4XIHA

Crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
153
Chain Sequence
b'HMLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANAGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site architecture in peroxiredoxins: a case study on Mycobacterium tuberculosis AhpE.
pubmed doi rcsb
molecule keywords AhpC/TSA family protein
source organism Mycobacterium tuberculosis (strain ccdc5079)
molecule tags Oxidoreductase
total genus 53
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4xihA00
1M2DA 5ECSA 1BYEA 2L4CA 4ZBBA 1FB6A 1RQMA 4MABA 4XRAA 5IMVA 2DJ3A 1GSFA 2RUFA 5AISA 3ZTLA 1TTZA 3WT2A 1EEJA 4DVCA 4OFNA 2WCIA 3UAPA 3LGCA 1TOFA 2EC4A 2MMAA 2OJLA 2YV9A 2H1BA 4ZXGA 4YQVA 3L9VA 2TRXA 2JSZA 1WMJA 1XW9A 4HQSA 3GYKA 3HVSA 4POLA 3RHBA 2KUCA 2YOIA 4JR6A 4LMWA 4IN0A 4CW9A 2OA7A 1T1VA 4XCSA 4PURA 5FWGA 5DJMA 2AJQB 4TXVA 1GSYA 2AYTA 1GTUA 3MWHA 3IRAA 1USBA 2H0IA 1T4ZA 3M9JA 3LYKA 1SK2A 2Z9SA 1ZCPA 3GKNA 4MLYA 1QQ2A 3QPMA 2H1DA 1X9MB 1K0CA 2ZNMA 5DVBA 1Y25A 5DQYA 4ZL8A 5L71A 2VL9A 3HYPA 4FIWA 1O73A 2IMKA 1A8LA 2H01A 3QAGA 3BJ5A 2LQQA 1XVWA 4MJEA 3FZ9A 1SJZA 1PQNA 5D96A 3O6TA 3HJOA 1DBYA 2FA4A 2H19A 2L6CA 2YJHA 2XBIA 3QAVA 1RW1A 4MZBA 1TW9A 1BG5A 1VF4A 1WE0A 3F6DA 4ZIJA 3ZMKA 4MF5A 3VWVA 3ZFBA 1CQHA 1Q98A 2YP6A 2WFCA 4K1FA 1QFNA 4I2UA 3O76A 3F4SA 1QK8A 4HI7A 1ON4A 4KCAA 1O81A 2LRCA 4X43A 3Q18A 2AAWA 2IFQB 2XHFA 3C8EA 4Q5QA 4NXIA 3C73A 2E2MA 2GZPA 2DIYA 2F8FA 1XCCA 1K0MA 5J5NA 1T7PB 2H66A 2AHEA 2YWOA 1SYXA 3GH6A 1OC3A 1X0RA 1YEPA 1A2MA 2F8AA 3W8SA 4V1Ap 2H30A 2H70A 1B9YC 1MTCA 2IL3A 4IS0A 3TCOA 2WS2A 3TRQA 5E4WA 3VPQA 3KMNA 4TR1A 4PXOA 4AJ7A 4MJCA 1TJDA 1QXHA 2HLSA 2FWHA 2ALBA 3FY7A 2QGVA 4GRFA 3VWWA 3DIEA 5DBQA 4J57E 2PERA 2NPBA 3NIVA 3ME7A 1H75A 1OE7A 4IW9A 1MDKA 3SBCA 2B7KA 1AIUA 1U87A 3RPPA 3LXZA 3QFAC 2MBSA 2BTOT 2ES7A 1JZDA 3F6FA 5FHIA 1SK1A 3CSJA 4MP4A 2F9SA 3IK7A 3F4RA 2O89A 4TN8A 2VD1A 5IO2A 1WOUA 3UOMA 2QC7A 5ABRA 4KNDA 2H72A 2I4AA 3HVVA 5ECHB 4IBPA 4IQAA 3G7YA 2MYGA 2K6VA 2VUPA 2C3NA 1M9AA 1EOHA 4EXJA 1AW9A 1R5AA 2PWJA 4HJ2A 5HR3A 3RAZA 3F3QA 3F0IA 3RDWA 5CAXA 3VWUA 2L57A 3GTUA 14GSA 2N5FA 3APOA 4NV5A 3L0HA 3HJPA 3TUEA 3EYTA 3H93A 1XPVA 5GSTA 1HYUA 1YF1A 2HXKA 2K9FA 4LMVA 1XIYA 3G7JA 5G30A 2MZCA 4MDCA 3HY2A 1A2JA 3UVHA 2I1UA 2X64A 6GSYA 3DEXA 1YQ1A 2JL4A 5CRHA 4I5QA 4GQFA 1HQOA 1TKDB 1XW5A 5IOXA 5ECLB 2GSTA 5D9WA 2G2QA 2TIRA 2F51A 2CAIA 1K0NA 1X5DA 1T4YA 2YZUA 4ULXA 2V6OA 4F0BA 2CVKA 3US3A 1A0RP 3A3TA 2GQMA 3KTLA 3IC4A 4D73B 1NSWA 4HU9A 3ZIVA 2DJJA 2LNSA 4JRRA 4IQ1A 3F63A 3IDVA 1Z7PA 1OC9B 4NHZA 3LEFA 2HNLA 4FO5A 2CQ9A 1QGVA 4EKZA 3QR6A 5H5RA 1TK5B 2FWGA 3KM6A 1M0UA 2B3SA 3E9JB 1X9SB 3H8QA 2VO4A 1BQ7A 4CDOA 3LG6A 4IP1A 3HXSA 4EDYA 3KIJA 2A2RA 3F3RA 1LU4A 3ZLPA 1HNAA 3DYRA 3HZ8A 4WEYA 3UMAA 3TDGA 5A4UA 3FRCA 2GSSA 3C71A 1G7OA 1JLWA 2CZ2A 4TR0A 5G5EA 4ZILA 1ERVA 2FWEA 2HRNA 4J56E 2IFQA 1MD3A 2YN1A 4GLTA 1ACVA 4RI7A 2V2GA 4POKA 1AQWA 1WRYA 4YQMA 2GLRA 4WR4A 1BAYA 2NVLA 5ENUA 4ZBDA 2PN8A 5J4UA 2PGTA 3VK9A 1M99A 3ERFA 4BVYA 1U6TA 5IOWA 3IAM2 1GUHA 5HFKA 4EF0A 1H4OA 2C0FA 3D4TA 4AGSA 1TDIA 4NWYA 4PX1A 2H1GA 5DQSA 1BX9A 1PX7A 2E7PA 3KD0A 5ECKB 3E0UA 3IR4A 3HA9A 5AIXA 1URMA 3CTGA 3H79A 3BD2A 2AB6A 2PBJA 4DEJA 4BWQA 3ZMLA 3CYNA 1G6WA 1PGTA 4NPBA 4KDXA 3HD5A 3O3TA 2G0FA 3HKRA 2C3QA 2JSYA 1T00A 5J41A 2WB9A 1XBSA 1XOAA 2L5OA 1OKTA 1K3LA 3KMOA 2YCDA 4I6XA 2IWTA 1J08A 4ZBAA 1B4PA 1QMVA 3MNGA 4XTSA 1UC7A 2B7JA 2HRFA 3GURA 1XW6A 4TKYA 2PVQA 5FT3A 4EE0A 4LL1B 3GSTA 5F8BA 2PVOC 2FGXA 2VOCA 2P0GA 4TR1B 4YAPA 2YNXA 1JZRA 4EVMA 5JWRB 2IIYA 3IXRA 1TK8B 5IM9A 2B5XA 2LRTA 1O85A 1XOBA 2MBTA 4F82A 5JCUA 3TJGA 5ELGA 2LNTA 1K0BA 2HZEA 1GP1A 1ZMAA 4EL1A 4K6XA 3GL3A 3GN3A 3TJKA 1X5EA 4JE1A 4POBA 4X1UA 1GSEA 2DJ1A 2JZTA 2TRCP 3CSIA 3IAS2 5AIVA 1M2AA 4OD7A 4IP6A 3VI5A 3E3EA 3M0FA 2CVBA 4MZWA 5ECRB 1SL0B 2X99A 3U5RE 2L5LA 16GSA 4D73A 4ECCA 3GFKA 5J9BA 5EL8A 1YKCA 4XS1A 1OC9A 2REMA 4L0UA 1BEDA 1U3AA 3TKRA 2GZZA 1GRXA 2E0QA 3GTUB 2J23A 3GA4A 1SK0A 3VI7A 2J9HA 2OE3A 3KGKA 2O87A 2E2GA 2VCQA 3TOTA 4N10A 3S9FA 12GSA 1T3BA 4WR5A 1A24A 4O32A 2FA8A 1NW2A 3A2VA 3EWLA 3LORA 4O92A 2R5GA 3J7Yb 3PR8A 4WKWA 5CNWA 2H71A 4HU7A 1PMTA 3GKKA 1JZOA 5A5KA 4AF2A 2N5BA 2A2SA 2VAFA 3J7Yk 5JWQB 5EY6A 3OR5A 4TXOB 3CMIA 4I2TA 6GSUA 2CT6A 2RIIA 1GSUA 4OO5A 2ON5A 1UVZA 2RLIA 3GH9A 2LJAA 3LQ7A 4CHSA 2VLVA 5F0GA 4JZQA 3A5WA 4HZ4A 1XZOA 4IGJA 3ERWA 5B7CA 5ID2A 4BVXA 3WT1A 1OVNA 1TRVA 2GSQA 4V1Ag 3D22A 1V9WA 3EURA 4G9HA 5G1KA 1ZZYA 2VD0A 1DE2A 4ECBA 5G31A 2GTUA 2AUVA 4MF7A 3LJRA 1N2AA 2ON7A 1B9XC 2LS5A 3CXGA 19GSA 3HJMA 1PD21 4GSNA 5KN3A 1PL1A 2EIRA 5HQPA 2AV4A 2MMZA 1Z3EA 2C80A 1C72A 2KP2A 4MJBA 4KW6A 2R3XA 4EUYA 2B1KA 4GCIA 3ZVJA 3AY8A 2BMXA 1UN2A 4EC0A 4TW5A 4ML1A 3QOUA 2H6ZA 20GSA 2QKEA 2FHEA 1JFUA 3NOFA 4RI6A 4WF5A 1R7HA 3MSZA 1A2LA 3UBLA 1EEMA 1CQGA 3UIWA 1K3YA 1EOGA 5JWOB 4K7IA 1VF1A 2WDUA 5CO3A 5GAPD 4JBBA 3RBTA 1R5PA 1SKRB 3FW2A 2VL3A 4QQ7A 2DMLA 2IMFA 2CZ3A 1F3BA 4PNFA 2GSRA 1ZYQB 5IO0A 3CSHA 3KZQA 1GSDA 5DJLA 2O85A 4KH7A 2L4QA 1FAAA 1MD4A 3I43A 2F3MA 2C0EA 4MK3A 3FR6A 1V57A 5IPHA 5DCGA 1U3IA 1GNWA 3FR9A 2GT6A 4PUAA 2DMMA 1TRWA 5ECNB 5HFIA 4G10A 3ZZXA 4XIHA 3P90A 5JCGA 4PGTA 5INYA 3APQA 2KLXA 2ZCTA 3IK9A 3DVWA 1PKWA 1GSQA 1ZGNA 2H0HA 2DIZA 1RK4A 3DKSA 5HR1A 2DSAA 5CP1A 1LBKA 4DSSA 4N11A 4I97A 4JU5A 3L9UA 2HZEB 4GXZA 2C0GA 4FYBA 3CRTA 4E8EA 2OADA 3EMPA 4TR3A 4F9ZA 2B1LA 4BA7A 1EP8A 3KP9A 3EC3A 2H6YA 1M9BA 3GKMA 2LJRA 1PL2A 3WGDA 2LKUA 2XBQA 5KN1A 3A2XA 1SD8A 3TRPA 1PSQA 1SYRA 3FYGA 4P3YB 4DSRA 2WZ9A 1GULA 3Q6OA 5ECMB 4TXOA 4XS6A 3F4TA 2HT9A 5IMAA 2BJXA 2VM1A 4XS4A 3WGXA 6GSXA 2C4JA 3GSSA 3IV4A 2P5RA 4G2EA 1A0FA 2NBSA 3TOUA 4K7NA 4OO4A 3I9V2 6GSWA 1E2YA 5JCWA 2NDOA 3I69A 2V32A 4HUAA 4PQIA 3DGQA 4BL7A 1MDIA 1PX6A 2DLXA 2GDRA 1DE1A 2EIQA 2MMNA 1EV4A 3IA1A 2LQOA 1FG4A 2QSIA 1FOVA 3VFIA 22GSA 2JZRA 1AAZA 2CV4A 7GSSA 3BBYA 1XWBA 4BPYA 1I9DA 2M46A 5IMDA 1ZL9A 3DWVA 1WPIA 4KE3A 4DSQA 3H1NA 5IPGA 4TRXA 1SL1B 2EIOA 4GF0A 5G5FA 1B4QA 2VCWA 1ERWA 1ILOA 5B6MA 3GUSA 3C1SA 1YZXA 3L9SA 3UJ1A 4N0VA 4ECIA 4WBRD 3LWAA 4RUVA 2PMTA 1OC8A 2VL2C 2VL2A 3VWXA 4N0ZA 5AGYA 1E6BA 3DRNA 5C00A 5ELAA 1GNEA 1XWCA 4NMUA 5D8IA 4IJIA 3D6IA 3KCMA 1VF3A 5E59A 1MDJA 5ECPB 5ID2B 3DXBA 5D9XA 1J9BA 4J2FA 1SENA 1YKAA 3G9BA 1YY7A 2KHPA 3TKPA 3ERGA 4L0WA 1FVJA 1TRUA 1WIKA 5COHA 5IMFA 3RHCA 3FR3A 2FLSA 1AXDA 2I9HA 2RM6A 3FHKA 1UA5A 1KTEA 2YV7A 3QMXA 4K7OA 1Z6MA 1XXUA 1YF0A 2JADA 5F06A 4GQCA 3APSA 2B6MA 5H5SA 2YWIA 5ECIB 4F0CA 4WBJA 4LA1A 3HVXA 5C04A 1V40A 5GZZB 1XWKA 5D9VA 2OE0A 4MH3A 6GSVA 1DUGA 4MA9A 3TB2A 1Z5YE 1S3CA 2C3TA 3W8JA 3TGZA 2H76A 2PU9C 1TXXA 5G2ZA 1EV9A 4IJ3A 1GUMA 3D4MA 4OFMA 3LXTA 3M8NA 3ZL5A 1O8XA 1SU9A 1XFLA 2I3YA 2XC2A 1Z6NA 1GL8A 1EGRA 2HSYA 3N5OA 4K0GA 4ECJA 2CAQA 3ZVJD 2GT5A 4ZL7A 2FUG2 3FZ5A 2H0GA 1HNCA 3EVIA 5DAKB 4K8MA 1A8YA 3D5JA 4Q5RA 5HR0A 4RQRA 3C7MA 2IMIA 2WRTA 2GQLA 3FZ4A 4XHMA 3KH9A 2WJUA 4OCEA 5LD0A 4ML6A 4L5LA 4NAXA 3QAWA 4EO3A 1R26A 4TOPA 1Y6EA 2VCZA 4KSMA 5J3RA 2FNOA 1GLQA 3FKFA 5KN2A 2CA8A 3KEBA 2C0DA 3CBUA 2LUSA 5DDLA 2KP1A 1SL2B 4O7HA 1GLPA 1DSBA 3V1WA 3U6VA 5EPFA 3ZREA 3VPTA 4DSSB 2M72A 3M1GA 4IELA 1ZOFA 2RM5A 1ERUA 2N5AA 2I81A 1A23A 5H5QA 1PKZA 3NZNA 4HDEA 1B48A 4PQ1A 3MAKA 2M80A 2MMOA 1G6YA 3HZ4A 3TJFA 4TR4A 1Z7RA 3P8WA 4K0NA 2IJYA 4Q5FA 1THXA 4KDUA 1Q4JA 4FYUA 1GSSA 3N9JA 2VCVA 2KOKA 2R6KA 2YZHA 1W4VA 3M9KA 2HE3A 2GZYA 4XS4B 2K8VA 1MEKA 3ZRDA 5DALA 3TRXA 1F37A 2XPDA 1OAZA 3ZYWA 2GS3A 8GSSA 5CRDA 1J0FA 18GSA 3EU3A 2V1MA 1FO5A 1XWGA 3HHVA 3ISOA 3C1RA 5CREA 4OCFA 2OKAA 3ED3A 1FVKA 1N8JA 3LSZA 1M7TA 4QL7A 1SKSB 4ILFA 1ML6A 1PN9A 5LNKe 1LJRA 3D0ZA 3DMLA 3GV1A 2DJ0A 2LRNA 2X8CA 4KUNA 1FHEA 2V6KA 4TVEA 4MCUA 1PA3A 4JR4A 1X5CA 3UVTA 3Q19A 5CRGA 5CRWA 3TKSE 4OMVA 4BWSA 4FYCA 2HI7A 1S3DA 4HEA2 4I8BA 2JU5A 4X0XA 1SKWB 1JLVA 5D73A 4RQXA 3FZAA 5A4WA 5D93A 4L8EA 3IOSA 1GWCA 5LCZA 1KBNA 2DC5A 4GSTA 1R4WA 4V2MA 2FY6A 2JACA 3EE2A 2ZUPA 4NHWA 1F9MA 2LV3A 3R2QA 1YDKA 5F07A 2B5YA 3MDKA 1M2BA 4G19A 2H6XA 4HZ2A 3UEMA 3GKXA 3GIXA 1AQXA 2GGTA 1IYHA 4HS1A 4KCEA 3F9UA 4YAVA 4L5OA 4N30A 3KP8A 2R37A 3KTBA 3PINA 2LTKA 3GNJA 5DAKA 4KAEA 1JHBA 4IKHA 3HCZA 2PPTA 1ABAA 3GMFA 1HNBA 1GTIA 3GRXA 3I6AA 3LYPA 2A4VA 5ECQB 1TU8A 2R4VA 2HYXA 1ZYEA 4V2LA 2IPAA 13GSA 2CX4A 4ZB8A 3TKQA 4LL4B 9GSSA 2O7KA 1O7UA 4MJAA 5B8BA 1SJIA 3GX0A 3IHQA 3PH9A 1T8EB 4K9ZA 5KEJA 4ZB9A 2HZFA 4QL9A 3GX8A 11GSA 4LLRA 4H86A 4WETA 2YANA 2IN3A 4KX4A 3EMXA 3EU4A 2LEGA 2OBIA 2WGRA 6GSTA 2CX3A 1NHOA 2H1AA 2CVDA 1O8WA 5G1LA 3WYWA 1GTBA 3KH7A 1TK0B 2V41A 1ERTA 1AUCA 2DJKA 3CRUA 4GTUA 4HOJA 2YWMA 3ZFLA 4KSOA 3W6GA 5D9TA 1U88A 2C8UA 1OE8A 3EINA 3SWLA 1WJKA 1W89A 4FH8A 1OYJA 5GSSA 4HQZA 3VLNA 3PGTA 2K8SA 2WULA 2B5EA 2DJ2A 2VCXA 3BCKA 1SD9A 2VLUA 2IMDA 2VLTA 1G0TA 1YEXA 4JEDA 3ZIJA 5A4VA 1V2AA 2XPEA 4YQUA 3K8NA 2HFDA 2OBKA 3RPNA 3P7XA 3CTFA 3QD9A 3GHAA 4YH2A 1K3OA 2IMEA 2VIMA 1F6MC 1NHYA 3TJBA 17GSA 1TI1A 4V2NA 2H8LA 3QCPA 1WP0A 3WD6A 2YPMA 3TKSA 3TKSC 6GSSA 1EGOA 2VCTA 1KEBA 1EP7A 3BOAA 4ACSA 1SJ6A 5EVOA 3IBHA 3L4NA 4IVFA 5DALB 1TI3A 1JZWA 1EWXA 1K0AA 1S3AA 3IPZA 2D2ZA 2NTOA 3UL3A 5IQYA 5F05A 3FK8A 2FWFA 4EDZA 4AJ6A 4GWRA 5HFGA 10GSA 4POMA 3D21A 5IMCA 4Q5NA 1K0DA 4MF6A 3TJJA 1XVQA 3KJYA 1PRXA 4PUFC 3M3MA 1VGLA 1X9WB 2FD3A 4GSSA 3KXOA 5CYYA 4ZL9A 1K0OA 4OWYA 4KGIA 2GVPA 2X8GA 2HSHA 3H4KA 3L78A 1I5GA 4WXTA 1FW1A 1V98A 3UBKA 1AQVA 1NM3A 4ZB6A 2OE1A 2C1YA 2O8VB 3A2WA 2RUEA 1B8XA 4F2IA 2PUKC 1IYIA 3VURA 5KN0A 4KDYA 3DD3A 1XWAA 3QFBC 4F03A 4OFTA 4ID0A 3BCIA 3F8UA 1ST9A 1YJ6A 3G7IA 2H74A 3HDCA 4IHUA 4MPFA 5IMZA 1EZKA 2LSTA 5J9CA 1QUWA 3ZITA 1AC1A 1OKDA 1GTAA 2DBCA 3UARA 3ME8A 5B6NA 5ECOB 5IIZA 1TU7A 5HR2A 4XRDA 4O5RA 2P31A 2X8HA 4NV2A 4ISDA 2H73A 5AN1A 2GQKA 3FEUA 3IE3A 5GAND 1KNGA 4MH2A 1F2EA 4PNGA 2L6DA 2H75A 4KB3A 1F3AA 4K2DA 2YJ7A 2JZSA 2YWNA 1THOA 1HD2A 4KA0A 2VM2A 2L59A 1VF2A 1TP9A 3WGEA 3P2AA 1GH2A 3Q74A 4MZCA 2LJKA 4Z7XA 1VRSD 4PQHA 3JCML 1BJXA 2OACA 2R2JA 4WF4A 4E8HA 2P5QA 3GL5A 4MMMA 2K18A 2FCHA 3QDNA 3LFLA 1G7EA 1Z9HA 1V58A 1GUKA 1O6JA 1TRSA 5B8AA 1WWJA 4MPGA 5DCHA 3DVXA 4HJMA 1FB0A 4AJ8A
