4XIHA

Crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
153
Chain Sequence
HMLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANAGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AhpC/TSA family protein
publication title The active site architecture in peroxiredoxins: a case study on Mycobacterium tuberculosis AhpE.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain ccdc5079)
molecule tags Oxidoreductase
total genus 53
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4xihA00
4OFNA 4TKYA 3HJOA 1TRVA 3QPMA 5CRHA 3TRPA 3ZITA 5LCZA 3W8JA 3US3A 1A2JA 3IA1A 4NAXA 4POMA 5ELGA 5EVOA 2LKUA 4OFTA 4PX1A 3CTFA 2NVLA 4G19A 4FYBA 4IGJA 4L5LA 2GSQA 3CRTA 3QCPA 12GSA 2VOCA 5H5QA 1XOBA 3DEXA 2PBJA 4K0GA 3RDWA 1T00A 2O87A 5INYA 1FB0A 3VWVA 1XW9A 3WGEA 3GURA 3M8NA 3M1GA 2H76A 1VGLA 1MDIA 3KD0A 2GS3A 9GSSA 1V2AA 5C04A 3H4KA 5ECOB 5J9BA 2BTOT 4WR4A 2H1BA 2L4CA 3D0ZA 3ZIJA 1XXUA 2PERA 3RPPA 4DSRA 2Z9SA 3F4SA 5ECNB 4G10A 4HJ2A 3DVWA 3KMNA 2H30A 1AAZA 1X5EA 2KP1A 1N2AA 3C1RA 2CVKA 1LBKA 3L9UA 4I5QA 4QQ7A 2F8AA 5GAND 4RUVA 4ZXGA 1EGOA 4NXIA 4XS1A 2YANA 2ZUPA 2CT6A 2GT6A 2FLSA 1M7TA 3C7MA 2B1KA 3KTBA 5A5KA 5FT3A 4MA9A 5JCWA 2AUVA 1HNBA 2JACA 3LFLA 3FK8A 2XBQA 3GV1A 5F05A 2C4JA 2XBIA 1ZZYA 3TJGA 5GZZB 2ALBA 4TXVA 4POLA 1ZGNA 1NW2A 2DSAA 1Z7RA 2LJRA 2AJQB 2C3QA 5FHIA 5D9VA 4KDYA 2CZ2A 2HFDA 4JBBA 4TXOA 5IO2A 4XS4A 4GRFA 5B7CA 1O8WA 2HXKA 2C3NA 4DSSB 4ECIA 4PGTA 2GZPA 3TJKA 3EMXA 4GSTA 3TJJA 4MP4A 3IR4A 3I9V2 2M72A 1BQ7A 4FYCA 3RPNA 4EL1A 2HLSA 3ZMLA 5DJLA 3EC3A 4D73B 4YQMA 2FA8A 3UIWA 2QGVA 2MBSA 1Z6MA 3HHVA 4PQHA 1SU9A 5DCGA 4XHMA 1YF1A 2QSIA 3APOA 2XPDA 1AW9A 1FOVA 1ERWA 4HQZA 3GTUB 1Z7PA 5KN0A 2R6KA 2H6XA 1CQGA 2P0GA 2E2GA 3LEFA 2PVOC 2HE3A 3LJRA 3OR5A 1A0FA 3QAVA 1K0DA 1QFNA 1XWGA 3IV4A 6GSXA 2VM1A 1I9DA 4OCEA 4MH2A 3RHBA 1ERTA 3ERFA 4ML6A 3G7YA 1M9AA 1X0RA 1ST9A 5E4WA 2O8VB 4GSNA 2OBIA 4JZQA 4BVXA 1X5DA 3C1SA 3L4NA 1BEDA 3A3TA 2A2RA 1M2AA 2JZSA 2VLVA 2KLXA 4N11A 4KW6A 2WB9A 5ECLB 3PR8A 4XCSA 1GWCA 1T3BA 3CYNA 3F3QA 3GSSA 4BL7A 2FNOA 5KN1A 4IVFA 1K3YA 2R37A 1Y6EA 1VF4A 1ACVA 1QMVA 1SYXA 1XPVA 4LL4B 1SL2B 3SWLA 2XHFA 2DJ1A 3Q6OA 2VD1A 3H1NA 5ELAA 3UEMA 3QR6A 1OC9A 3GKKA 5IMAA 4WEYA 1YKCA 3F63A 4KDXA 8GSSA 3FYGA 1DBYA 2LJKA 3F4TA 1MDJA 2E7PA 2K6VA 4OO5A 4OMVA 4WBRD 1TK5B 3D6IA 1K0CA 1PX6A 3QFBC 7GSSA 5D9XA 4Q5NA 2EC4A 1U87A 2F51A 3TOUA 1VF3A 1MD4A 3BCIA 2DJ3A 4MK3A 20GSA 4WF4A 5IPGA 4MF7A 4N0VA 3K8NA 2B3SA 1EV4A 2IFQA 1JFUA 1AIUA 4HZ2A 3FR9A 3UBLA 4OFMA 3C73A 2OKAA 2WGRA 2BMXA 4AJ7A 3MAKA 1A8YA 4KSMA 4IP1A 2DIZA 1UC7A 1YKAA 4MPGA 1ABAA 5CRDA 5CRWA 1TI1A 1TRSA 4L5OA 6GSVA 1ON4A 1FW1A 4ECJA 2OE3A 4F9ZA 3CXGA 1TW9A 2YP6A 2QKEA 1IYIA 1JZDA 3KGKA 5GAPD 3VPQA 1EWXA 3WT2A 4RQXA 2VLUA 3IAS2 2X99A 2K8SA 1EEMA 1WP0A 3UAPA 5IMVA 3CTGA 3IHQA 4HOJA 2L5OA 2WZ9A 2YOIA 2X8CA 1SL0B 1F3BA 2MMNA 3QMXA 3UBKA 1UA5A 1SJIA 1JZRA 5IOXA 1M0UA 1UVZA 2DJ2A 2H74A 3DVXA 4F2IA 4Z7XA 3AY8A 2TIRA 2KUCA 1ZL9A 2H72A 1HQOA 1AXDA 2HZEA 3KEBA 3ZMKA 5IOWA 1SD9A 1ILOA 2E2MA 1PSQA 2C3TA 1OKDA 4XRDA 4AGSA 3DIEA 3A2XA 1OYJA 5F06A 1FVKA 2FWFA 3FZ4A 3VI5A 1TP9A 1THXA 2LTKA 2VCTA 2KOKA 1TK8B 2WRTA 3GFKA 3M9JA 5D96A 3I43A 1K0BA 1GTAA 4IS0A 5ID2B 2MMAA 1R5AA 3HKRA 4BWSA 2M46A 4I2UA 4TXOB 4EE0A 1GRXA 4XS4B 3FR3A 5CNWA 1WE0A 3KXOA 1R5PA 4KH7A 1GLQA 1O85A 1SL1B 2RM6A 1XVQA 1URMA 4PURA 2GQKA 1ERUA 3LWAA 1DUGA 3VLNA 2FWHA 2C0GA 1XIYA 3L0HA 1OE7A 4TOPA 2H66A 3VPTA 4GTUA 3HZ4A 4WETA 3KZQA 2M80A 1FHEA 4MABA 2C8UA 2LRTA 5HQPA 2CA8A 6GSSA 4IBPA 1TU7A 3CBUA 4ZBAA 3GX0A 4TR4A 2I81A 2PVQA 3I6AA 4IJ3A 4K7NA 4H86A 4POBA 1SJZA 4OWYA 3O6TA 5ECKB 2PUKC 4ULXA 3CMIA 1A2MA 1YQ1A 3P90A 5ECRB 4YAVA 2LRCA 3TKSA 4XS6A 4OO4A 2IMEA 2AHEA 3CSIA 4KB3A 3SBCA 3O76A 1OKTA 3M3MA 2B1LA 3TOTA 3GMFA 3L9SA 5A4UA 2MZCA 3BCKA 2B7KA 2MMOA 5KN3A 2YWNA 4AJ6A 3E9JB 3EU3A 4GXZA 3WYWA 2OACA 3DRNA 1X9MB 4O7HA 4J57E 1Q98A 1PX7A 1TRWA 2VCWA 4Q5QA 2GLRA 3F0IA 4ECBA 1T1VA 2J23A 1XBSA 1X5CA 2V6KA 4FIWA 5HR2A 1T4YA 5J5NA 3TKRA 4EKZA 2ES7A 3LGCA 1S3AA 1PA3A 2MBTA 2H6YA 2P31A 2YZHA 5ECSA 4GSSA 2EIOA 2I3YA 1DE1A 1SK0A 4OD7A 1V58A 2FA4A 4Q5FA 2VCZA 1OVNA 1YEXA 4ZILA 4IKHA 5CYYA 2WJUA 1OC9B 2GSRA 3WGDA 3D4TA 1TRUA 3A2VA 2C0EA 3UARA 4TR3A 4EO3A 1BAYA 1HYUA 3IRAA 3TRQA 1O8XA 2YZUA 3QAWA 5LNKe 3ME8A 4CDOA 5EPFA 3P7XA 2JADA 1PMTA 2YV7A 2YWOA 4V2MA 2CAIA 2CVBA 4FH8A 1BJXA 3TGZA 2VCVA 1WIKA 2KHPA 1F2EA 3Q18A 3GX8A 4KA0A 2X8HA 2B5EA 5ID2A 4KCEA 3HZ8A 1GSEA 2IWTA 1ZYQB 3ME7A 2IMDA 4F0CA 1V9WA 3GL5A 2IFQB 2HYXA 5G2ZA 3ZTLA 3IPZA 2I4AA 5D9WA 1ZCPA 2NBSA 4KE3A 1YDKA 16GSA 1F9MA 3ZL5A 5CAXA 4K7IA 1PD21 2PMTA 3H93A 4DVCA 2DC5A 4F0BA 5DALA 1WOUA 4NHZA 4AJ8A 5JCGA 1QXHA 1KNGA 5KN2A 4HZ4A 2LQQA 1VF1A 2IN3A 3NZNA 3P8WA 2LUSA 3HVVA 3KP8A 2G0FA 1PQNA 1QK8A 1H75A 4BA7A 4X43A 5A4VA 2TRXA 5G1KA 2MYGA 1A24A 3RBTA 2JL4A 1TDIA 3NIVA 2B6MA 2X8GA 3GHAA 2R5GA 3EU4A 5ECQB 2PPTA 1B4PA 2N5BA 1C72A 2LNTA 4MF6A 1AUCA 3QOUA 5LD0A 4TW5A 2JSZA 5HFKA 3LYKA 3GIXA 1V98A 2L59A 1GTBA 2HZEB 3BJ5A 3UVHA 1R26A 2FWEA 2K9FA 1J0FA 6GSTA 2V6OA 3F6FA 3FW2A 5H5SA 2JSYA 3C71A 2CAQA 3VI7A 2MMZA 4I8BA 2X64A 14GSA 1VF2A 2H0GA 4J56E 5ABRA 3GNJA 3QDNA 4L0WA 2HT9A 2VD0A 2L6DA 1GSSA 1A23A 4KAEA 3ZREA 1TXXA 3VK9A 1WMJA 3QAGA 4QL7A 2O89A 5J3RA 3R2QA 1CQHA 3HD5A 1U3AA 1PL1A 3IOSA 3KH7A 4NV5A 3UL3A 4GCIA 1R4WA 4PUAA 3D5JA 2CX4A 1XVWA 2FUG2 2GTUA 1YF0A 1U88A 2IJYA 3GKXA 4KGIA 3GKMA 2V32A 3TUEA 2KP2A 2DLXA 2YN1A 4N30A 2LSTA 5D8IA 2AV4A 4GQCA 1OE8A 3FZAA 4ML1A 4XRAA 3F8UA 3Q19A 3HYPA 5IIZA 2G2QA 2WCIA 1GTUA 1R7HA 1WJKA 4IW9A 3TRXA 3MDKA 1GSYA 2J9HA 1G7OA 1EZKA 5A4WA 3HDCA 4E8HA 3GH9A 1MDKA 1RQMA 4AF2A 3EINA 1EV9A 3VWUA 3PGTA 1Z6NA 2JZRA 3ZZXA 3IAM2 3LORA 3M0FA 2GSTA 2IMFA 4IP6A 1HNAA 4TR0A 1USBA 5C00A 1QQ2A 1ZMAA 2V2GA 1GL8A 1E6BA 1K0NA 1T8EB 3HA9A 3HXSA 2FD3A 3LQ7A 4IJIA 1FO5A 1PRXA 5COHA 1MEKA 2VL2A 2OJLA 1THOA 3VURA 2LV3A 5HR0A 3HY2A 4TR1A 5JWRB 3MWHA 2GVPA 4XIHA 2B7JA 3WGXA 2C1YA 1LU4A 1Q4JA 5ECIB 4K8MA 3VWXA 1FVJA 2B5XA 5G5EA 2HRFA 5F07A 3N5OA 3GYKA 10GSA 4EXJA 4MJCA 3Q74A 4RI6A 3GH6A 2R3XA 2FWGA 4ZL8A 3W8SA 3ZYWA 1X9WB 1AQXA 3JCML 5HR3A 4CHSA 1SENA 3DMLA 4JU5A 4MJBA 4F82A 2O7KA 4JR4A 5DQYA 1SD8A 5CRGA 4MPFA 4K6XA 5G31A 1OAZA 2E0QA 2NDOA 3GUSA 4G9HA 3FEUA 4LMVA 4POKA 4MH3A 1XOAA 1KTEA 3KM6A 1OC3A 1F6MC 2IMKA 5DBQA 4G2EA 2DJ0A 3A5WA 4OCFA 3ZFBA 1SKWB 4HS1A 3MNGA 22GSA 5IMFA 1JLVA 3D4MA 2H75A 2YWMA 2LRNA 4K7OA 1BX9A 2JZTA 4KCAA 1O6JA 4IN0A 3F6DA 1NHYA 1Z3EA 2RIIA 2RM5A 1BYEA 1EGRA 5D9TA 1XW5A 4J2FA 1X9SB 2YCDA 2HSYA 3PH9A 3J7Yb 3DYRA 3EE2A 3FHKA 5IO0A 2IMIA 4MJEA 3APQA 3H8QA 3HJMA 1TJDA 3CRUA 3LYPA 1GSFA 3TDGA 2CVDA 2LS5A 1HNCA 3GSTA 5DALB 1RW1A 3ZRDA 5CREA 5ENUA 4Q5RA 4FYUA 2VO4A 1M9BA 1F37A 1TOFA 4E8EA 1SK2A 3BD2A 4XTSA 2H73A 3IE3A 4EVMA 5J41A 2GSSA 4ZBDA 4HDEA 1PL2A 4EDYA 3LG6A 1YZXA 4PNFA 3C8EA 4DEJA 5L71A 1EP8A 5G5FA 2OE1A 2GQMA 4MF5A 1XZOA 4TVEA 3VFIA 1EOHA 1GSQA 2CQ9A 2IIYA 3U5RE 2VCXA 4O32A 2DMMA 2A2SA 2YPMA 4FO5A 3RHCA 3G7IA 4NMUA 2YJHA 1GUKA 2C0FA 1TK0B 1QGVA 4KSOA 1K0OA 1T4ZA 4PQ1A 2ON7A 3UMAA 3GA4A 1J08A 1O73A 3IDVA 5ECMB 2LEGA 1G0TA 2VUPA 2DJJA 2BJXA 1K0AA 3KMOA 2EIQA 1PKZA 5B6NA 4L0UA 3CSJA 4IHUA 2B5YA 3DGQA 1M2BA 1SJ6A 1G7EA 3TCOA 4X1UA 4KUNA 2H19A 1QUWA 3FY7A 3J7Yk 4ZB6A 1V57A 1JLWA 3D22A 2PWJA 3HVXA 1ZOFA 2HNLA 2OBKA 2H0HA 3HJPA 3BOAA 2L6CA 5HFGA 1BG5A 3BBYA 1B8XA 4KX4A 1DE2A 3L9VA 3APSA 4N0ZA 3WT1A 4YAPA 3TJBA 11GSA 1SK1A 5DAKA 3KP9A 1O7UA 3FRCA 3UOMA 3VWWA 4V2LA 4EF0A 4ZBBA 4PUFC 5F0GA 5B6MA 3UJ1A 5B8BA 5DCHA 2IL3A 5EL8A 4PNGA 1PGTA 2GDRA 2VM2A 3TKSC 2ZNMA 3GL3A 4K9ZA 1GP1A 4K0NA 1MD3A 4PXOA 1E2YA 2REMA 2EIRA 1EP7A 1NM3A 3ZFLA 3W6GA 4ECCA 2AAWA 4JRRA 4LMWA 4LL1B 4EDZA 5G30A 4MCUA 2JU5A 3IK9A 1U3IA 1GSDA 1XWAA 4WBJA 1W4VA 1JHBA 2K18A 1GNEA 1JZWA 1ZYEA 2DBCA 13GSA 4MDCA 4BPYA 3TKSE 1AQWA 2WDUA 3QD9A 2VLTA 1ERVA 2NPBA 2V41A 2FCHA 3NOFA 1B48A 1WWJA 4LA1A 4JE1A 3QFAC 19GSA 5J9CA 4ILFA 2H01A 5DVBA 5AISA 2H0IA 1RK4A 2VL3A 5AN1A 4GWRA 1JZOA 1UN2A 4HJMA 4N10A 1EOGA 4IQAA 2XPEA 2DJKA 4NPBA 4TR1B 2YNXA 3G7JA 4MMMA 2VCQA 3RAZA 3EWLA 2ZCTA 1S3CA 4F03A 1PN9A 2H70A 2N5AA 3DXBA 1GULA 2RLIA 3A2WA 4JR6A 4PQIA 1SYRA 1FAAA 5JWQB 3TB2A 4X0XA 1TU8A 4V1Ag 5GSTA 2QC7A 5E59A 4DSQA 5CO3A 1G6WA 2LNSA 5HFIA 2XC2A 5AIXA 4ZL7A 1WRYA 4NWYA 5G1LA 1KBNA 3LXZA 3DWVA 4GLTA 4YQUA 2HZFA 2PGTA 2H1AA 2F3MA 4IQ1A 3EMPA 2GT5A 1K3LA 4RQRA 3TJFA 2FY6A 5KEJA 2AYTA 2FHEA 4HI7A 5H5RA 5F8BA 1LJRA 2P5QA 2F8FA 3M9KA 3GRXA 5IMCA 2WS2A 5AIVA 4EUYA 4ID0A 1A2LA 3IBHA 2K8VA 4GQFA 1H4OA 2OE0A 2H1GA 3FZ9A 1K3OA 1TI3A 4ACSA 4V1Ap 1XWKA 3EVIA 2IPAA 3GKNA 4I97A 2GGTA 1W89A 3FKFA 2OA7A 2O85A 3ERGA 1G6YA 3KTLA 4WKWA 5ECHB 2C80A 2H1DA 1B9YC 3LXTA 4RI7A 2ON5A 1F3AA 3E0UA 4MJAA 5IMDA 2D2ZA 4MZWA 3F4RA 4YH2A 3KJYA 4KDUA 4TRXA 1B9XC 3F3RA 4EC0A 5CP1A 2RUFA 4NV2A 3HCZA 2L4QA 3FZ5A 2V1MA 4HU7A 3HVSA 1N8JA 3O3TA 4O92A 2TRCP 2I1UA 1SKSB 5IPHA 2WFCA 1YEPA 4WR5A 1Y25A 4K1FA 1XWCA 2A4VA 1MTCA 3KCMA 6GSUA 4MLYA 4WF5A 2YWIA 3PINA 4IELA 3EYTA 3IC4A 5EY6A 4JEDA 2OADA 2GQLA 1GUMA 4I2TA 5AGYA 5IQYA 1V40A 3ERWA 5IM9A 4DSSA 6GSWA 1NSWA 3H79A 4HEA2 4LLRA 3ZVJA 4O5RA 3IXRA 2C0DA 3EURA 5JWOB 3P2AA 5IMZA 4D73A 3ZLPA 4ZB9A 2R2JA 3WD6A 1M2DA 1T7PB 3MSZA 2I9HA 1GNWA 1HD2A 1TKDB 3U6VA 1M99A 3KH9A 4KNDA 3GTUA 4V2NA 5B8AA 4TN8A 4HU9A 5JCUA 6GSYA 3ED3A 3G9BA 4P3YB 4BWQA 2PU9C 5DDLA 1GSUA 1ML6A 1GH2A 2HSHA 3KIJA 2H6ZA 3GN3A 1GLPA 1XWBA 2HI7A 1S3DA 4I6XA 2L5LA 3I69A 1VRSD 2FGXA 2GZYA 3D21A 4ZIJA 5GSSA 2VAFA 4MZBA 1U6TA 1XCCA 3UVTA 1Z9HA 2DMLA 5D93A 1PKWA 1K0MA 1YY7A 5DAKB 17GSA 4MZCA 2PN8A 1NHOA 1DSBA 1XW6A 1AQVA 2LQOA 2YJ7A 1FG4A 3TKQA 3IK7A 1OC8A 2DIYA 2CX3A 4HUAA 3FR6A 2CV4A 1O81A 2VL9A 2CZ3A 3ZIVA 4HQSA 2N5FA 2F9SA 3DKSA 2GZZA 3CSHA 4WXTA 5HR1A 1GTIA 1GUHA 1A8LA 5DJMA 2LJAA 5DQSA 5ECPB 3TKPA 2WULA 1TTZA 2VL2C 1A0RP 1SKRB 1KEBA 4K2DA 1I5GA 3ISOA 3S9FA 2HRNA 1WPIA 3F9UA 1IYHA 4NHWA 2NTOA 1XFLA 4QL9A 1J9BA 2RUEA 3DD3A 1YJ6A 4YQVA 1B4QA 2H8LA 2L57A 1FB6A 18GSA 4ZB8A 4BVYA 4GF0A 1Z5YE 3ZVJD 3N9JA 5FWGA 3V1WA 2R4VA 3LSZA 4L8EA 5D73A 4ZL9A 1EEJA 4CW9A 2H71A 2VIMA 2P5RA 1AC1A 4ISDA 2AB6A 3E3EA 2YV9A 3L78A 5J4UA
