4XJEA

Crystal structure of ant(2") in complex with amp and tobramycin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
175
structure length
175
Chain Sequence
b'DTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AadB
publication title Crystal structure of 2''-aminoglycoside nucleotidyltransferase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/antibiotic
total genus 61
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4xjeA00
4XJEA 4WH5A 2FCLA 5CFUA 2EWRA 5CFTA 5CFSA 4HX0A 4FO1A 4WQLA 4WQKA
chains in the Genus database with same CATH superfamily
5IIOA 5B3PA 8ICTA 1R8AA 5D62A 1MQ2A 5CR0A 4DOCA 4IQWA 1BPBA 4XQ7A 4EGWA 4JWMA 8ICXA 4FHVA 4RPXA 5IIIA 3JPNA 4M9LA 3HJ4A 3OVSA 3MBYA 3C2LA 9ICRA 1ZQIA 2FCLA 3MDAA 1BPYA 9ICQA 2ZH5A 4UD4A 7ICNA 3EF2A 5J0WA 3JPSA 2O5AA 3MDCA 2BCUA 9ICJA 5DBCA 4K96A 3K7DA 5HHHA 4FH5A 3MGIA 3JCFA 4RWQA 3AUOA 1HUOA 4X4UA 4EBKA 4AT8A 1ZQEA 3UXNA 3V7JA 3ER8C 3AQMA 1JAJA 4RQ6A 4KLQA 4WC2A 4RQ3A 4RT2A 4LEZA 8ICQA 3ISDA 1KDHA 5DB6A 4M04A 3H38A 3HWTA 3AQNA 4WQLA 4XA5A 5IIKA 4TURA 4PGYA 5J0XA 5CFSA 9ICXA 5J2HA 5DBAA 3V72A 4QZEA 7ICIA 4X4PA 4I27A 2O1PA 5J2KA 1R8CA 4M2YA 5CP2A 5J0PA 2PFNA 2BPCA 2ZH1A 4IG8A 9ICSA 2BCQA 2BBHA 8ICBA 1MIVA 1ZQWA 4KLGA 4O68A 5DDMA 7ICEA 2BCVA 4TUPA 5IIMA 4QZHA 1BPDA 4QZAA 4F5NA 3HIYA 4M5DA 5J0SA 1UEUA 2BE3A 1JQRA 2ZH8A 9ICWA 4DO9A 4IQUA 7ICPA 4WQKA 4K4GA 8ICJA 3LQCB 4NLKA 2NRKA 4WC7A 1R89A 4Z6FA 9ICHA 1XSLA 3B0XA 4O67A 3JPRA 3H3AA 4KLFA 2GA9D 4RWPA 5DEDA 3OV7A 8ICUA 2ZH4A 5J2IA 1XSNA 5J29A 7ICQA 4NLNA 1ZQVA 5D63A 3UQ0A 4UB1A 2BCSA 4KLOA 4WCWA 4UD5A 3MCRA 4WBYA 3WFQE 2FMQA 2PFPA 4UBBA 4X4RA 4R63A 7ICVA 4TUSA 4IQVA 5CHEA 1ZQJA 3TFRA 3C2MA 2HN2A 5IIJA 9ICTA 4RPZA 1TVAA 4X4QA 5CJ7A 5CHGA 3C5GA 4EEBA 4QZIA 4Z6EA 1RPLA 4KLTA 3JZ0A 3JPPA 2DR5A 4MFAA 7ICUA 1ZQRA 8ICGA 4RQ1A 9ICPA 4F5RA 1ZQYA 2RFFA 5HRLA 9ICGA 2B4VA 1GPJA 5HC9A 4NXZA 4UB5A 4MFCA 2DRBA 5DB8A 4X4VA 1ZQZA 8ICEA 1HUZA 