chains in the Genus database with same CATH superfamily
1M2DA 5ECSA 1BYEA 2L4CA 4ZBBA 1FB6A 1RQMA 4MABA 4XRAA 5IMVA 2DJ3A 1GSFA 2RUFA 5AISA 3ZTLA 1TTZA 3WT2A 1EEJA 4DVCA 4OFNA 2WCIA 3UAPA 3LGCA 1TOFA 2EC4A 3IC8A 2MMAA 2OJLA 2YV9A 2H1BA 4ZXGA 4YQVA 3L9VA 2TRXA 2JSZA 1WMJA 1XW9A 4HQSA 3GYKA 3HVSA 4POLA 3RHBA 2KUCA 2YOIA 4JR6A 4LMWA 4IN0A 4CW9A 2OA7A 1T1VA 4XCSA 4PURA 5FWGA 1FOHA 5DJMA 2AJQB 4TXVA 1GSYA 2AYTA 1GTUA 3MWHA 3IRAA 1USBA 2H0IA 1S3RA 1T4ZA 3M9JA 3LYKA 1SK2A 2Z9SA 1ZCPA 3GKNA 4MLYA 1QQ2A 3QPMA 2H1DA 1X9MB 1K0CA 2ZNMA 5DVBA 4O5UA 1Y25A 5DQYA 4ZL8A 5L71A 2VL9A 3HYPA 4FIWA 1O73A 2IMKA 1A8LA 2H01A 3QAGA 3BJ5A 2LQQA 1XVWA 4MJEA 3FZ9A 1SJZA 1PQNA 5D96A 3O6TA 3HJOA 1DBYA 2FA4A 2H19A 2L6CA 2YJHA 2XBIA 3QAVA 1M3JA 1RW1A 4MZBA 1TW9A 1BG5A 5KOXA 1VF4A 1WE0A 3F6DA 4ZIJA 3ZMKA 4MF5A 3VWVA 3ZFBA 1CQHA 1Q98A 2YP6A 2WFCA 4K1FA 1QFNA 4I2UA 3O76A 3F4SA 1QK8A 4HI7A 1ON4A 4KCAA 1O81A 2LRCA 4X43A 3Q18A 2AAWA 2IFQB 2XHFA 3C8EA 4Q5QA 4NXIA 3C73A 2E2MA 2GZPA 2DIYA 4CY6A 2F8FA 1XCCA 1K0MA 4A5PA 5J5NA 1T7PB 2H66A 2AHEA 2YWOA 1SYXA 3GH6A 1OC3A 1X0RA 1YEPA 1A2MA 2F8AA 3W8SA 4V1Ap 2H30A 2H70A 1B9YC 1MTCA 2IL3A 4IS0A 3TCOA 2WS2A 3TRQA 5E4WA 3VPQA 3KMNA 4TR1A 4PXOA 4AJ7A 4MJCA 1TJDA 1QXHA 2HLSA 2FWHA 2ALBA 3FY7A 2QGVA 4GRFA 3VWWA 3DIEA 1PN0A 5DBQA 4J57E 2PERA 1PFOA 2NPBA 3NIVA 3ME7A 1H75A 1OE7A 4IW9A 1MDKA 3SBCA 2B7KA 1AIUA 1U87A 3RPPA 3LXZA 3QFAC 2MBSA 2BTOT 2ES7A 1JZDA 3F6FA 5FHIA 1SK1A 3CSJA 4MP4A 2F9SA 3IK7A 3F4RA 2O89A 4TN8A 2VD1A 5IO2A 1WOUA 3UOMA 2QC7A 5ABRA 4KNDA 2H72A 2I4AA 3HVVA 5ECHB 4IBPA 4IQAA 3G7YA 2MYGA 2K6VA 2VUPA 2C3NA 1M9AA 1EOHA 4EXJA 1AW9A 1R5AA 2PWJA 4HJ2A 5HR3A 3RAZA 3F3QA 3F0IA 3RDWA 5CAXA 3VWUA 2L57A 3GTUA 14GSA 1ZYPA 2N5FA 3APOA 4NV5A 3L0HA 3HJPA 3TUEA 4K5RA 3EYTA 3H93A 1XPVA 5GSTA 1HYUA 1YF1A 2HXKA 2K9FA 4LMVA 1XIYA 3G7JA 5G30A 2MZCA 4MDCA 3HY2A 1A2JA 3UVHA 2I1UA 2X64A 6GSYA 3DEXA 1YQ1A 2JL4A 5CRHA 4I5QA 4GQFA 1HQOA 1TKDB 1XW5A 5IOXA 5ECLB 2GSTA 5D9WA 2G2QA 2TIRA 2F51A 2CAIA 1K0NA 1X5DA 1T4YA 2YZUA 4ULXA 2V6OA 4F0BA 2CVKA 3US3A 1A0RP 3A3TA 2GQMA 3KTLA 3IC4A 2HSMA 4D73B 1NSWA 4HU9A 3ZIVA 2DJJA 2LNSA 4JRRA 4IQ1A 3F63A 3IDVA 1Z7PA 1OC9B 4NHZA 3LEFA 2HNLA 4FO5A 2CQ9A 1QGVA 4EKZA 3QR6A 5H5RA 1TK5B 2FWGA 3KM6A 1M0UA 2B3SA 4K5SA 3E9JB 1X9SB 3H8QA 2VO4A 1BQ7A 3LW9A 4CDOA 3LG6A 4IP1A 3HXSA 4EDYA 3KIJA 2A2RA 3F3RA 1LU4A 3ZLPA 2DKIA 1HNAA 3DYRA 3HZ8A 4WEYA 3UMAA 3TDGA 5A4UA 3FRCA 2GSSA 3C71A 1G7OA 4G0KA 1JLWA 2CZ2A 4TR0A 3CQFA 5G5EA 4ZILA 1ERVA 2FWEA 2HRNA 4J56E 2IFQA 1MD3A 2YN1A 4GLTA 1ACVA 4RI7A 2V2GA 4POKA 1AQWA 1WRYA 4YQMA 2GLRA 4WR4A 1BAYA 2NVLA 5ENUA 4ZBDA 2PN8A 5J4UA 2PGTA 3VK9A 1M99A 3ERFA 4BVYA 1U6TA 2HRAA 4BVXB 5IOWA 3IAM2 1GUHA 5HFKA 4EF0A 1H4OA 2C0FA 3D4TA 4AGSA 1TDIA 4NWYA 4PX1A 2H1GA 5DQSA 1BX9A 1PX7A 2E7PA 3KD0A 5ECKB 3E0UA 3IR4A 3HA9A 5AIXA 1URMA 3CTGA 3H79A 3BD2A 2AB6A 2PBJA 4DEJA 4BWQA 3ZMLA 3CYNA 1G6WA 1PGTA 4NPBA 4KDXA 3HD5A 3O3TA 2G0FA 3HKRA 2C3QA 2JSYA 1T00A 5J41A 2WB9A 1XBSA 1XOAA 2L5OA 1OKTA 1K3LA 3KMOA 2YCDA 4I6XA 2IWTA 1J08A 4ZBAA 1B4PA 1QMVA 3MNGA 4MNNA 4XTSA 1UC7A 2B7JA 2HRFA 3GURA 1XW6A 4TKYA 2PVQA 5FT3A 4EE0A 4LL1B 3GSTA 5F8BA 2PVOC 2FGXA 4PTSA 4EIQA 2VOCA 2P0GA 4TR1B 4YAPA 2YNXA 1JZRA 4EVMA 5JWRB 2IIYA 3IXRA 1TK8B 5IM9A 2B5XA 2LRTA 1O85A 1XOBA 2MBTA 4F82A 5JCUA 3TJGA 5ELGA 2LNTA 1K0BA 2HZEA 1GP1A 1ZMAA 4EL1A 4K6XA 3GL3A 3GN3A 3TJKA 4EIPA 3MIXA 1X5EA 4JE1A 4POBA 4X1UA 1GSEA 2DJ1A 2JZTA 2TRCP 3CSIA 3IAS2 5AIVA 1M2AA 4OD7A 4IP6A 3VI5A 3E3EA 3M0FA 2CVBA 4MZWA 5ECRB 1SL0B 2X99A 3U5RE 2L5LA 16GSA 4D73A 2A4HA 4ECCA 3GFKA 5J9BA 2X4AA 5EL8A 1YKCA 4XS1A 1OC9A 2REMA 4L0UA 1BEDA 1U3AA 4CY8A 3TKRA 2GZZA 1GRXA 2E0QA 3GTUB 2J23A 3GA4A 1SK0A 3VI7A 2J9HA 2OE3A 3KGKA 2O87A 2E2GA 2VCQA 3TOTA 4N10A 3S9FA 12GSA 1T3BA 4WR5A 1A24A 4O32A 2FA8A 1NW2A 3A2VA 3EWLA 3LORA 4O92A 2R5GA 3J7Yb 3PR8A 4WKWA 5CNWA 2H71A 4HU7A 1PMTA 3GKKA 1JZOA 4AJ8A 5A5KA 4AF2A 2N5BA 2A2SA 2VAFA 3J7Yk 5JWQB 5EY6A 5BRTA 3OR5A 4TXOB 3CMIA 4I2TA 6GSUA 2CT6A 2RIIA 1GSUA 4OO5A 2ON5A 1UVZA 2RLIA 3GH9A 2LJAA 3LQ7A 4CHSA 3HVNA 2VLVA 5F0GA 4JZQA 3A5WA 4HZ4A 1XZOA 4IGJA 3ERWA 5B7CA 5ID2A 4BVXA 3WT1A 1OVNA 1TRVA 2GSQA 4V1Ag 3D22A 1V9WA 3EURA 4G9HA 5G1KA 1ZZYA 2VD0A 1DE2A 4ECBA 5G31A 2GTUA 2AUVA 4MF7A 3LJRA 1N2AA 2ON7A 1B9XC 2LS5A 3CXGA 19GSA 3HJMA 1PD21 4GSNA 5KN3A 1PL1A 2EIRA 5HQPA 2AV4A 2MMZA 1Z3EA 2C80A 1C72A 2KP2A 3A5IA 4MJBA 4KW6A 2R3XA 4EUYA 2B1KA 4GCIA 3ZVJA 3AY8A 2BMXA 1UN2A 4EC0A 4TW5A 4ML1A 3QOUA 2H6ZA 20GSA 4BVYB 2QKEA 2FHEA 1JFUA 3NOFA 4RI6A 4WF5A 1R7HA 3MSZA 1A2LA 3UBLA 1EEMA 1CQGA 3UIWA 1K3YA 1EOGA 5JWOB 4K7IA 1VF1A 2WDUA 5CO3A 5GAPD 4JBBA 3RBTA 1R5PA 1SKRB 3FW2A 2VL3A 4QQ7A 2DMLA 2IMFA 2CZ3A 1F3BA 4PNFA 2GSRA 1ZYQB 5IO0A 3CSHA 3KZQA 1GSDA 5DJLA 3IHGA 2O85A 4KH7A 2L4QA 1FAAA 1MD4A 3I43A 2R0PA 2F3MA 2C0EA 4MK3A 3FR6A 1V57A 5IPHA 5DCGA 1U3IA 1GNWA 3FR9A 2GT6A 4PUAA 2DMMA 1TRWA 5ECNB 5HFIA 4G10A 3ZZXA 4XIHA 3P90A 5JCGA 4PGTA 5INYA 3APQA 2KLXA 2ZCTA 3IK9A 3DVWA 1PKWA 1GSQA 1ZGNA 2H0HA 2DIZA 1RK4A 3DKSA 5HR1A 2DSAA 5CP1A 1LBKA 4DSSA 4N11A 4I97A 4JU5A 4X4JA 3L9UA 2HZEB 4GXZA 2C0GA 4FYBA 3CRTA 4E8EA 2OADA 3EMPA 4TR3A 4F9ZA 2B1LA 4BA7A 1EP8A 3KP9A 3EC3A 2H6YA 1M9BA 3GKMA 2LJRA 1PL2A 3WGDA 2LKUA 2XBQA 5KN1A 3A2XA 1SD8A 3TRPA 1PSQA 1SYRA 3FYGA 4P3YB 4DSRA 2WZ9A 1GULA 3Q6OA 5ECMB 4TXOA 4XS6A 3F4TA 2HT9A 5IMAA 2BJXA 2VM1A 4XS4A 3WGXA 6GSXA 2C4JA 3GSSA 3IV4A 2P5RA 4G2EA 1A0FA 2NBSA 3TOUA 4K7NA 4OO4A 3I9V2 6GSWA 1E2YA 5JCWA 2NDOA 3I69A 2V32A 4HUAA 4PQIA 3DGQA 4BL7A 1MDIA 1PX6A 2DLXA 2GDRA 1DE1A 2EIQA 2MMNA 1EV4A 3IA1A 2LQOA 1FG4A 2QSIA 1FOVA 3VFIA 22GSA 2JZRA 1AAZA 2CV4A 2DKHA 7GSSA 3BBYA 1XWBA 4BPYA 1I9DA 2QA1A 2M46A 5IMDA 1ZL9A 3DWVA 1WPIA 4KE3A 4DSQA 3H1NA 5IPGA 4TRXA 1SL1B 2EIOA 4GF0A 5G5FA 1B4QA 2VCWA 1ERWA 1ILOA 5B6MA 3GUSA 3C1SA 1YZXA 3L9SA 3UJ1A 4N0VA 4ECIA 4WBRD 3LWAA 4Z2RA 4RUVA 2PMTA 1OC8A 2VL2C 2VL2A 3VWXA 4N0ZA 5AGYA 1E6BA 3DRNA 5C00A 5ELAA 1GNEA 1XWCA 4NMUA 5D8IA 4IJIA 3D6IA 3KCMA 1VF3A 2X49A 5E59A 1MDJA 5ECPB 5ID2B 3DXBA 5D9XA 1J9BA 4J2FA 1SENA 3EPTA 1YKAA 3G9BA 1YY7A 2KHPA 3TKPA 3ERGA 4L0WA 1FVJA 2R0GA 1TRUA 1WIKA 5COHA 5IMFA 3RHCA 3FR3A 2FLSA 1AXDA 2I9HA 2RM6A 3FHKA 1UA5A 1KTEA 2YV7A 3QMXA 4K7OA 1Z6MA 1XXUA 1YF0A 4HSCX 2JADA 5F06A 4GQCA 3APSA 2B6MA 4KF9A 5H5SA 2YWIA 5ECIB 4F0CA 4WBJA 4LA1A 3HVXA 5C04A 1V40A 5GZZB 1XWKA 5D9VA 2OE0A 4MH3A 6GSVA 1DUGA 4MA9A 3TB2A 1Z5YE 1S3CA 2C3TA 3W8JA 3TGZA 2H76A 2PU9C 1TXXA 5G2ZA 1EV9A 4IJ3A 1GUMA 3D4MA 4OFMA 3LXTA 3M8NA 3ZL5A 1O8XA 1SU9A 1XFLA 2I3YA 2XC2A 1Z6NA 1GL8A 1EGRA 2HSYA 3N5OA 4K0GA 4ECJA 2CAQA 3ZVJD 2GT5A 4ZL7A 2FUG2 3FZ5A 2H0GA 1HNCA 3EVIA 5DAKB 4K8MA 1A8YA 3D5JA 4Q5RA 5HR0A 4RQRA 3C7MA 2IMIA 2WRTA 2GQLA 3FZ4A 4XHMA 3KH9A 2WJUA 4OCEA 5LD0A 1M3IA 4ML6A 4L5LA 4NAXA 3QAWA 4EO3A 1R26A 4TOPA 1Y6EA 2VCZA 2UZ8A 4KSMA 5J3RA 2FNOA 1GLQA 3FKFA 5KN2A 2CA8A 3KEBA 2C0DA 3CBUA 2LUSA 5DDLA 2KP1A 1SL2B 4O7HA 1GLPA 1DSBA 3V1WA 3U6VA 5EPFA 3ZREA 3VPTA 4DSSB 2M72A 3M1GA 4IELA 1ZOFA 2RM5A 1ERUA 2N5AA 2I81A 1A23A 5H5QA 3PPUA 1PKZA 3NZNA 4HDEA 1B48A 4PQ1A 2A2PA 3MAKA 2M80A 2MMOA 4ICYA 1G6YA 3HZ4A 3TJFA 4TR4A 1Z7RA 3P8WA 4K0NA 2IJYA 4Q5FA 1THXA 4KDUA 5KOWA 1Q4JA 4FYUA 1GSSA 3N9JA 2VCVA 2KOKA 2R6KA 2YZHA 1W4VA 3M9KA 2HE3A 2GZYA 4XS4B 2K8VA 1MEKA 3ZRDA 1XG8A 5DALA 3TRXA 1F37A 2XPDA 1OAZA 3ZYWA 2GS3A 8GSSA 5CRDA 1J0FA 18GSA 3EU3A 2V1MA 1FO5A 1XWGA 3HHVA 4BL7B 3ISOA 3C1RA 5CREA 4OCFA 2OKAA 3ED3A 1FVKA 1N8JA 3LSZA 1M7TA 4QL7A 1SKSB 4ILFA 1ML6A 1PN9A 5LNKe 1LJRA 3D0ZA 3DMLA 4K2XA 3GV1A 3MYDA 2DJ0A 2LRNA 2X8CA 4KUNA 1FHEA 2V6KA 4TVEA 4MCUA 1PA3A 4JR4A 1X5CA 3UVTA 3Q19A 5CRGA 5CRWA 3TKSE 4OMVA 4BWSA 4FYCA 2HI7A 1S3DA 4HEA2 1ZYNA 4I8BA 2JU5A 4X0XA 1SKWB 1JLVA 4FQUA 5D73A 4RQXA 3FZAA 5A4WA 5D93A 4L8EA 3IOSA 1GWCA 5LCZA 4G0LA 1KBNA 2DC5A 4GSTA 1R4WA 4V2MA 2FY6A 2JACA 3EE2A 2ZUPA 4NHWA 1F9MA 2LV3A 3R2QA 1YDKA 5F07A 2B5YA 3MDKA 1M2BA 4G19A 2HRKA 2H6XA 4HZ2A 3UEMA 3GKXA 3GIXA 1AQXA 4USSA 2GGTA 1IYHA 4HS1A 4KCEA 3F9UA 4YAVA 4L5OA 4N30A 3KP8A 2R37A 3KTBA 4O5QA 3PINA 2LTKA 3GNJA 5DAKA 4KAEA 1JHBA 4IKHA 3HCZA 2PPTA 1ABAA 3GMFA 1HNBA 1GTIA 3GRXA 3I6AA 3LYPA 2A4VA 5ECQB 1TU8A 2R4VA 2HYXA 1ZYEA 4V2LA 2IPAA 13GSA 2CX4A 4ZB8A 3TKQA 4LL4B 9GSSA 2O7KA 1O7UA 4MJAA 5B8BA 1SJIA 3GX0A 5BMUA 3IHQA 3PH9A 1T8EB 4K9ZA 5KEJA 4ZB9A 2HZFA 4QL9A 3GX8A 4G0IA 11GSA 4LLRA 4H86A 4WETA 2YANA 2IN3A 4KX4A 3EMXA 3EU4A 2LEGA 2OBIA 2WGRA 6GSTA 2CX3A 1NHOA 2H1AA 2CVDA 1O8WA 5G1LA 3WYWA 1GTBA 4YKFA 4YKGA 3KH7A 1TK0B 2V41A 1ERTA 1AUCA 2DJKA 3CRUA 4GTUA 4HOJA 2YWMA 3ZFLA 4KSOA 3W6GA 5D9TA 1U88A 2C8UA 1OE8A 