chains in the Genus database with same CATH superfamily
4OFNA 4TKYA 3HJOA 1TRVA 3QPMA 5CRHA 3TRPA 3ZITA 4A5PA 5LCZA 3W8JA 3US3A 1A2JA 3IA1A 4NAXA 4POMA 5ELGA 5EVOA 2LKUA 4OFTA 4PX1A 3CTFA 2NVLA 2UZ8A 4G19A 4FYBA 4IGJA 4Z2TA 4L5LA 2GSQA 3CRTA 3QCPA 12GSA 2VOCA 5H5QA 1XOBA 3DEXA 2PBJA 4K0GA 3RDWA 1T00A 2O87A 5INYA 1FB0A 3VWVA 1XW9A 3WGEA 4BVXB 3GURA 3M8NA 3M1GA 2H76A 1VGLA 1MDIA 3KD0A 4K5RA 2GS3A 9GSSA 1V2AA 5C04A 3H4KA 5ECOB 5J9BA 2BTOT 4WR4A 2H1BA 2L4CA 3D0ZA 3ZIJA 1XXUA 2PERA 3RPPA 4DSRA 2Z9SA 4BL7B 3F4SA 5ECNB 4G10A 4HJ2A 3DVWA 3KMNA 2A2PA 2H30A 1AAZA 1X5EA 2KP1A 1N2AA 3C1RA 2CVKA 1LBKA 3L9UA 4I5QA 4QQ7A 2F8AA 2DKHA 5GAND 4RUVA 4ZXGA 1EGOA 4NXIA 4XS1A 2YANA 2ZUPA 2CT6A 2GT6A 2FLSA 1M7TA 3C7MA 2B1KA 3KTBA 5A5KA 5FT3A 4MA9A 5JCWA 2AUVA 1HNBA 2JACA 3LFLA 3FK8A 2XBQA 3GV1A 5F05A 2C4JA 2XBIA 1ZZYA 3TJGA 5GZZB 2ALBA 4TXVA 4POLA 1ZGNA 1NW2A 2DSAA 1Z7RA 2LJRA 2AJQB 2C3QA 5FHIA 5D9VA 4KDYA 2CZ2A 2HFDA 4JBBA 4TXOA 5IO2A 4XS4A 4GRFA 5B7CA 1O8WA 2HXKA 2C3NA 4DSSB 4ECIA 4PGTA 2GZPA 3TJKA 3EMXA 4GSTA 3TJJA 4MP4A 3IR4A 3I9V2 2M72A 1BQ7A 4FYCA 3RPNA 4EL1A 2HLSA 3ZMLA 5DJLA 3EC3A 4D73B 4YQMA 2FA8A 3UIWA 2QGVA 2MBSA 1Z6MA 3HHVA 4PQHA 1SU9A 5DCGA 4XHMA 1YF1A 2QSIA 3APOA 2XPDA 1AW9A 1FOVA 1ERWA 4HQZA 3GTUB 1Z7PA 5KN0A 2R6KA 2H6XA 1CQGA 2P0GA 2E2GA 3LEFA 2PVOC 4X4JA 2HE3A 3LJRA 3OR5A 1A0FA 3QAVA 1K0DA 1QFNA 1XWGA 3IV4A 6GSXA 2VM1A 1I9DA 4OCEA 4MNNA 4MH2A 3RHBA 1ERTA 3ERFA 4ML6A 3G7YA 1M9AA 1X0RA 1ST9A 5E4WA 2QA2A 2O8VB 2HRKA 4GSNA 2OBIA 4JZQA 4BVXA 1X5DA 3C1SA 3L4NA 1BEDA 3A3TA 2A2RA 4HSCX 1M2AA 2JZSA 2VLVA 2KLXA 4N11A 4KW6A 2WB9A 5ECLB 1PFOA 3PR8A 4XCSA 1GWCA 1T3BA 3CYNA 3F3QA 3GSSA 4BL7A 2FNOA 5KN1A 4IVFA 1K3YA 2R37A 1Y6EA 5KOWA 3EPTA 1VF4A 1ACVA 1QMVA 1SYXA 1XPVA 4LL4B 1SL2B 3SWLA 2XHFA 2DJ1A 3Q6OA 2VD1A 3H1NA 5ELAA 3UEMA 3QR6A 1OC9A 3GKKA 5IMAA 4WEYA 1YKCA 3F63A 4KDXA 8GSSA 3FYGA 1DBYA 2LJKA 3F4TA 1MDJA 2E7PA 2K6VA 4OO5A 4OMVA 4WBRD 1TK5B 3D6IA 4BVYB 1K0CA 1PX6A 3QFBC 7GSSA 5D9XA 4Q5NA 2EC4A 1U87A 2F51A 2HSMA 1VF3A 3TOUA 1MD4A 3BCIA 2DJ3A 4MK3A 20GSA 4WF4A 5IPGA 4MF7A 4N0VA 3K8NA 2B3SA 1EV4A 2IFQA 1JFUA 1AIUA 4HZ2A 3FR9A 3UBLA 4OFMA 3C73A 2OKAA 2WGRA 2BMXA 4AJ7A 3MAKA 1A8YA 4KSMA 4IP1A 2DIZA 1UC7A 1YKAA 4MPGA 1ABAA 5CRDA 5CRWA 1TI1A 1TRSA 4L5OA 6GSVA 1ON4A 1FW1A 4ECJA 2OE3A 4F9ZA 3CXGA 1TW9A 2YP6A 2QKEA 1IYIA 1JZDA 3KGKA 5GAPD 3VPQA 1EWXA 3WT2A 4RQXA 2VLUA 3IAS2 2X99A 2K8SA 4G0IA 1EEMA 1WP0A 3UAPA 5IMVA 3CTGA 3IHQA 4HOJA 2L5OA 2WZ9A 2YOIA 2X8CA 1SL0B 1F3BA 2MMNA 3QMXA 3UBKA 1UA5A 1SJIA 1JZRA 5IOXA 1M0UA 1UVZA 2DJ2A 2H74A 3DVXA 4F2IA 4Z7XA 3AY8A 2TIRA 2KUCA 1ZL9A 2H72A 1HQOA 1AXDA 2HZEA 3KEBA 3ZMKA 5IOWA 1SD9A 1ILOA 2E2MA 1PSQA 2C3TA 1OKDA 4XRDA 2X4AA 4AGSA 3DIEA 3A2XA 1OYJA 5F06A 1FVKA 2FWFA 3FZ4A 3VI5A 1TP9A 1THXA 2LTKA 2VCTA 2KOKA 1TK8B 2WRTA 3GFKA 3M9JA 5D96A 3I43A 1K0BA 1GTAA 4IS0A 5ID2B 2MMAA 1R5AA 3HKRA 4BWSA 2M46A 4EIPA 4I2UA 4TXOB 4EE0A 1GRXA 4XS4B 3FR3A 5CNWA 1WE0A 3KXOA 1R5PA 4KH7A 1GLQA 1O85A 1SL1B 2RM6A 1XVQA 1URMA 4PURA 2GQKA 1ERUA 3LWAA 1DUGA 3VLNA 2FWHA 2C0GA 1XIYA 3L0HA 1OE7A 4TOPA 2H66A 3VPTA 4GTUA 3HZ4A 4WETA 3KZQA 2M80A 1FHEA 4MABA 2C8UA 2LRTA 5HQPA 2CA8A 3CQFA 6GSSA 4IBPA 1TU7A 3CBUA 4ZBAA 3GX0A 4TR4A 2I81A 2PVQA 3I6AA 4IJ3A 4K7NA 4H86A 4POBA 1SJZA 4OWYA 3O6TA 5ECKB 2PUKC 2R0PA 4ULXA 3CMIA 1A2MA 1YQ1A 3P90A 5ECRB 4YAVA 2LRCA 3TKSA 4XS6A 4OO4A 2IMEA 2AHEA 3CSIA 4KB3A 3SBCA 3O76A 1OKTA 3M3MA 2B1LA 3TOTA 3GMFA 3L9SA 5A4UA 2MZCA 3BCKA 2B7KA 2MMOA 5KN3A 2YWNA 4AJ6A 3E9JB 3EU3A 4GXZA 3WYWA 2OACA 3DRNA 1X9MB 4O7HA 4J57E 1Q98A 1PX7A 1TRWA 2VCWA 4Q5QA 2GLRA 3F0IA 4ECBA 1T1VA 2J23A 1XBSA 1X5CA 2V6KA 4FIWA 5HR2A 2R0GA 1T4YA 5J5NA 3TKRA 4EKZA 2ES7A 3LGCA 1S3AA 1PA3A 2MBTA 2H6YA 2P31A 2YZHA 5ECSA 4GSSA 2EIOA 2I3YA 1DE1A 1SK0A 4OD7A 1V58A 2FA4A 4Q5FA 2VCZA 1OVNA 1YEXA 4ZILA 4IKHA 5CYYA 2WJUA 1OC9B 2GSRA 3WGDA 4ICYA 3D4TA 4YKFA 1TRUA 3A2VA 2C0EA 3UARA 4TR3A 4EO3A 1BAYA 1HYUA 3IRAA 3TRQA 1O8XA 2YZUA 3QAWA 3IHGA 5LNKe 3ME8A 4CDOA 5EPFA 3P7XA 2JADA 1PMTA 2YV7A 2YWOA 4V2MA 2CAIA 2CVBA 4FH8A 1BJXA 3TGZA 2VCVA 1WIKA 2KHPA 1F2EA 3Q18A 3GX8A 4KA0A 2HRAA 2X8HA 2B5EA 5ID2A 4KCEA 3HZ8A 1GSEA 2IWTA 1M3IA 2A4HA 1ZYQB 3ME7A 2IMDA 4F0CA 1V9WA 3GL5A 2IFQB 2HYXA 5G2ZA 3ZTLA 3IPZA 2I4AA 5D9WA 1ZCPA 2NBSA 4KE3A 1YDKA 16GSA 1F9MA 2DKIA 3ZL5A 5CAXA 4K7IA 1PD21 2PMTA 3H93A 4DVCA 2DC5A 4F0BA 5DALA 1WOUA 4NHZA 4AJ8A 5JCGA 1QXHA 1KNGA 5KN2A 4G0LA 4K2XA 4HZ4A 2LQQA 1VF1A 2IN3A 3NZNA 3P8WA 3HVNA 2LUSA 3HVVA 3KP8A 2G0FA 1PQNA 1QK8A 1H75A 4BA7A 4X43A 5A4VA 2TRXA 5G1KA 2MYGA 4CY8A 1A24A 3RBTA 2JL4A 1TDIA 3NIVA 2B6MA 2X8GA 3GHAA 2R5GA 4Z2RA 3EU4A 5ECQB 2PPTA 1B4PA 2N5BA 1C72A 2LNTA 4MF6A 1AUCA 3QOUA 5LD0A 4BIKA 4TW5A 2JSZA 5HFKA 3LYKA 3GIXA 1V98A 2L59A 1GTBA 2HZEB 3BJ5A 3UVHA 1R26A 2FWEA 2K9FA 1J0FA 6GSTA 2V6OA 3F6FA 3FW2A 5H5SA 2JSYA 3C71A 2CAQA 3VI7A 5BRTA 2MMZA 4G0KA 4I8BA 2X64A 14GSA 1VF2A 2H0GA 4J56E 5ABRA 3GNJA 3QDNA 4L0WA 2HT9A 2VD0A 2L6DA 1GSSA 1A23A 4KAEA 3ZREA 1TXXA 3VK9A 1WMJA 3QAGA 4QL7A 2O89A 5J3RA 3R2QA 1CQHA 3HD5A 1U3AA 3PPUA 1PL1A 3IOSA 3KH7A 4NV5A 3UL3A 4GCIA 1R4WA 4PUAA 3D5JA 2CX4A 1XVWA 2FUG2 2GTUA 1YF0A 1U88A 2IJYA 2X49A 3GKXA 4KGIA 3GKMA 4Z2UA 2V32A 3TUEA 2KP2A 2DLXA 2YN1A 4N30A 2LSTA 5D8IA 2AV4A 4GQCA 1OE8A 3FZAA 4ML1A 4XRAA 3F8UA 3Q19A 3A5IA 3HYPA 5IIZA 2G2QA 2WCIA 1GTUA 1R7HA 1WJKA 4IW9A 3TRXA 1M3JA 3MDKA 1GSYA 2J9HA 1G7OA 1EZKA 5A4WA 3HDCA 4E8HA 3GH9A 1MDKA 1RQMA 4AF2A 3EINA 1EV9A 3VWUA 3PGTA 1Z6NA 2JZRA 3ZZXA 3IAM2 3LORA 3M0FA 2GSTA 2IMFA 4IP6A 1HNAA 4TR0A 1USBA 5C00A 1QQ2A 2QA1A 1ZMAA 2V2GA 1GL8A 1E6BA 1K0NA 1T8EB 3HA9A 3HXSA 2FD3A 3LQ7A 4IJIA 1FO5A 1PRXA 5COHA 1MEKA 2VL2A 2OJLA 1THOA 3VURA 2LV3A 5HR0A 3HY2A 4TR1A 5JWRB 4FQUA 3R3EA 3MWHA 2GVPA 4KF9A 4XIHA 2B7JA 3WGXA 2C1YA 1LU4A 1Q4JA 5ECIB 4K8MA 3VWXA 1FVJA 2B5XA 5G5EA 2HRFA 5F07A 3N5OA 3GYKA 10GSA 4EXJA 4MJCA 3Q74A 4RI6A 3GH6A 2R3XA 2FWGA 4ZL8A 4USSA 3W8SA 3ZYWA 1X9WB 1AQXA 3JCML 5HR3A 4CHSA 1SENA 3DMLA 4JU5A 4MJBA 4F82A 2O7KA 3MIXA 4JR4A 1SD8A 5DQYA 5CRGA 4MPFA 4K6XA 5G31A 5KOXA 1OAZA 2E0QA 2NDOA 3GUSA 4G9HA 3FEUA 4LMVA 4POKA 4MH3A 1XOAA 1KTEA 3KM6A 1OC3A 1F6MC 2IMKA 5DBQA 4G2EA 2DJ0A 3A5WA 4OCFA 3ZFBA 1SKWB 4HS1A 3MNGA 22GSA 5IMFA 1JLVA 3D4MA 2H75A 2YWMA 2LRNA 4K7OA 1BX9A 2JZTA 2R0CA 4KCAA 1O6JA 4IN0A 3F6DA 1NHYA 1Z3EA 2RIIA 2RM5A 1BYEA 1EGRA 5D9TA 1XW5A 4J2FA 1X9SB 2YCDA 2HSYA 3PH9A 3J7Yb 3DYRA 3EE2A 3FHKA 5IO0A 2IMIA 4MJEA 3APQA 3H8QA 3HJMA 1TJDA 3CRUA 3LYPA 1GSFA 3TDGA 2CVDA 2LS5A 1HNCA 3GSTA 5DALB 1RW1A 3ZRDA 5CREA 5ENUA 4Q5RA 4FYUA 2VO4A 3MYDA 1M9BA 1F37A 1TOFA 4E8EA 1SK2A 3BD2A 4XTSA 2H73A 3IE3A 4EVMA 5J41A 2GSSA 4ZBDA 4HDEA 1PL2A 4EDYA 3LG6A 1YZXA 4PNFA 3C8EA 4DEJA 5L71A 1EP8A 5G5FA 2OE1A 2GQMA 4MF5A 1XZOA 4TVEA 3VFIA 1EOHA 1GSQA 2CQ9A 2IIYA 3U5RE 1XG8A 2VCXA 4O32A 2DMMA 2A2SA 2YPMA 4FO5A 3RHCA 3G7IA 4NMUA 2YJHA 1GUKA 2C0FA 1TK0B 1QGVA 4KSOA 1K0OA 1T4ZA 4PQ1A 2ON7A 3UMAA 3GA4A 1J08A 1O73A 3IDVA 5ECMB 2LEGA 1G0TA 2VUPA 1FOHA 2DJJA 2BJXA 1K0AA 3KMOA 2EIQA 1PKZA 5B6NA 4L0UA 4CY6A 3CSJA 4IHUA 2B5YA 3DGQA 1M2BA 1SJ6A 1G7EA 3TCOA 4X1UA 4KUNA 2H19A 1QUWA 3FY7A 3J7Yk 4ZB6A 1V57A 1JLWA 3D22A 2PWJA 3HVXA 1ZOFA 2HNLA 2OBKA 2H0HA 3HJPA 3BOAA 2L6CA 5HFGA 1BG5A 3BBYA 1B8XA 4KX4A 1DE2A 3L9VA 3APSA 4N0ZA 3WT1A 4YAPA 3TJBA 11GSA 1SK1A 5DAKA 3KP9A 1O7UA 3FRCA 3UOMA 3VWWA 4V2LA 4EF0A 4ZBBA 4PUFC 5F0GA 5B6MA 3UJ1A 5B8BA 5DCHA 3IC8A 2IL3A 5EL8A 4PNGA 1PGTA 2GDRA 2VM2A 3TKSC 2ZNMA 3GL3A 4K9ZA 1GP1A 4K0NA 1MD3A 4YKGA 4PXOA 1E2YA 2REMA 2EIRA 1EP7A 1NM3A 3ZFLA 3W6GA 4ECCA 2AAWA 4JRRA 3FMWA 4LMWA 4LL1B 4EDZA 1ZYNA 5G30A 4MCUA 2JU5A 3IK9A 1U3IA 1GSDA 1XWAA 4WBJA 1W4VA 1JHBA 2K18A 1GNEA 1JZWA 1ZYEA 2DBCA 13GSA 4MDCA 4BPYA 3TKSE 1AQWA 2WDUA 4O5QA 3QD9A 1ZYPA 2VLTA 1ERVA 2NPBA 2V41A 2FCHA 3NOFA 1B48A 1WWJA 4LA1A 4JE1A 3QFAC 19GSA 5J9CA 4ILFA 2H01A 5DVBA 5AISA 2H0IA 1RK4A 2VL3A 5AN1A 4GWRA 1JZOA 1UN2A 4HJMA 4N10A 1EOGA 4IQAA 2XPEA 2DJKA 1S3RA 4NPBA 4TR1B 2YNXA 3G7JA 4MMMA 2VCQA 3RAZA 3EWLA 2ZCTA 1S3CA 4F03A 1PN9A 2H70A 2N5AA 3DXBA 1GULA 2RLIA 3A2WA 4JR6A 4PQIA 1SYRA 1FAAA 5JWQB 3TB2A 4X0XA 1TU8A 4V1Ag 5GSTA 2QC7A 5E59A 4O5UA 5CO3A 4DSQA 1G6WA 2LNSA 5HFIA 2XC2A 5AIXA 4ZL7A 1WRYA 4NWYA 5G1LA 1KBNA 3LXZA 3DWVA 4GLTA 4YQUA 2HZFA 2PGTA 2H1AA 2F3MA 4IQ1A 3EMPA 2GT5A 1K3LA 4RQRA 3TJFA 2FY6A 5KEJA 2AYTA 5BMUA 2FHEA 4HI7A 5H5RA 5F8BA 1LJRA 2P5QA 2F8FA 3M9KA 3GRXA 5IMCA 2WS2A 5AIVA 4EUYA 4ID0A 1A2LA 3IBHA 2K8VA 4GQFA 1H4OA 2OE0A 2H1GA 3FZ9A 1K3OA 1TI3A 4ACSA 4V1Ap 1XWKA 3EVIA 2IPAA 3GKNA 4I97A 2GGTA 1W89A 3FKFA 2OA7A 2O85A 3ERGA 1G6YA 3KTLA 4WKWA 