7ICJA 1BPEA 5IINA 5J0YA 3ISCA 4NM1A 1F5AA 4X0BA 3ISBA 4X4SA 2ZH2A 8ICSA 4XRHA 3ER9B 4P4PA 4K9BA 4DOBA 4LVSA 4RWOA 2ZHBA 9ICKA 9ICFA 4ATBB 4I2BA 4KM5A 1NOMA 8ICPA 5J0RA 3RJJA 3JYYA 8ICRA 9ICIA 2BPGA 3V7LA 4UB2A 2HN1A 4WH5A 4I2GA 4I2DA 5D49A 4LEYA 3C66A 3PNCA 1ZQBA 4RWNA 4I2HA 4QZ9A 2ZH7A 1Q78A 4OAIZ 2DVIA 3AU6A 8ICVA 5DDYA 4KLHA 3ERCC 4JLXA 5J2CA 4I2AA 4I28A 4K4HA 4KB6A 1R8BA 5F2VO 7ICTA 1MIYA 3C18A 3RJFA 4YD1A 1TV9A 3OWGA 2M2WA 4QZCA 4X4TA 2Q66A 3NKUA 4UBCA 2DR9A 3RJKA 4AT9B 4KLEA 3RJIA 5HRGA 4I0UA 4LEWA 4RQ4A 3JPTA 3UPSA 4YCXA 4GXJA 3UPQA 3B0YA 4X4NA 5HREA 4NLZA 5D4BA 3UQ2A 7ICKA 1ZQMA 1ZJMA 3MGHA 1BPZA 4ATBA 2EWRA 1ZQUA 4KLMA 1TFYA 2DR7A 4X4OA 3LK9A 4WC0A 5DECA 4XQ8A 8ICNA 4QZ8A 4UAYA 4FHWA 1BPXA 5IILA 4O5CA 1ZQGA 2BPFA 2P66A 9ICEA 4PHDA 4NKTA 4QZDA 2IUBA 1ZQLA 2FMSA 1ZQKA 2BCRA 4NXUA 2IHMA 2ISOA 1VJ7A 4HX0A 4Z6DA 2ZHAA 9ICLA 2ZH9A 4GXKA 4UAWA 3HJ1A 2ID1A 5BPCA 4QZBA 4NM2A 1ZQXA 4PGXA 3AU2A 4EV6A 5J2EA 3H37A 5J2AA 4I2JA 4JLZA 4M9JA 2M2TA 4FO1A 4FHPA 4AT9A 4FO6A 4E80A 5J2JA 3WFRE 4K4IA 1ZJNA 1FA0A 3NYBA 5CWRA 3L9DA 4RQ7A 5DB9A 1VFGA 2VANA 3OUYB 2ZH6A 1ZQHA 1ZQOA 8ICIA 2B51A 8ICLA 1OU5A 4N7RA 4K98A 4YMMA 2BBJA 7ICLA 5J2GA 1KEJA 8ICOA 4AT7B 4KLLA 4NXWA 4GXIA 3PMLA 3NVOA 3RJHA 2M2VA 1KNYA 1Q79A 4XUSA 4MF8A 4P2HA 3JPQA 4YMOA 1WOTA 9ICVA 8ICYA 4EP7A 4K99A 8ICMA 2I9GA 4E8FA 4OAFA 4I2FA 5HRIA 3WFSC 4TUQA 4KLUA 2W9MA 4F5PA 5J0QA 5HRHA 4KLIA 1UEVA 1ZQFA 2PBEA 4NXXA 3C2KA 4X0AA 4P4OA 4NY8A 5DB7A 9ICAA 4YN4A 1ZQPA 5BOMA 4OAGA 7ICGA 5B3QA 1ZQCA 4LEVA 5HR9A 1PX5A 3WFPA 8ICHA 2ZH3A 2PFQA 8ICWA 3OUYA 4NXVA 5D46A 2GWSA 9ICNA 1TFWA 4M9GA 2M2UA 4F5QA 4I29A 4PH5A 1YLQA 7ICFA 2IHOA 5CFTA 5CFUA 4LT6A 4LZGA 3TFSA 4WBZA 4AT7A 2DRAA 1NO5A 4WC6A 4O6AA 3PHZA 5JTGA 4EEDA 7ICSA 3V7KA 5DBBA 3CK6A 4FHYA 5TZVA 4I2CA 3RJEA 7ICMA 1ZQQA 1ZQSA 5CA7A 1MIWA 1MQ3A 4MFFA 4KLDA 3WFOA 1JMSA 4PGQA 3RJGA 3HX0A 1ZQAA 4PPXA 3C5FA 5J2BA 4I2EA 4KLSA 5J2DA 4WC5A 9ICOA 