3EINA 3SWLA 1WJKA 1W89A 4Z2TA 4FH8A 1OYJA 5GSSA 4HQZA 3VLNA 3PGTA 2K8SA 2WULA 2B5EA 2DJ2A 2VCXA 3BCKA 1SD9A 2VLUA 2IMDA 2VLTA 1G0TA 1YEXA 4JEDA 3ZIJA 5A4VA 1V2AA 2XPEA 4YQUA 3K8NA 2HFDA 2OBKA 3RPNA 3P7XA 3CTFA 3QD9A 3GHAA 4YH2A 1K3OA 2IMEA 2VIMA 1F6MC 1NHYA 3TJBA 17GSA 1TI1A 4V2NA 2H8LA 3QCPA 1WP0A 3WD6A 2YPMA 3TKSA 3TKSC 6GSSA 1EGOA 2VCTA 1KEBA 1EP7A 3BOAA 4ACSA 1SJ6A 5EVOA 3IBHA 3L4NA 4IVFA 5DALB 1TI3A 1JZWA 1EWXA 1K0AA 1S3AA 3IPZA 2D2ZA 2NTOA 3UL3A 5IQYA 5F05A 3FK8A 2FWFA 4EDZA 4AJ6A 4GWRA 5HFGA 10GSA 4POMA 3D21A 5IMCA 4Q5NA 1K0DA 4MF6A 3TJJA 1XVQA 3KJYA 1PRXA 4PUFC 3M3MA 1VGLA 1X9WB 2FD3A 4GSSA 3KXOA 5CYYA 4ZL9A 1K0OA 4OWYA 4KGIA 2GVPA 4Z2UA 2X8GA 2HSHA 3H4KA 3L78A 1I5GA 4WXTA 1FW1A 1V98A 3UBKA 1AQVA 1NM3A 4ZB6A 2OE1A 2C1YA 2O8VB 3A2WA 2RUEA 1B8XA 4F2IA 2PUKC 1IYIA 3VURA 5KN0A 4KDYA 3DD3A 1XWAA 3QFBC 4F03A 4OFTA 4ID0A 3BCIA 3F8UA 1ST9A 1YJ6A 3G7IA 2H74A 4BIKA 3HDCA 4IHUA 4MPFA 5IMZA 1EZKA 2LSTA 5J9CA 1QUWA 3ZITA 1AC1A 1OKDA 1GTAA 2DBCA 3UARA 3ME8A 5B6NA 5ECOB 5IIZA 1TU7A 5HR2A 4XRDA 4O5RA 2P31A 2X8HA 4NV2A 4ISDA 2H73A 5AN1A 2GQKA 3FEUA 3IE3A 5GAND 1KNGA 4MH2A 1F2EA 3R3EA 3FMWA 4PNGA 2L6DA 2H75A 4KB3A 1F3AA 4K2DA 2YJ7A 2JZSA 2YWNA 1THOA 1HD2A 4KA0A 2VM2A 2L59A 1VF2A 1TP9A 3WGEA 3P2AA 1GH2A 3Q74A 4MZCA 2LJKA 4Z7XA 1VRSD 4PQHA 3JCML 1BJXA 2OACA 2R2JA 4WF4A 4E8HA 2P5QA 3GL5A 4MMMA 2K18A 2FCHA 3QDNA 3LFLA 1G7EA 1Z9HA 1V58A 2R0CA 1GUKA 1O6JA 1TRSA 5B8AA 1WWJA 4MPGA 5DCHA 3DVXA 4HJMA 1FB0A 2QA2A
chains in the Genus database with same CATH topology
1M2DA 5ECSA 1BYEA 2L4CA 4ZBBA 1FB6A 1RQMA 4MABA 4XRAA 5IMVA 2DJ3A 1GSFA 2RUFA 5AISA 3ZTLA 1TTZA 3WT2A 1EEJA 4DVCA 4OFNA 2WCIA 3UAPA 3LGCA 1TOFA 2EC4A 3IC8A 2MMAA 2OJLA 2YV9A 2H1BA 4ZXGA 4YQVA 3L9VA 2TRXA 2JSZA 1WMJA 1XW9A 4HQSA 3GYKA 3HVSA 4POLA 3RHBA 2KUCA 2YOIA 4JR6A 4LMWA 4IN0A 4CW9A 2OA7A 1T1VA 4XCSA 4PURA 5FWGA 1FOHA 5DJMA 2AJQB 4TXVA 1GSYA 2AYTA 1GTUA 3MWHA 3IRAA 1USBA 2H0IA 1T4ZA 3M9JA 3LYKA 1SK2A 2Z9SA 1ZCPA 3GKNA 4MLYA 1QQ2A 3QPMA 2H1DA 1X9MB 1K0CA 2ZNMA 5DVBA 4O5UA 1Y25A 5DQYA 4ZL8A 5L71A 2VL9A 3HYPA 4FIWA 1O73A 2IMKA 1A8LA 2H01A 3QAGA 3BJ5A 2LQQA 1XVWA 4MJEA 3FZ9A 1SJZA 1PQNA 5D96A 3O6TA 3HJOA 1DBYA 2FA4A 2H19A 2L6CA 2YJHA 2XBIA 3QAVA 1RW1A 4MZBA 1TW9A 1BG5A 5KOXA 1VF4A 1WE0A 3F6DA 4ZIJA 3ZMKA 4MF5A 3VWVA 3ZFBA 1CQHA 1Q98A 2YP6A 2WFCA 4K1FA 1QFNA 4I2UA 3O76A 3F4SA 1QK8A 4HI7A 1ON4A 4KCAA 1O81A 2LRCA 4X43A 3Q18A 2AAWA 2IFQB 2XHFA 3C8EA 4Q5QA 4NXIA 3C73A 2E2MA 2GZPA 2DIYA 4CY6A 2F8FA 1XCCA 1K0MA 4A5PA 5J5NA 1T7PB 2H66A 2AHEA 2YWOA 1SYXA 3GH6A 1OC3A 1X0RA 1YEPA 1A2MA 2F8AA 3W8SA 4V1Ap 2H30A 2H70A 1B9YC 1MTCA 2IL3A 4IS0A 3TCOA 2WS2A 3TRQA 5E4WA 3VPQA 3KMNA 4TR1A 4PXOA 4AJ7A 4MJCA 1TJDA 1QXHA 2HLSA 2FWHA 2ALBA 3FY7A 2QGVA 4GRFA 3VWWA 3DIEA 1PN0A 5DBQA 4J57E 2PERA 2NPBA 3NIVA 3ME7A 1H75A 1OE7A 4IW9A 1MDKA 3SBCA 2B7KA 1AIUA 1U87A 3RPPA 3LXZA 3QFAC 2MBSA 2BTOT 2ES7A 1JZDA 3F6FA 5FHIA 1SK1A 3CSJA 4MP4A 2F9SA 3IK7A 3F4RA 2O89A 4TN8A 2VD1A 5IO2A 1WOUA 3UOMA 2QC7A 5ABRA 4KNDA 2H72A 2I4AA 3HVVA 5ECHB 4IBPA 4IQAA 3G7YA 2MYGA 2K6VA 2VUPA 2C3NA 1M9AA 1EOHA 4EXJA 1AW9A 1R5AA 2PWJA 4HJ2A 5HR3A 3RAZA 3F3QA 3F0IA 3RDWA 5CAXA 3VWUA 2L57A 3GTUA 14GSA 1ZYPA 2N5FA 3APOA 4NV5A 3L0HA 3HJPA 3TUEA 4K5RA 3EYTA 3H93A 1XPVA 5GSTA 1HYUA 1YF1A 2HXKA 2K9FA 4LMVA 1XIYA 3G7JA 5G30A 2MZCA 4MDCA 3HY2A 1A2JA 3UVHA 2I1UA 2X64A 6GSYA 3DEXA 1YQ1A 2JL4A 5CRHA 4I5QA 4GQFA 1HQOA 1TKDB 1XW5A 5IOXA 5ECLB 2GSTA 5D9WA 2G2QA 2TIRA 2F51A 2CAIA 1K0NA 1X5DA 1T4YA 2YZUA 4ULXA 2V6OA 4F0BA 2CVKA 3US3A 1A0RP 3A3TA 2GQMA 3KTLA 3IC4A 2HSMA 4D73B 1NSWA 4HU9A 3ZIVA 2DJJA 2LNSA 4JRRA 4IQ1A 3F63A 3IDVA 1Z7PA 1OC9B 4NHZA 3LEFA 2HNLA 4FO5A 2CQ9A 1QGVA 4EKZA 3QR6A 5H5RA 1TK5B 2FWGA 3KM6A 1M0UA 2B3SA 4K5SA 3E9JB 1X9SB 3H8QA 2VO4A 1BQ7A 3LW9A 4CDOA 3LG6A 4IP1A 3HXSA 4EDYA 3KIJA 2A2RA 3F3RA 1LU4A 3ZLPA 2DKIA 1HNAA 3DYRA 3HZ8A 4WEYA 3UMAA 3TDGA 5A4UA 3FRCA 2GSSA 3C71A 1G7OA 4G0KA 1JLWA 2CZ2A 4TR0A 5G5EA 4ZILA 1ERVA 2FWEA 2HRNA 4J56E 2IFQA 1MD3A 2YN1A 4GLTA 1ACVA 4RI7A 2V2GA 4POKA 1AQWA 1WRYA 4YQMA 2GLRA 4WR4A 1BAYA 2NVLA 5ENUA 4ZBDA 2PN8A 5J4UA 2PGTA 3VK9A 1M99A 3ERFA 4BVYA 1U6TA 2HRAA 4BVXB 5IOWA 3IAM2 1GUHA 5HFKA 4EF0A 1H4OA 2C0FA 3D4TA 4AGSA 1TDIA 4NWYA 4PX1A 2H1GA 5DQSA 1BX9A 1PX7A 2E7PA 3KD0A 5ECKB 3E0UA 3IR4A 3HA9A 5AIXA 1URMA 3CTGA 3H79A 3BD2A 2AB6A 2PBJA 4DEJA 4BWQA 3ZMLA 3CYNA 1G6WA 1PGTA 4NPBA 4KDXA 3HD5A 3O3TA 2G0FA 3HKRA 2C3QA 2JSYA 1T00A 5J41A 2WB9A 1XBSA 1XOAA 2L5OA 1OKTA 1K3LA 3KMOA 2YCDA 4I6XA 2IWTA 1J08A 4ZBAA 1B4PA 1QMVA 3MNGA 4MNNA 4XTSA 1UC7A 2B7JA 2HRFA 3GURA 1XW6A 4TKYA 2PVQA 5FT3A 4EE0A 4LL1B 3GSTA 5F8BA 2PVOC 2FGXA 4PTSA 4EIQA 2VOCA 2P0GA 4TR1B 4YAPA 2YNXA 1JZRA 4EVMA 5JWRB 2IIYA 3IXRA 1TK8B 5IM9A 2B5XA 2LRTA 1O85A 1XOBA 2MBTA 4F82A 5JCUA 3TJGA 5ELGA 2LNTA 1K0BA 2HZEA 1GP1A 1ZMAA 4EL1A 4K6XA 3GL3A 3GN3A 3TJKA 4EIPA 3MIXA 1X5EA 4JE1A 4POBA 4X1UA 1GSEA 2DJ1A 2JZTA 2TRCP 3CSIA 3IAS2 5AIVA 1M2AA 4OD7A 4IP6A 3VI5A 3E3EA 3M0FA 2CVBA 4MZWA 5ECRB 1SL0B 2X99A 3U5RE 2L5LA 16GSA 4D73A 2A4HA 4ECCA 3GFKA 5J9BA 2X4AA 5EL8A 1YKCA 4XS1A 1OC9A 2REMA 4L0UA 1BEDA 1U3AA 4CY8A 3TKRA 2GZZA 1GRXA 2E0QA 3GTUB 2J23A 3GA4A 1SK0A 3VI7A 2J9HA 2OE3A 3KGKA 2O87A 2E2GA 2VCQA 3TOTA 4N10A 3S9FA 12GSA 1T3BA 4WR5A 1A24A 4O32A 2FA8A 1NW2A 3A2VA 3EWLA 3LORA 4O92A 2R5GA 3J7Yb 3PR8A 4WKWA 5CNWA 2H71A 4HU7A 1PMTA 3GKKA 1JZOA 4AJ8A 5A5KA 4AF2A 2N5BA 2A2SA 2VAFA 3J7Yk 5JWQB 5EY6A 5BRTA 3OR5A 4TXOB 3CMIA 4I2TA 6GSUA 2CT6A 2RIIA 1GSUA 4OO5A 2ON5A 1UVZA 2RLIA 3GH9A 2LJAA 3LQ7A 4CHSA 2VLVA 5F0GA 4JZQA 3A5WA 4HZ4A 1XZOA 4IGJA 3ERWA 5B7CA 5ID2A 4BVXA 3WT1A 1OVNA 1TRVA 2GSQA 4V1Ag 3D22A 1V9WA 3EURA 4G9HA 5G1KA 1ZZYA 2VD0A 1DE2A 4ECBA 5G31A 2GTUA 2AUVA 4MF7A 3LJRA 1N2AA 2ON7A 1B9XC 2LS5A 3CXGA 19GSA 3HJMA 1PD21 4GSNA 5KN3A 1PL1A 2EIRA 5HQPA 2AV4A 2MMZA 1Z3EA 2C80A 1C72A 2KP2A 3A5IA 4MJBA 4KW6A 2R3XA 4EUYA 2B1KA 4GCIA 3ZVJA 3AY8A 2BMXA 1UN2A 4EC0A 4TW5A 4ML1A 3QOUA 2H6ZA 20GSA 4BVYB 2QKEA 2FHEA 1JFUA 3NOFA 4RI6A 4WF5A 1R7HA 3MSZA 1A2LA 3UBLA 1EEMA 1CQGA 3UIWA 1K3YA 1EOGA 5JWOB 4K7IA 1VF1A 2WDUA 5CO3A 5GAPD 4JBBA 3RBTA 1R5PA 1SKRB 3FW2A 2VL3A 4QQ7A 2DMLA 2IMFA 2CZ3A 1F3BA 4PNFA 2GSRA 1ZYQB 5IO0A 3CSHA 3KZQA 1GSDA 5DJLA 3IHGA 2O85A 4KH7A 2L4QA 1FAAA 1MD4A 3I43A 2R0PA 2F3MA 2C0EA 4MK3A 3FR6A 1V57A 5IPHA 5DCGA 1U3IA 1GNWA 3FR9A 2GT6A 4PUAA 2DMMA 1TRWA 5ECNB 5HFIA 4G10A 3ZZXA 4XIHA 3P90A 5JCGA 4PGTA 5INYA 3APQA 2KLXA 2ZCTA 3IK9A 3DVWA 1PKWA 1GSQA 1ZGNA 2H0HA 2DIZA 1RK4A 3DKSA 5HR1A 2DSAA 5CP1A 1LBKA 4DSSA 4N11A 4I97A 4JU5A 4X4JA 3L9UA 2HZEB 4GXZA 2C0GA 4FYBA 3CRTA 4E8EA 2OADA 3EMPA 4TR3A 4F9ZA 2B1LA 4BA7A 1EP8A 3KP9A 3EC3A 2H6YA 1M9BA 3GKMA 2LJRA 1PL2A 3WGDA 2LKUA 2XBQA 5KN1A 3A2XA 1SD8A 3TRPA 1PSQA 1SYRA 3FYGA 4P3YB 4DSRA 2WZ9A 1GULA 3Q6OA 5ECMB 4TXOA 4XS6A 3F4TA 2HT9A 5IMAA 2BJXA 2VM1A 4XS4A 3WGXA 6GSXA 2C4JA 3GSSA 3IV4A 2P5RA 4G2EA 1A0FA 2NBSA 3TOUA 4K7NA 4OO4A 3I9V2 6GSWA 1E2YA 5JCWA 2NDOA 3I69A 2V32A 4HUAA 4PQIA 3DGQA 4BL7A 1MDIA 1PX6A 2DLXA 2GDRA 1DE1A 2EIQA 2MMNA 1EV4A 3IA1A 2LQOA 1FG4A 2QSIA 1FOVA 3VFIA 22GSA 2JZRA 1AAZA 2CV4A 2DKHA 7GSSA 3BBYA 1XWBA 4BPYA 1I9DA 2QA1A 2M46A 5IMDA 1ZL9A 3DWVA 1WPIA 4KE3A 4DSQA 3H1NA 5IPGA 4TRXA 1SL1B 2EIOA 4GF0A 5G5FA 1B4QA 2VCWA 1ERWA 1ILOA 5B6MA 3GUSA 3C1SA 1YZXA 3L9SA 3UJ1A 4N0VA 4ECIA 4WBRD 3LWAA 4Z2RA 4RUVA 2PMTA 1OC8A 2VL2C 2VL2A 3VWXA 4N0ZA 5AGYA 1E6BA 3DRNA 5C00A 5ELAA 1GNEA 1XWCA 4NMUA 5D8IA 4IJIA 3D6IA 3KCMA 1VF3A 2X49A 5E59A 1MDJA 5ECPB 5ID2B 3DXBA 5D9XA 1J9BA 4J2FA 1SENA 3EPTA 1YKAA 3G9BA 1YY7A 2KHPA 3TKPA 3ERGA 4L0WA 1FVJA 2R0GA 1TRUA 1WIKA 5COHA 5IMFA 3RHCA 3FR3A 2FLSA 1AXDA 2I9HA 2RM6A 3FHKA 1UA5A 1KTEA 2YV7A 3QMXA 4K7OA 1Z6MA 1XXUA 1YF0A 2JADA 5F06A 4GQCA 3APSA 2B6MA 4KF9A 5H5SA 2YWIA 5ECIB 4F0CA 4WBJA 4LA1A 3HVXA 5C04A 1V40A 5GZZB 1XWKA 5D9VA 2OE0A 4MH3A 6GSVA 1DUGA 4MA9A 3TB2A 1Z5YE 1S3CA 2C3TA 3W8JA 3TGZA 2H76A 2PU9C 1TXXA 5G2ZA 1EV9A 4IJ3A 1GUMA 3D4MA 4OFMA 3LXTA 3M8NA 3ZL5A 1O8XA 1SU9A 1XFLA 2I3YA 2XC2A 1Z6NA 1GL8A 1EGRA 2HSYA 3N5OA 4K0GA 4ECJA 2CAQA 3ZVJD 2GT5A 4ZL7A 2FUG2 3FZ5A 2H0GA 1HNCA 3EVIA 5DAKB 4K8MA 1A8YA 3D5JA 4Q5RA 5HR0A 4RQRA 3C7MA 2IMIA 2WRTA 2GQLA 3FZ4A 4XHMA 3KH9A 2WJUA 4OCEA 5LD0A 4ML6A 4L5LA 4NAXA 3QAWA 4EO3A 1R26A 4TOPA 1Y6EA 2VCZA 2UZ8A 4KSMA 5J3RA 2FNOA 1GLQA 3FKFA 5KN2A 2CA8A 3KEBA 2C0DA 3CBUA 2LUSA 5DDLA 2KP1A 1SL2B 4O7HA 1GLPA 1DSBA 3V1WA 3U6VA 5EPFA 3ZREA 3VPTA 4DSSB 2M72A 3M1GA 4IELA 1ZOFA 2RM5A 1ERUA 2N5AA 2I81A 1A23A 5H5QA 3PPUA 1PKZA 3NZNA 4HDEA 1B48A 4PQ1A 2A2PA 3MAKA 2M80A 2MMOA 4ICYA 1G6YA 3HZ4A 3TJFA 4TR4A 1Z7RA 3P8WA 4K0NA 2IJYA 4Q5FA 1THXA 4KDUA 5KOWA 1Q4JA 4FYUA 1GSSA 3N9JA 2VCVA 2KOKA 2R6KA 2YZHA 1W4VA 3M9KA 2HE3A 2GZYA 4XS4B 2K8VA 1MEKA 3ZRDA 5DALA 3TRXA 1F37A 2XPDA 1OAZA 3ZYWA 2GS3A 8GSSA 5CRDA 1J0FA 18GSA 3EU3A 2V1MA 1FO5A 1XWGA 3HHVA 4BL7B 3ISOA 3C1RA 5CREA 4OCFA 2OKAA 3ED3A 1FVKA 1N8JA 3LSZA 1M7TA 4QL7A 1SKSB 4ILFA 1ML6A 1PN9A 5LNKe 1LJRA 3D0ZA 3DMLA 4K2XA 3GV1A 3MYDA 2DJ0A 2LRNA 2X8CA 4KUNA 1FHEA 2V6KA 4TVEA 4MCUA 1PA3A 4JR4A 1X5CA 3UVTA 3Q19A 5CRGA 5CRWA 3TKSE 4OMVA 4BWSA 4FYCA 2HI7A 1S3DA 4HEA2 1ZYNA 4I8BA 2JU5A 4X0XA 1SKWB 1JLVA 4FQUA 5D73A 4RQXA 3FZAA 5A4WA 5D93A 4L8EA 3IOSA 1GWCA 5LCZA 4G0LA 1KBNA 2DC5A 4GSTA 1R4WA 4V2MA 2FY6A 2JACA 3EE2A 2ZUPA 4NHWA 1F9MA 2LV3A 3R2QA 1YDKA 5F07A 2B5YA 3MDKA 1M2BA 4G19A 