5ECHB 2C80A 1PN0A 2H1DA 1B9YC 3LXTA 4RI7A 2ON5A 1F3AA 3E0UA 4MJAA 5IMDA 2D2ZA 4MZWA 3F4RA 4YH2A 3KJYA 4KDUA 4TRXA 1B9XC 3F3RA 4EC0A 5CP1A 2RUFA 4NV2A 3HCZA 2L4QA 3FZ5A 2V1MA 4HU7A 3HVSA 1N8JA 3O3TA 4O92A 2TRCP 2I1UA 1SKSB 5IPHA 2WFCA 1YEPA 4WR5A 1Y25A 4K1FA 1XWCA 2A4VA 1MTCA 3KCMA 6GSUA 4MLYA 4WF5A 2YWIA 3PINA 4IELA 3EYTA 3IC4A 5EY6A 4JEDA 2OADA 2GQLA 1GUMA 4I2TA 5AGYA 5IQYA 1V40A 3ERWA 5IM9A 4DSSA 6GSWA 1NSWA 3H79A 4HEA2 4LLRA 3ZVJA 4O5RA 3IXRA 2C0DA 4K5SA 3EURA 5JWOB 3P2AA 5IMZA 4D73A 3ZLPA 4ZB9A 2R2JA 3WD6A 1M2DA 1T7PB 3MSZA 2I9HA 1GNWA 1HD2A 1TKDB 3U6VA 1M99A 3KH9A 4KNDA 3GTUA 4V2NA 5B8AA 4TN8A 4HU9A 5JCUA 6GSYA 3ED3A 3G9BA 4P3YB 4BWQA 2PU9C 5DDLA 1GSUA 1ML6A 1GH2A 2HSHA 3KIJA 2H6ZA 3GN3A 1GLPA 1XWBA 2HI7A 1S3DA 2L5LA 4I6XA 3I69A 1VRSD 2FGXA 2GZYA 3D21A 4ZIJA 5GSSA 4PTSA 2VAFA 4MZBA 4EIQA 1U6TA 1XCCA 3UVTA 1Z9HA 2DMLA 5D93A 1PKWA 1K0MA 1YY7A 5DAKB 17GSA 4MZCA 2PN8A 1NHOA 1DSBA 1XW6A 1AQVA 2LQOA 2YJ7A 1FG4A 3TKQA 3IK7A 1OC8A 2DIYA 2CX3A 4HUAA 3LW9A 3FR6A 2CV4A 1O81A 2VL9A 2CZ3A 3ZIVA 4HQSA 2N5FA 2F9SA 3DKSA 2GZZA 3CSHA 4WXTA 5HR1A 1GTIA 1GUHA 1A8LA 5DJMA 2LJAA 5DQSA 5ECPB 3TKPA 2WULA 1TTZA 2VL2C 1A0RP 1SKRB 1KEBA 4K2DA 1I5GA 3ISOA 3S9FA 2HRNA 1WPIA 3F9UA 1IYHA 4NHWA 2NTOA 1XFLA 4QL9A 1J9BA 2RUEA 3DD3A 1YJ6A 4YQVA 1B4QA 2H8LA 2L57A 1FB6A 18GSA 4ZB8A 4BVYA 4GF0A 1Z5YE 3ZVJD 3N9JA 5FWGA 3V1WA 2R4VA 3LSZA 4L8EA 5D73A 4ZL9A 1EEJA 4CW9A 2H71A 2VIMA 2P5RA 1AC1A 4ISDA 2AB6A 3E3EA 2YV9A 3L78A 5J4UA
chains in the Genus database with same CATH topology
4OFNA 4TKYA 3HJOA 1TRVA 3QPMA 5CRHA 3TRPA 3ZITA 4A5PA 5LCZA 3W8JA 3US3A 1A2JA 3IA1A 4NAXA 4POMA 5ELGA 5EVOA 2LKUA 4OFTA 4PX1A 3CTFA 2NVLA 2UZ8A 4G19A 4FYBA 4IGJA 4Z2TA 4L5LA 2GSQA 3CRTA 3QCPA 12GSA 2VOCA 5H5QA 1XOBA 3DEXA 2PBJA 4K0GA 3RDWA 1T00A 2O87A 5INYA 1FB0A 3VWVA 1XW9A 3WGEA 4BVXB 3GURA 3M8NA 3M1GA 2H76A 1VGLA 1MDIA 3KD0A 4K5RA 2GS3A 9GSSA 1V2AA 5C04A 3H4KA 5ECOB 5J9BA 2BTOT 4WR4A 2H1BA 2L4CA 3D0ZA 3ZIJA 1XXUA 2PERA 3RPPA 4DSRA 2Z9SA 4BL7B 3F4SA 5ECNB 4G10A 4HJ2A 3DVWA 3KMNA 2A2PA 2H30A 1AAZA 1X5EA 2KP1A 1N2AA 3C1RA 2CVKA 1LBKA 3L9UA 4I5QA 4QQ7A 2F8AA 2DKHA 5GAND 4RUVA 4ZXGA 1EGOA 4NXIA 4XS1A 2YANA 2ZUPA 2CT6A 2GT6A 2FLSA 1M7TA 3C7MA 2B1KA 3KTBA 5A5KA 5FT3A 4MA9A 5JCWA 2AUVA 1HNBA 2JACA 3LFLA 3FK8A 2XBQA 3GV1A 5F05A 2C4JA 2XBIA 1ZZYA 3TJGA 5GZZB 2ALBA 4TXVA 4POLA 1ZGNA 1NW2A 2DSAA 1Z7RA 2LJRA 2AJQB 2C3QA 5FHIA 5D9VA 4KDYA 2CZ2A 2HFDA 4JBBA 4TXOA 5IO2A 4XS4A 4GRFA 5B7CA 1O8WA 2HXKA 2C3NA 4DSSB 4ECIA 4PGTA 2GZPA 3TJKA 3EMXA 4GSTA 3TJJA 4MP4A 3IR4A 3I9V2 2M72A 1BQ7A 4FYCA 3RPNA 4EL1A 2HLSA 3ZMLA 5DJLA 3EC3A 4D73B 4YQMA 2FA8A 3UIWA 2QGVA 2MBSA 1Z6MA 3HHVA 4PQHA 1SU9A 5DCGA 4XHMA 1YF1A 2QSIA 3APOA 2XPDA 1AW9A 1FOVA 1ERWA 4HQZA 3GTUB 1Z7PA 5KN0A 2R6KA 2H6XA 1CQGA 2P0GA 2E2GA 3LEFA 2PVOC 4X4JA 2HE3A 3LJRA 3OR5A 1A0FA 3QAVA 1K0DA 1QFNA 1XWGA 3IV4A 6GSXA 2VM1A 1I9DA 4OCEA 4MNNA 4MH2A 3RHBA 1ERTA 3ERFA 4ML6A 3G7YA 1M9AA 1X0RA 1ST9A 5E4WA 2QA2A 2O8VB 2HRKA 4GSNA 2OBIA 4JZQA 4BVXA 1X5DA 3C1SA 3L4NA 1BEDA 3A3TA 2A2RA 1M2AA 2JZSA 2VLVA 2KLXA 4N11A 4KW6A 2WB9A 5ECLB 3PR8A 4XCSA 1GWCA 1T3BA 3CYNA 3F3QA 3GSSA 4BL7A 2FNOA 5KN1A 4IVFA 1K3YA 2R37A 1Y6EA 5KOWA 3EPTA 1VF4A 1ACVA 1QMVA 1SYXA 1XPVA 4LL4B 1SL2B 3SWLA 2XHFA 2DJ1A 3Q6OA 2VD1A 3H1NA 5ELAA 3UEMA 3QR6A 1OC9A 3GKKA 5IMAA 4WEYA 1YKCA 3F63A 4KDXA 8GSSA 3FYGA 1DBYA 2LJKA 3F4TA 1MDJA 2E7PA 2K6VA 4OO5A 4OMVA 4WBRD 1TK5B 3D6IA 4BVYB 1K0CA 1PX6A 3QFBC 7GSSA 5D9XA 4Q5NA 2EC4A 1U87A 2F51A 2HSMA 1VF3A 3TOUA 1MD4A 3BCIA 2DJ3A 4MK3A 20GSA 4WF4A 5IPGA 4MF7A 4N0VA 3K8NA 2B3SA 1EV4A 2IFQA 1JFUA 1AIUA 4HZ2A 3FR9A 3UBLA 4OFMA 3C73A 2OKAA 2WGRA 2BMXA 4AJ7A 3MAKA 1A8YA 4KSMA 4IP1A 2DIZA 1UC7A 1YKAA 4MPGA 1ABAA 5CRDA 5CRWA 1TI1A 1TRSA 4L5OA 6GSVA 1ON4A 1FW1A 4ECJA 2OE3A 4F9ZA 3CXGA 1TW9A 2YP6A 2QKEA 1IYIA 1JZDA 3KGKA 5GAPD 3VPQA 1EWXA 3WT2A 4RQXA 2VLUA 3IAS2 2X99A 2K8SA 4G0IA 1EEMA 1WP0A 3UAPA 5IMVA 3CTGA 3IHQA 4HOJA 2L5OA 2WZ9A 2YOIA 2X8CA 1SL0B 1F3BA 2MMNA 3QMXA 3UBKA 1UA5A 1SJIA 1JZRA 5IOXA 1M0UA 1UVZA 2DJ2A 2H74A 3DVXA 4F2IA 4Z7XA 3AY8A 2TIRA 2KUCA 1ZL9A 2H72A 1HQOA 1AXDA 2HZEA 3KEBA 3ZMKA 5IOWA 1SD9A 1ILOA 2E2MA 1PSQA 2C3TA 1OKDA 4XRDA 2X4AA 4AGSA 3DIEA 3A2XA 1OYJA 5F06A 1FVKA 2FWFA 3FZ4A 3VI5A 1TP9A 1THXA 2LTKA 2VCTA 2KOKA 1TK8B 2WRTA 3GFKA 3M9JA 5D96A 3I43A 1K0BA 1GTAA 4IS0A 5ID2B 2MMAA 1R5AA 3HKRA 4BWSA 2M46A 4EIPA 4I2UA 4TXOB 4EE0A 1GRXA 4XS4B 3FR3A 5CNWA 1WE0A 3KXOA 1R5PA 4KH7A 1GLQA 1O85A 1SL1B 2RM6A 1XVQA 1URMA 4PURA 2GQKA 1ERUA 3LWAA 1DUGA 3VLNA 2FWHA 2C0GA 1XIYA 3L0HA 1OE7A 4TOPA 2H66A 3VPTA 4GTUA 3HZ4A 4WETA 3KZQA 2M80A 1FHEA 4MABA 2C8UA 2LRTA 5HQPA 2CA8A 6GSSA 4IBPA 1TU7A 3CBUA 4ZBAA 3GX0A 4TR4A 2I81A 2PVQA 3I6AA 4IJ3A 4K7NA 4H86A 4POBA 1SJZA 4OWYA 3O6TA 5ECKB 2PUKC 2R0PA 4ULXA 3CMIA 1A2MA 1YQ1A 3P90A 5ECRB 4YAVA 2LRCA 3TKSA 4XS6A 4OO4A 2IMEA 2AHEA 3CSIA 4KB3A 3SBCA 3O76A 1OKTA 3M3MA 2B1LA 3TOTA 3GMFA 3L9SA 5A4UA 2MZCA 3BCKA 2B7KA 2MMOA 5KN3A 2YWNA 4AJ6A 3E9JB 3EU3A 4GXZA 3WYWA 2OACA 3DRNA 1X9MB 4O7HA 4J57E 1Q98A 1PX7A 1TRWA 2VCWA 4Q5QA 2GLRA 3F0IA 4ECBA 1T1VA 2J23A 1XBSA 1X5CA 2V6KA 4FIWA 5HR2A 2R0GA 1T4YA 5J5NA 3TKRA 4EKZA 2ES7A 3LGCA 1S3AA 1PA3A 2MBTA 2H6YA 2P31A 2YZHA 5ECSA 4GSSA 2EIOA 2I3YA 1DE1A 1SK0A 4OD7A 1V58A 2FA4A 4Q5FA 2VCZA 1OVNA 1YEXA 4ZILA 4IKHA 5CYYA 2WJUA 1OC9B 2GSRA 3WGDA 4ICYA 3D4TA 4YKFA 1TRUA 3A2VA 2C0EA 3UARA 4TR3A 4EO3A 1BAYA 1HYUA 3IRAA 3TRQA 1O8XA 2YZUA 3QAWA 3IHGA 5LNKe 3ME8A 4CDOA 5EPFA 3P7XA 2JADA 1PMTA 2YV7A 2YWOA 4V2MA 2CAIA 2CVBA 4FH8A 1BJXA 3TGZA 2VCVA 1WIKA 2KHPA 1F2EA 3Q18A 3GX8A 4KA0A 2HRAA 2X8HA 2B5EA 5ID2A 4KCEA 3HZ8A 1GSEA 2IWTA 2A4HA 1ZYQB 3ME7A 2IMDA 4F0CA 1V9WA 3GL5A 2IFQB 2HYXA 5G2ZA 3ZTLA 3IPZA 2I4AA 5D9WA 1ZCPA 2NBSA 4KE3A 1YDKA 16GSA 1F9MA 2DKIA 3ZL5A 5CAXA 4K7IA 1PD21 2PMTA 3H93A 4DVCA 2DC5A 4F0BA 5DALA 1WOUA 4NHZA 4AJ8A 5JCGA 1QXHA 1KNGA 5KN2A 4G0LA 4K2XA 4HZ4A 2LQQA 1VF1A 2IN3A 3NZNA 3P8WA 2LUSA 3HVVA 3KP8A 2G0FA 1PQNA 1QK8A 1H75A 4BA7A 4X43A 5A4VA 2TRXA 5G1KA 2MYGA 4CY8A 1A24A 3RBTA 2JL4A 1TDIA 3NIVA 2B6MA 2X8GA 3GHAA 2R5GA 4Z2RA 3EU4A 5ECQB 2PPTA 1B4PA 2N5BA 1C72A 2LNTA 4MF6A 1AUCA 3QOUA 5LD0A 4TW5A 2JSZA 5HFKA 3LYKA 3GIXA 1V98A 2L59A 1GTBA 2HZEB 3BJ5A 3UVHA 1R26A 2FWEA 2K9FA 1J0FA 6GSTA 2V6OA 3F6FA 3FW2A 5H5SA 2JSYA 3C71A 2CAQA 3VI7A 5BRTA 2MMZA 4G0KA 4I8BA 2X64A 14GSA 1VF2A 2H0GA 4J56E 5ABRA 3GNJA 3QDNA 4L0WA 2HT9A 2VD0A 2L6DA 1GSSA 1A23A 4KAEA 3ZREA 1TXXA 3VK9A 1WMJA 3QAGA 4QL7A 2O89A 5J3RA 3R2QA 1CQHA 3HD5A 1U3AA 3PPUA 1PL1A 3IOSA 3KH7A 4NV5A 3UL3A 4GCIA 1R4WA 4PUAA 3D5JA 2CX4A 1XVWA 2FUG2 2GTUA 1YF0A 1U88A 2IJYA 2X49A 3GKXA 4KGIA 3GKMA 4Z2UA 2V32A 3TUEA 2KP2A 2DLXA 2YN1A 4N30A 2LSTA 5D8IA 2AV4A 4GQCA 1OE8A 3FZAA 4ML1A 4XRAA 3F8UA 3Q19A 3A5IA 3HYPA 5IIZA 2G2QA 2WCIA 1GTUA 1R7HA 1WJKA 4IW9A 3TRXA 3MDKA 1GSYA 2J9HA 1G7OA 1EZKA 5A4WA 3HDCA 4E8HA 3GH9A 1MDKA 1RQMA 4AF2A 3EINA 1EV9A 3VWUA 3PGTA 1Z6NA 2JZRA 3ZZXA 3IAM2 3LORA 3M0FA 2GSTA 2IMFA 4IP6A 1HNAA 4TR0A 1USBA 5C00A 1QQ2A 2QA1A 1ZMAA 2V2GA 1GL8A 1E6BA 1K0NA 1T8EB 3HA9A 3HXSA 2FD3A 3LQ7A 4IJIA 1FO5A 1PRXA 5COHA 1MEKA 2VL2A 2OJLA 1THOA 3VURA 2LV3A 5HR0A 3HY2A 4TR1A 5JWRB 4FQUA 3R3EA 3MWHA 2GVPA 4KF9A 4XIHA 2B7JA 3WGXA 2C1YA 1LU4A 1Q4JA 5ECIB 4K8MA 3VWXA 1FVJA 2B5XA 5G5EA 2HRFA 5F07A 3N5OA 3GYKA 10GSA 4EXJA 4MJCA 3Q74A 4RI6A 3GH6A 2R3XA 2FWGA 4ZL8A 4USSA 3W8SA 3ZYWA 1X9WB 1AQXA 3JCML 5HR3A 4CHSA 1SENA 3DMLA 4JU5A 4MJBA 4F82A 2O7KA 3MIXA 4JR4A 1SD8A 5DQYA 5CRGA 4MPFA 4K6XA 5G31A 5KOXA 1OAZA 2E0QA 2NDOA 3GUSA 4G9HA 3FEUA 4LMVA 4POKA 4MH3A 1XOAA 1KTEA 3KM6A 1OC3A 1F6MC 2IMKA 5DBQA 4G2EA 2DJ0A 3A5WA 4OCFA 3ZFBA 1SKWB 4HS1A 3MNGA 22GSA 5IMFA 1JLVA 3D4MA 2H75A 2YWMA 2LRNA 4K7OA 1BX9A 2JZTA 2R0CA 4KCAA 1O6JA 4IN0A 3F6DA 1NHYA 1Z3EA 2RIIA 2RM5A 1BYEA 1EGRA 5D9TA 1XW5A 4J2FA 1X9SB 2YCDA 2HSYA 3PH9A 3J7Yb 3DYRA 3EE2A 3FHKA 5IO0A 2IMIA 4MJEA 3APQA 3H8QA 3HJMA 1TJDA 3CRUA 3LYPA 1GSFA 3TDGA 2CVDA 2LS5A 1HNCA 3GSTA 5DALB 1RW1A 3ZRDA 5CREA 5ENUA 4Q5RA 4FYUA 2VO4A 3MYDA 1M9BA 1F37A 1TOFA 4E8EA 1SK2A 3BD2A 4XTSA 2H73A 3IE3A 4EVMA 5J41A 2GSSA 4ZBDA 4HDEA 1PL2A 4EDYA 3LG6A 1YZXA 4PNFA 3C8EA 4DEJA 5L71A 1EP8A 5G5FA 2OE1A 2GQMA 4MF5A 1XZOA 4TVEA 3VFIA 1EOHA 1GSQA 2CQ9A 2IIYA 3U5RE 2VCXA 4O32A 2DMMA 2A2SA 2YPMA 4FO5A 3RHCA 3G7IA 4NMUA 2YJHA 1GUKA 2C0FA 1TK0B 1QGVA 4KSOA 1K0OA 1T4ZA 4PQ1A 2ON7A 3UMAA 3GA4A 1J08A 1O73A 3IDVA 5ECMB 2LEGA 1G0TA 2VUPA 1FOHA 2DJJA 2BJXA 1K0AA 3KMOA 2EIQA 1PKZA 5B6NA 4L0UA 4CY6A 3CSJA 4IHUA 2B5YA 3DGQA 1M2BA 1SJ6A 1G7EA 3TCOA 4X1UA 4KUNA 2H19A 1QUWA 3FY7A 3J7Yk 4ZB6A 1V57A 1JLWA 3D22A 2PWJA 3HVXA 1ZOFA 2HNLA 2OBKA 2H0HA 3HJPA 3BOAA 2L6CA 5HFGA 1BG5A 3BBYA 1B8XA 4KX4A 1DE2A 3L9VA 3APSA 4N0ZA 3WT1A 4YAPA 3TJBA 11GSA 1SK1A 5DAKA 3KP9A 1O7UA 3FRCA 3UOMA 3VWWA 4V2LA 4EF0A 4ZBBA 4PUFC 5F0GA 5B6MA 3UJ1A 5B8BA 5DCHA 3IC8A 2IL3A 5EL8A 4PNGA 1PGTA 2GDRA 2VM2A 3TKSC 2ZNMA 3GL3A 4K9ZA 1GP1A 4K0NA 1MD3A 4YKGA 4PXOA 1E2YA 2REMA 2EIRA 1EP7A 1NM3A 3ZFLA 3W6GA 4ECCA 2AAWA 4JRRA 3FMWA 4LMWA 4LL1B 4EDZA 1ZYNA 5G30A 4MCUA 2JU5A 3IK9A 1U3IA 1GSDA 1XWAA 4WBJA 1W4VA 1JHBA 2K18A 1GNEA 1JZWA 1ZYEA 2DBCA 13GSA 4MDCA 4BPYA 3TKSE 1AQWA 2WDUA 4O5QA 3QD9A 1ZYPA 2VLTA 1ERVA 2NPBA 2V41A 2FCHA 3NOFA 1B48A 1WWJA 4LA1A 4JE1A 3QFAC 19GSA 5J9CA 4ILFA 2H01A 5DVBA 5AISA 2H0IA 1RK4A 2VL3A 5AN1A 4GWRA 1JZOA 1UN2A 4HJMA 