;  1NK2 P;  3JRD A;  3HGG A;  4EEF G;  2M34 A;  2AHQ A;  1HCR A;  5GPC A;  2OPT A;  2MG4 A;  2EH3 A;  2Y9Z A;  1ETY A;  3GTO J;  1BJZ A;  1H89 C;  2M8G X;  2Y0S N;  2CQQ A;  1JUP A;  2NOG A;  4A3E J;  2ME0 A;  2JK3 A;  2NVY J;  3A02 A;  1HF0 A;  2ID3 A;  3TW6 A;  4X1E A;  2VUM J;  5GP9 A;  2NVX J;  1Y1V J;  1I3Q J;  3ZQG A;  2E1O A;  4DW6 A;  1A6I A;  2EBI A;  1ZKG A;  3BTC A;  3IH4 A;  1P7J A;  2Y2Z A;  5E3N A;  1MBK A;  5F0F A;  1I50 J;  4DZP A;  4MO7 A;  1TWC J;  1XC5 A;  4AUX A;  1HLV A;  5FLV A;  1ZGW A;  3HOY J;  3FIS A;  1JGG A;  3JRE A;  2VKV A;  1GT0 C;  1ZQ3 P;  2X9D A;  3HM5 A;  3Q0W A;  1ZK8 A;  5IP6 A;  3S1R J;  2X6O A;  1RKW A;  1NTC A;  3BR5 A;  3HBL A;  2XB0 X;  5J1R A;  4DYR A;  4D7M A;  3TW7 A;  1POG A;  5BNG A;  1GDT A;  1PUF A;  4B4C A;  4D5C A;  3DCF A;  5EG0 B;  1IDY A;  1OJL A;  4A3K J;  3H3V K;  1OFC X;  4AC0 A;  3G1M A;  3B6C A;  2JJ7 A;  1QVU A;  3WHB A;  4AYB N;  5IOZ A;  1Z77 A;  5IYB J;  2W48 A;  1ETO A;  3CDL A;  1AKH A;  3LSR A;  1VF9 A;  2JA7 J;  4HNV A;  2D5V A;  2LP0 A;  2RAE A;  2XGD A;  5M5X J;  3PM1 A;  2WB1 N;  1CQT A;  4XID A;  1FEX A;  5EGO B;  3FK7 A;  1U8B A;  4A3J J;  1AKH B;  3A01 A;  4IHY A;  2MSY A;  1BA5 A;  3CQZ J;  1RR7 A;  4V2G A;  3LSG A;  2DN0 A;  5M5Y J;  2HOS A;  1X2N A;  2Y31 A;  1JJ8 C;  2K9S A;  1LFU P;  3F0C A;  1TWH J;  4JYK A;  2CRG A;  2G0E A;  3RKQ A;  2E2H J;  3I4M J;  1A5J A;  5C4X J;  3LOC A;  5K7F A;  4M3E A;  1IV6 A;  4A3I J;  1WCM J;  2LKX A;  1FIP A;  3JRF A;  1U9O A;  2LR8 A;  5HOD A;  2EZI A;  3TED A;  1ETW A;  1MBE A;  1APL C;  3BTJ A;  2L0K A;  4D5F A;  2DMP A;  3S1Q J;  2B63 J;  3O8H A;  1ZTR A;  1LE8 B;  1GV2 A;  4M3B A;  1VFC A;  1MH4 A;  1TWA J;  2I10 A;  2L9R A;  3DEW A;  2IBD A;  3ZQI A;  1SAN A;  3GTP J;  4C2M J;  4XRS A;  2FX0 A;  3W6V A;  2DA3 A;  1BW6 A;  3GTJ J;  4M3F A;  2R5Y A;  3HOX J;  2NS8 A;  2IEK A;  2XRL A;  4MFE A;  4DYC A;  1AU7 A;  3SDG A;  2EZL A;  4CYC B;  2YS9 A;  4DZJ A;  1XS9 A;  3GTL J;  1BL0 A;  2E2J J;  4NDL A;  2HXI A;  5EYR A;  2YU9 J;  4B3A A;  3BR0 A;  4W97 A;  4C3I J;  2R5Y B;  2IAI A;  1X2M A;  4D7N A;  1JKR C;  1FTZ A;  2TRT A;  2DA5 A;  1TWF J;  4ABZ A;  3GTG J;  2MGQ A;  2EZK A;  2E19 A;  1ITY A;  1DU6 A;  2LY9 A;  1P7I A;  2M0C A;  2LFB A;  3HKZ N;  3JRI A;  2ME6 A;  1R9T J;  1ETX A;  4JX6 A;  5M3M J;  5J1U A;  5DS9 A;  3BG5 A;  1JT6 A;  5K7Z A;  4MLO A;  2FJ1 A;  4XRM A;  1MBH A;  1NK3 P;  4QTR A;  2HOA A;  4RDU A;  1RET A;  3MN2 A;  1B8I B;  1TC3 C;  3C2B A;  2JA6 J;  2PMZ N;  3K2A A;  3CCY A;  4FE7 A;  3BR3 A;  1MBG A;  5EG0 A;  4M3D A;  2JN6 A;  2H8R A;  3ZQH A;  1IC8 A;  2QCO A;  5IP9 J;  4C3J J;  2CUF A;  3FK6 A;  3S15 J;  3S1N J;  2XSD C;  2LD5 A;  5C44 J;  2JMW A;  3A03 A;  1JKP C;  4BBR J;  1WH7 A;  2FD5 A;  