2HRKA 2H6XA 4HZ2A 3UEMA 3GKXA 3GIXA 1AQXA 4USSA 2GGTA 1IYHA 4HS1A 4KCEA 3F9UA 4YAVA 4L5OA 4N30A 3KP8A 2R37A 3KTBA 4O5QA 3PINA 2LTKA 3GNJA 5DAKA 4KAEA 1JHBA 4IKHA 3HCZA 2PPTA 1ABAA 3GMFA 1HNBA 1GTIA 3GRXA 3I6AA 3LYPA 2A4VA 5ECQB 1TU8A 2R4VA 2HYXA 1ZYEA 4V2LA 2IPAA 13GSA 2CX4A 4ZB8A 3TKQA 4LL4B 9GSSA 2O7KA 1O7UA 4MJAA 5B8BA 1SJIA 3GX0A 5BMUA 3IHQA 3PH9A 1T8EB 4K9ZA 5KEJA 4ZB9A 2HZFA 4QL9A 3GX8A 4G0IA 11GSA 4LLRA 4H86A 4WETA 2YANA 2IN3A 4KX4A 3EMXA 3EU4A 2LEGA 2OBIA 2WGRA 6GSTA 2CX3A 1NHOA 2H1AA 2CVDA 1O8WA 5G1LA 3WYWA 1GTBA 4YKFA 4YKGA 3KH7A 1TK0B 2V41A 1ERTA 1AUCA 2DJKA 3CRUA 4GTUA 4HOJA 2YWMA 3ZFLA 4KSOA 3W6GA 5D9TA 1U88A 2C8UA 1OE8A 3EINA 3SWLA 1WJKA 1W89A 4Z2TA 4FH8A 1OYJA 5GSSA 4HQZA 3VLNA 3PGTA 2K8SA 2WULA 2B5EA 2DJ2A 2VCXA 3BCKA 1SD9A 2VLUA 2IMDA 2VLTA 1G0TA 1YEXA 4JEDA 3ZIJA 5A4VA 1V2AA 2XPEA 4YQUA 3K8NA 2HFDA 2OBKA 3RPNA 3P7XA 3CTFA 3QD9A 3GHAA 4YH2A 1K3OA 2IMEA 2VIMA 1F6MC 1NHYA 3TJBA 17GSA 1TI1A 4V2NA 2H8LA 3QCPA 1WP0A 3WD6A 2YPMA 3TKSA 3TKSC 6GSSA 1EGOA 2VCTA 1KEBA 1EP7A 3BOAA 4ACSA 1SJ6A 5EVOA 3IBHA 3L4NA 4IVFA 5DALB 1TI3A 1JZWA 1EWXA 1K0AA 1S3AA 3IPZA 2D2ZA 2NTOA 3UL3A 5IQYA 5F05A 3FK8A 2FWFA 4EDZA 4AJ6A 4GWRA 5HFGA 10GSA 4POMA 3D21A 5IMCA 4Q5NA 1K0DA 4MF6A 3TJJA 1XVQA 3KJYA 1PRXA 4PUFC 3M3MA 1VGLA 1X9WB 2FD3A 4GSSA 3KXOA 5CYYA 4ZL9A 1K0OA 4OWYA 4KGIA 2GVPA 4Z2UA 2X8GA 2HSHA 3H4KA 3L78A 1I5GA 4WXTA 1FW1A 1V98A 3UBKA 1AQVA 1NM3A 4ZB6A 2OE1A 2C1YA 2O8VB 3A2WA 2RUEA 1B8XA 4F2IA 2PUKC 1IYIA 3VURA 5KN0A 4KDYA 3DD3A 1XWAA 3QFBC 4F03A 4OFTA 4ID0A 3BCIA 3F8UA 1ST9A 1YJ6A 3G7IA 2H74A 3HDCA 4IHUA 4MPFA 5IMZA 1EZKA 2LSTA 5J9CA 1QUWA 3ZITA 1AC1A 1OKDA 1GTAA 2DBCA 3UARA 3ME8A 5B6NA 5ECOB 5IIZA 1TU7A 5HR2A 4XRDA 4O5RA 2P31A 2X8HA 4NV2A 4ISDA 2H73A 5AN1A 2GQKA 3FEUA 3IE3A 5GAND 1KNGA 4MH2A 1F2EA 3R3EA 3FMWA 4PNGA 2L6DA 2H75A 4KB3A 1F3AA 4K2DA 2YJ7A 2JZSA 2YWNA 1THOA 1HD2A 4KA0A 2VM2A 2L59A 1VF2A 1TP9A 3WGEA 3P2AA 1GH2A 3Q74A 4MZCA 2LJKA 4Z7XA 1VRSD 4PQHA 3JCML 1BJXA 2OACA 2R2JA 4WF4A 4E8HA 2P5QA 3GL5A 4MMMA 2K18A 2FCHA 3QDNA 3LFLA 1G7EA 1Z9HA 1V58A 2R0CA 1GUKA 1O6JA 1TRSA 5B8AA 1WWJA 4MPGA 5DCHA 3DVXA 4HJMA 1FB0A 2QA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M2D A;  5ECS A;  1BYE A;  2L4C A;  4ZBB A;  1FB6 A;  1RQM A;  4MAB A;  4XRA A;  5IMV A;  2DJ3 A;  1GSF A;  2RUF A;  5AIS A;  3ZTL A;  1TTZ A;  3WT2 A;  1EEJ A;  4DVC A;  4OFN A;  2WCI A;  3UAP A;  3LGC A;  1TOF A;  2EC4 A;  2MMA A;  2OJL A;  2YV9 A;  2H1B A;  4ZXG A;  4YQV A;  3L9V A;  2TRX A;  2JSZ A;  1WMJ A;  1XW9 A;  4HQS A;  3GYK A;  3HVS A;  4POL A;  3RHB A;  2KUC A;  2YOI A;  4JR6 A;  4LMW A;  4IN0 A;  4CW9 A;  2OA7 A;  1T1V A;  4XCS A;  4PUR A;  5FWG A;  5DJM A;  2AJQ B;  4TXV A;  1GSY A;  2AYT A;  1GTU A;  3MWH A;  3IRA A;  1USB A;  2H0I A;  1T4Z A;  3M9J A;  3LYK A;  1SK2 A;  2Z9S A;  1ZCP A;  3GKN A;  4MLY A;  1QQ2 A;  3QPM A;  2H1D A;  1X9M B;  1K0C A;  2ZNM A;  5DVB A;  1Y25 A;  5DQY A;  4ZL8 A;  5L71 A;  2VL9 A;  3HYP A;  4FIW A;  1O73 A;  2IMK A;  1A8L A;  2H01 A;  3QAG A;  3BJ5 A;  2LQQ A;  1XVW A;  4MJE A;  3FZ9 A;  1SJZ A;  1PQN A;  5D96 A;  3O6T A;  3HJO A;  1DBY A;  2FA4 A;  2H19 A;  2L6C A;  2YJH A;  2XBI A;  3QAV A;  1RW1 A;  4MZB A;  1TW9 A;  1BG5 A;  1VF4 A;  1WE0 A;  3F6D A;  4ZIJ A;  3ZMK A;  4MF5 A;  3VWV A;  3ZFB A;  1CQH A;  1Q98 A;  2YP6 A;  2WFC A;  4K1F A;  1QFN A;  4I2U A;  3O76 A;  3F4S A;  1QK8 A;  4HI7 A;  1ON4 A;  4KCA A;  1O81 A;  2LRC A;  4X43 A;  3Q18 A;  2AAW A;  2IFQ B;  2XHF A;  3C8E A;  4Q5Q A;  4NXI A;  3C73 A;  2E2M A;  2GZP A;  2DIY A;  2F8F A;  1XCC A;  1K0M A;  5J5N A;  1T7P B;  2H66 A;  2AHE A;  2YWO A;  1SYX A;  3GH6 A;  1OC3 A;  1X0R A;  1YEP A;  1A2M A;  2F8A A;  3W8S A;  4V1A p;  2H30 A;  2H70 A;  1B9Y C;  1MTC A;  2IL3 A;  4IS0 A;  3TCO A;  2WS2 A;  3TRQ A;  5E4W A;  3VPQ A;  3KMN A;  4TR1 A;  4PXO A;  4AJ7 A;  4MJC A;  1TJD A;  1QXH A;  2HLS A;  2FWH A;  2ALB A;  3FY7 A;  2QGV A;  4GRF A;  3VWW A;  3DIE A;  5DBQ A;  4J57 E;  2PER A;  2NPB A;  3NIV A;  3ME7 A;  1H75 A;  1OE7 A;  4IW9 A;  1MDK A;  3SBC A;  2B7K A;  1AIU A;  1U87 A;  3RPP A;  3LXZ A;  3QFA C;  2MBS A;  2BTO T;  2ES7 A;  1JZD A;  3F6F A;  5FHI A;  1SK1 A;  3CSJ A;  4MP4 A;  2F9S A;  3IK7 A;  3F4R A;  2O89 A;  4TN8 A;  2VD1 A;  5IO2 A;  1WOU A;  3UOM A;  2QC7 A;  5ABR A;  4KND A;  2H72 A;  2I4A A;  3HVV A;  5ECH B;  4IBP A;  4IQA A;  3G7Y A;  2MYG A;  2K6V A;  2VUP A;  2C3N A;  1M9A A;  1EOH A;  4EXJ A;  1AW9 A;  1R5A A;  2PWJ A;  4HJ2 A;  5HR3 A;  3RAZ A;  3F3Q A;  3F0I A;  3RDW A;  5CAX A;  3VWU A;  2L57 A;  3GTU A;  14GS A;  2N5F A;  3APO A;  4NV5 A;  3L0H A;  3HJP A;  3TUE A;  3EYT A;  3H93 A;  1XPV A;  5GST A;  1HYU A;  1YF1 A;  2HXK A;  2K9F A;  4LMV A;  1XIY A;  3G7J A;  5G30 A;  2MZC A;  4MDC A;  3HY2 A;  1A2J A;  3UVH A;  2I1U A;  2X64 A;  6GSY A;  3DEX A;  1YQ1 A;  2JL4 A;  5CRH A;  4I5Q A;  4GQF A;  1HQO A;  1TKD B;  1XW5 A;  5IOX A;  5ECL B;  2GST A;  5D9W A;  2G2Q A;  2TIR A;  2F51 A;  2CAI A;  1K0N A;  1X5D A;  1T4Y A;  2YZU A;  4ULX A;  2V6O A;  4F0B A;  2CVK A;  3US3 A;  1A0R P;  3A3T A;  2GQM A;  3KTL A;  3IC4 A;  4D73 B;  1NSW A;  4HU9 A;  3ZIV A;  2DJJ A;  2LNS A;  4JRR A;  4IQ1 A;  3F63 A;  3IDV A;  1Z7P A;  1OC9 B;  4NHZ A;  3LEF A;  2HNL A;  4FO5 A;  2CQ9 A;  1QGV A;  4EKZ A;  3QR6 A;  5H5R A;  1TK5 B;  2FWG A;  3KM6 A;  1M0U A;  2B3S A;  3E9J B;  1X9S B;  3H8Q A;  2VO4 A;  1BQ7 A;  4CDO A;  3LG6 A;  4IP1 A;  3HXS A;  4EDY A;  3KIJ A;  2A2R A;  3F3R A;  1LU4 A;  3ZLP A;  1HNA A;  3DYR A;  3HZ8 A;  4WEY A;  3UMA A;  3TDG A;  5A4U A;  3FRC A;  2GSS A;  3C71 A;  1G7O A;  1JLW A;  2CZ2 A;  4TR0 A;  5G5E A;  4ZIL A;  1ERV A;  2FWE A;  2HRN A;  4J56 E;  2IFQ A;  1MD3 A;  2YN1 A;  4GLT A;  1ACV A;  4RI7 A;  2V2G A;  4POK A;  1AQW A;  1WRY A;  4YQM A;  2GLR A;  4WR4 A;  1BAY A;  2NVL A;  5ENU A;  4ZBD A;  2PN8 A;  5J4U A;  2PGT A;  3VK9 A;  1M99 A;  3ERF A;  4BVY A;  1U6T A;  5IOW A;  3IAM 2;  1GUH A;  5HFK A;  4EF0 A;  1H4O A;  2C0F A;  3D4T A;  4AGS A;  1TDI A;  4NWY A;  4PX1 A;  2H1G A;  5DQS A;  1BX9 A;  1PX7 A;  2E7P A;  3KD0 A;  5ECK B;  3E0U A;  3IR4 A;  3HA9 A;  5AIX A;  1URM A;  3CTG A;  3H79 A;  3BD2 A;  2AB6 A;  2PBJ A;  4DEJ A;  4BWQ A;  3ZML A;  3CYN A;  1G6W A;  1PGT A;  4NPB A;  4KDX A;  3HD5 A;  3O3T A;  2G0F A;  3HKR A;  2C3Q A;  2JSY A;  1T00 A;  5J41 A;  2WB9 A;  1XBS A;  1XOA A;  2L5O A;  1OKT A;  1K3L A;  3KMO A;  2YCD A;  4I6X A;  2IWT A;  1J08 A;  4ZBA A;  1B4P A;  1QMV A;  3MNG A;  4XTS A;  1UC7 A;  2B7J A;  2HRF A;  3GUR A;  1XW6 A;  4TKY A;  2PVQ A;  5FT3 A;  4EE0 A;  4LL1 B;  3GST A;  5F8B A;  2PVO C;  2FGX A;  2VOC A;  2P0G A;  4TR1 B;  4YAP A;  2YNX A;  1JZR A;  4EVM A;  5JWR B;  2IIY A;  3IXR A;  1TK8 B;  5IM9 A;  2B5X A;  2LRT A;  1O85 A;  1XOB A;  2MBT A;  4F82 A;  5JCU A;  3TJG A;  5ELG A;  2LNT A;  1K0B A;  2HZE A;  1GP1 A;  1ZMA A;  4EL1 A;  4K6X A;  3GL3 A;  3GN3 A;  3TJK A;  1X5E A;  4JE1 A;  4POB A;  4X1U A;  1GSE A;  2DJ1 A;  2JZT A;  2TRC P;  3CSI A;  3IAS 2;  5AIV A;  1M2A A;  4OD7 A;  4IP6 A;  3VI5 A;  3E3E A;  3M0F A;  2CVB A;  4MZW A;  5ECR B;  1SL0 B;  2X99 A;  3U5R E;  2L5L A;  16GS A;  4D73 A;  4ECC A;  3GFK A;  5J9B A;  5EL8 A;  1YKC A;  4XS1 A;  1OC9 A;  2REM A;  4L0U A;  1BED A;  1U3A A;  3TKR A;  2GZZ A;  1GRX A;  2E0Q A;  3GTU B;  2J23 A;  3GA4 A;  1SK0 A;  3VI7 A;  2J9H A;  2OE3 A;  3KGK A;  2O87 A;  2E2G A;  2VCQ A;  3TOT A;  4N10 A;  3S9F A;  12GS A;  1T3B A;  4WR5 A;  1A24 A;  4O32 A;  2FA8 A;  1NW2 A;  3A2V A;  3EWL A;  3LOR A;  4O92 A;  2R5G A;  3J7Y b;  3PR8 A;  4WKW A;  5CNW A;  2H71 A;  4HU7 A;  1PMT A;  3GKK A;  1JZO A;  5A5K A;  4AF2 A;  2N5B A;  2A2S A;  2VAF A;  3J7Y k;  5JWQ B;  5EY6 A;  3OR5 A;  4TXO B;  3CMI A;  4I2T A;  6GSU A;  2CT6 A;  2RII A;  1GSU A;  4OO5 A;  2ON5 A;  1UVZ A;  2RLI A;  3GH9 A;  2LJA A;  3LQ7 A;  4CHS A;  2VLV A;  5F0G A;  4JZQ A;  3A5W A;  4HZ4 A;  1XZO A;  4IGJ A;  3ERW A;  5B7C A;  5ID2 A;  4BVX A;  3WT1 A;  1OVN A;  1TRV A;  2GSQ A;  4V1A g;  3D22 A;  1V9W A;  3EUR A;  4G9H A;  5G1K A;  1ZZY A;  2VD0 A;  1DE2 A;  4ECB A;  5G31 A;  2GTU A;  2AUV A;  4MF7 A;  3LJR A;  1N2A A;  2ON7 A;  1B9X C;  2LS5 A;  3CXG A;  19GS A;  3HJM A;  1PD2 1;  4GSN A;  5KN3 A;  1PL1 A;  2EIR A;  5HQP A;  2AV4 A;  2MMZ A;  1Z3E A;  2C80 A;  1C72 A;  2KP2 A;  4MJB A;  4KW6 A;  2R3X A;  4EUY A;  2B1K A;  4GCI A;  3ZVJ A;  3AY8 A;  2BMX A;  1UN2 A;  4EC0 A;  4TW5 A;  4ML1 A;  3QOU A;  2H6Z A;  20GS A;  2QKE A;  2FHE A;  1JFU A;  3NOF A;  4RI6 A;  4WF5 A;  1R7H A;  3MSZ A;  1A2L A;  3UBL A;  1EEM A;  1CQG A;  3UIW A;  1K3Y A;  1EOG A;  5JWO B;  4K7I A;  1VF1 A;  2WDU A;  5CO3 A;  5GAP D;  4JBB A;  3RBT A;  1R5P A;  1SKR B;  3FW2 A;  2VL3 A;  4QQ7 A;  2DML A;  2IMF A;  2CZ3 A;  1F3B A;  4PNF A;  2GSR A;  1ZYQ B;  5IO0 A;  3CSH A;  3KZQ A;  1GSD A;  5DJL A;  2O85 A;  4KH7 A;  2L4Q A;  1FAA A;  1MD4 A;  3I43 A;  2F3M A;  2C0E A;  4MK3 A;  3FR6 A;  1V57 A;  5IPH A;  5DCG A;  1U3I A;  1GNW A;  3FR9 A;  2GT6 A;  4PUA A;  2DMM A;  1TRW A;  5ECN B;  5HFI A;  4G10 A;  3ZZX A;  4XIH A;  3P90 A;  5JCG A;  4PGT A;  5INY A;  3APQ A;  2KLX A;  2ZCT A;  3IK9 A;  3DVW A;  1PKW A;  1GSQ A;  1ZGN A;  2H0H A;  2DIZ A;  1RK4 