4N10A 1EOGA 4IQAA 2XPEA 2DJKA 4NPBA 4TR1B 2YNXA 3G7JA 4MMMA 2VCQA 3RAZA 3EWLA 2ZCTA 1S3CA 4F03A 1PN9A 2H70A 2N5AA 3DXBA 1GULA 2RLIA 3A2WA 4JR6A 4PQIA 1SYRA 1FAAA 5JWQB 3TB2A 4X0XA 1TU8A 4V1Ag 5GSTA 2QC7A 5E59A 4O5UA 5CO3A 4DSQA 1G6WA 2LNSA 5HFIA 2XC2A 5AIXA 4ZL7A 1WRYA 4NWYA 5G1LA 1KBNA 3LXZA 3DWVA 4GLTA 4YQUA 2HZFA 2PGTA 2H1AA 2F3MA 4IQ1A 3EMPA 2GT5A 1K3LA 4RQRA 3TJFA 2FY6A 5KEJA 2AYTA 5BMUA 2FHEA 4HI7A 5H5RA 5F8BA 1LJRA 2P5QA 2F8FA 3M9KA 3GRXA 5IMCA 2WS2A 5AIVA 4EUYA 4ID0A 1A2LA 3IBHA 2K8VA 4GQFA 1H4OA 2OE0A 2H1GA 3FZ9A 1K3OA 1TI3A 4ACSA 4V1Ap 1XWKA 3EVIA 2IPAA 3GKNA 4I97A 2GGTA 1W89A 3FKFA 2OA7A 2O85A 3ERGA 1G6YA 3KTLA 4WKWA 5ECHB 2C80A 1PN0A 2H1DA 1B9YC 3LXTA 4RI7A 2ON5A 1F3AA 3E0UA 4MJAA 5IMDA 2D2ZA 4MZWA 3F4RA 4YH2A 3KJYA 4KDUA 4TRXA 1B9XC 3F3RA 4EC0A 5CP1A 2RUFA 4NV2A 3HCZA 2L4QA 3FZ5A 2V1MA 4HU7A 3HVSA 1N8JA 3O3TA 4O92A 2TRCP 2I1UA 1SKSB 5IPHA 2WFCA 1YEPA 4WR5A 1Y25A 4K1FA 1XWCA 2A4VA 1MTCA 3KCMA 6GSUA 4MLYA 4WF5A 2YWIA 3PINA 4IELA 3EYTA 3IC4A 5EY6A 4JEDA 2OADA 2GQLA 1GUMA 4I2TA 5AGYA 5IQYA 1V40A 3ERWA 5IM9A 4DSSA 6GSWA 1NSWA 3H79A 4HEA2 4LLRA 3ZVJA 4O5RA 3IXRA 2C0DA 4K5SA 3EURA 5JWOB 3P2AA 5IMZA 4D73A 3ZLPA 4ZB9A 2R2JA 3WD6A 1M2DA 1T7PB 3MSZA 2I9HA 1GNWA 1HD2A 1TKDB 3U6VA 1M99A 3KH9A 4KNDA 3GTUA 4V2NA 5B8AA 4TN8A 4HU9A 5JCUA 6GSYA 3ED3A 3G9BA 4P3YB 4BWQA 2PU9C 5DDLA 1GSUA 1ML6A 1GH2A 2HSHA 3KIJA 2H6ZA 3GN3A 1GLPA 1XWBA 2HI7A 1S3DA 2L5LA 4I6XA 3I69A 1VRSD 2FGXA 2GZYA 3D21A 4ZIJA 5GSSA 4PTSA 2VAFA 4MZBA 4EIQA 1U6TA 1XCCA 3UVTA 1Z9HA 2DMLA 5D93A 1PKWA 1K0MA 1YY7A 5DAKB 17GSA 4MZCA 2PN8A 1NHOA 1DSBA 1XW6A 1AQVA 2LQOA 2YJ7A 1FG4A 3TKQA 3IK7A 1OC8A 2DIYA 2CX3A 4HUAA 3LW9A 3FR6A 2CV4A 1O81A 2VL9A 2CZ3A 3ZIVA 4HQSA 2N5FA 2F9SA 3DKSA 2GZZA 3CSHA 4WXTA 5HR1A 1GTIA 1GUHA 1A8LA 5DJMA 2LJAA 5DQSA 5ECPB 3TKPA 2WULA 1TTZA 2VL2C 1A0RP 1SKRB 1KEBA 4K2DA 1I5GA 3ISOA 3S9FA 2HRNA 1WPIA 3F9UA 1IYHA 4NHWA 2NTOA 1XFLA 4QL9A 1J9BA 2RUEA 3DD3A 1YJ6A 4YQVA 1B4QA 2H8LA 2L57A 1FB6A 18GSA 4ZB8A 4BVYA 4GF0A 1Z5YE 3ZVJD 3N9JA 5FWGA 3V1WA 2R4VA 3LSZA 4L8EA 5D73A 4ZL9A 1EEJA 4CW9A 2H71A 2VIMA 2P5RA 1AC1A 4ISDA 2AB6A 3E3EA 2YV9A 3L78A 5J4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OFN A;  4TKY A;  3HJO A;  1TRV A;  3QPM A;  5CRH A;  3TRP A;  3ZIT A;  5LCZ A;  3W8J A;  3US3 A;  1A2J A;  3IA1 A;  4NAX A;  4POM A;  5ELG A;  5EVO A;  2LKU A;  4OFT A;  4PX1 A;  3CTF A;  2NVL A;  4G19 A;  4FYB A;  4IGJ A;  4L5L A;  2GSQ A;  3CRT A;  3QCP A;  12GS A;  2VOC A;  5H5Q A;  1XOB A;  3DEX A;  2PBJ A;  4K0G A;  3RDW A;  1T00 A;  2O87 A;  5INY A;  1FB0 A;  3VWV A;  1XW9 A;  3WGE A;  3GUR A;  3M8N A;  3M1G A;  2H76 A;  1VGL A;  1MDI A;  3KD0 A;  2GS3 A;  9GSS A;  1V2A A;  5C04 A;  3H4K A;  5ECO B;  5J9B A;  2BTO T;  4WR4 A;  2H1B A;  2L4C A;  3D0Z A;  3ZIJ A;  1XXU A;  2PER A;  3RPP A;  4DSR A;  2Z9S A;  3F4S A;  5ECN B;  4G10 A;  4HJ2 A;  3DVW A;  3KMN A;  2H30 A;  1AAZ A;  1X5E A;  2KP1 A;  1N2A A;  3C1R A;  2CVK A;  1LBK A;  3L9U A;  4I5Q A;  4QQ7 A;  2F8A A;  5GAN D;  4RUV A;  4ZXG A;  1EGO A;  4NXI A;  4XS1 A;  2YAN A;  2ZUP A;  2CT6 A;  2GT6 A;  2FLS A;  1M7T A;  3C7M A;  2B1K A;  3KTB A;  5A5K A;  5FT3 A;  4MA9 A;  5JCW A;  2AUV A;  1HNB A;  2JAC A;  3LFL A;  3FK8 A;  2XBQ A;  3GV1 A;  5F05 A;  2C4J A;  2XBI A;  1ZZY A;  3TJG A;  5GZZ B;  2ALB A;  4TXV A;  4POL A;  1ZGN A;  1NW2 A;  2DSA A;  1Z7R A;  2LJR A;  2AJQ B;  2C3Q A;  5FHI A;  5D9V A;  4KDY A;  2CZ2 A;  2HFD A;  4JBB A;  4TXO A;  5IO2 A;  4XS4 A;  4GRF A;  5B7C A;  1O8W A;  2HXK A;  2C3N A;  4DSS B;  4ECI A;  4PGT A;  2GZP A;  3TJK A;  3EMX A;  4GST A;  3TJJ A;  4MP4 A;  3IR4 A;  3I9V 2;  2M72 A;  1BQ7 A;  4FYC A;  3RPN A;  4EL1 A;  2HLS A;  3ZML A;  5DJL A;  3EC3 A;  4D73 B;  4YQM A;  2FA8 A;  3UIW A;  2QGV A;  2MBS A;  1Z6M A;  3HHV A;  4PQH A;  1SU9 A;  5DCG A;  4XHM A;  1YF1 A;  2QSI A;  3APO A;  2XPD A;  1AW9 A;  1FOV A;  1ERW A;  4HQZ A;  3GTU B;  1Z7P A;  5KN0 A;  2R6K A;  2H6X A;  1CQG A;  2P0G A;  2E2G A;  3LEF A;  2PVO C;  2HE3 A;  3LJR A;  3OR5 A;  1A0F A;  3QAV A;  1K0D A;  1QFN A;  1XWG A;  3IV4 A;  6GSX A;  2VM1 A;  1I9D A;  4OCE A;  4MH2 A;  3RHB A;  1ERT A;  3ERF A;  4ML6 A;  3G7Y A;  1M9A A;  1X0R A;  1ST9 A;  5E4W A;  2O8V B;  4GSN A;  2OBI A;  4JZQ A;  4BVX A;  1X5D A;  3C1S A;  3L4N A;  1BED A;  3A3T A;  2A2R A;  1M2A A;  2JZS A;  2VLV A;  2KLX A;  4N11 A;  4KW6 A;  2WB9 A;  5ECL B;  3PR8 A;  4XCS A;  1GWC A;  1T3B A;  3CYN A;  3F3Q A;  3GSS A;  4BL7 A;  2FNO A;  5KN1 A;  4IVF A;  1K3Y A;  2R37 A;  1Y6E A;  1VF4 A;  1ACV A;  1QMV A;  1SYX A;  1XPV A;  4LL4 B;  1SL2 B;  3SWL A;  2XHF A;  2DJ1 A;  3Q6O A;  2VD1 A;  3H1N A;  5ELA A;  3UEM A;  3QR6 A;  1OC9 A;  3GKK A;  5IMA A;  4WEY A;  1YKC A;  3F63 A;  4KDX A;  8GSS A;  3FYG A;  1DBY A;  2LJK A;  3F4T A;  1MDJ A;  2E7P A;  2K6V A;  4OO5 A;  4OMV A;  4WBR D;  1TK5 B;  3D6I A;  1K0C A;  1PX6 A;  3QFB C;  7GSS A;  5D9X A;  4Q5N A;  2EC4 A;  1U87 A;  2F51 A;  3TOU A;  1VF3 A;  1MD4 A;  3BCI A;  2DJ3 A;  4MK3 A;  20GS A;  4WF4 A;  5IPG A;  4MF7 A;  4N0V A;  3K8N A;  2B3S A;  1EV4 A;  2IFQ A;  1JFU A;  1AIU A;  4HZ2 A;  3FR9 A;  3UBL A;  4OFM A;  3C73 A;  2OKA A;  2WGR A;  2BMX A;  4AJ7 A;  3MAK A;  1A8Y A;  4KSM A;  4IP1 A;  2DIZ A;  1UC7 A;  1YKA A;  4MPG A;  1ABA A;  5CRD A;  5CRW A;  1TI1 A;  1TRS A;  4L5O A;  6GSV A;  1ON4 A;  1FW1 A;  4ECJ A;  2OE3 A;  4F9Z A;  3CXG A;  1TW9 A;  2YP6 A;  2QKE A;  1IYI A;  1JZD A;  3KGK A;  5GAP D;  3VPQ A;  1EWX A;  3WT2 A;  4RQX A;  2VLU A;  3IAS 2;  2X99 A;  2K8S A;  1EEM A;  1WP0 A;  3UAP A;  5IMV A;  3CTG A;  3IHQ A;  4HOJ A;  2L5O A;  2WZ9 A;  2YOI A;  2X8C A;  1SL0 B;  1F3B A;  2MMN A;  3QMX A;  3UBK A;  1UA5 A;  1SJI A;  1JZR A;  5IOX A;  1M0U A;  1UVZ A;  2DJ2 A;  2H74 A;  3DVX A;  4F2I A;  4Z7X A;  3AY8 A;  2TIR A;  2KUC A;  1ZL9 A;  2H72 A;  1HQO A;  1AXD A;  2HZE A;  3KEB A;  3ZMK A;  5IOW A;  1SD9 A;  1ILO A;  2E2M A;  1PSQ A;  2C3T A;  1OKD A;  4XRD A;  4AGS A;  3DIE A;  3A2X A;  1OYJ A;  5F06 A;  1FVK A;  2FWF A;  3FZ4 A;  3VI5 A;  1TP9 A;  1THX A;  2LTK A;  2VCT A;  2KOK A;  1TK8 B;  2WRT A;  3GFK A;  3M9J A;  5D96 A;  3I43 A;  1K0B A;  1GTA A;  4IS0 A;  5ID2 B;  2MMA A;  1R5A A;  3HKR A;  4BWS A;  2M46 A;  4I2U A;  4TXO B;  4EE0 A;  1GRX A;  4XS4 B;  3FR3 A;  5CNW A;  1WE0 A;  3KXO A;  1R5P A;  4KH7 A;  1GLQ A;  1O85 A;  1SL1 B;  2RM6 A;  1XVQ A;  1URM A;  4PUR A;  2GQK A;  1ERU A;  3LWA A;  1DUG A;  3VLN A;  2FWH A;  2C0G A;  1XIY A;  3L0H A;  1OE7 A;  4TOP A;  2H66 A;  3VPT A;  4GTU A;  3HZ4 A;  4WET A;  3KZQ A;  2M80 A;  1FHE A;  4MAB A;  2C8U A;  2LRT A;  5HQP A;  2CA8 A;  6GSS A;  4IBP A;  1TU7 A;  3CBU A;  4ZBA A;  3GX0 A;  4TR4 A;  2I81 A;  2PVQ A;  3I6A A;  4IJ3 A;  4K7N A;  4H86 A;  4POB A;  1SJZ A;  4OWY A;  3O6T A;  5ECK B;  2PUK C;  4ULX A;  3CMI A;  1A2M A;  1YQ1 A;  3P90 A;  5ECR B;  4YAV A;  2LRC A;  3TKS A;  4XS6 A;  4OO4 A;  2IME A;  2AHE A;  3CSI A;  4KB3 A;  3SBC A;  3O76 A;  1OKT A;  3M3M A;  2B1L A;  3TOT A;  3GMF A;  3L9S A;  5A4U A;  2MZC A;  3BCK A;  2B7K A;  2MMO A;  5KN3 A;  2YWN A;  4AJ6 A;  3E9J B;  3EU3 A;  4GXZ A;  3WYW A;  2OAC A;  3DRN A;  1X9M B;  4O7H A;  4J57 E;  1Q98 A;  1PX7 A;  1TRW A;  2VCW A;  4Q5Q A;  2GLR A;  3F0I A;  4ECB A;  1T1V A;  2J23 A;  1XBS A;  1X5C A;  2V6K A;  4FIW A;  5HR2 A;  1T4Y A;  5J5N A;  3TKR A;  4EKZ A;  2ES7 A;  3LGC A;  1S3A A;  1PA3 A;  2MBT A;  2H6Y A;  2P31 A;  2YZH A;  5ECS A;  4GSS A;  2EIO A;  2I3Y A;  1DE1 A;  1SK0 A;  4OD7 A;  1V58 A;  2FA4 A;  4Q5F A;  2VCZ A;  1OVN A;  1YEX A;  4ZIL A;  4IKH A;  5CYY A;  2WJU A;  1OC9 B;  2GSR A;  3WGD A;  3D4T A;  1TRU A;  3A2V A;  2C0E A;  3UAR A;  4TR3 A;  4EO3 A;  1BAY A;  1HYU A;  3IRA A;  3TRQ A;  1O8X A;  2YZU A;  3QAW A;  5LNK e;  3ME8 A;  4CDO A;  5EPF A;  3P7X A;  2JAD A;  1PMT A;  2YV7 A;  2YWO A;  4V2M A;  2CAI A;  2CVB A;  4FH8 A;  1BJX A;  3TGZ A;  2VCV A;  1WIK A;  2KHP A;  1F2E A;  3Q18 A;  3GX8 A;  4KA0 A;  2X8H A;  2B5E A;  5ID2 A;  4KCE A;  3HZ8 A;  1GSE A;  2IWT A;  1ZYQ B;  3ME7 A;  2IMD A;  4F0C A;  1V9W A;  3GL5 A;  2IFQ B;  2HYX A;  5G2Z A;  3ZTL A;  3IPZ A;  2I4A A;  5D9W A;  1ZCP A;  2NBS A;  4KE3 A;  1YDK A;  16GS A;  1F9M A;  3ZL5 A;  5CAX A;  4K7I A;  1PD2 1;  2PMT A;  3H93 A;  4DVC A;  2DC5 A;  4F0B A;  5DAL A;  1WOU A;  4NHZ A;  4AJ8 A;  5JCG A;  1QXH A;  1KNG A;  5KN2 A;  4HZ4 A;  2LQQ A;  1VF1 A;  2IN3 A;  3NZN A;  3P8W A;  2LUS A;  3HVV A;  3KP8 A;  2G0F A;  1PQN A;  1QK8 A;  1H75 A;  4BA7 A;  4X43 A;  5A4V A;  2TRX A;  5G1K A;  2MYG A;  1A24 A;  3RBT A;  2JL4 A;  1TDI A;  3NIV A;  2B6M A;  2X8G A;  3GHA A;  2R5G A;  3EU4 A;  5ECQ B;  2PPT A;  1B4P A;  2N5B A;  1C72 A;  2LNT A;  4MF6 A;  1AUC A;  3QOU A;  5LD0 A;  4TW5 A;  2JSZ A;  5HFK A;  3LYK A;  3GIX A;  1V98 A;  2L59 A;  1GTB A;  2HZE B;  3BJ5 A;  3UVH A;  1R26 A;  2FWE A;  2K9F A;  1J0F A;  6GST A;  2V6O A;  3F6F A;  3FW2 A;  5H5S A;  2JSY A;  3C71 A;  2CAQ A;  3VI7 A;  2MMZ A;  4I8B A;  2X64 A;  14GS A;  1VF2 A;  2H0G A;  4J56 E;  5ABR A;  3GNJ A;  3QDN A;  4L0W A;  2HT9 A;  2VD0 A;  2L6D A;  1GSS A;  1A23 A;  4KAE A;  3ZRE A;  1TXX A;  3VK9 A;  1WMJ A;  3QAG A;  4QL7 A;  2O89 A;  5J3R A;  3R2Q A;  1CQH A;  3HD5 A;  