5IOY A;  2L7Z A;  2X48 A;  1JTX A;  3JR9 A;  4S0H B;  1W0U A;  3GBG A;  2DA2 A;  3ZQC A;  1AHD P;  5EGO A;  2LK2 A;  2XGE A;  1IG7 A;  3SFI A;  5C4J J;  4QSH A;  4Y7N J;  2HYJ A;  4FCY A;  3SJM A;  2K9N A;  2JA5 J;  3M3Y J;  1LFB A;  1UMQ A;  1B72 B;  3LSP A;  5IP7 J;  3M4O J;  2DA7 A;  3QPS A;  1ZR2 A;  5IYC J;  1O4X A;  3K7A J;  1F36 A;  4A3C J;  4IHW A;  2QF7 A;  2K9Q A;  5F27 A;  3CMY A;  1HDP A;  2HI3 A;  2H1K A;  3S17 J;  2COB A;  5F0C A;  5E3M A;  2HDD A;  2VPR A;  1JKQ C;  4IHV A;  4UUS B;  3D1N I;  1GVD A;  2CJJ A;  4A3B J;  1Z0X A;  3BQZ A;  5EZH A;  4FE4 A;  2R7Z J;  2LLK A;  1SFO J;  2JA8 J;  2JWT A;  5FKL A;  2L7M P;  5FKO A;  2GBY A;  4XRS G;  2R0Q C;  2KDZ A;  3RQI A;  5E3L A;  3H0G J;  3OSG A;  1T56 A;  2AO9 A;  1VND A;  1IJW C;  2O7O A;  3QQA A;  5GPA A;  4RBO A;  3RZD J;  1LE8 A;  4M3G A;  2R93 J;  4A3G J;  2M9H A;  1JT0 A;  3HOU J;  1JUS A;  4XK4 A;  1WPK A;  3JRG A;  3BQY A;  3G1O A;  3I4N J;  5JLX A;  4J19 A;  3HDD A;  2DMN A;  4A3D J;  1XG1 A;  5C3E J;  2DA1 A;  4JX5 A;  4CYC A;  3S14 J;  3NAR A;  5EEA A;  1H8A C;  3QPL A;  2VI6 A;  2NS7 A;  1RES A;  3L1P A;  4BKX A;  2DA6 A;  3JRB A;  5IPA A;  3ZQL A;  4BY1 J;  2CU7 A;  3JRC A;  1Y1W J;  1ZR4 A;  3JRA A;  3S16 J;  1YRN B;  3PO2 J;  2DA4 A;  3E7L A;  5FLM J;  1FJL A;  1UHS A;  4C3H J;  2N8G A;  3WHC A;  3LNQ A;  2DMT A;  1HOM A;  4DYQ A;  3GTM J;  5K7H A;  4QIW N;  2O9L A;  1Q1V A;  5E3O A;  2R92 J;  2MW8 A;  3BG9 A;  2XPU A;  3TP0 A;  1HDD C;  1K83 J;  5JLW A;  1ETV A;  4UUT A;  3OSF A;  3RZO J;  4A93 J;  2LVS A;  4JX4 A;  4XIC A;  4BBS J;  3IH3 A;  1ENH A;  5EDN A;  1B8I A;  2WV1 A;  2HQ5 A;  4IHX A;  2ID6 A;  3FIW A;  4B1R A;  1FIA A;  1JJ6 C;  2DMQ A;  2Y30 A;  1X58 A;  5EF6 A;  5F1J A;  5EZG A;  2ELK A;  4FTH A;  2CUE A;  4BXX J;  3UKG A;  3OOU A;  3S1M J;  2HXO A;  3HOV J;  4W1U A;  1E3O C;  1BW5 A;  1IDZ A;  1MH3 A;  4JP0 A;  5M5W J;  2P81 A;  4G12 A;  2DTZ A;  3HB9 A;  1IGN A;  3HGY A;  5M3F J;  1D5Y A;  1WGX A;  4A3M J;  1WI3 A;  1QVT A;  3B6A A;  4FIS A;  3NAU A;  4M6V A;  5FKN A;  1MNM C;  2GLO A;  1DU0 A;  1FTT A;  3JRH A;  3BT9 A;  1OCP A;  2XPW A;  3GTQ J;  2DMU A;  1OCT C;  1ORK A;  4X6A J;  1QRY A;  2XB5 A;  1B72 A;  4L5E A;  4BY7 J;  4V2F A;  2EZH A;  3HOW J;  3BG3 A;  2R5Z A;  2YUS A;  1U78 A;  1K61 A;  3BTI A;  4MFD A;  2FQ4 A;  5J1Y A;  3G1L A;  1S7E A;  2DJN A;  1I6H J;  3S2D J;  4UUS A;  4LOC A;  3TP3 A;  1MBF A;  9ANT A;  4A3F J;  3GTK J;  2R5Z B;  2CQX A;  4I76 A;  5F04 A;  1IUF A;  3S2H J;  3LSJ A;  3VPR A;  2XGC A;  3BR2 A;  1ETK A;  3O8G A;  3OIO A;  2NVQ J;  1PUF B;  1T33 A;  1U9N A;  1H88 C;  4A3L J;  5FJ8 J;  1UG2 A;  5F0H A;  2EQR A;  2ECC A;  2VKE A;  4I6Z A;  1F43 A;  2LTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...