4PHPA 4M9HA 3GDXA 4WC4A 3RH6A 3AQLA 4F5OA 3RH4A 5HHIA 4I2IA 4XJEA 2PFOA 4RQ5A 4K8VA 4RQ2A 3UXPA 5CB1A 4UB3A 3JPOA 1ZQNA 4FH3A 4LZDA 4O5KA 8ICCA 3AQKA 4RQ0A 5HRBA 3H39A 4RT3A 1RZTA 9ICBA 4QZFA 5HRFA 3HW8A 4M9NA 1V4AA 4EBJA 3RH5A 4YMNA 2FMPA 5J2FA 4PHEA 5HRDA 4YD2A 4M0AA 7ICRA 3OVBA 4K9AA 9ICMA 4IQTA 2PXIA 3K75D 4S3NA 4RPYA 4R66A 3OVAA 4KLJA 2GAFD 4P4MA 4R65A 4M47A 3OGUA 4UAZA 1XSPA 9ICUA 5DKWA 4NXTA 4O5EA 4FHXA 8ICFA 5J0OA 3NWIA 4PHAA 4RQ8A 4Z6CA 1UETA 2ISPA 5HRKA 4O69A 4X5VA 5D61A 1JN3A 5EOZA 8ICZA 2HHPA 5BOLA 4AT8B 8ICKA 4WOYA 1ZQTA 4UB4A 3PMNA 4MF2A 7ICHA 4OAHA 3UXOA 2B56A 4WC1A 4R64A 2DR8A 5J0TA 7ICOA 4MKPA 4NKUA 4O9MA 4E7XA 8ICAA 4QZGA 4JWNA 4K97A 9ICCA 4DOAA 4WC3A 1ZQDA 5J0UA
chains in the Genus database with same CATH topology
5B3PA 4NXXA 4O69A 3OWGA 5D61A 4FO1A 4NXWA 5D62A 4O6AA 3NKUA 3MCRA 3ER8C 4OAGA 4K9AA 3PHZA 4XJEA 4WOYA 2B4VA 4WH5A 5B3QA 1GPJA 4LEVA 4K8VA 4LEWA 4LEYA 4WQKA 4OAHA 5CHEA 2GAFD 4NXUA 4K99A 2B56A 4NXVA 4LEZA 2FCLA 4O68A 4OAIZ 4HX0A 4OAFA 4O67A 3EF2A 4MKPA 4JLXA 4WQLA 3ERCC 3ER9B 4K9BA 2GA9D 4NXTA 2B51A 2IHOA 2EWRA 5CFTA 3K7DA 5CFUA 4N7RA 5CFSA 4KB6A 4K96A 4K98A 4K97A 4KM5A 4JLZA 5D63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJE A;  4WH5 A;  2FCL A;  5CFU A;  2EWR A;  5CFT A;  5CFS A;  4HX0 A;  4FO1 A;  4WQL A;  4WQK A; 
#chains in the Genus database with same CATH topology
 5IIO A;  5B3P A;  8ICT A;  1R8A A;  5D62 A;  1MQ2 A;  5CR0 A;  4DOC A;  4IQW A;  1BPB A;  4XQ7 A;  4EGW A;  4JWM A;  8ICX A;  4FHV A;  4RPX A;  5III A;  3JPN A;  4M9L A;  3HJ4 A;  3OVS A;  3MBY A;  3C2L A;  9ICR A;  1ZQI A;  2FCL A;  3MDA A;  1BPY A;  9ICQ A;  2ZH5 A;  4UD4 A;  7ICN A;  3EF2 A;  5J0W A;  3JPS A;  2O5A A;  3MDC A;  2BCU A;  9ICJ A;  5DBC A;  4K96 A;  3K7D A;  5HHH A;  4FH5 A;  3MGI A;  3JCF A;  4RWQ A;  3AUO A;  1HUO A;  4X4U A;  4EBK A;  4AT8 A;  1ZQE A;  3UXN A;  3V7J A;  3ER8 C;  3AQM A;  1JAJ A;  4RQ6 A;  