1U3A A;  1PL1 A;  3IOS A;  3KH7 A;  4NV5 A;  3UL3 A;  4GCI A;  1R4W A;  4PUA A;  3D5J A;  2CX4 A;  1XVW A;  2FUG 2;  2GTU A;  1YF0 A;  1U88 A;  2IJY A;  3GKX A;  4KGI A;  3GKM A;  2V32 A;  3TUE A;  2KP2 A;  2DLX A;  2YN1 A;  4N30 A;  2LST A;  5D8I A;  2AV4 A;  4GQC A;  1OE8 A;  3FZA A;  4ML1 A;  4XRA A;  3F8U A;  3Q19 A;  3HYP A;  5IIZ A;  2G2Q A;  2WCI A;  1GTU A;  1R7H A;  1WJK A;  4IW9 A;  3TRX A;  3MDK A;  1GSY A;  2J9H A;  1G7O A;  1EZK A;  5A4W A;  3HDC A;  4E8H A;  3GH9 A;  1MDK A;  1RQM A;  4AF2 A;  3EIN A;  1EV9 A;  3VWU A;  3PGT A;  1Z6N A;  2JZR A;  3ZZX A;  3IAM 2;  3LOR A;  3M0F A;  2GST A;  2IMF A;  4IP6 A;  1HNA A;  4TR0 A;  1USB A;  5C00 A;  1QQ2 A;  1ZMA A;  2V2G A;  1GL8 A;  1E6B A;  1K0N A;  1T8E B;  3HA9 A;  3HXS A;  2FD3 A;  3LQ7 A;  4IJI A;  1FO5 A;  1PRX A;  5COH A;  1MEK A;  2VL2 A;  2OJL A;  1THO A;  3VUR A;  2LV3 A;  5HR0 A;  3HY2 A;  4TR1 A;  5JWR B;  3MWH A;  2GVP A;  4XIH A;  2B7J A;  3WGX A;  2C1Y A;  1LU4 A;  1Q4J A;  5ECI B;  4K8M A;  3VWX A;  1FVJ A;  2B5X A;  5G5E A;  2HRF A;  5F07 A;  3N5O A;  3GYK A;  10GS A;  4EXJ A;  4MJC A;  3Q74 A;  4RI6 A;  3GH6 A;  2R3X A;  2FWG A;  4ZL8 A;  3W8S A;  3ZYW A;  1X9W B;  1AQX A;  3JCM L;  5HR3 A;  4CHS A;  1SEN A;  3DML A;  4JU5 A;  4MJB A;  4F82 A;  2O7K A;  4JR4 A;  5DQY A;  1SD8 A;  5CRG A;  4MPF A;  4K6X A;  5G31 A;  1OAZ A;  2E0Q A;  2NDO A;  3GUS A;  4G9H A;  3FEU A;  4LMV A;  4POK A;  4MH3 A;  1XOA A;  1KTE A;  3KM6 A;  1OC3 A;  1F6M C;  2IMK A;  5DBQ A;  4G2E A;  2DJ0 A;  3A5W A;  4OCF A;  3ZFB A;  1SKW B;  4HS1 A;  3MNG A;  22GS A;  5IMF A;  1JLV A;  3D4M A;  2H75 A;  2YWM A;  2LRN A;  4K7O A;  1BX9 A;  2JZT A;  4KCA A;  1O6J A;  4IN0 A;  3F6D A;  1NHY A;  1Z3E A;  2RII A;  2RM5 A;  1BYE A;  1EGR A;  5D9T A;  1XW5 A;  4J2F A;  1X9S B;  2YCD A;  2HSY A;  3PH9 A;  3J7Y b;  3DYR A;  3EE2 A;  3FHK A;  5IO0 A;  2IMI A;  4MJE A;  3APQ A;  3H8Q A;  3HJM A;  1TJD A;  3CRU A;  3LYP A;  1GSF A;  3TDG A;  2CVD A;  2LS5 A;  1HNC A;  3GST A;  5DAL B;  1RW1 A;  3ZRD A;  5CRE A;  5ENU A;  4Q5R A;  4FYU A;  2VO4 A;  1M9B A;  1F37 A;  1TOF A;  4E8E A;  1SK2 A;  3BD2 A;  4XTS A;  2H73 A;  3IE3 A;  4EVM A;  5J41 A;  2GSS A;  4ZBD A;  4HDE A;  1PL2 A;  4EDY A;  3LG6 A;  1YZX A;  4PNF A;  3C8E A;  4DEJ A;  5L71 A;  1EP8 A;  5G5F A;  2OE1 A;  2GQM A;  4MF5 A;  1XZO A;  4TVE A;  3VFI A;  1EOH A;  1GSQ A;  2CQ9 A;  2IIY A;  3U5R E;  2VCX A;  4O32 A;  2DMM A;  2A2S A;  2YPM A;  4FO5 A;  3RHC A;  3G7I A;  4NMU A;  2YJH A;  1GUK A;  2C0F A;  1TK0 B;  1QGV A;  4KSO A;  1K0O A;  1T4Z A;  4PQ1 A;  2ON7 A;  3UMA A;  3GA4 A;  1J08 A;  1O73 A;  3IDV A;  5ECM B;  2LEG A;  1G0T A;  2VUP A;  2DJJ A;  2BJX A;  1K0A A;  3KMO A;  2EIQ A;  1PKZ A;  5B6N A;  4L0U A;  3CSJ A;  4IHU A;  2B5Y A;  3DGQ A;  1M2B A;  1SJ6 A;  1G7E A;  3TCO A;  4X1U A;  4KUN A;  2H19 A;  1QUW A;  3FY7 A;  3J7Y k;  4ZB6 A;  1V57 A;  1JLW A;  3D22 A;  2PWJ A;  3HVX A;  1ZOF A;  2HNL A;  2OBK A;  2H0H A;  3HJP A;  3BOA A;  2L6C A;  5HFG A;  1BG5 A;  3BBY A;  1B8X A;  4KX4 A;  1DE2 A;  3L9V A;  3APS A;  4N0Z A;  3WT1 A;  4YAP A;  3TJB A;  11GS A;  1SK1 A;  5DAK A;  3KP9 A;  1O7U A;  3FRC A;  3UOM A;  3VWW A;  4V2L A;  4EF0 A;  4ZBB A;  4PUF C;  5F0G A;  5B6M A;  3UJ1 A;  5B8B A;  5DCH A;  2IL3 A;  5EL8 A;  4PNG A;  1PGT A;  2GDR A;  2VM2 A;  3TKS C;  2ZNM A;  3GL3 A;  4K9Z A;  1GP1 A;  4K0N A;  1MD3 A;  4PXO A;  1E2Y A;  2REM A;  2EIR A;  1EP7 A;  1NM3 A;  3ZFL A;  3W6G A;  4ECC A;  2AAW A;  4JRR A;  4LMW A;  4LL1 B;  4EDZ A;  5G30 A;  4MCU A;  2JU5 A;  3IK9 A;  1U3I A;  1GSD A;  1XWA A;  4WBJ A;  1W4V A;  1JHB A;  2K18 A;  1GNE A;  1JZW A;  1ZYE A;  2DBC A;  13GS A;  4MDC A;  4BPY A;  3TKS E;  1AQW A;  2WDU A;  3QD9 A;  2VLT A;  1ERV A;  2NPB A;  2V41 A;  2FCH A;  3NOF A;  1B48 A;  1WWJ A;  4LA1 A;  4JE1 A;  3QFA C;  19GS A;  5J9C A;  4ILF A;  2H01 A;  5DVB A;  5AIS A;  2H0I A;  1RK4 A;  2VL3 A;  5AN1 A;  4GWR A;  1JZO A;  1UN2 A;  4HJM A;  4N10 A;  1EOG A;  4IQA A;  2XPE A;  2DJK A;  4NPB A;  4TR1 B;  2YNX A;  3G7J A;  4MMM A;  2VCQ A;  3RAZ A;  3EWL A;  2ZCT A;  1S3C A;  4F03 A;  1PN9 A;  2H70 A;  2N5A A;  3DXB A;  1GUL A;  2RLI A;  3A2W A;  4JR6 A;  4PQI A;  1SYR A;  1FAA A;  5JWQ B;  3TB2 A;  4X0X A;  1TU8 A;  4V1A g;  5GST A;  2QC7 A;  5E59 A;  4DSQ A;  5CO3 A;  1G6W A;  2LNS A;  5HFI A;  2XC2 A;  5AIX A;  4ZL7 A;  1WRY A;  4NWY A;  5G1L A;  1KBN A;  3LXZ A;  3DWV A;  4GLT A;  4YQU A;  2HZF A;  2PGT A;  2H1A A;  2F3M A;  4IQ1 A;  3EMP A;  2GT5 A;  1K3L A;  4RQR A;  3TJF A;  2FY6 A;  5KEJ A;  2AYT A;  2FHE A;  4HI7 A;  5H5R A;  5F8B A;  1LJR A;  2P5Q A;  2F8F A;  3M9K A;  3GRX A;  5IMC A;  2WS2 A;  5AIV A;  4EUY A;  4ID0 A;  1A2L A;  3IBH A;  2K8V A;  4GQF A;  1H4O A;  2OE0 A;  2H1G A;  3FZ9 A;  1K3O A;  1TI3 A;  4ACS A;  4V1A p;  1XWK A;  3EVI A;  2IPA A;  3GKN A;  4I97 A;  2GGT A;  1W89 A;  3FKF A;  2OA7 A;  2O85 A;  3ERG A;  1G6Y A;  3KTL A;  4WKW A;  5ECH B;  2C80 A;  2H1D A;  1B9Y C;  3LXT A;  4RI7 A;  2ON5 A;  1F3A A;  3E0U A;  4MJA A;  5IMD A;  2D2Z A;  4MZW A;  3F4R A;  4YH2 A;  3KJY A;  4KDU A;  4TRX A;  1B9X C;  3F3R A;  4EC0 A;  5CP1 A;  2RUF A;  4NV2 A;  3HCZ A;  2L4Q A;  3FZ5 A;  2V1M A;  4HU7 A;  3HVS A;  1N8J A;  3O3T A;  4O92 A;  2TRC P;  2I1U A;  1SKS B;  5IPH A;  2WFC A;  1YEP A;  4WR5 A;  1Y25 A;  4K1F A;  1XWC A;  2A4V A;  1MTC A;  3KCM A;  6GSU A;  4MLY A;  4WF5 A;  2YWI A;  3PIN A;  4IEL A;  3EYT A;  3IC4 A;  5EY6 A;  4JED A;  2OAD A;  2GQL A;  1GUM A;  4I2T A;  5AGY A;  5IQY A;  1V40 A;  3ERW A;  5IM9 A;  4DSS A;  6GSW A;  1NSW A;  3H79 A;  4HEA 2;  4LLR A;  3ZVJ A;  4O5R A;  3IXR A;  2C0D A;  3EUR A;  5JWO B;  3P2A A;  5IMZ A;  4D73 A;  3ZLP A;  4ZB9 A;  2R2J A;  3WD6 A;  1M2D A;  1T7P B;  3MSZ A;  2I9H A;  1GNW A;  1HD2 A;  1TKD B;  3U6V A;  1M99 A;  3KH9 A;  4KND A;  3GTU A;  4V2N A;  5B8A A;  4TN8 A;  4HU9 A;  5JCU A;  6GSY A;  3ED3 A;  3G9B A;  4P3Y B;  4BWQ A;  2PU9 C;  5DDL A;  1GSU A;  1ML6 A;  1GH2 A;  2HSH A;  3KIJ A;  2H6Z A;  3GN3 A;  1GLP A;  1XWB A;  2HI7 A;  1S3D A;  4I6X A;  2L5L A;  3I69 A;  1VRS D;  2FGX A;  2GZY A;  3D21 A;  4ZIJ A;  5GSS A;  2VAF A;  4MZB A;  1U6T A;  1XCC A;  3UVT A;  1Z9H A;  2DML A;  5D93 A;  1PKW A;  1K0M A;  1YY7 A;  5DAK B;  17GS A;  4MZC A;  2PN8 A;  1NHO A;  1DSB A;  1XW6 A;  1AQV A;  2LQO A;  2YJ7 A;  1FG4 A;  3TKQ A;  3IK7 A;  1OC8 A;  2DIY A;  2CX3 A;  4HUA A;  3FR6 A;  2CV4 A;  1O81 A;  2VL9 A;  2CZ3 A;  3ZIV A;  4HQS A;  2N5F A;  2F9S A;  3DKS A;  2GZZ A;  3CSH A;  4WXT A;  5HR1 A;  1GTI A;  1GUH A;  1A8L A;  5DJM A;  2LJA A;  5DQS A;  5ECP B;  3TKP A;  2WUL A;  1TTZ A;  2VL2 C;  1A0R P;  1SKR B;  1KEB A;  4K2D A;  1I5G A;  3ISO A;  3S9F A;  2HRN A;  1WPI A;  3F9U A;  1IYH A;  4NHW A;  2NTO A;  1XFL A;  4QL9 A;  1J9B A;  2RUE A;  3DD3 A;  1YJ6 A;  4YQV A;  1B4Q A;  2H8L A;  2L57 A;  1FB6 A;  18GS A;  4ZB8 A;  4BVY A;  4GF0 A;  1Z5Y E;  3ZVJ D;  3N9J A;  5FWG A;  3V1W A;  2R4V A;  3LSZ A;  4L8E A;  5D73 A;  4ZL9 A;  1EEJ A;  4CW9 A;  2H71 A;  2VIM A;  2P5R A;  1AC1 A;  4ISD A;  2AB6 A;  3E3E A;  2YV9 A;  3L78 A;  5J4U A; 
#chains in the Genus database with same CATH topology
 4OFN A;  4TKY A;  3HJO A;  1TRV A;  3QPM A;  5CRH A;  3TRP A;  3ZIT A;  4A5P A;  5LCZ A;  3W8J A;  3US3 A;  1A2J A;  3IA1 A;  4NAX A;  4POM A;  5ELG A;  5EVO A;  2LKU A;  4OFT A;  4PX1 A;  3CTF A;  2NVL A;  2UZ8 A;  4G19 A;  4FYB A;  4IGJ A;  4Z2T A;  4L5L A;  2GSQ A;  3CRT A;  3QCP A;  12GS A;  2VOC A;  5H5Q A;  1XOB A;  3DEX A;  2PBJ A;  4K0G A;  3RDW A;  1T00 A;  2O87 A;  5INY A;  1FB0 A;  3VWV A;  1XW9 A;  3WGE A;  4BVX B;  3GUR A;  3M8N A;  3M1G A;  2H76 A;  1VGL A;  1MDI A;  3KD0 A;  4K5R A;  2GS3 A;  9GSS A;  1V2A A;  5C04 A;  3H4K A;  5ECO B;  5J9B A;  2BTO T;  4WR4 A;  2H1B A;  2L4C A;  3D0Z A;  3ZIJ A;  1XXU A;  2PER A;  3RPP A;  4DSR A;  2Z9S A;  4BL7 B;  3F4S A;  5ECN B;  4G10 A;  4HJ2 A;  3DVW A;  3KMN A;  2A2P A;  2H30 A;  1AAZ A;  1X5E A;  2KP1 A;  1N2A A;  3C1R A;  2CVK A;  1LBK A;  3L9U A;  4I5Q A;  4QQ7 A;  2F8A A;  2DKH A;  5GAN D;  4RUV A;  4ZXG A;  1EGO A;  4NXI A;  4XS1 A;  2YAN A;  2ZUP A;  2CT6 A;  2GT6 A;  2FLS A;  1M7T A;  3C7M A;  2B1K A;  3KTB A;  5A5K A;  5FT3 A;  4MA9 A;  5JCW A;  2AUV A;  1HNB A;  2JAC A;  3LFL A;  3FK8 A;  2XBQ A;  3GV1 A;  5F05 A;  2C4J A;  2XBI A;  1ZZY A;  3TJG A;  5GZZ B;  2ALB A;  4TXV A;  4POL A;  1ZGN A;  1NW2 A;  2DSA A;  1Z7R A;  2LJR A;  2AJQ B;  2C3Q A;  5FHI A;  5D9V A;  4KDY A;  2CZ2 A;  2HFD A;  4JBB A;  4TXO A;  5IO2 A;  4XS4 A;  4GRF A;  5B7C A;  1O8W A;  2HXK A;  2C3N A;  4DSS B;  4ECI A;  4PGT A;  2GZP A;  3TJK A;  3EMX A;  4GST A;  3TJJ A;  4MP4 A;  3IR4 A;  3I9V 2;  2M72 A;  1BQ7 A;  4FYC A;  3RPN A;  4EL1 A;  2HLS A;  3ZML A;  5DJL A;  3EC3 A;  4D73 B;  4YQM A;  2FA8 A;  3UIW A;  2QGV A;  2MBS A;  1Z6M A;  3HHV A;  4PQH A;  1SU9 A;  5DCG A;  4XHM A;  1YF1 A;  2QSI A;  3APO A;  2XPD A;  1AW9 A;  1FOV A;  1ERW A;  4HQZ A;  3GTU B;  1Z7P A;  5KN0 A;  2R6K A;  2H6X A;  1CQG A;  2P0G A;  2E2G A;  3LEF A;  2PVO C;  4X4J A;  2HE3 A;  3LJR A;  3OR5 A;  1A0F A;  3QAV A;  1K0D A;  1QFN A;  1XWG A;  3IV4 A;  6GSX A;  2VM1 A;  1I9D A;  4OCE A;  