A;  3DKS A;  5HR1 A;  2DSA A;  5CP1 A;  1LBK A;  4DSS A;  4N11 A;  4I97 A;  4JU5 A;  3L9U A;  2HZE B;  4GXZ A;  2C0G A;  4FYB A;  3CRT A;  4E8E A;  2OAD A;  3EMP A;  4TR3 A;  4F9Z A;  2B1L A;  4BA7 A;  1EP8 A;  3KP9 A;  3EC3 A;  2H6Y A;  1M9B A;  3GKM A;  2LJR A;  1PL2 A;  3WGD A;  2LKU A;  2XBQ A;  5KN1 A;  3A2X A;  1SD8 A;  3TRP A;  1PSQ A;  1SYR A;  3FYG A;  4P3Y B;  4DSR A;  2WZ9 A;  1GUL A;  3Q6O A;  5ECM B;  4TXO A;  4XS6 A;  3F4T A;  2HT9 A;  5IMA A;  2BJX A;  2VM1 A;  4XS4 A;  3WGX A;  6GSX A;  2C4J A;  3GSS A;  3IV4 A;  2P5R A;  4G2E A;  1A0F A;  2NBS A;  3TOU A;  4K7N A;  4OO4 A;  3I9V 2;  6GSW A;  1E2Y A;  5JCW A;  2NDO A;  3I69 A;  2V32 A;  4HUA A;  4PQI A;  3DGQ A;  4BL7 A;  1MDI A;  1PX6 A;  2DLX A;  2GDR A;  1DE1 A;  2EIQ A;  2MMN A;  1EV4 A;  3IA1 A;  2LQO A;  1FG4 A;  2QSI A;  1FOV A;  3VFI A;  22GS A;  2JZR A;  1AAZ A;  2CV4 A;  7GSS A;  3BBY A;  1XWB A;  4BPY A;  1I9D A;  2M46 A;  5IMD A;  1ZL9 A;  3DWV A;  1WPI A;  4KE3 A;  4DSQ A;  3H1N A;  5IPG A;  4TRX A;  1SL1 B;  2EIO A;  4GF0 A;  5G5F A;  1B4Q A;  2VCW A;  1ERW A;  1ILO A;  5B6M A;  3GUS A;  3C1S A;  1YZX A;  3L9S A;  3UJ1 A;  4N0V A;  4ECI A;  4WBR D;  3LWA A;  4RUV A;  2PMT A;  1OC8 A;  2VL2 C;  2VL2 A;  3VWX A;  4N0Z A;  5AGY A;  1E6B A;  3DRN A;  5C00 A;  5ELA A;  1GNE A;  1XWC A;  4NMU A;  5D8I A;  4IJI A;  3D6I A;  3KCM A;  1VF3 A;  5E59 A;  1MDJ A;  5ECP B;  5ID2 B;  3DXB A;  5D9X A;  1J9B A;  4J2F A;  1SEN A;  1YKA A;  3G9B A;  1YY7 A;  2KHP A;  3TKP A;  3ERG A;  4L0W A;  1FVJ A;  1TRU A;  1WIK A;  5COH A;  5IMF A;  3RHC A;  3FR3 A;  2FLS A;  1AXD A;  2I9H A;  2RM6 A;  3FHK A;  1UA5 A;  1KTE A;  2YV7 A;  3QMX A;  4K7O A;  1Z6M A;  1XXU A;  1YF0 A;  2JAD A;  5F06 A;  4GQC A;  3APS A;  2B6M A;  5H5S A;  2YWI A;  5ECI B;  4F0C A;  4WBJ A;  4LA1 A;  3HVX A;  5C04 A;  1V40 A;  5GZZ B;  1XWK A;  5D9V A;  2OE0 A;  4MH3 A;  6GSV A;  1DUG A;  4MA9 A;  3TB2 A;  1Z5Y E;  1S3C A;  2C3T A;  3W8J A;  3TGZ A;  2H76 A;  2PU9 C;  1TXX A;  5G2Z A;  1EV9 A;  4IJ3 A;  1GUM A;  3D4M A;  4OFM A;  3LXT A;  3M8N A;  3ZL5 A;  1O8X A;  1SU9 A;  1XFL A;  2I3Y A;  2XC2 A;  1Z6N A;  1GL8 A;  1EGR A;  2HSY A;  3N5O A;  4K0G A;  4ECJ A;  2CAQ A;  3ZVJ D;  2GT5 A;  4ZL7 A;  2FUG 2;  3FZ5 A;  2H0G A;  1HNC A;  3EVI A;  5DAK B;  4K8M A;  1A8Y A;  3D5J A;  4Q5R A;  5HR0 A;  4RQR A;  3C7M A;  2IMI A;  2WRT A;  2GQL A;  3FZ4 A;  4XHM A;  3KH9 A;  2WJU A;  4OCE A;  5LD0 A;  4ML6 A;  4L5L A;  4NAX A;  3QAW A;  4EO3 A;  1R26 A;  4TOP A;  1Y6E A;  2VCZ A;  4KSM A;  5J3R A;  2FNO A;  1GLQ A;  3FKF A;  5KN2 A;  2CA8 A;  3KEB A;  2C0D A;  3CBU A;  2LUS A;  5DDL A;  2KP1 A;  1SL2 B;  4O7H A;  1GLP A;  1DSB A;  3V1W A;  3U6V A;  5EPF A;  3ZRE A;  3VPT A;  4DSS B;  2M72 A;  3M1G A;  4IEL A;  1ZOF A;  2RM5 A;  1ERU A;  2N5A A;  2I81 A;  1A23 A;  5H5Q A;  1PKZ A;  3NZN A;  4HDE A;  1B48 A;  4PQ1 A;  3MAK A;  2M80 A;  2MMO A;  1G6Y A;  3HZ4 A;  3TJF A;  4TR4 A;  1Z7R A;  3P8W A;  4K0N A;  2IJY A;  4Q5F A;  1THX A;  4KDU A;  1Q4J A;  4FYU A;  1GSS A;  3N9J A;  2VCV A;  2KOK A;  2R6K A;  2YZH A;  1W4V A;  3M9K A;  2HE3 A;  2GZY A;  4XS4 B;  2K8V A;  1MEK A;  3ZRD A;  5DAL A;  3TRX A;  1F37 A;  2XPD A;  1OAZ A;  3ZYW A;  2GS3 A;  8GSS A;  5CRD A;  1J0F A;  18GS A;  3EU3 A;  2V1M A;  1FO5 A;  1XWG A;  3HHV A;  3ISO A;  3C1R A;  5CRE A;  4OCF A;  2OKA A;  3ED3 A;  1FVK A;  1N8J A;  3LSZ A;  1M7T A;  4QL7 A;  1SKS B;  4ILF A;  1ML6 A;  1PN9 A;  5LNK e;  1LJR A;  3D0Z A;  3DML A;  3GV1 A;  2DJ0 A;  2LRN A;  2X8C A;  4KUN A;  1FHE A;  2V6K A;  4TVE A;  4MCU A;  1PA3 A;  4JR4 A;  1X5C A;  3UVT A;  3Q19 A;  5CRG A;  5CRW A;  3TKS E;  4OMV A;  4BWS A;  4FYC A;  2HI7 A;  1S3D A;  4HEA 2;  4I8B A;  2JU5 A;  4X0X A;  1SKW B;  1JLV A;  5D73 A;  4RQX A;  3FZA A;  5A4W A;  5D93 A;  4L8E A;  3IOS A;  1GWC A;  5LCZ A;  1KBN A;  2DC5 A;  4GST A;  1R4W A;  4V2M A;  2FY6 A;  2JAC A;  3EE2 A;  2ZUP A;  4NHW A;  1F9M A;  2LV3 A;  3R2Q A;  1YDK A;  5F07 A;  2B5Y A;  3MDK A;  1M2B A;  4G19 A;  2H6X A;  4HZ2 A;  3UEM A;  3GKX A;  3GIX A;  1AQX A;  2GGT A;  1IYH A;  4HS1 A;  4KCE A;  3F9U A;  4YAV A;  4L5O A;  4N30 A;  3KP8 A;  2R37 A;  3KTB A;  3PIN A;  2LTK A;  3GNJ A;  5DAK A;  4KAE A;  1JHB A;  4IKH A;  3HCZ A;  2PPT A;  1ABA A;  3GMF A;  1HNB A;  1GTI A;  3GRX A;  3I6A A;  3LYP A;  2A4V A;  5ECQ B;  1TU8 A;  2R4V A;  2HYX A;  1ZYE A;  4V2L A;  2IPA A;  13GS A;  2CX4 A;  4ZB8 A;  3TKQ A;  4LL4 B;  9GSS A;  2O7K A;  1O7U A;  4MJA A;  5B8B A;  1SJI A;  3GX0 A;  3IHQ A;  3PH9 A;  1T8E B;  4K9Z A;  5KEJ A;  4ZB9 A;  2HZF A;  4QL9 A;  3GX8 A;  11GS A;  4LLR A;  4H86 A;  4WET A;  2YAN A;  2IN3 A;  4KX4 A;  3EMX A;  3EU4 A;  2LEG A;  2OBI A;  2WGR A;  6GST A;  2CX3 A;  1NHO A;  2H1A A;  2CVD A;  1O8W A;  5G1L A;  3WYW A;  1GTB A;  3KH7 A;  1TK0 B;  2V41 A;  1ERT A;  1AUC A;  2DJK A;  3CRU A;  4GTU A;  4HOJ A;  2YWM A;  3ZFL A;  4KSO A;  3W6G A;  5D9T A;  1U88 A;  2C8U A;  1OE8 A;  3EIN A;  3SWL A;  1WJK A;  1W89 A;  4FH8 A;  1OYJ A;  5GSS A;  4HQZ A;  3VLN A;  3PGT A;  2K8S A;  2WUL A;  2B5E A;  2DJ2 A;  2VCX A;  3BCK A;  1SD9 A;  2VLU A;  2IMD A;  2VLT A;  1G0T A;  1YEX A;  4JED A;  3ZIJ A;  5A4V A;  1V2A A;  2XPE A;  4YQU A;  3K8N A;  2HFD A;  2OBK A;  3RPN A;  3P7X A;  3CTF A;  3QD9 A;  3GHA A;  4YH2 A;  1K3O A;  2IME A;  2VIM A;  1F6M C;  1NHY A;  3TJB A;  17GS A;  1TI1 A;  4V2N A;  2H8L A;  3QCP A;  1WP0 A;  3WD6 A;  2YPM A;  3TKS A;  3TKS C;  6GSS A;  1EGO A;  2VCT A;  1KEB A;  1EP7 A;  3BOA A;  4ACS A;  1SJ6 A;  5EVO A;  3IBH A;  3L4N A;  4IVF A;  5DAL B;  1TI3 A;  1JZW A;  1EWX A;  1K0A A;  1S3A A;  3IPZ A;  2D2Z A;  2NTO A;  3UL3 A;  5IQY A;  5F05 A;  3FK8 A;  2FWF A;  4EDZ A;  4AJ6 A;  4GWR A;  5HFG A;  10GS A;  4POM A;  3D21 A;  5IMC A;  4Q5N A;  1K0D A;  4MF6 A;  3TJJ A;  1XVQ A;  3KJY A;  1PRX A;  4PUF C;  3M3M A;  1VGL A;  1X9W B;  2FD3 A;  4GSS A;  3KXO A;  5CYY A;  4ZL9 A;  1K0O A;  4OWY A;  4KGI A;  2GVP A;  2X8G A;  2HSH A;  3H4K A;  3L78 A;  1I5G A;  4WXT A;  1FW1 A;  1V98 A;  3UBK A;  1AQV A;  1NM3 A;  4ZB6 A;  2OE1 A;  2C1Y A;  2O8V B;  3A2W A;  2RUE A;  1B8X A;  4F2I A;  2PUK C;  1IYI A;  3VUR A;  5KN0 A;  4KDY A;  3DD3 A;  1XWA A;  3QFB C;  4F03 A;  4OFT A;  4ID0 A;  3BCI A;  3F8U A;  1ST9 A;  1YJ6 A;  3G7I A;  2H74 A;  3HDC A;  4IHU A;  4MPF A;  5IMZ A;  1EZK A;  2LST A;  5J9C A;  1QUW A;  3ZIT A;  1AC1 A;  1OKD A;  1GTA A;  2DBC A;  3UAR A;  3ME8 A;  5B6N A;  5ECO B;  5IIZ A;  1TU7 A;  5HR2 A;  4XRD A;  4O5R A;  2P31 A;  2X8H A;  4NV2 A;  4ISD A;  2H73 A;  5AN1 A;  2GQK A;  3FEU A;  3IE3 A;  5GAN D;  1KNG A;  4MH2 A;  1F2E A;  4PNG A;  2L6D A;  2H75 A;  4KB3 A;  1F3A A;  4K2D A;  2YJ7 A;  2JZS A;  2YWN A;  1THO A;  1HD2 A;  4KA0 A;  2VM2 A;  2L59 A;  1VF2 A;  1TP9 A;  3WGE A;  3P2A A;  1GH2 A;  3Q74 A;  4MZC A;  2LJK A;  4Z7X A;  1VRS D;  4PQH A;  3JCM L;  1BJX A;  2OAC A;  2R2J A;  4WF4 A;  4E8H A;  2P5Q A;  3GL5 A;  4MMM A;  2K18 A;  2FCH A;  3QDN A;  3LFL A;  1G7E A;  1Z9H A;  1V58 A;  1GUK A;  1O6J A;  1TRS A;  5B8A A;  1WWJ A;  4MPG A;  5DCH A;  3DVX A;  4HJM A;  1FB0 A;  4AJ8 A; 
#chains in the Genus database with same CATH topology
 1M2D A;  5ECS A;  1BYE A;  2L4C A;  4ZBB A;  1FB6 A;  1RQM A;  4MAB A;  4XRA A;  5IMV A;  2DJ3 A;  1GSF A;  2RUF A;  5AIS A;  3ZTL A;  1TTZ A;  3WT2 A;  1EEJ A;  4DVC A;  4OFN A;  2WCI A;  3UAP A;  3LGC A;  1TOF A;  2EC4 A;  3IC8 A;  2MMA A;  2OJL A;  2YV9 A;  2H1B A;  4ZXG A;  4YQV A;  3L9V A;  2TRX A;  2JSZ A;  1WMJ A;  1XW9 A;  4HQS A;  3GYK A;  3HVS A;  4POL A;  3RHB A;  2KUC A;  2YOI A;  4JR6 A;  4LMW A;  4IN0 A;  4CW9 A;  2OA7 A;  1T1V A;  4XCS A;  4PUR A;  5FWG A;  1FOH A;  5DJM A;  2AJQ B;  4TXV A;  1GSY A;  2AYT A;  1GTU A;  3MWH A;  3IRA A;  1USB A;  2H0I A;  1S3R A;  1T4Z A;  3M9J A;  3LYK A;  1SK2 A;  2Z9S A;  1ZCP A;  3GKN A;  4MLY A;  1QQ2 A;  3QPM A;  2H1D A;  1X9M B;  1K0C A;  2ZNM A;  5DVB A;  4O5U A;  1Y25 A;  5DQY A;  4ZL8 A;  5L71 A;  2VL9 A;  3HYP A;  4FIW A;  1O73 A;  2IMK A;  1A8L A;  2H01 A;  3QAG A;  3BJ5 A;  2LQQ A;  1XVW A;  4MJE A;  3FZ9 A;  1SJZ A;  1PQN A;  5D96 A;  3O6T A;  3HJO A;  1DBY A;  2FA4 A;  2H19 A;  2L6C A;  2YJH A;  2XBI A;  3QAV A;  1M3J A;  1RW1 A;  4MZB A;  1TW9 A;  1BG5 A;  5KOX A;  1VF4 A;  1WE0 A;  3F6D A;  4ZIJ A;  3ZMK A;  4MF5 A;  3VWV A;  3ZFB A;  1CQH A;  1Q98 A;  2YP6 A;  2WFC A;  4K1F A;  1QFN A;  4I2U A;  3O76 A;  3F4S A;  1QK8 A;  4HI7 A;  1ON4 A;  4KCA A;  1O81 A;  2LRC A;  4X43 A;  3Q18 A;  2AAW A;  2IFQ B;  2XHF A;  3C8E A;  4Q5Q A;  4NXI A;  3C73 A;  2E2M A;  2GZP A;  2DIY A;  4CY6 A;  2F8F A;  1XCC A;  1K0M A;  4A5P A;  5J5N A;  1T7P B;  2H66 A;  2AHE A;  2YWO A;  1SYX A;  3GH6 A;  1OC3 A;  1X0R A;  1YEP A;  1A2M A;  2F8A A;  3W8S A;  4V1A p;  2H30 A;  2H70 A;  1B9Y C;  1MTC A;  2IL3 A;  4IS0 A;  3TCO A;  2WS2 A;  3TRQ A;  5E4W A;  3VPQ A;  3KMN A;  4TR1 A;  4PXO A;  4AJ7 A;  4MJC A;  1TJD A;  1QXH A;  2HLS A;  2FWH A;  2ALB A;  3FY7 A;  2QGV A;  4GRF A;  3VWW A;  3DIE A;  1PN0 A;  5DBQ A;  4J57 E;  2PER A;  1PFO A;  2NPB A;  3NIV A;  3ME7 A;  1H75 A;  1OE7 A;  4IW9 A;  1MDK A;  3SBC A;  2B7K A;  1AIU A;  1U87 A;  3RPP A;  3LXZ A;  3QFA C;  