4KLQ A;  4WC2 A;  4RQ3 A;  4RT2 A;  4LEZ A;  8ICQ A;  3ISD A;  1KDH A;  5DB6 A;  4M04 A;  3H38 A;  3HWT A;  3AQN A;  4WQL A;  4XA5 A;  5IIK A;  4TUR A;  4PGY A;  5J0X A;  5CFS A;  9ICX A;  5J2H A;  5DBA A;  3V72 A;  4QZE A;  7ICI A;  4X4P A;  4I27 A;  2O1P A;  5J2K A;  1R8C A;  4M2Y A;  5CP2 A;  5J0P A;  2PFN A;  2BPC A;  2ZH1 A;  4IG8 A;  9ICS A;  2BCQ A;  2BBH A;  8ICB A;  1MIV A;  1ZQW A;  4KLG A;  4O68 A;  5DDM A;  7ICE A;  2BCV A;  4TUP A;  5IIM A;  4QZH A;  1BPD A;  4QZA A;  4F5N A;  3HIY A;  4M5D A;  5J0S A;  1UEU A;  2BE3 A;  1JQR A;  2ZH8 A;  9ICW A;  4DO9 A;  4IQU A;  7ICP A;  4WQK A;  4K4G A;  8ICJ A;  3LQC B;  4NLK A;  2NRK A;  4WC7 A;  1R89 A;  4Z6F A;  9ICH A;  1XSL A;  3B0X A;  4O67 A;  3JPR A;  3H3A A;  4KLF A;  2GA9 D;  4RWP A;  5DED A;  3OV7 A;  8ICU A;  2ZH4 A;  5J2I A;  1XSN A;  5J29 A;  7ICQ A;  4NLN A;  1ZQV A;  5D63 A;  3UQ0 A;  4UB1 A;  2BCS A;  4KLO A;  4WCW A;  4UD5 A;  3MCR A;  4WBY A;  3WFQ E;  2FMQ A;  2PFP A;  4UBB A;  4X4R A;  4R63 A;  7ICV A;  4TUS A;  4IQV A;  5CHE A;  1ZQJ A;  3TFR A;  3C2M A;  2HN2 A;  5IIJ A;  9ICT A;  4RPZ A;  1TVA A;  4X4Q A;  5CJ7 A;  5CHG A;  3C5G A;  4EEB A;  4QZI A;  4Z6E A;  1RPL A;  4KLT A;  3JZ0 A;  3JPP A;  2DR5 A;  4MFA A;  7ICU A;  1ZQR A;  8ICG A;  4RQ1 A;  9ICP A;  4F5R A;  1ZQY A;  2RFF A;  5HRL A;  9ICG A;  2B4V A;  1GPJ A;  5HC9 A;  4NXZ A;  4UB5 A;  4MFC A;  2DRB A;  5DB8 A;  4X4V A;  1ZQZ A;  8ICE A;  1HUZ A;  7ICJ A;  1BPE A;  5IIN A;  5J0Y A;  3ISC A;  4NM1 A;  1F5A A;  4X0B A;  3ISB A;  4X4S A;  2ZH2 A;  8ICS A;  4XRH A;  3ER9 B;  4P4P A;  4K9B A;  4DOB A;  4LVS A;  4RWO A;  2ZHB A;  9ICK A;  9ICF A;  4ATB B;  4I2B A;  4KM5 A;  1NOM A;  8ICP A;  5J0R A;  3RJJ A;  3JYY A;  8ICR A;  9ICI A;  2BPG A;  3V7L A;  4UB2 A;  2HN1 A;  4WH5 A;  4I2G A;  4I2D A;  5D49 A;  4LEY A;  3C66 A;  3PNC A;  1ZQB A;  4RWN A;  4I2H A;  4QZ9 A;  2ZH7 A;  1Q78 A;  4OAI Z;  