4MNN A;  4MH2 A;  3RHB A;  1ERT A;  3ERF A;  4ML6 A;  3G7Y A;  1M9A A;  1X0R A;  1ST9 A;  5E4W A;  2QA2 A;  2O8V B;  2HRK A;  4GSN A;  2OBI A;  4JZQ A;  4BVX A;  1X5D A;  3C1S A;  3L4N A;  1BED A;  3A3T A;  2A2R A;  4HSC X;  1M2A A;  2JZS A;  2VLV A;  2KLX A;  4N11 A;  4KW6 A;  2WB9 A;  5ECL B;  1PFO A;  3PR8 A;  4XCS A;  1GWC A;  1T3B A;  3CYN A;  3F3Q A;  3GSS A;  4BL7 A;  2FNO A;  5KN1 A;  4IVF A;  1K3Y A;  2R37 A;  1Y6E A;  5KOW A;  3EPT A;  1VF4 A;  1ACV A;  1QMV A;  1SYX A;  1XPV A;  4LL4 B;  1SL2 B;  3SWL A;  2XHF A;  2DJ1 A;  3Q6O A;  2VD1 A;  3H1N A;  5ELA A;  3UEM A;  3QR6 A;  1OC9 A;  3GKK A;  5IMA A;  4WEY A;  1YKC A;  3F63 A;  4KDX A;  8GSS A;  3FYG A;  1DBY A;  2LJK A;  3F4T A;  1MDJ A;  2E7P A;  2K6V A;  4OO5 A;  4OMV A;  4WBR D;  1TK5 B;  3D6I A;  4BVY B;  1K0C A;  1PX6 A;  3QFB C;  7GSS A;  5D9X A;  4Q5N A;  2EC4 A;  1U87 A;  2F51 A;  2HSM A;  1VF3 A;  3TOU A;  1MD4 A;  3BCI A;  2DJ3 A;  4MK3 A;  20GS A;  4WF4 A;  5IPG A;  4MF7 A;  4N0V A;  3K8N A;  2B3S A;  1EV4 A;  2IFQ A;  1JFU A;  1AIU A;  4HZ2 A;  3FR9 A;  3UBL A;  4OFM A;  3C73 A;  2OKA A;  2WGR A;  2BMX A;  4AJ7 A;  3MAK A;  1A8Y A;  4KSM A;  4IP1 A;  2DIZ A;  1UC7 A;  1YKA A;  4MPG A;  1ABA A;  5CRD A;  5CRW A;  1TI1 A;  1TRS A;  4L5O A;  6GSV A;  1ON4 A;  1FW1 A;  4ECJ A;  2OE3 A;  4F9Z A;  3CXG A;  1TW9 A;  2YP6 A;  2QKE A;  1IYI A;  1JZD A;  3KGK A;  5GAP D;  3VPQ A;  1EWX A;  3WT2 A;  4RQX A;  2VLU A;  3IAS 2;  2X99 A;  2K8S A;  4G0I A;  1EEM A;  1WP0 A;  3UAP A;  5IMV A;  3CTG A;  3IHQ A;  4HOJ A;  2L5O A;  2WZ9 A;  2YOI A;  2X8C A;  1SL0 B;  1F3B A;  2MMN A;  3QMX A;  3UBK A;  1UA5 A;  1SJI A;  1JZR A;  5IOX A;  1M0U A;  1UVZ A;  2DJ2 A;  2H74 A;  3DVX A;  4F2I A;  4Z7X A;  3AY8 A;  2TIR A;  2KUC A;  1ZL9 A;  2H72 A;  1HQO A;  1AXD A;  2HZE A;  3KEB A;  3ZMK A;  5IOW A;  1SD9 A;  1ILO A;  2E2M A;  1PSQ A;  2C3T A;  1OKD A;  4XRD A;  2X4A A;  4AGS A;  3DIE A;  3A2X A;  1OYJ A;  5F06 A;  1FVK A;  2FWF A;  3FZ4 A;  3VI5 A;  1TP9 A;  1THX A;  2LTK A;  2VCT A;  2KOK A;  1TK8 B;  2WRT A;  3GFK A;  3M9J A;  5D96 A;  3I43 A;  1K0B A;  1GTA A;  4IS0 A;  5ID2 B;  2MMA A;  1R5A A;  3HKR A;  4BWS A;  2M46 A;  4EIP A;  4I2U A;  4TXO B;  4EE0 A;  1GRX A;  4XS4 B;  3FR3 A;  5CNW A;  1WE0 A;  3KXO A;  1R5P A;  4KH7 A;  1GLQ A;  1O85 A;  1SL1 B;  2RM6 A;  1XVQ A;  1URM A;  4PUR A;  2GQK A;  1ERU A;  3LWA A;  1DUG A;  3VLN A;  2FWH A;  2C0G A;  1XIY A;  3L0H A;  1OE7 A;  4TOP A;  2H66 A;  3VPT A;  4GTU A;  3HZ4 A;  4WET A;  3KZQ A;  2M80 A;  1FHE A;  4MAB A;  2C8U A;  2LRT A;  5HQP A;  2CA8 A;  3CQF A;  6GSS A;  4IBP A;  1TU7 A;  3CBU A;  4ZBA A;  3GX0 A;  4TR4 A;  2I81 A;  2PVQ A;  3I6A A;  4IJ3 A;  4K7N A;  4H86 A;  4POB A;  1SJZ A;  4OWY A;  3O6T A;  5ECK B;  2PUK C;  2R0P A;  4ULX A;  3CMI A;  1A2M A;  1YQ1 A;  3P90 A;  5ECR B;  4YAV A;  2LRC A;  3TKS A;  4XS6 A;  4OO4 A;  2IME A;  2AHE A;  3CSI A;  4KB3 A;  3SBC A;  3O76 A;  1OKT A;  3M3M A;  2B1L A;  3TOT A;  3GMF A;  3L9S A;  5A4U A;  2MZC A;  3BCK A;  2B7K A;  2MMO A;  5KN3 A;  2YWN A;  4AJ6 A;  3E9J B;  3EU3 A;  4GXZ A;  3WYW A;  2OAC A;  3DRN A;  1X9M B;  4O7H A;  4J57 E;  1Q98 A;  1PX7 A;  1TRW A;  2VCW A;  4Q5Q A;  2GLR A;  3F0I A;  4ECB A;  1T1V A;  2J23 A;  1XBS A;  1X5C A;  2V6K A;  4FIW A;  5HR2 A;  2R0G A;  1T4Y A;  5J5N A;  3TKR A;  4EKZ A;  2ES7 A;  3LGC A;  1S3A A;  1PA3 A;  2MBT A;  2H6Y A;  2P31 A;  2YZH A;  5ECS A;  4GSS A;  2EIO A;  2I3Y A;  1DE1 A;  1SK0 A;  4OD7 A;  1V58 A;  2FA4 A;  4Q5F A;  2VCZ A;  1OVN A;  1YEX A;  4ZIL A;  4IKH A;  5CYY A;  2WJU A;  1OC9 B;  2GSR A;  3WGD A;  4ICY A;  3D4T A;  4YKF A;  1TRU A;  3A2V A;  2C0E A;  3UAR A;  4TR3 A;  4EO3 A;  1BAY A;  1HYU A;  3IRA A;  3TRQ A;  1O8X A;  2YZU A;  3QAW A;  3IHG A;  5LNK e;  3ME8 A;  4CDO A;  5EPF A;  3P7X A;  2JAD A;  1PMT A;  2YV7 A;  2YWO A;  4V2M A;  2CAI A;  2CVB A;  4FH8 A;  1BJX A;  3TGZ A;  2VCV A;  1WIK A;  2KHP A;  1F2E A;  3Q18 A;  3GX8 A;  4KA0 A;  2HRA A;  2X8H A;  2B5E A;  5ID2 A;  4KCE A;  3HZ8 A;  1GSE A;  2IWT A;  1M3I A;  2A4H A;  1ZYQ B;  3ME7 A;  2IMD A;  4F0C A;  1V9W A;  3GL5 A;  2IFQ B;  2HYX A;  5G2Z A;  3ZTL A;  3IPZ A;  2I4A A;  5D9W A;  1ZCP A;  2NBS A;  4KE3 A;  1YDK A;  16GS A;  1F9M A;  2DKI A;  3ZL5 A;  5CAX A;  4K7I A;  1PD2 1;  2PMT A;  3H93 A;  4DVC A;  2DC5 A;  4F0B A;  5DAL A;  1WOU A;  4NHZ A;  4AJ8 A;  5JCG A;  1QXH A;  1KNG A;  5KN2 A;  4G0L A;  4K2X A;  4HZ4 A;  2LQQ A;  1VF1 A;  2IN3 A;  3NZN A;  3P8W A;  3HVN A;  2LUS A;  3HVV A;  3KP8 A;  2G0F A;  1PQN A;  1QK8 A;  1H75 A;  4BA7 A;  4X43 A;  5A4V A;  2TRX A;  5G1K A;  2MYG A;  4CY8 A;  1A24 A;  3RBT A;  2JL4 A;  1TDI A;  3NIV A;  2B6M A;  2X8G A;  3GHA A;  2R5G A;  4Z2R A;  3EU4 A;  5ECQ B;  2PPT A;  1B4P A;  2N5B A;  1C72 A;  2LNT A;  4MF6 A;  1AUC A;  3QOU A;  5LD0 A;  4BIK A;  4TW5 A;  2JSZ A;  5HFK A;  3LYK A;  3GIX A;  1V98 A;  2L59 A;  1GTB A;  2HZE B;  3BJ5 A;  3UVH A;  1R26 A;  2FWE A;  2K9F A;  1J0F A;  6GST A;  2V6O A;  3F6F A;  3FW2 A;  5H5S A;  2JSY A;  3C71 A;  2CAQ A;  3VI7 A;  5BRT A;  2MMZ A;  4G0K A;  4I8B A;  2X64 A;  14GS A;  1VF2 A;  2H0G A;  4J56 E;  5ABR A;  3GNJ A;  3QDN A;  4L0W A;  2HT9 A;  2VD0 A;  2L6D A;  1GSS A;  1A23 A;  4KAE A;  3ZRE A;  1TXX A;  3VK9 A;  1WMJ A;  3QAG A;  4QL7 A;  2O89 A;  5J3R A;  3R2Q A;  1CQH A;  3HD5 A;  1U3A A;  3PPU A;  1PL1 A;  3IOS A;  3KH7 A;  4NV5 A;  3UL3 A;  4GCI A;  1R4W A;  4PUA A;  3D5J A;  2CX4 A;  1XVW A;  2FUG 2;  2GTU A;  1YF0 A;  1U88 A;  2IJY A;  2X49 A;  3GKX A;  4KGI A;  3GKM A;  4Z2U A;  2V32 A;  3TUE A;  2KP2 A;  2DLX A;  2YN1 A;  4N30 A;  2LST A;  5D8I A;  2AV4 A;  4GQC A;  1OE8 A;  3FZA A;  4ML1 A;  4XRA A;  3F8U A;  3Q19 A;  3A5I A;  3HYP A;  5IIZ A;  2G2Q A;  2WCI A;  1GTU A;  1R7H A;  1WJK A;  4IW9 A;  3TRX A;  1M3J A;  3MDK A;  1GSY A;  2J9H A;  1G7O A;  1EZK A;  5A4W A;  3HDC A;  4E8H A;  3GH9 A;  1MDK A;  1RQM A;  4AF2 A;  3EIN A;  1EV9 A;  3VWU A;  3PGT A;  1Z6N A;  2JZR A;  3ZZX A;  3IAM 2;  3LOR A;  3M0F A;  2GST A;  2IMF A;  4IP6 A;  1HNA A;  4TR0 A;  1USB A;  5C00 A;  1QQ2 A;  2QA1 A;  1ZMA A;  2V2G A;  1GL8 A;  1E6B A;  1K0N A;  1T8E B;  3HA9 A;  3HXS A;  2FD3 A;  3LQ7 A;  4IJI A;  1FO5 A;  1PRX A;  5COH A;  1MEK A;  2VL2 A;  2OJL A;  1THO A;  3VUR A;  2LV3 A;  5HR0 A;  3HY2 A;  4TR1 A;  5JWR B;  4FQU A;  3R3E A;  3MWH A;  2GVP A;  4KF9 A;  4XIH A;  2B7J A;  3WGX A;  2C1Y A;  1LU4 A;  1Q4J A;  5ECI B;  4K8M A;  3VWX A;  1FVJ A;  2B5X A;  5G5E A;  2HRF A;  5F07 A;  3N5O A;  3GYK A;  10GS A;  4EXJ A;  4MJC A;  3Q74 A;  4RI6 A;  3GH6 A;  2R3X A;  2FWG A;  4ZL8 A;  4USS A;  3W8S A;  3ZYW A;  1X9W B;  1AQX A;  3JCM L;  5HR3 A;  4CHS A;  1SEN A;  3DML A;  4JU5 A;  4MJB A;  4F82 A;  2O7K A;  3MIX A;  4JR4 A;  1SD8 A;  5DQY A;  5CRG A;  4MPF A;  4K6X A;  5G31 A;  5KOX A;  1OAZ A;  2E0Q A;  2NDO A;  3GUS A;  4G9H A;  3FEU A;  4LMV A;  4POK A;  4MH3 A;  1XOA A;  1KTE A;  3KM6 A;  1OC3 A;  1F6M C;  2IMK A;  5DBQ A;  4G2E A;  2DJ0 A;  3A5W A;  4OCF A;  3ZFB A;  1SKW B;  4HS1 A;  3MNG A;  22GS A;  5IMF A;  1JLV A;  3D4M A;  2H75 A;  2YWM A;  2LRN A;  4K7O A;  1BX9 A;  2JZT A;  2R0C A;  4KCA A;  1O6J A;  4IN0 A;  3F6D A;  1NHY A;  1Z3E A;  2RII A;  2RM5 A;  1BYE A;  1EGR A;  5D9T A;  1XW5 A;  4J2F A;  1X9S B;  2YCD A;  2HSY A;  3PH9 A;  3J7Y b;  3DYR A;  3EE2 A;  3FHK A;  5IO0 A;  2IMI A;  4MJE A;  3APQ A;  3H8Q A;  3HJM A;  1TJD A;  3CRU A;  3LYP A;  1GSF A;  3TDG A;  2CVD A;  2LS5 A;  1HNC A;  3GST A;  5DAL B;  1RW1 A;  3ZRD A;  5CRE A;  5ENU A;  4Q5R A;  4FYU A;  2VO4 A;  3MYD A;  1M9B A;  1F37 A;  1TOF A;  4E8E A;  1SK2 A;  3BD2 A;  4XTS A;  2H73 A;  3IE3 A;  4EVM A;  5J41 A;  2GSS A;  4ZBD A;  4HDE A;  1PL2 A;  4EDY A;  3LG6 A;  1YZX A;  4PNF A;  3C8E A;  4DEJ A;  5L71 A;  1EP8 A;  5G5F A;  2OE1 A;  2GQM A;  4MF5 A;  1XZO A;  4TVE A;  3VFI A;  1EOH A;  1GSQ A;  2CQ9 A;  2IIY A;  3U5R E;  1XG8 A;  2VCX A;  4O32 A;  2DMM A;  2A2S A;  2YPM A;  4FO5 A;  3RHC A;  3G7I A;  4NMU A;  2YJH A;  1GUK A;  2C0F A;  1TK0 B;  1QGV A;  4KSO A;  1K0O A;  1T4Z A;  4PQ1 A;  2ON7 A;  3UMA A;  3GA4 A;  1J08 A;  1O73 A;  3IDV A;  5ECM B;  2LEG A;  1G0T A;  2VUP A;  1FOH A;  2DJJ A;  2BJX A;  1K0A A;  3KMO A;  2EIQ A;  1PKZ A;  5B6N A;  4L0U A;  4CY6 A;  3CSJ A;  4IHU A;  2B5Y A;  3DGQ A;  1M2B A;  1SJ6 A;  1G7E A;  3TCO A;  4X1U A;  4KUN A;  2H19 A;  1QUW A;  3FY7 A;  3J7Y k;  4ZB6 A;  1V57 A;  1JLW A;  3D22 A;  2PWJ A;  3HVX A;  1ZOF A;  2HNL A;  2OBK A;  2H0H A;  3HJP A;  3BOA A;  2L6C A;  5HFG A;  1BG5 A;  3BBY A;  1B8X A;  4KX4 A;  1DE2 A;  3L9V A;  3APS A;  4N0Z A;  3WT1 A;  4YAP A;  3TJB A;  11GS A;  1SK1 A;  5DAK A;  3KP9 A;  1O7U A;  3FRC A;  3UOM A;  3VWW A;  4V2L A;  4EF0 A;  4ZBB A;  4PUF C;  5F0G A;  5B6M A;  3UJ1 A;  5B8B A;  5DCH A;  3IC8 A;  2IL3 A;  5EL8 A;  4PNG A;  1PGT A;  2GDR A;  2VM2 A;  3TKS C;  2ZNM A;  3GL3 A;  4K9Z A;  1GP1 A;  4K0N A;  1MD3 A;  4YKG A;  4PXO A;  1E2Y A;  2REM A;  2EIR A;  1EP7 A;  1NM3 A;  3ZFL A;  3W6G A;  4ECC A;  2AAW A;  4JRR A;  3FMW A;  4LMW A;  4LL1 B;  4EDZ A;  1ZYN A;  5G30 A;  4MCU A;  2JU5 A;  3IK9 A;  1U3I A;  1GSD A;  1XWA A;  4WBJ A;  1W4V A;  1JHB A;  