2MBS A;  2BTO T;  2ES7 A;  1JZD A;  3F6F A;  5FHI A;  1SK1 A;  3CSJ A;  4MP4 A;  2F9S A;  3IK7 A;  3F4R A;  2O89 A;  4TN8 A;  2VD1 A;  5IO2 A;  1WOU A;  3UOM A;  2QC7 A;  5ABR A;  4KND A;  2H72 A;  2I4A A;  3HVV A;  5ECH B;  4IBP A;  4IQA A;  3G7Y A;  2MYG A;  2K6V A;  2VUP A;  2C3N A;  1M9A A;  1EOH A;  4EXJ A;  1AW9 A;  1R5A A;  2PWJ A;  4HJ2 A;  5HR3 A;  3RAZ A;  3F3Q A;  3F0I A;  3RDW A;  5CAX A;  3VWU A;  2L57 A;  3GTU A;  14GS A;  1ZYP A;  2N5F A;  3APO A;  4NV5 A;  3L0H A;  3HJP A;  3TUE A;  4K5R A;  3EYT A;  3H93 A;  1XPV A;  5GST A;  1HYU A;  1YF1 A;  2HXK A;  2K9F A;  4LMV A;  1XIY A;  3G7J A;  5G30 A;  2MZC A;  4MDC A;  3HY2 A;  1A2J A;  3UVH A;  2I1U A;  2X64 A;  6GSY A;  3DEX A;  1YQ1 A;  2JL4 A;  5CRH A;  4I5Q A;  4GQF A;  1HQO A;  1TKD B;  1XW5 A;  5IOX A;  5ECL B;  2GST A;  5D9W A;  2G2Q A;  2TIR A;  2F51 A;  2CAI A;  1K0N A;  1X5D A;  1T4Y A;  2YZU A;  4ULX A;  2V6O A;  4F0B A;  2CVK A;  3US3 A;  1A0R P;  3A3T A;  2GQM A;  3KTL A;  3IC4 A;  2HSM A;  4D73 B;  1NSW A;  4HU9 A;  3ZIV A;  2DJJ A;  2LNS A;  4JRR A;  4IQ1 A;  3F63 A;  3IDV A;  1Z7P A;  1OC9 B;  4NHZ A;  3LEF A;  2HNL A;  4FO5 A;  2CQ9 A;  1QGV A;  4EKZ A;  3QR6 A;  5H5R A;  1TK5 B;  2FWG A;  3KM6 A;  1M0U A;  2B3S A;  4K5S A;  3E9J B;  1X9S B;  3H8Q A;  2VO4 A;  1BQ7 A;  3LW9 A;  4CDO A;  3LG6 A;  4IP1 A;  3HXS A;  4EDY A;  3KIJ A;  2A2R A;  3F3R A;  1LU4 A;  3ZLP A;  2DKI A;  1HNA A;  3DYR A;  3HZ8 A;  4WEY A;  3UMA A;  3TDG A;  5A4U A;  3FRC A;  2GSS A;  3C71 A;  1G7O A;  4G0K A;  1JLW A;  2CZ2 A;  4TR0 A;  3CQF A;  5G5E A;  4ZIL A;  1ERV A;  2FWE A;  2HRN A;  4J56 E;  2IFQ A;  1MD3 A;  2YN1 A;  4GLT A;  1ACV A;  4RI7 A;  2V2G A;  4POK A;  1AQW A;  1WRY A;  4YQM A;  2GLR A;  4WR4 A;  1BAY A;  2NVL A;  5ENU A;  4ZBD A;  2PN8 A;  5J4U A;  2PGT A;  3VK9 A;  1M99 A;  3ERF A;  4BVY A;  1U6T A;  2HRA A;  4BVX B;  5IOW A;  3IAM 2;  1GUH A;  5HFK A;  4EF0 A;  1H4O A;  2C0F A;  3D4T A;  4AGS A;  1TDI A;  4NWY A;  4PX1 A;  2H1G A;  5DQS A;  1BX9 A;  1PX7 A;  2E7P A;  3KD0 A;  5ECK B;  3E0U A;  3IR4 A;  3HA9 A;  5AIX A;  1URM A;  3CTG A;  3H79 A;  3BD2 A;  2AB6 A;  2PBJ A;  4DEJ A;  4BWQ A;  3ZML A;  3CYN A;  1G6W A;  1PGT A;  4NPB A;  4KDX A;  3HD5 A;  3O3T A;  2G0F A;  3HKR A;  2C3Q A;  2JSY A;  1T00 A;  5J41 A;  2WB9 A;  1XBS A;  1XOA A;  2L5O A;  1OKT A;  1K3L A;  3KMO A;  2YCD A;  4I6X A;  2IWT A;  1J08 A;  4ZBA A;  1B4P A;  1QMV A;  3MNG A;  4MNN A;  4XTS A;  1UC7 A;  2B7J A;  2HRF A;  3GUR A;  1XW6 A;  4TKY A;  2PVQ A;  5FT3 A;  4EE0 A;  4LL1 B;  3GST A;  5F8B A;  2PVO C;  2FGX A;  4PTS A;  4EIQ A;  2VOC A;  2P0G A;  4TR1 B;  4YAP A;  2YNX A;  1JZR A;  4EVM A;  5JWR B;  2IIY A;  3IXR A;  1TK8 B;  5IM9 A;  2B5X A;  2LRT A;  1O85 A;  1XOB A;  2MBT A;  4F82 A;  5JCU A;  3TJG A;  5ELG A;  2LNT A;  1K0B A;  2HZE A;  1GP1 A;  1ZMA A;  4EL1 A;  4K6X A;  3GL3 A;  3GN3 A;  3TJK A;  4EIP A;  3MIX A;  1X5E A;  4JE1 A;  4POB A;  4X1U A;  1GSE A;  2DJ1 A;  2JZT A;  2TRC P;  3CSI A;  3IAS 2;  5AIV A;  1M2A A;  4OD7 A;  4IP6 A;  3VI5 A;  3E3E A;  3M0F A;  2CVB A;  4MZW A;  5ECR B;  1SL0 B;  2X99 A;  3U5R E;  2L5L A;  16GS A;  4D73 A;  2A4H A;  4ECC A;  3GFK A;  5J9B A;  2X4A A;  5EL8 A;  1YKC A;  4XS1 A;  1OC9 A;  2REM A;  4L0U A;  1BED A;  1U3A A;  4CY8 A;  3TKR A;  2GZZ A;  1GRX A;  2E0Q A;  3GTU B;  2J23 A;  3GA4 A;  1SK0 A;  3VI7 A;  2J9H A;  2OE3 A;  3KGK A;  2O87 A;  2E2G A;  2VCQ A;  3TOT A;  4N10 A;  3S9F A;  12GS A;  1T3B A;  4WR5 A;  1A24 A;  4O32 A;  2FA8 A;  1NW2 A;  3A2V A;  3EWL A;  3LOR A;  4O92 A;  2R5G A;  3J7Y b;  3PR8 A;  4WKW A;  5CNW A;  2H71 A;  4HU7 A;  1PMT A;  3GKK A;  1JZO A;  4AJ8 A;  5A5K A;  4AF2 A;  2N5B A;  2A2S A;  2VAF A;  3J7Y k;  5JWQ B;  5EY6 A;  5BRT A;  3OR5 A;  4TXO B;  3CMI A;  4I2T A;  6GSU A;  2CT6 A;  2RII A;  1GSU A;  4OO5 A;  2ON5 A;  1UVZ A;  2RLI A;  3GH9 A;  2LJA A;  3LQ7 A;  4CHS A;  3HVN A;  2VLV A;  5F0G A;  4JZQ A;  3A5W A;  4HZ4 A;  1XZO A;  4IGJ A;  3ERW A;  5B7C A;  5ID2 A;  4BVX A;  3WT1 A;  1OVN A;  1TRV A;  2GSQ A;  4V1A g;  3D22 A;  1V9W A;  3EUR A;  4G9H A;  5G1K A;  1ZZY A;  2VD0 A;  1DE2 A;  4ECB A;  5G31 A;  2GTU A;  2AUV A;  4MF7 A;  3LJR A;  1N2A A;  2ON7 A;  1B9X C;  2LS5 A;  3CXG A;  19GS A;  3HJM A;  1PD2 1;  4GSN A;  5KN3 A;  1PL1 A;  2EIR A;  5HQP A;  2AV4 A;  2MMZ A;  1Z3E A;  2C80 A;  1C72 A;  2KP2 A;  3A5I A;  4MJB A;  4KW6 A;  2R3X A;  4EUY A;  2B1K A;  4GCI A;  3ZVJ A;  3AY8 A;  2BMX A;  1UN2 A;  4EC0 A;  4TW5 A;  4ML1 A;  3QOU A;  2H6Z A;  20GS A;  4BVY B;  2QKE A;  2FHE A;  1JFU A;  3NOF A;  4RI6 A;  4WF5 A;  1R7H A;  3MSZ A;  1A2L A;  3UBL A;  1EEM A;  1CQG A;  3UIW A;  1K3Y A;  1EOG A;  5JWO B;  4K7I A;  1VF1 A;  2WDU A;  5CO3 A;  5GAP D;  4JBB A;  3RBT A;  1R5P A;  1SKR B;  3FW2 A;  2VL3 A;  4QQ7 A;  2DML A;  2IMF A;  2CZ3 A;  1F3B A;  4PNF A;  2GSR A;  1ZYQ B;  5IO0 A;  3CSH A;  3KZQ A;  1GSD A;  5DJL A;  3IHG A;  2O85 A;  4KH7 A;  2L4Q A;  1FAA A;  1MD4 A;  3I43 A;  2R0P A;  2F3M A;  2C0E A;  4MK3 A;  3FR6 A;  1V57 A;  5IPH A;  5DCG A;  1U3I A;  1GNW A;  3FR9 A;  2GT6 A;  4PUA A;  2DMM A;  1TRW A;  5ECN B;  5HFI A;  4G10 A;  3ZZX A;  4XIH A;  3P90 A;  5JCG A;  4PGT A;  5INY A;  3APQ A;  2KLX A;  2ZCT A;  3IK9 A;  3DVW A;  1PKW A;  1GSQ A;  1ZGN A;  2H0H A;  2DIZ A;  1RK4 A;  3DKS A;  5HR1 A;  2DSA A;  5CP1 A;  1LBK A;  4DSS A;  4N11 A;  4I97 A;  4JU5 A;  4X4J A;  3L9U A;  2HZE B;  4GXZ A;  2C0G A;  4FYB A;  3CRT A;  4E8E A;  2OAD A;  3EMP A;  4TR3 A;  4F9Z A;  2B1L A;  4BA7 A;  1EP8 A;  3KP9 A;  3EC3 A;  2H6Y A;  1M9B A;  3GKM A;  2LJR A;  1PL2 A;  3WGD A;  2LKU A;  2XBQ A;  5KN1 A;  3A2X A;  1SD8 A;  3TRP A;  1PSQ A;  1SYR A;  3FYG A;  4P3Y B;  4DSR A;  2WZ9 A;  1GUL A;  3Q6O A;  5ECM B;  4TXO A;  4XS6 A;  3F4T A;  2HT9 A;  5IMA A;  2BJX A;  2VM1 A;  4XS4 A;  3WGX A;  6GSX A;  2C4J A;  3GSS A;  3IV4 A;  2P5R A;  4G2E A;  1A0F A;  2NBS A;  3TOU A;  4K7N A;  4OO4 A;  3I9V 2;  6GSW A;  1E2Y A;  5JCW A;  2NDO A;  3I69 A;  2V32 A;  4HUA A;  4PQI A;  3DGQ A;  4BL7 A;  1MDI A;  1PX6 A;  2DLX A;  2GDR A;  1DE1 A;  2EIQ A;  2MMN A;  1EV4 A;  3IA1 A;  2LQO A;  1FG4 A;  2QSI A;  1FOV A;  3VFI A;  22GS A;  2JZR A;  1AAZ A;  2CV4 A;  2DKH A;  7GSS A;  3BBY A;  1XWB A;  4BPY A;  1I9D A;  2QA1 A;  2M46 A;  5IMD A;  1ZL9 A;  3DWV A;  1WPI A;  4KE3 A;  4DSQ A;  3H1N A;  5IPG A;  4TRX A;  1SL1 B;  2EIO A;  4GF0 A;  5G5F A;  1B4Q A;  2VCW A;  1ERW A;  1ILO A;  5B6M A;  3GUS A;  3C1S A;  1YZX A;  3L9S A;  3UJ1 A;  4N0V A;  4ECI A;  4WBR D;  3LWA A;  4Z2R A;  4RUV A;  2PMT A;  1OC8 A;  2VL2 C;  2VL2 A;  3VWX A;  4N0Z A;  5AGY A;  1E6B A;  3DRN A;  5C00 A;  5ELA A;  1GNE A;  1XWC A;  4NMU A;  5D8I A;  4IJI A;  3D6I A;  3KCM A;  1VF3 A;  2X49 A;  5E59 A;  1MDJ A;  5ECP B;  5ID2 B;  3DXB A;  5D9X A;  1J9B A;  4J2F A;  1SEN A;  3EPT A;  1YKA A;  3G9B A;  1YY7 A;  2KHP A;  3TKP A;  3ERG A;  4L0W A;  1FVJ A;  2R0G A;  1TRU A;  1WIK A;  5COH A;  5IMF A;  3RHC A;  3FR3 A;  2FLS A;  1AXD A;  2I9H A;  2RM6 A;  3FHK A;  1UA5 A;  1KTE A;  2YV7 A;  3QMX A;  4K7O A;  1Z6M A;  1XXU A;  1YF0 A;  4HSC X;  2JAD A;  5F06 A;  4GQC A;  3APS A;  2B6M A;  4KF9 A;  5H5S A;  2YWI A;  5ECI B;  4F0C A;  4WBJ A;  4LA1 A;  3HVX A;  5C04 A;  1V40 A;  5GZZ B;  1XWK A;  5D9V A;  2OE0 A;  4MH3 A;  6GSV A;  1DUG A;  4MA9 A;  3TB2 A;  1Z5Y E;  1S3C A;  2C3T A;  3W8J A;  3TGZ A;  2H76 A;  2PU9 C;  1TXX A;  5G2Z A;  1EV9 A;  4IJ3 A;  1GUM A;  3D4M A;  4OFM A;  3LXT A;  3M8N A;  3ZL5 A;  1O8X A;  1SU9 A;  1XFL A;  2I3Y A;  2XC2 A;  1Z6N A;  1GL8 A;  1EGR A;  2HSY A;  3N5O A;  4K0G A;  4ECJ A;  2CAQ A;  3ZVJ D;  2GT5 A;  4ZL7 A;  2FUG 2;  3FZ5 A;  2H0G A;  1HNC A;  3EVI A;  5DAK B;  4K8M A;  1A8Y A;  3D5J A;  4Q5R A;  5HR0 A;  4RQR A;  3C7M A;  2IMI A;  2WRT A;  2GQL A;  3FZ4 A;  4XHM A;  3KH9 A;  2WJU A;  4OCE A;  5LD0 A;  1M3I A;  4ML6 A;  4L5L A;  4NAX A;  3QAW A;  4EO3 A;  1R26 A;  4TOP A;  1Y6E A;  2VCZ A;  2UZ8 A;  4KSM A;  5J3R A;  2FNO A;  1GLQ A;  3FKF A;  5KN2 A;  2CA8 A;  3KEB A;  2C0D A;  3CBU A;  2LUS A;  5DDL A;  2KP1 A;  1SL2 B;  4O7H A;  1GLP A;  1DSB A;  3V1W A;  3U6V A;  5EPF A;  3ZRE A;  3VPT A;  4DSS B;  2M72 A;  3M1G A;  4IEL A;  1ZOF A;  2RM5 A;  1ERU A;  2N5A A;  2I81 A;  1A23 A;  5H5Q A;  3PPU A;  1PKZ A;  3NZN A;  4HDE A;  1B48 A;  4PQ1 A;  2A2P A;  3MAK A;  2M80 A;  2MMO A;  4ICY A;  1G6Y A;  3HZ4 A;  3TJF A;  4TR4 A;  1Z7R A;  3P8W A;  4K0N A;  2IJY A;  4Q5F A;  1THX A;  4KDU A;  5KOW A;  1Q4J A;  4FYU A;  1GSS A;  3N9J A;  2VCV A;  2KOK A;  2R6K A;  2YZH A;  1W4V A;  3M9K A;  2HE3 A;  2GZY A;  4XS4 B;  2K8V A;  1MEK A;  3ZRD A;  1XG8 A;  5DAL A;  3TRX A;  1F37 A;  2XPD A;  1OAZ A;  3ZYW A;  2GS3 A;  8GSS A;  5CRD A;  1J0F A;  18GS A;  3EU3 A;  2V1M A;  1FO5 A;  1XWG A;  3HHV A;  4BL7 B;  3ISO A;  3C1R A;  5CRE A;  4OCF A;  2OKA A;  3ED3 A;  1FVK A;  1N8J A;  3LSZ A;  1M7T A;  4QL7 A;  1SKS B;  4ILF A;  1ML6 A;  1PN9 A;  5LNK e;  1LJR A;  3D0Z A;  3DML A;  4K2X A;  3GV1 A;  3MYD A;  2DJ0 A;  2LRN A;  2X8C A;  4KUN A;  1FHE A;  2V6K A;  4TVE A;  4MCU A;  1PA3 A;  4JR4 A;  1X5C A;  3UVT A;  3Q19 A;  5CRG A;  5CRW A;  3TKS E;  4OMV A;  4BWS A;  4FYC A;  