2K18 A;  1GNE A;  1JZW A;  1ZYE A;  2DBC A;  13GS A;  4MDC A;  4BPY A;  3TKS E;  1AQW A;  2WDU A;  4O5Q A;  3QD9 A;  1ZYP A;  2VLT A;  1ERV A;  2NPB A;  2V41 A;  2FCH A;  3NOF A;  1B48 A;  1WWJ A;  4LA1 A;  4JE1 A;  3QFA C;  19GS A;  5J9C A;  4ILF A;  2H01 A;  5DVB A;  5AIS A;  2H0I A;  1RK4 A;  2VL3 A;  5AN1 A;  4GWR A;  1JZO A;  1UN2 A;  4HJM A;  4N10 A;  1EOG A;  4IQA A;  2XPE A;  2DJK A;  1S3R A;  4NPB A;  4TR1 B;  2YNX A;  3G7J A;  4MMM A;  2VCQ A;  3RAZ A;  3EWL A;  2ZCT A;  1S3C A;  4F03 A;  1PN9 A;  2H70 A;  2N5A A;  3DXB A;  1GUL A;  2RLI A;  3A2W A;  4JR6 A;  4PQI A;  1SYR A;  1FAA A;  5JWQ B;  3TB2 A;  4X0X A;  1TU8 A;  4V1A g;  5GST A;  2QC7 A;  5E59 A;  4O5U A;  5CO3 A;  4DSQ A;  1G6W A;  2LNS A;  5HFI A;  2XC2 A;  5AIX A;  4ZL7 A;  1WRY A;  4NWY A;  5G1L A;  1KBN A;  3LXZ A;  3DWV A;  4GLT A;  4YQU A;  2HZF A;  2PGT A;  2H1A A;  2F3M A;  4IQ1 A;  3EMP A;  2GT5 A;  1K3L A;  4RQR A;  3TJF A;  2FY6 A;  5KEJ A;  2AYT A;  5BMU A;  2FHE A;  4HI7 A;  5H5R A;  5F8B A;  1LJR A;  2P5Q A;  2F8F A;  3M9K A;  3GRX A;  5IMC A;  2WS2 A;  5AIV A;  4EUY A;  4ID0 A;  1A2L A;  3IBH A;  2K8V A;  4GQF A;  1H4O A;  2OE0 A;  2H1G A;  3FZ9 A;  1K3O A;  1TI3 A;  4ACS A;  4V1A p;  1XWK A;  3EVI A;  2IPA A;  3GKN A;  4I97 A;  2GGT A;  1W89 A;  3FKF A;  2OA7 A;  2O85 A;  3ERG A;  1G6Y A;  3KTL A;  4WKW A;  5ECH B;  2C80 A;  1PN0 A;  2H1D A;  1B9Y C;  3LXT A;  4RI7 A;  2ON5 A;  1F3A A;  3E0U A;  4MJA A;  5IMD A;  2D2Z A;  4MZW A;  3F4R A;  4YH2 A;  3KJY A;  4KDU A;  4TRX A;  1B9X C;  3F3R A;  4EC0 A;  5CP1 A;  2RUF A;  4NV2 A;  3HCZ A;  2L4Q A;  3FZ5 A;  2V1M A;  4HU7 A;  3HVS A;  1N8J A;  3O3T A;  4O92 A;  2TRC P;  2I1U A;  1SKS B;  5IPH A;  2WFC A;  1YEP A;  4WR5 A;  1Y25 A;  4K1F A;  1XWC A;  2A4V A;  1MTC A;  3KCM A;  6GSU A;  4MLY A;  4WF5 A;  2YWI A;  3PIN A;  4IEL A;  3EYT A;  3IC4 A;  5EY6 A;  4JED A;  2OAD A;  2GQL A;  1GUM A;  4I2T A;  5AGY A;  5IQY A;  1V40 A;  3ERW A;  5IM9 A;  4DSS A;  6GSW A;  1NSW A;  3H79 A;  4HEA 2;  4LLR A;  3ZVJ A;  4O5R A;  3IXR A;  2C0D A;  4K5S A;  3EUR A;  5JWO B;  3P2A A;  5IMZ A;  4D73 A;  3ZLP A;  4ZB9 A;  2R2J A;  3WD6 A;  1M2D A;  1T7P B;  3MSZ A;  2I9H A;  1GNW A;  1HD2 A;  1TKD B;  3U6V A;  1M99 A;  3KH9 A;  4KND A;  3GTU A;  4V2N A;  5B8A A;  4TN8 A;  4HU9 A;  5JCU A;  6GSY A;  3ED3 A;  3G9B A;  4P3Y B;  4BWQ A;  2PU9 C;  5DDL A;  1GSU A;  1ML6 A;  1GH2 A;  2HSH A;  3KIJ A;  2H6Z A;  3GN3 A;  1GLP A;  1XWB A;  2HI7 A;  1S3D A;  2L5L A;  4I6X A;  3I69 A;  1VRS D;  2FGX A;  2GZY A;  3D21 A;  4ZIJ A;  5GSS A;  4PTS A;  2VAF A;  4MZB A;  4EIQ A;  1U6T A;  1XCC A;  3UVT A;  1Z9H A;  2DML A;  5D93 A;  1PKW A;  1K0M A;  1YY7 A;  5DAK B;  17GS A;  4MZC A;  2PN8 A;  1NHO A;  1DSB A;  1XW6 A;  1AQV A;  2LQO A;  2YJ7 A;  1FG4 A;  3TKQ A;  3IK7 A;  1OC8 A;  2DIY A;  2CX3 A;  4HUA A;  3LW9 A;  3FR6 A;  2CV4 A;  1O81 A;  2VL9 A;  2CZ3 A;  3ZIV A;  4HQS A;  2N5F A;  2F9S A;  3DKS A;  2GZZ A;  3CSH A;  4WXT A;  5HR1 A;  1GTI A;  1GUH A;  1A8L A;  5DJM A;  2LJA A;  5DQS A;  5ECP B;  3TKP A;  2WUL A;  1TTZ A;  2VL2 C;  1A0R P;  1SKR B;  1KEB A;  4K2D A;  1I5G A;  3ISO A;  3S9F A;  2HRN A;  1WPI A;  3F9U A;  1IYH A;  4NHW A;  2NTO A;  1XFL A;  4QL9 A;  1J9B A;  2RUE A;  3DD3 A;  1YJ6 A;  4YQV A;  1B4Q A;  2H8L A;  2L57 A;  1FB6 A;  18GS A;  4ZB8 A;  4BVY A;  4GF0 A;  1Z5Y E;  3ZVJ D;  3N9J A;  5FWG A;  3V1W A;  2R4V A;  3LSZ A;  4L8E A;  5D73 A;  4ZL9 A;  1EEJ A;  4CW9 A;  2H71 A;  2VIM A;  2P5R A;  1AC1 A;  4ISD A;  2AB6 A;  3E3E A;  2YV9 A;  3L78 A;  5J4U A; 
#chains in the Genus database with same CATH homology
 4OFN A;  4TKY A;  3HJO A;  1TRV A;  3QPM A;  5CRH A;  3TRP A;  3ZIT A;  4A5P A;  5LCZ A;  3W8J A;  3US3 A;  1A2J A;  3IA1 A;  4NAX A;  4POM A;  5ELG A;  5EVO A;  2LKU A;  4OFT A;  4PX1 A;  3CTF A;  2NVL A;  2UZ8 A;  4G19 A;  4FYB A;  4IGJ A;  4Z2T A;  4L5L A;  2GSQ A;  3CRT A;  3QCP A;  12GS A;  2VOC A;  5H5Q A;  1XOB A;  3DEX A;  2PBJ A;  4K0G A;  3RDW A;  1T00 A;  2O87 A;  5INY A;  1FB0 A;  3VWV A;  1XW9 A;  3WGE A;  4BVX B;  3GUR A;  3M8N A;  3M1G A;  2H76 A;  1VGL A;  1MDI A;  3KD0 A;  4K5R A;  2GS3 A;  9GSS A;  1V2A A;  5C04 A;  3H4K A;  5ECO B;  5J9B A;  2BTO T;  4WR4 A;  2H1B A;  2L4C A;  3D0Z A;  3ZIJ A;  1XXU A;  2PER A;  3RPP A;  4DSR A;  2Z9S A;  4BL7 B;  3F4S A;  5ECN B;  4G10 A;  4HJ2 A;  3DVW A;  3KMN A;  2A2P A;  2H30 A;  1AAZ A;  1X5E A;  2KP1 A;  1N2A A;  3C1R A;  2CVK A;  1LBK A;  3L9U A;  4I5Q A;  4QQ7 A;  2F8A A;  2DKH A;  5GAN D;  4RUV A;  4ZXG A;  1EGO A;  4NXI A;  4XS1 A;  2YAN A;  2ZUP A;  2CT6 A;  2GT6 A;  2FLS A;  1M7T A;  3C7M A;  2B1K A;  3KTB A;  5A5K A;  5FT3 A;  4MA9 A;  5JCW A;  2AUV A;  1HNB A;  2JAC A;  3LFL A;  3FK8 A;  2XBQ A;  3GV1 A;  5F05 A;  2C4J A;  2XBI A;  1ZZY A;  3TJG A;  5GZZ B;  2ALB A;  4TXV A;  4POL A;  1ZGN A;  1NW2 A;  2DSA A;  1Z7R A;  2LJR A;  2AJQ B;  2C3Q A;  5FHI A;  5D9V A;  4KDY A;  2CZ2 A;  2HFD A;  4JBB A;  4TXO A;  5IO2 A;  4XS4 A;  4GRF A;  5B7C A;  1O8W A;  2HXK A;  2C3N A;  4DSS B;  4ECI A;  4PGT A;  2GZP A;  3TJK A;  3EMX A;  4GST A;  3TJJ A;  4MP4 A;  3IR4 A;  3I9V 2;  2M72 A;  1BQ7 A;  4FYC A;  3RPN A;  4EL1 A;  2HLS A;  3ZML A;  5DJL A;  3EC3 A;  4D73 B;  4YQM A;  2FA8 A;  3UIW A;  2QGV A;  2MBS A;  1Z6M A;  3HHV A;  4PQH A;  1SU9 A;  5DCG A;  4XHM A;  1YF1 A;  2QSI A;  3APO A;  2XPD A;  1AW9 A;  1FOV A;  1ERW A;  4HQZ A;  3GTU B;  1Z7P A;  5KN0 A;  2R6K A;  2H6X A;  1CQG A;  2P0G A;  2E2G A;  3LEF A;  2PVO C;  4X4J A;  2HE3 A;  3LJR A;  3OR5 A;  1A0F A;  3QAV A;  1K0D A;  1QFN A;  1XWG A;  3IV4 A;  6GSX A;  2VM1 A;  1I9D A;  4OCE A;  4MNN A;  4MH2 A;  3RHB A;  1ERT A;  3ERF A;  4ML6 A;  3G7Y A;  1M9A A;  1X0R A;  1ST9 A;  5E4W A;  2QA2 A;  2O8V B;  2HRK A;  4GSN A;  2OBI A;  4JZQ A;  4BVX A;  1X5D A;  3C1S A;  3L4N A;  1BED A;  3A3T A;  2A2R A;  1M2A A;  2JZS A;  2VLV A;  2KLX A;  4N11 A;  4KW6 A;  2WB9 A;  5ECL B;  3PR8 A;  4XCS A;  1GWC A;  1T3B A;  3CYN A;  3F3Q A;  3GSS A;  4BL7 A;  2FNO A;  5KN1 A;  4IVF A;  1K3Y A;  2R37 A;  1Y6E A;  5KOW A;  3EPT A;  1VF4 A;  1ACV A;  1QMV A;  1SYX A;  1XPV A;  4LL4 B;  1SL2 B;  3SWL A;  2XHF A;  2DJ1 A;  3Q6O A;  2VD1 A;  3H1N A;  5ELA A;  3UEM A;  3QR6 A;  1OC9 A;  3GKK A;  5IMA A;  4WEY A;  1YKC A;  3F63 A;  4KDX A;  8GSS A;  3FYG A;  1DBY A;  2LJK A;  3F4T A;  1MDJ A;  2E7P A;  2K6V A;  4OO5 A;  4OMV A;  4WBR D;  1TK5 B;  3D6I A;  4BVY B;  1K0C A;  1PX6 A;  3QFB C;  7GSS A;  5D9X A;  4Q5N A;  2EC4 A;  1U87 A;  2F51 A;  2HSM A;  1VF3 A;  3TOU A;  1MD4 A;  3BCI A;  2DJ3 A;  4MK3 A;  20GS A;  4WF4 A;  5IPG A;  4MF7 A;  4N0V A;  3K8N A;  2B3S A;  1EV4 A;  2IFQ A;  1JFU A;  1AIU A;  4HZ2 A;  3FR9 A;  3UBL A;  4OFM A;  3C73 A;  2OKA A;  2WGR A;  2BMX A;  4AJ7 A;  3MAK A;  1A8Y A;  4KSM A;  4IP1 A;  2DIZ A;  1UC7 A;  1YKA A;  4MPG A;  1ABA A;  5CRD A;  5CRW A;  1TI1 A;  1TRS A;  4L5O A;  6GSV A;  1ON4 A;  1FW1 A;  4ECJ A;  2OE3 A;  4F9Z A;  3CXG A;  1TW9 A;  2YP6 A;  2QKE A;  1IYI A;  1JZD A;  3KGK A;  5GAP D;  3VPQ A;  1EWX A;  3WT2 A;  4RQX A;  2VLU A;  3IAS 2;  2X99 A;  2K8S A;  4G0I A;  1EEM A;  1WP0 A;  3UAP A;  5IMV A;  3CTG A;  3IHQ A;  4HOJ A;  2L5O A;  2WZ9 A;  2YOI A;  2X8C A;  1SL0 B;  1F3B A;  2MMN A;  3QMX A;  3UBK A;  1UA5 A;  1SJI A;  1JZR A;  5IOX A;  1M0U A;  1UVZ A;  2DJ2 A;  2H74 A;  3DVX A;  4F2I A;  4Z7X A;  3AY8 A;  2TIR A;  2KUC A;  1ZL9 A;  2H72 A;  1HQO A;  1AXD A;  2HZE A;  3KEB A;  3ZMK A;  5IOW A;  1SD9 A;  1ILO A;  2E2M A;  1PSQ A;  2C3T A;  1OKD A;  4XRD A;  2X4A A;  4AGS A;  3DIE A;  3A2X A;  1OYJ A;  5F06 A;  1FVK A;  2FWF A;  3FZ4 A;  3VI5 A;  1TP9 A;  1THX A;  2LTK A;  2VCT A;  2KOK A;  1TK8 B;  2WRT A;  3GFK A;  3M9J A;  5D96 A;  3I43 A;  1K0B A;  1GTA A;  4IS0 A;  5ID2 B;  2MMA A;  1R5A A;  3HKR A;  4BWS A;  2M46 A;  4EIP A;  4I2U A;  4TXO B;  4EE0 A;  1GRX A;  4XS4 B;  3FR3 A;  5CNW A;  1WE0 A;  3KXO A;  1R5P A;  4KH7 A;  1GLQ A;  1O85 A;  1SL1 B;  2RM6 A;  1XVQ A;  1URM A;  4PUR A;  2GQK A;  1ERU A;  3LWA A;  1DUG A;  3VLN A;  2FWH A;  2C0G A;  1XIY A;  3L0H A;  1OE7 A;  4TOP A;  2H66 A;  3VPT A;  4GTU A;  3HZ4 A;  4WET A;  3KZQ A;  2M80 A;  1FHE A;  4MAB A;  2C8U A;  2LRT A;  5HQP A;  2CA8 A;  6GSS A;  4IBP A;  1TU7 A;  3CBU A;  4ZBA A;  3GX0 A;  4TR4 A;  2I81 A;  2PVQ A;  3I6A A;  4IJ3 A;  4K7N A;  4H86 A;  4POB A;  1SJZ A;  4OWY A;  3O6T A;  5ECK B;  2PUK C;  2R0P A;  4ULX A;  3CMI A;  1A2M A;  1YQ1 A;  3P90 A;  5ECR B;  4YAV A;  2LRC A;  3TKS A;  4XS6 A;  4OO4 A;  2IME A;  2AHE A;  3CSI A;  4KB3 A;  3SBC A;  3O76 A;  1OKT A;  3M3M A;  2B1L A;  3TOT A;  3GMF A;  3L9S A;  5A4U A;  2MZC A;  3BCK A;  2B7K A;  2MMO A;  5KN3 A;  2YWN A;  4AJ6 A;  3E9J B;  3EU3 A;  4GXZ A;  3WYW A;  2OAC A;  3DRN A;  1X9M B;  4O7H A;  4J57 E;  1Q98 A;  1PX7 A;  1TRW A;  2VCW A;  4Q5Q A;  2GLR A;  3F0I A;  4ECB A;  1T1V A;  2J23 A;  1XBS A;  1X5C A;  2V6K A;  4FIW A;  5HR2 A;  2R0G A;  1T4Y A;  5J5N A;  3TKR A;  4EKZ A;  2ES7 A;  3LGC A;  1S3A A;  1PA3 A;  2MBT A;  2H6Y A;  2P31 A;  2YZH A;  5ECS A;  4GSS A;  2EIO A;  2I3Y A;  1DE1 A;  1SK0 A;  4OD7 A;  1V58 A;  2FA4 A;  4Q5F A;  2VCZ A;  1OVN A;  1YEX A;  4ZIL A;  4IKH A;  5CYY A;  2WJU A;  1OC9 B;  2GSR A;  3WGD A;  4ICY A;  3D4T A;  4YKF A;  1TRU A;  3A2V A;  2C0E A;  3UAR A;  4TR3 A;  4EO3 A;  1BAY A;  1HYU A;  3IRA A;  3TRQ A;  1O8X A;  2YZU A;  3QAW A;  3IHG A;  5LNK e;  3ME8 A;  4CDO A;  5EPF A;  3P7X A;  2JAD A;  1PMT A;  2YV7 A;  2YWO A;  4V2M A;  2CAI A;  2CVB A;  4FH8 A;  1BJX A;  3TGZ A;  2VCV A;  1WIK A;  2KHP A;  1F2E A;  3Q18 A;  3GX8 A;  4KA0 A;  2HRA A;  2X8H A;  2B5E A;  5ID2 A;  4KCE A;  3HZ8 A;  1GSE A;  2IWT A;  2A4H A;  1ZYQ B;  3ME7 A;  2IMD A;  4F0C A;  1V9W A;  3GL5 A;  2IFQ B;  2HYX A;  5G2Z A;  3ZTL A;  3IPZ A;  2I4A A;  5D9W A;  1ZCP A;  2NBS A;  4KE3 A;  1YDK A;  16GS A;  1F9M A;  2DKI A;  3ZL5 A;  5CAX A;  4K7I A;  1PD2 1;  2PMT A;  3H93 A;  4DVC A;  2DC5 A;  4F0B A;  5DAL A;  1WOU A;  4NHZ A;  4AJ8 A;  5JCG A;  1QXH A;  1KNG A;  5KN2 A;  4G0L A;  4K2X A;  4HZ4 A;  2LQQ A;  1VF1 A;  2IN3 A;  3NZN A;  3P8W A;  2LUS A;  3HVV A;  3KP8 A;  2G0F A;  1PQN A;  1QK8 A;  1H75 A;  4BA7 A;  4X43 A;  5A4V A;  2TRX A;  5G1K A;  2MYG A;  4CY8 A;  1A24 A;  3RBT A;  2JL4 A;  1TDI A;  3NIV A;  2B6M A;  2X8G A;  3GHA A;  2R5G A;  4Z2R A;  3EU4 A;  5ECQ B;  2PPT A;  1B4P A;  2N5B A;  1C72 A;  2LNT A;  4MF6 A;  1AUC A;  3QOU A;  5LD0 A;  4TW5 A;  2JSZ A;  5HFK A;  3LYK A;  3GIX A;  1V98 A;  2L59 A;  1GTB A;  2HZE B;  3BJ5 A;  3UVH A;  1R26 A;  2FWE A;  2K9F A;  1J0F A;  6GST A;  2V6O A;  3F6F A;  3FW2 A;  5H5S A;  2JSY A;  3C71 A;  2CAQ A;  3VI7 A;  5BRT A;  2MMZ A;  4G0K A;  4I8B A;  2X64 A;  14GS A;  1VF2 A;  2H0G A;  4J56 E;  5ABR A;  3GNJ A;  3QDN A;  4L0W A;  2HT9 A;  2VD0 A;  2L6D A;  1GSS A;  1A23 A;  4KAE A;  3ZRE A;  1TXX A;  3VK9 A;  1WMJ A;  3QAG A;  4QL7 A;  2O89 A;  5J3R A;  3R2Q A;  1CQH A;  3HD5 A;  1U3A A;  3PPU A;  1PL1 A;  3IOS A;  3KH7 A;  4NV5 A;  3UL3 A;  4GCI A;  1R4W A;  4PUA A;  3D5J A;  2CX4 A;  1XVW A;  2FUG 2;  2GTU A;  1YF0 A;  1U88 A;  2IJY A;  2X49 A;  3GKX A;  4KGI A;  3GKM A;  4Z2U A;  2V32 A;  3TUE A;  2KP2 A;  2DLX A;  2YN1 A;  4N30 A;  2LST A;  5D8I A;  2AV4 A;  4GQC A;  1OE8 A;  3FZA A;  4ML1 A;  4XRA A;  3F8U A;  3Q19 A;  3A5I A;  3HYP A;  5IIZ A;  2G2Q A;  2WCI A;  1GTU A;  1R7H A;  1WJK A;  4IW9 A;  3TRX A;  3MDK A;  1GSY A;  2J9H A;  1G7O A;  1EZK A;  5A4W A;  3HDC A;  4E8H A;  3GH9 A;  1MDK A;  1RQM A;  4AF2 A;  3EIN A;  1EV9 A;  3VWU A;  3PGT A;  1Z6N A;  2JZR A;  3ZZX A;  3IAM 2;  3LOR A;  3M0F A;  2GST A;  2IMF A;  4IP6 A;  1HNA A;  4TR0 A;  1USB A;  5C00 A;  1QQ2 A;  2QA1 A;  1ZMA A;  2V2G A;  1GL8 A;  1E6B A;  1K0N A;  1T8E B;  3HA9 A;  3HXS A;  2FD3 A;  3LQ7 A;  4IJI A;  1FO5 A;  1PRX A;  5COH A;  1MEK A;  2VL2 A;  2OJL A;  1THO A;  3VUR A;  2LV3 A;  5HR0 A;  3HY2 A;  4TR1 A;  5JWR B;  4FQU A;  3R3E A;  3MWH A;  2GVP A;  4KF9 A;  4XIH A;  2B7J A;  3WGX A;  2C1Y A;  1LU4 A;  1Q4J A;  5ECI B;  4K8M A;  3VWX A;  1FVJ A;  2B5X A;  5G5E A;  2HRF A;  5F07 A;  3N5O A;  3GYK A;  10GS A;  4EXJ A;  4MJC A;  3Q74 A;  4RI6 A;  3GH6 A;  2R3X A;  2FWG A;  4ZL8 A;  4USS A;  3W8S A;  3ZYW A;  1X9W B;  1AQX A;  3JCM L;  5HR3 A;  4CHS A;  1SEN A;  3DML A;  4JU5 A;  4MJB A;  4F82 A;  2O7K A;  3MIX A;  4JR4 A;  1SD8 A;  5DQY A;  5CRG A;  4MPF A;  4K6X A;  5G31 A;  5KOX A;  1OAZ A;  2E0Q A;  2NDO A;  3GUS A;  4G9H A;  3FEU A;  4LMV A;  4POK A;  4MH3 A;  1XOA A;  1KTE A;  3KM6 A;  1OC3 A;  1F6M C;  2IMK A;  5DBQ A;  4G2E A;  2DJ0 A;  3A5W A;  4OCF A;  3ZFB A;  1SKW B;  4HS1 A;  3MNG A;  22GS A;  5IMF A;  1JLV A;  3D4M A;  2H75 A;  2YWM A;  2LRN A;  4K7O A;  1BX9 A;  2JZT A;  2R0C A;  4KCA A;  1O6J A;  4IN0 A;  3F6D A;  1NHY A;  1Z3E A;  2RII A;  2RM5 A;  1BYE A;  1EGR A;  5D9T A;  1XW5 A;  4J2F A;  1X9S B;  2YCD A;  2HSY A;  3PH9 A;  3J7Y b;  3DYR A;  3EE2 A;  3FHK A;  5IO0 A;  2IMI A;  4MJE A;  3APQ A;  3H8Q A;  3HJM A;  1TJD A;  3CRU A;  3LYP A;  1GSF A;  3TDG A;  2CVD A;  2LS5 A;  1HNC A;  3GST A;  5DAL B;  1RW1 A;  3ZRD A;  5CRE A;  5ENU A;  4Q5R A;  4FYU A;  2VO4 A;  3MYD A;  1M9B A;  1F37 A;  1TOF A;  4E8E A;  1SK2 A;  3BD2 A;  4XTS A;  2H73 A;  3IE3 A;  4EVM A;  5J41 A;  2GSS A;  4ZBD A;  4HDE A;  1PL2 A;  4EDY A;  3LG6 A;  1YZX A;  4PNF A;  3C8E A;  4DEJ A;  5L71 A;  1EP8 A;  5G5F A;  2OE1 A;  2GQM A;  4MF5 A;  1XZO A;  4TVE A;  3VFI A;  1EOH A;  1GSQ A;  2CQ9 A;  2IIY A;  3U5R E;  2VCX A;  4O32 A;  2DMM A;  2A2S A;  2YPM A;  4FO5 A;  3RHC A;  3G7I A;  4NMU A;  2YJH A;  1GUK A;  2C0F A;  1TK0 B;  1QGV A;  4KSO A;  1K0O A;  1T4Z A;  4PQ1 A;  2ON7 A;  3UMA A;  3GA4 A;  1J08 A;  1O73 A;  3IDV A;  5ECM B;  2LEG A;  1G0T A;  2VUP A;  1FOH A;  2DJJ A;  2BJX A;  1K0A A;  3KMO A;  2EIQ A;  1PKZ A;  5B6N A;  4L0U A;  4CY6 A;  3CSJ A;  4IHU A;  2B5Y A;  3DGQ A;  1M2B A;  1SJ6 A;  1G7E A;  3TCO A;  4X1U A;  4KUN A;  2H19 A;  1QUW A;  3FY7 A;  3J7Y k;  4ZB6 A;  1V57 A;  1JLW A;  3D22 A;  2PWJ A;  3HVX A;  1ZOF A;  2HNL A;  2OBK A;  2H0H A;  3HJP A;  3BOA A;  2L6C A;  5HFG A;  1BG5 A;  3BBY A;  1B8X A;  4KX4 A;  1DE2 A;  3L9V A;  3APS A;  4N0Z A;  3WT1 A;  4YAP A;  3TJB A;  11GS A;  1SK1 A;  5DAK A;  3KP9 A;  1O7U A;  3FRC A;  3UOM A;  3VWW A;  4V2L A;  4EF0 A;  4ZBB A;  4PUF C;  5F0G A;  5B6M A;  3UJ1 A;  5B8B A;  5DCH A;  3IC8 A;  2IL3 A;  5EL8 A;  4PNG A;  1PGT A;  2GDR A;  2VM2 A;  3TKS C;  2ZNM A;  3GL3 A;  4K9Z A;  1GP1 A;  4K0N A;  1MD3 A;  4YKG A;  4PXO A;  1E2Y A;  2REM A;  2EIR A;  1EP7 A;  1NM3 A;  3ZFL A;  3W6G A;  4ECC A;  2AAW A;  4JRR A;  3FMW A;  4LMW A;  4LL1 B;  4EDZ A;  1ZYN A;  5G30 A;  4MCU A;  2JU5 A;  3IK9 A;  1U3I A;  1GSD A;  1XWA A;  4WBJ A;  1W4V A;  1JHB A;  2K18 A;  1GNE A;  1JZW A;  1ZYE A;  2DBC A;  13GS A;  4MDC A;  4BPY A;  3TKS E;  1AQW A;  2WDU A;  4O5Q A;  3QD9 A;  1ZYP A;  2VLT A;  1ERV A;  2NPB A;  2V41 A;  2FCH A;  3NOF A;  1B48 A;  1WWJ A;  4LA1 A;  4JE1 A;  3QFA C;  19GS A;  5J9C A;  4ILF A;  2H01 A;  5DVB A;  5AIS A;  2H0I A;  1RK4 A;  2VL3 A;  5AN1 A;  4GWR A;  1JZO A;  1UN2 A;  4HJM A;  4N10 A;  1EOG A;  4IQA A;  2XPE A;  2DJK A;  4NPB A;  4TR1 B;  2YNX A;  3G7J A;  4MMM A;  2VCQ A;  3RAZ A;  3EWL A;  2ZCT A;  1S3C A;  4F03 A;  1PN9 A;  2H70 A;  2N5A A;  3DXB A;  1GUL A;  2RLI A;  3A2W A;  4JR6 A;  4PQI A;  1SYR A;  1FAA A;  5JWQ B;  3TB2 A;  4X0X A;  1TU8 A;  4V1A g;  5GST A;  2QC7 A;  5E59 A;  4O5U A;  5CO3 A;  4DSQ A;  1G6W A;  2LNS A;  5HFI A;  2XC2 A;  5AIX A;  4ZL7 A;  1WRY A;  4NWY A;  5G1L A;  1KBN A;  3LXZ A;  3DWV A;  4GLT A;  4YQU A;  2HZF A;  2PGT A;  2H1A A;  2F3M A;  4IQ1 A;  3EMP A;  2GT5 A;  1K3L A;  4RQR A;  3TJF A;  2FY6 A;  5KEJ A;  2AYT A;  5BMU A;  2FHE A;  4HI7 A;  5H5R A;  5F8B A;  1LJR A;  2P5Q A;  2F8F A;  3M9K A;  3GRX A;  5IMC A;  2WS2 A;  5AIV A;  4EUY A;  4ID0 A;  1A2L A;  3IBH A;  2K8V A;  4GQF A;  1H4O A;  2OE0 A;  2H1G A;  3FZ9 A;  1K3O A;  1TI3 A;  4ACS A;  4V1A p;  1XWK A;  3EVI A;  2IPA A;  3GKN A;  4I97 A;  2GGT A;  1W89 A;  3FKF A;  2OA7 A;  2O85 A;  3ERG A;  1G6Y A;  3KTL A;  4WKW A;  5ECH B;  2C80 A;  1PN0 A;  2H1D A;  1B9Y C;  3LXT A;  4RI7 A;  2ON5 A;  1F3A A;  3E0U A;  4MJA A;  5IMD A;  2D2Z A;  4MZW A;  3F4R A;  4YH2 A;  3KJY A;  4KDU A;  4TRX A;  1B9X C;  3F3R A;  4EC0 A;  5CP1 A;  2RUF A;  4NV2 A;  3HCZ A;  2L4Q A;  3FZ5 A;  2V1M A;  4HU7 A;  3HVS A;  1N8J A;  3O3T A;  4O92 A;  2TRC P;  2I1U A;  1SKS B;  5IPH A;  2WFC A;  1YEP A;  4WR5 A;  1Y25 A;  4K1F A;  1XWC A;  2A4V A;  1MTC A;  3KCM A;  6GSU A;  4MLY A;  4WF5 A;  2YWI A;  3PIN A;  4IEL A;  3EYT A;  3IC4 A;  5EY6 A;  4JED A;  2OAD A;  2GQL A;  1GUM A;  4I2T A;  5AGY A;  5IQY A;  1V40 A;  3ERW A;  5IM9 A;  4DSS A;  6GSW A;  1NSW A;  3H79 A;  4HEA 2;  4LLR A;  3ZVJ A;  4O5R A;  3IXR A;  2C0D A;  4K5S A;  3EUR A;  5JWO B;  3P2A A;  5IMZ A;  4D73 A;  3ZLP A;  4ZB9 A;  2R2J A;  3WD6 A;  1M2D A;  1T7P B;  3MSZ A;  2I9H A;  1GNW A;  1HD2 A;  1TKD B;  3U6V A;  1M99 A;  3KH9 A;  4KND A;  3GTU A;  4V2N A;  5B8A A;  4TN8 A;  4HU9 A;  5JCU A;  6GSY A;  3ED3 A;  3G9B A;  4P3Y B;  4BWQ A;  2PU9 C;  5DDL A;  1GSU A;  1ML6 A;  1GH2 A;  2HSH A;  3KIJ A;  2H6Z A;  3GN3 A;  1GLP A;  1XWB A;  2HI7 A;  1S3D A;  2L5L A;  4I6X A;  3I69 A;  1VRS D;  2FGX A;  2GZY A;  3D21 A;  4ZIJ A;  5GSS A;  4PTS A;  2VAF A;  4MZB A;  4EIQ A;  1U6T A;  1XCC A;  3UVT A;  1Z9H A;  2DML A;  5D93 A;  1PKW A;  1K0M A;  1YY7 A;  5DAK B;  17GS A;  4MZC A;  2PN8 A;  1NHO A;  1DSB A;  1XW6 A;  1AQV A;  2LQO A;  2YJ7 A;  1FG4 A;  3TKQ A;  3IK7 A;  1OC8 A;  2DIY A;  2CX3 A;  4HUA A;  3LW9 A;  3FR6 A;  2CV4 A;  1O81 A;  2VL9 A;  2CZ3 A;  3ZIV A;  4HQS A;  2N5F A;  2F9S A;  3DKS A;  2GZZ A;  3CSH A;  4WXT A;  5HR1 A;  1GTI A;  1GUH A;  1A8L A;  5DJM A;  2LJA A;  5DQS A;  5ECP B;  3TKP A;  2WUL A;  1TTZ A;  2VL2 C;  1A0R P;  1SKR B;  1KEB A;  4K2D A;  1I5G A;  3ISO A;  3S9F A;  2HRN A;  1WPI A;  3F9U A;  1IYH A;  4NHW A;  2NTO A;  1XFL A;  4QL9 A;  1J9B A;  2RUE A;  3DD3 A;  1YJ6 A;  4YQV A;  1B4Q A;  2H8L A;  2L57 A;  1FB6 A;  18GS A;  4ZB8 A;  4BVY A;  4GF0 A;  1Z5Y E;  3ZVJ D;  3N9J A;  5FWG A;  3V1W A;  2R4V A;  3LSZ A;  4L8E A;  5D73 A;  4ZL9 A;  1EEJ A;  4CW9 A;  2H71 A;  2VIM A;  2P5R A;  1AC1 A;  4ISD A;  2AB6 A;  3E3E A;  2YV9 A;  3L78 A;  5J4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...