2HI7 A;  1S3D A;  4HEA 2;  1ZYN A;  4I8B A;  2JU5 A;  4X0X A;  1SKW B;  1JLV A;  4FQU A;  5D73 A;  4RQX A;  3FZA A;  5A4W A;  5D93 A;  4L8E A;  3IOS A;  1GWC A;  5LCZ A;  4G0L A;  1KBN A;  2DC5 A;  4GST A;  1R4W A;  4V2M A;  2FY6 A;  2JAC A;  3EE2 A;  2ZUP A;  4NHW A;  1F9M A;  2LV3 A;  3R2Q A;  1YDK A;  5F07 A;  2B5Y A;  3MDK A;  1M2B A;  4G19 A;  2HRK A;  2H6X A;  4HZ2 A;  3UEM A;  3GKX A;  3GIX A;  1AQX A;  4USS A;  2GGT A;  1IYH A;  4HS1 A;  4KCE A;  3F9U A;  4YAV A;  4L5O A;  4N30 A;  3KP8 A;  2R37 A;  3KTB A;  4O5Q A;  3PIN A;  2LTK A;  3GNJ A;  5DAK A;  4KAE A;  1JHB A;  4IKH A;  3HCZ A;  2PPT A;  1ABA A;  3GMF A;  1HNB A;  1GTI A;  3GRX A;  3I6A A;  3LYP A;  2A4V A;  5ECQ B;  1TU8 A;  2R4V A;  2HYX A;  1ZYE A;  4V2L A;  2IPA A;  13GS A;  2CX4 A;  4ZB8 A;  3TKQ A;  4LL4 B;  9GSS A;  2O7K A;  1O7U A;  4MJA A;  5B8B A;  1SJI A;  3GX0 A;  5BMU A;  3IHQ A;  3PH9 A;  1T8E B;  4K9Z A;  5KEJ A;  4ZB9 A;  2HZF A;  4QL9 A;  3GX8 A;  4G0I A;  11GS A;  4LLR A;  4H86 A;  4WET A;  2YAN A;  2IN3 A;  4KX4 A;  3EMX A;  3EU4 A;  2LEG A;  2OBI A;  2WGR A;  6GST A;  2CX3 A;  1NHO A;  2H1A A;  2CVD A;  1O8W A;  5G1L A;  3WYW A;  1GTB A;  4YKF A;  4YKG A;  3KH7 A;  1TK0 B;  2V41 A;  1ERT A;  1AUC A;  2DJK A;  3CRU A;  4GTU A;  4HOJ A;  2YWM A;  3ZFL A;  4KSO A;  3W6G A;  5D9T A;  1U88 A;  2C8U A;  1OE8 A;  3EIN A;  3SWL A;  1WJK A;  1W89 A;  4Z2T A;  4FH8 A;  1OYJ A;  5GSS A;  4HQZ A;  3VLN A;  3PGT A;  2K8S A;  2WUL A;  2B5E A;  2DJ2 A;  2VCX A;  3BCK A;  1SD9 A;  2VLU A;  2IMD A;  2VLT A;  1G0T A;  1YEX A;  4JED A;  3ZIJ A;  5A4V A;  1V2A A;  2XPE A;  4YQU A;  3K8N A;  2HFD A;  2OBK A;  3RPN A;  3P7X A;  3CTF A;  3QD9 A;  3GHA A;  4YH2 A;  1K3O A;  2IME A;  2VIM A;  1F6M C;  1NHY A;  3TJB A;  17GS A;  1TI1 A;  4V2N A;  2H8L A;  3QCP A;  1WP0 A;  3WD6 A;  2YPM A;  3TKS A;  3TKS C;  6GSS A;  1EGO A;  2VCT A;  1KEB A;  1EP7 A;  3BOA A;  4ACS A;  1SJ6 A;  5EVO A;  3IBH A;  3L4N A;  4IVF A;  5DAL B;  1TI3 A;  1JZW A;  1EWX A;  1K0A A;  1S3A A;  3IPZ A;  2D2Z A;  2NTO A;  3UL3 A;  5IQY A;  5F05 A;  3FK8 A;  2FWF A;  4EDZ A;  4AJ6 A;  4GWR A;  5HFG A;  10GS A;  4POM A;  3D21 A;  5IMC A;  4Q5N A;  1K0D A;  4MF6 A;  3TJJ A;  1XVQ A;  3KJY A;  1PRX A;  4PUF C;  3M3M A;  1VGL A;  1X9W B;  2FD3 A;  4GSS A;  3KXO A;  5CYY A;  4ZL9 A;  1K0O A;  4OWY A;  4KGI A;  2GVP A;  4Z2U A;  2X8G A;  2HSH A;  3H4K A;  3L78 A;  1I5G A;  4WXT A;  1FW1 A;  1V98 A;  3UBK A;  1AQV A;  1NM3 A;  4ZB6 A;  2OE1 A;  2C1Y A;  2O8V B;  3A2W A;  2RUE A;  1B8X A;  4F2I A;  2PUK C;  1IYI A;  3VUR A;  5KN0 A;  4KDY A;  3DD3 A;  1XWA A;  3QFB C;  4F03 A;  4OFT A;  4ID0 A;  3BCI A;  3F8U A;  1ST9 A;  1YJ6 A;  3G7I A;  2H74 A;  4BIK A;  3HDC A;  4IHU A;  4MPF A;  5IMZ A;  1EZK A;  2LST A;  5J9C A;  1QUW A;  3ZIT A;  1AC1 A;  1OKD A;  1GTA A;  2DBC A;  3UAR A;  3ME8 A;  5B6N A;  5ECO B;  5IIZ A;  1TU7 A;  5HR2 A;  4XRD A;  4O5R A;  2P31 A;  2X8H A;  4NV2 A;  4ISD A;  2H73 A;  5AN1 A;  2GQK A;  3FEU A;  3IE3 A;  5GAN D;  1KNG A;  4MH2 A;  1F2E A;  3R3E A;  3FMW A;  4PNG A;  2L6D A;  2H75 A;  4KB3 A;  1F3A A;  4K2D A;  2YJ7 A;  2JZS A;  2YWN A;  1THO A;  1HD2 A;  4KA0 A;  2VM2 A;  2L59 A;  1VF2 A;  1TP9 A;  3WGE A;  3P2A A;  1GH2 A;  3Q74 A;  4MZC A;  2LJK A;  4Z7X A;  1VRS D;  4PQH A;  3JCM L;  1BJX A;  2OAC A;  2R2J A;  4WF4 A;  4E8H A;  2P5Q A;  3GL5 A;  4MMM A;  2K18 A;  2FCH A;  3QDN A;  3LFL A;  1G7E A;  1Z9H A;  1V58 A;  2R0C A;  1GUK A;  1O6J A;  1TRS A;  5B8A A;  1WWJ A;  4MPG A;  5DCH A;  3DVX A;  4HJM A;  1FB0 A;  2QA2 A; 
#chains in the Genus database with same CATH homology
 1M2D A;  5ECS A;  1BYE A;  2L4C A;  4ZBB A;  1FB6 A;  1RQM A;  4MAB A;  4XRA A;  5IMV A;  2DJ3 A;  1GSF A;  2RUF A;  5AIS A;  3ZTL A;  1TTZ A;  3WT2 A;  1EEJ A;  4DVC A;  4OFN A;  2WCI A;  3UAP A;  3LGC A;  1TOF A;  2EC4 A;  3IC8 A;  2MMA A;  2OJL A;  2YV9 A;  2H1B A;  4ZXG A;  4YQV A;  3L9V A;  2TRX A;  2JSZ A;  1WMJ A;  1XW9 A;  4HQS A;  3GYK A;  3HVS A;  4POL A;  3RHB A;  2KUC A;  2YOI A;  4JR6 A;  4LMW A;  4IN0 A;  4CW9 A;  2OA7 A;  1T1V A;  4XCS A;  4PUR A;  5FWG A;  1FOH A;  5DJM A;  2AJQ B;  4TXV A;  1GSY A;  2AYT A;  1GTU A;  3MWH A;  3IRA A;  1USB A;  2H0I A;  1T4Z A;  3M9J A;  3LYK A;  1SK2 A;  2Z9S A;  1ZCP A;  3GKN A;  4MLY A;  1QQ2 A;  3QPM A;  2H1D A;  1X9M B;  1K0C A;  2ZNM A;  5DVB A;  4O5U A;  1Y25 A;  5DQY A;  4ZL8 A;  5L71 A;  2VL9 A;  3HYP A;  4FIW A;  1O73 A;  2IMK A;  1A8L A;  2H01 A;  3QAG A;  3BJ5 A;  2LQQ A;  1XVW A;  4MJE A;  3FZ9 A;  1SJZ A;  1PQN A;  5D96 A;  3O6T A;  3HJO A;  1DBY A;  2FA4 A;  2H19 A;  2L6C A;  2YJH A;  2XBI A;  3QAV A;  1RW1 A;  4MZB A;  1TW9 A;  1BG5 A;  5KOX A;  1VF4 A;  1WE0 A;  3F6D A;  4ZIJ A;  3ZMK A;  4MF5 A;  3VWV A;  3ZFB A;  1CQH A;  1Q98 A;  2YP6 A;  2WFC A;  4K1F A;  1QFN A;  4I2U A;  3O76 A;  3F4S A;  1QK8 A;  4HI7 A;  1ON4 A;  4KCA A;  1O81 A;  2LRC A;  4X43 A;  3Q18 A;  2AAW A;  2IFQ B;  2XHF A;  3C8E A;  4Q5Q A;  4NXI A;  3C73 A;  2E2M A;  2GZP A;  2DIY A;  4CY6 A;  2F8F A;  1XCC A;  1K0M A;  4A5P A;  5J5N A;  1T7P B;  2H66 A;  2AHE A;  2YWO A;  1SYX A;  3GH6 A;  1OC3 A;  1X0R A;  1YEP A;  1A2M A;  2F8A A;  3W8S A;  4V1A p;  2H30 A;  2H70 A;  1B9Y C;  1MTC A;  2IL3 A;  4IS0 A;  3TCO A;  2WS2 A;  3TRQ A;  5E4W A;  3VPQ A;  3KMN A;  4TR1 A;  4PXO A;  4AJ7 A;  4MJC A;  1TJD A;  1QXH A;  2HLS A;  2FWH A;  2ALB A;  3FY7 A;  2QGV A;  4GRF A;  3VWW A;  3DIE A;  1PN0 A;  5DBQ A;  4J57 E;  2PER A;  2NPB A;  3NIV A;  3ME7 A;  1H75 A;  1OE7 A;  4IW9 A;  1MDK A;  3SBC A;  2B7K A;  1AIU A;  1U87 A;  3RPP A;  3LXZ A;  3QFA C;  2MBS A;  2BTO T;  2ES7 A;  1JZD A;  3F6F A;  5FHI A;  1SK1 A;  3CSJ A;  4MP4 A;  2F9S A;  3IK7 A;  3F4R A;  2O89 A;  4TN8 A;  2VD1 A;  5IO2 A;  1WOU A;  3UOM A;  2QC7 A;  5ABR A;  4KND A;  2H72 A;  2I4A A;  3HVV A;  5ECH B;  4IBP A;  4IQA A;  3G7Y A;  2MYG A;  2K6V A;  2VUP A;  2C3N A;  1M9A A;  1EOH A;  4EXJ A;  1AW9 A;  1R5A A;  2PWJ A;  4HJ2 A;  5HR3 A;  3RAZ A;  3F3Q A;  3F0I A;  3RDW A;  5CAX A;  3VWU A;  2L57 A;  3GTU A;  14GS A;  1ZYP A;  2N5F A;  3APO A;  4NV5 A;  3L0H A;  3HJP A;  3TUE A;  4K5R A;  3EYT A;  3H93 A;  1XPV A;  5GST A;  1HYU A;  1YF1 A;  2HXK A;  2K9F A;  4LMV A;  1XIY A;  3G7J A;  5G30 A;  2MZC A;  4MDC A;  3HY2 A;  1A2J A;  3UVH A;  2I1U A;  2X64 A;  6GSY A;  3DEX A;  1YQ1 A;  2JL4 A;  5CRH A;  4I5Q A;  4GQF A;  1HQO A;  1TKD B;  1XW5 A;  5IOX A;  5ECL B;  2GST A;  5D9W A;  2G2Q A;  2TIR A;  2F51 A;  2CAI A;  1K0N A;  1X5D A;  1T4Y A;  2YZU A;  4ULX A;  2V6O A;  4F0B A;  2CVK A;  3US3 A;  1A0R P;  3A3T A;  2GQM A;  3KTL A;  3IC4 A;  2HSM A;  4D73 B;  1NSW A;  4HU9 A;  3ZIV A;  2DJJ A;  2LNS A;  4JRR A;  4IQ1 A;  3F63 A;  3IDV A;  1Z7P A;  1OC9 B;  4NHZ A;  3LEF A;  2HNL A;  4FO5 A;  2CQ9 A;  1QGV A;  4EKZ A;  3QR6 A;  5H5R A;  1TK5 B;  2FWG A;  3KM6 A;  1M0U A;  2B3S A;  4K5S A;  3E9J B;  1X9S B;  3H8Q A;  2VO4 A;  1BQ7 A;  3LW9 A;  4CDO A;  3LG6 A;  4IP1 A;  3HXS A;  4EDY A;  3KIJ A;  2A2R A;  3F3R A;  1LU4 A;  3ZLP A;  2DKI A;  1HNA A;  3DYR A;  3HZ8 A;  4WEY A;  3UMA A;  3TDG A;  5A4U A;  3FRC A;  2GSS A;  3C71 A;  1G7O A;  4G0K A;  1JLW A;  2CZ2 A;  4TR0 A;  5G5E A;  4ZIL A;  1ERV A;  2FWE A;  2HRN A;  4J56 E;  2IFQ A;  1MD3 A;  2YN1 A;  4GLT A;  1ACV A;  4RI7 A;  2V2G A;  4POK A;  1AQW A;  1WRY A;  4YQM A;  2GLR A;  4WR4 A;  1BAY A;  2NVL A;  5ENU A;  4ZBD A;  2PN8 A;  5J4U A;  2PGT A;  3VK9 A;  1M99 A;  3ERF A;  4BVY A;  1U6T A;  2HRA A;  4BVX B;  5IOW A;  3IAM 2;  1GUH A;  5HFK A;  4EF0 A;  1H4O A;  2C0F A;  3D4T A;  4AGS A;  1TDI A;  4NWY A;  4PX1 A;  2H1G A;  5DQS A;  1BX9 A;  1PX7 A;  2E7P A;  3KD0 A;  5ECK B;  3E0U A;  3IR4 A;  3HA9 A;  5AIX A;  1URM A;  3CTG A;  3H79 A;  3BD2 A;  2AB6 A;  2PBJ A;  4DEJ A;  4BWQ A;  3ZML A;  3CYN A;  1G6W A;  1PGT A;  4NPB A;  4KDX A;  3HD5 A;  3O3T A;  2G0F A;  3HKR A;  2C3Q A;  2JSY A;  1T00 A;  5J41 A;  2WB9 A;  1XBS A;  1XOA A;  2L5O A;  1OKT A;  1K3L A;  3KMO A;  2YCD A;  4I6X A;  2IWT A;  1J08 A;  4ZBA A;  1B4P A;  1QMV A;  3MNG A;  4MNN A;  4XTS A;  1UC7 A;  2B7J A;  2HRF A;  3GUR A;  1XW6 A;  4TKY A;  2PVQ A;  5FT3 A;  4EE0 A;  4LL1 B;  3GST A;  5F8B A;  2PVO C;  2FGX A;  4PTS A;  4EIQ A;  2VOC A;  2P0G A;  4TR1 B;  4YAP A;  2YNX A;  1JZR A;  4EVM A;  5JWR B;  2IIY A;  3IXR A;  1TK8 B;  5IM9 A;  2B5X A;  2LRT A;  1O85 A;  1XOB A;  2MBT A;  4F82 A;  5JCU A;  3TJG A;  5ELG A;  2LNT A;  1K0B A;  2HZE A;  1GP1 A;  1ZMA A;  4EL1 A;  4K6X A;  3GL3 A;  3GN3 A;  3TJK A;  4EIP A;  3MIX A;  1X5E A;  4JE1 A;  4POB A;  4X1U A;  1GSE A;  2DJ1 A;  2JZT A;  2TRC P;  3CSI A;  3IAS 2;  5AIV A;  1M2A A;  4OD7 A;  4IP6 A;  3VI5 A;  3E3E A;  3M0F A;  2CVB A;  4MZW A;  5ECR B;  1SL0 B;  2X99 A;  3U5R E;  2L5L A;  16GS A;  4D73 A;  2A4H A;  4ECC A;  3GFK A;  5J9B A;  2X4A A;  5EL8 A;  1YKC A;  4XS1 A;  1OC9 A;  2REM A;  4L0U A;  1BED A;  1U3A A;  4CY8 A;  3TKR A;  2GZZ A;  1GRX A;  2E0Q A;  3GTU B;  2J23 A;  3GA4 A;  1SK0 A;  3VI7 A;  2J9H A;  2OE3 A;  3KGK A;  2O87 A;  2E2G A;  2VCQ A;  3TOT A;  4N10 A;  3S9F A;  12GS A;  1T3B A;  4WR5 A;  1A24 A;  4O32 A;  2FA8 A;  1NW2 A;  3A2V A;  3EWL A;  3LOR A;  4O92 A;  2R5G A;  3J7Y b;  3PR8 A;  4WKW A;  5CNW A;  2H71 A;  4HU7 A;  1PMT A;  3GKK A;  1JZO A;  4AJ8 A;  5A5K A;  4AF2 A;  2N5B A;  2A2S A;  2VAF A;  3J7Y k;  5JWQ B;  5EY6 A;  5BRT A;  3OR5 A;  4TXO B;  3CMI A;  4I2T A;  6GSU A;  2CT6 A;  2RII A;  1GSU A;  4OO5 A;  2ON5 A;  1UVZ A;  2RLI A;  3GH9 A;  2LJA A;  3LQ7 A;  4CHS A;  2VLV A;  5F0G A;  4JZQ A;  3A5W A;  4HZ4 A;  1XZO A;  4IGJ A;  3ERW A;  5B7C A;  5ID2 A;  4BVX A;  3WT1 A;  1OVN A;  1TRV A;  2GSQ A;  4V1A g;  3D22 A;  1V9W A;  3EUR A;  4G9H A;  5G1K A;  1ZZY A;  2VD0 A;  1DE2 A;  4ECB A;  5G31 A;  2GTU A;  2AUV A;  4MF7 A;  3LJR A;  1N2A A;  2ON7 A;  1B9X C;  2LS5 A;  3CXG A;  19GS A;  3HJM A;  1PD2 1;  4GSN A;  5KN3 A;  1PL1 A;  2EIR A;  5HQP A;  2AV4 A;  2MMZ A;  1Z3E A;  2C80 A;  1C72 A;  2KP2 A;  3A5I A;  4MJB A;  4KW6 A;  2R3X A;  4EUY A;  2B1K A;  4GCI A;  3ZVJ A;  3AY8 A;  2BMX A;  1UN2 A;  4EC0 A;  4TW5 A;  4ML1 A;  3QOU A;  2H6Z A;  20GS A;  4BVY B;  2QKE A;  2FHE A;  1JFU A;  3NOF A;  4RI6 A;  4WF5 A;  1R7H A;  3MSZ A;  1A2L A;  3UBL A;  1EEM A;  1CQG A;  3UIW A;  1K3Y A;  1EOG A;  5JWO B;  4K7I A;  1VF1 A;  2WDU A;  5CO3 A;  5GAP D;  4JBB A;  3RBT A;  1R5P A;  1SKR B;  3FW2 A;  2VL3 A;  4QQ7 A;  2DML A;  2IMF A;  2CZ3 A;  1F3B A;  4PNF A;  2GSR A;  1ZYQ B;  5IO0 A;  3CSH A;  3KZQ A;  1GSD A;  5DJL A;  3IHG A;  2O85 A;  4KH7 A;  2L4Q A;  1FAA A;  1MD4 A;  3I43 A;  2R0P A;  2F3M A;  2C0E A;  4MK3 A;  3FR6 A;  1V57 A;  5IPH A;  5DCG A;  1U3I A;  1GNW A;  3FR9 A;  2GT6 A;  4PUA A;  2DMM A;  1TRW A;  5ECN B;  5HFI A;  4G10 A;  3ZZX A;  4XIH A;  3P90 A;  5JCG A;  4PGT A;  5INY A;  3APQ A;  2KLX A;  2ZCT A;  3IK9 A;  3DVW A;  1PKW A;  1GSQ A;  1ZGN A;  2H0H A;  2DIZ A;  1RK4 A;  3DKS A;  5HR1 A;  2DSA A;  5CP1 A;  1LBK A;  4DSS A;  4N11 A;  4I97 A;  4JU5 A;  4X4J A;  3L9U A;  2HZE B;  4GXZ A;  2C0G A;  4FYB A;  3CRT A;  4E8E A;  2OAD A;  3EMP A;  4TR3 A;  4F9Z A;  2B1L A;  4BA7 A;  1EP8 A;  3KP9 A;  3EC3 A;  2H6Y A;  1M9B A;  3GKM A;  2LJR A;  1PL2 A;  3WGD A;  2LKU A;  2XBQ A;  5KN1 A;  3A2X A;  1SD8 A;  3TRP A;  1PSQ A;  1SYR A;  3FYG A;  4P3Y B;  4DSR A;  2WZ9 A;  1GUL A;  3Q6O A;  5ECM B;  4TXO A;  4XS6 A;  3F4T A;  2HT9 A;  5IMA A;  2BJX A;  2VM1 A;  4XS4 A;  3WGX A;  6GSX A;  2C4J A;  3GSS A;  3IV4 A;  2P5R A;  4G2E A;  1A0F A;  2NBS A;  3TOU A;  4K7N A;  4OO4 A;  3I9V 2;  6GSW A;  1E2Y A;  5JCW A;  2NDO A;  3I69 A;  2V32 A;  4HUA A;  4PQI A;  3DGQ A;  4BL7 A;  1MDI A;  1PX6 A;  2DLX A;  2GDR A;  1DE1 A;  2EIQ A;  2MMN A;  1EV4 A;  3IA1 A;  2LQO A;  1FG4 A;  2QSI A;  1FOV A;  3VFI A;  22GS A;  2JZR A;  1AAZ A;  2CV4 A;  2DKH A;  7GSS A;  3BBY A;  1XWB A;  4BPY A;  1I9D A;  2QA1 A;  2M46 A;  5IMD A;  1ZL9 A;  3DWV A;  1WPI A;  4KE3 A;  4DSQ A;  3H1N A;  5IPG A;  4TRX A;  1SL1 B;  2EIO A;  4GF0 A;  5G5F A;  1B4Q A;  2VCW A;  1ERW A;  1ILO A;  5B6M A;  3GUS A;  3C1S A;  1YZX A;  3L9S A;  3UJ1 A;  4N0V A;  4ECI A;  4WBR D;  3LWA A;  4Z2R A;  4RUV A;  2PMT A;  1OC8 A;  2VL2 C;  2VL2 A;  3VWX A;  4N0Z A;  5AGY A;  1E6B A;  3DRN A;  5C00 A;  5ELA A;  1GNE A;  1XWC A;  4NMU A;  5D8I A;  4IJI A;  3D6I A;  3KCM A;  1VF3 A;  2X49 A;  5E59 A;  1MDJ A;  5ECP B;  5ID2 B;  3DXB A;  5D9X A;  1J9B A;  4J2F A;  1SEN A;  3EPT A;  1YKA A;  3G9B A;  1YY7 A;  2KHP A;  3TKP A;  3ERG A;  4L0W A;  1FVJ A;  2R0G A;  1TRU A;  1WIK A;  5COH A;  5IMF A;  3RHC A;  3FR3 A;  2FLS A;  1AXD A;  2I9H A;  2RM6 A;  3FHK A;  1UA5 A;  1KTE A;  2YV7 A;  3QMX A;  4K7O A;  1Z6M A;  1XXU A;  1YF0 A;  2JAD A;  5F06 A;  4GQC A;  3APS A;  2B6M A;  4KF9 A;  5H5S A;  2YWI A;  5ECI B;  4F0C A;  4WBJ A;  4LA1 A;  3HVX A;  5C04 A;  1V40 A;  5GZZ B;  1XWK A;  5D9V A;  2OE0 A;  4MH3 A;  6GSV A;  1DUG A;  4MA9 A;  3TB2 A;  1Z5Y E;  1S3C A;  2C3T A;  3W8J A;  3TGZ A;  2H76 A;  2PU9 C;  1TXX A;  5G2Z A;  1EV9 A;  4IJ3 A;  1GUM A;  3D4M A;  4OFM A;  3LXT A;  3M8N A;  3ZL5 A;  1O8X A;  1SU9 A;  1XFL A;  2I3Y A;  2XC2 A;  1Z6N A;  1GL8 A;  1EGR A;  2HSY A;  3N5O A;  4K0G A;  4ECJ A;  2CAQ A;  3ZVJ D;  2GT5 A;  4ZL7 A;  2FUG 2;  3FZ5 A;  2H0G A;  1HNC A;  3EVI A;  5DAK B;  4K8M A;  1A8Y A;  3D5J A;  4Q5R A;  5HR0 A;  4RQR A;  3C7M A;  2IMI A;  2WRT A;  2GQL A;  3FZ4 A;  4XHM A;  3KH9 A;  2WJU A;  4OCE A;  5LD0 A;  4ML6 A;  4L5L A;  4NAX A;  3QAW A;  4EO3 A;  1R26 A;  4TOP A;  1Y6E A;  2VCZ A;  2UZ8 A;  4KSM A;  5J3R A;  2FNO A;  1GLQ A;  3FKF A;  5KN2 A;  2CA8 A;  3KEB A;  2C0D A;  3CBU A;  2LUS A;  5DDL A;  2KP1 A;  1SL2 B;  4O7H A;  1GLP A;  1DSB A;  3V1W A;  3U6V A;  5EPF A;  3ZRE A;  3VPT A;  4DSS B;  2M72 A;  3M1G A;  4IEL A;  1ZOF A;  2RM5 A;  1ERU A;  2N5A A;  2I81 A;  1A23 A;  5H5Q A;  3PPU A;  1PKZ A;  3NZN A;  4HDE A;  1B48 A;  4PQ1 A;  2A2P A;  3MAK A;  2M80 A;  2MMO A;  4ICY A;  1G6Y A;  3HZ4 A;  3TJF A;  4TR4 A;  1Z7R A;  3P8W A;  4K0N A;  2IJY A;  4Q5F A;  1THX A;  4KDU A;  5KOW A;  1Q4J A;  4FYU A;  1GSS A;  3N9J A;  2VCV A;  2KOK A;  2R6K A;  2YZH A;  1W4V A;  3M9K A;  2HE3 A;  2GZY A;  4XS4 B;  2K8V A;  1MEK A;  3ZRD A;  5DAL A;  3TRX A;  1F37 A;  2XPD A;  1OAZ A;  3ZYW A;  2GS3 A;  8GSS A;  5CRD A;  1J0F A;  18GS A;  3EU3 A;  2V1M A;  1FO5 A;  1XWG A;  3HHV A;  4BL7 B;  3ISO A;  3C1R A;  5CRE A;  4OCF A;  2OKA A;  3ED3 A;  1FVK A;  1N8J A;  3LSZ A;  1M7T A;  4QL7 A;  1SKS B;  4ILF A;  1ML6 A;  1PN9 A;  5LNK e;  1LJR A;  3D0Z A;  3DML A;  4K2X A;  3GV1 A;  3MYD A;  2DJ0 A;  2LRN A;  2X8C A;  4KUN A;  1FHE A;  2V6K A;  4TVE A;  4MCU A;  1PA3 A;  4JR4 A;  1X5C A;  3UVT A;  3Q19 A;  5CRG A;  5CRW A;  3TKS E;  4OMV A;  4BWS A;  4FYC A;  2HI7 A;  1S3D A;  4HEA 2;  1ZYN A;  4I8B A;  2JU5 A;  4X0X A;  1SKW B;  1JLV A;  4FQU A;  5D73 A;  4RQX A;  3FZA A;  5A4W A;  5D93 A;  4L8E A;  3IOS A;  1GWC A;  5LCZ A;  4G0L A;  1KBN A;  2DC5 A;  4GST A;  1R4W A;  4V2M A;  2FY6 A;  2JAC A;  3EE2 A;  2ZUP A;  4NHW A;  1F9M A;  2LV3 A;  3R2Q A;  1YDK A;  5F07 A;  2B5Y A;  3MDK A;  1M2B A;  4G19 A;  2HRK A;  2H6X A;  4HZ2 A;  3UEM A;  3GKX A;  3GIX A;  1AQX A;  4USS A;  2GGT A;  1IYH A;  4HS1 A;  4KCE A;  3F9U A;  4YAV A;  4L5O A;  4N30 A;  3KP8 A;  2R37 A;  3KTB A;  4O5Q A;  3PIN A;  2LTK A;  3GNJ A;  5DAK A;  4KAE A;  1JHB A;  4IKH A;  3HCZ A;  2PPT A;  1ABA A;  3GMF A;  1HNB A;  1GTI A;  3GRX A;  3I6A A;  3LYP A;  2A4V A;  5ECQ B;  1TU8 A;  2R4V A;  2HYX A;  1ZYE A;  4V2L A;  2IPA A;  13GS A;  2CX4 A;  4ZB8 A;  3TKQ A;  4LL4 B;  9GSS A;  2O7K A;  1O7U A;  4MJA A;  5B8B A;  1SJI A;  3GX0 A;  5BMU A;  3IHQ A;  3PH9 A;  1T8E B;  4K9Z A;  5KEJ A;  4ZB9 A;  2HZF A;  4QL9 A;  3GX8 A;  4G0I A;  11GS A;  4LLR A;  4H86 A;  4WET A;  2YAN A;  2IN3 A;  4KX4 A;  3EMX A;  3EU4 A;  2LEG A;  2OBI A;  2WGR A;  6GST A;  2CX3 A;  1NHO A;  2H1A A;  2CVD A;  1O8W A;  5G1L A;  3WYW A;  1GTB A;  4YKF A;  4YKG A;  3KH7 A;  1TK0 B;  2V41 A;  1ERT A;  1AUC A;  2DJK A;  3CRU A;  4GTU A;  4HOJ A;  2YWM A;  3ZFL A;  4KSO A;  3W6G A;  5D9T A;  1U88 A;  2C8U A;  1OE8 A;  3EIN A;  3SWL A;  1WJK A;  1W89 A;  4Z2T A;  4FH8 A;  1OYJ A;  5GSS A;  4HQZ A;  3VLN A;  3PGT A;  2K8S A;  2WUL A;  2B5E A;  2DJ2 A;  2VCX A;  3BCK A;  1SD9 A;  2VLU A;  2IMD A;  2VLT A;  1G0T A;  1YEX A;  4JED A;  3ZIJ A;  5A4V A;  1V2A A;  2XPE A;  4YQU A;  3K8N A;  2HFD A;  2OBK A;  3RPN A;  3P7X A;  3CTF A;  3QD9 A;  3GHA A;  4YH2 A;  1K3O A;  2IME A;  2VIM A;  1F6M C;  1NHY A;  3TJB A;  17GS A;  1TI1 A;  4V2N A;  2H8L A;  3QCP A;  1WP0 A;  3WD6 A;  2YPM A;  3TKS A;  3TKS C;  6GSS A;  1EGO A;  2VCT A;  1KEB A;  1EP7 A;  3BOA A;  4ACS A;  1SJ6 A;  5EVO A;  3IBH A;  3L4N A;  4IVF A;  5DAL B;  1TI3 A;  1JZW A;  1EWX A;  1K0A A;  1S3A A;  3IPZ A;  2D2Z A;  2NTO A;  3UL3 A;  5IQY A;  5F05 A;  3FK8 A;  2FWF A;  4EDZ A;  4AJ6 A;  4GWR A;  5HFG A;  10GS A;  4POM A;  3D21 A;  5IMC A;  4Q5N A;  1K0D A;  4MF6 A;  3TJJ A;  1XVQ A;  3KJY A;  1PRX A;  4PUF C;  3M3M A;  1VGL A;  1X9W B;  2FD3 A;  4GSS A;  3KXO A;  5CYY A;  4ZL9 A;  1K0O A;  4OWY A;  4KGI A;  2GVP A;  4Z2U A;  2X8G A;  2HSH A;  3H4K A;  3L78 A;  1I5G A;  4WXT A;  1FW1 A;  1V98 A;  3UBK A;  1AQV A;  1NM3 A;  4ZB6 A;  2OE1 A;  2C1Y A;  2O8V B;  3A2W A;  2RUE A;  1B8X A;  4F2I A;  2PUK C;  1IYI A;  3VUR A;  5KN0 A;  4KDY A;  3DD3 A;  1XWA A;  3QFB C;  4F03 A;  4OFT A;  4ID0 A;  3BCI A;  3F8U A;  1ST9 A;  1YJ6 A;  3G7I A;  2H74 A;  3HDC A;  4IHU A;  4MPF A;  5IMZ A;  1EZK A;  2LST A;  5J9C A;  1QUW A;  3ZIT A;  1AC1 A;  1OKD A;  1GTA A;  2DBC A;  3UAR A;  3ME8 A;  5B6N A;  5ECO B;  5IIZ A;  1TU7 A;  5HR2 A;  4XRD A;  4O5R A;  2P31 A;  2X8H A;  4NV2 A;  4ISD A;  2H73 A;  5AN1 A;  2GQK A;  3FEU A;  3IE3 A;  5GAN D;  1KNG A;  4MH2 A;  1F2E A;  3R3E A;  3FMW A;  4PNG A;  2L6D A;  2H75 A;  4KB3 A;  1F3A A;  4K2D A;  2YJ7 A;  2JZS A;  2YWN A;  1THO A;  1HD2 A;  4KA0 A;  2VM2 A;  2L59 A;  1VF2 A;  1TP9 A;  3WGE A;  3P2A A;  1GH2 A;  3Q74 A;  4MZC A;  2LJK A;  4Z7X A;  1VRS D;  4PQH A;  3JCM L;  1BJX A;  2OAC A;  2R2J A;  4WF4 A;  4E8H A;  2P5Q A;  3GL5 A;  4MMM A;  2K18 A;  2FCH A;  3QDN A;  3LFL A;  1G7E A;  1Z9H A;  1V58 A;  2R0C A;  1GUK A;  1O6J A;  1TRS A;  5B8A A;  1WWJ A;  4MPG A;  5DCH A;  3DVX A;  4HJM A;  1FB0 A;  2QA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...