2DVI A;  3AU6 A;  8ICV A;  5DDY A;  4KLH A;  3ERC C;  4JLX A;  5J2C A;  4I2A A;  4I28 A;  4K4H A;  4KB6 A;  1R8B A;  5F2V O;  7ICT A;  1MIY A;  3C18 A;  3RJF A;  4YD1 A;  1TV9 A;  3OWG A;  2M2W A;  4QZC A;  4X4T A;  2Q66 A;  3NKU A;  4UBC A;  2DR9 A;  3RJK A;  4AT9 B;  4KLE A;  3RJI A;  5HRG A;  4I0U A;  4LEW A;  4RQ4 A;  3JPT A;  3UPS A;  4YCX A;  4GXJ A;  3UPQ A;  3B0Y A;  4X4N A;  5HRE A;  4NLZ A;  5D4B A;  3UQ2 A;  7ICK A;  1ZQM A;  1ZJM A;  3MGH A;  1BPZ A;  4ATB A;  2EWR A;  1ZQU A;  4KLM A;  1TFY A;  2DR7 A;  4X4O A;  3LK9 A;  4WC0 A;  5DEC A;  4XQ8 A;  8ICN A;  4QZ8 A;  4UAY A;  4FHW A;  1BPX A;  5IIL A;  4O5C A;  1ZQG A;  2BPF A;  2P66 A;  9ICE A;  4PHD A;  4NKT A;  4QZD A;  2IUB A;  1ZQL A;  2FMS A;  1ZQK A;  2BCR A;  4NXU A;  2IHM A;  2ISO A;  1VJ7 A;  4HX0 A;  4Z6D A;  2ZHA A;  9ICL A;  2ZH9 A;  4GXK A;  4UAW A;  3HJ1 A;  2ID1 A;  5BPC A;  4QZB A;  4NM2 A;  1ZQX A;  4PGX A;  3AU2 A;  4EV6 A;  5J2E A;  3H37 A;  5J2A A;  4I2J A;  4JLZ A;  4M9J A;  2M2T A;  4FO1 A;  4FHP A;  4AT9 A;  4FO6 A;  4E80 A;  5J2J A;  3WFR E;  4K4I A;  1ZJN A;  1FA0 A;  3NYB A;  5CWR A;  3L9D A;  4RQ7 A;  5DB9 A;  1VFG A;  2VAN A;  3OUY B;  2ZH6 A;  1ZQH A;  1ZQO A;  8ICI A;  2B51 A;  8ICL A;  1OU5 A;  4N7R A;  4K98 A;  4YMM A;  2BBJ A;  7ICL A;  5J2G A;  1KEJ A;  8ICO A;  4AT7 B;  4KLL A;  4NXW A;  4GXI A;  3PML A;  3NVO A;  3RJH A;  2M2V A;  1KNY A;  1Q79 A;  4XUS A;  4MF8 A;  4P2H A;  3JPQ A;  4YMO A;  1WOT A;  9ICV A;  8ICY A;  4EP7 A;  4K99 A;  8ICM A;  2I9G A;  4E8F A;  4OAF A;  4I2F A;  5HRI A;  3WFS C;  4TUQ A;  4KLU A;  2W9M A;  4F5P A;  5J0Q A;  5HRH A;  4KLI A;  1UEV A;  1ZQF A;  2PBE A;  4NXX A;  3C2K A;  4X0A A;  4P4O A;  4NY8 A;  5DB7 A;  9ICA A;  4YN4 A;  1ZQP A;  5BOM A;  4OAG A;  7ICG A;  5B3Q A;  1ZQC A;  4LEV A;  5HR9 A;  1PX5 A;  3WFP A;  8ICH A;  2ZH3 A;  2PFQ A;  8ICW A;  3OUY A;  4NXV A;  5D46 A;  2GWS A;  9ICN A;  1TFW A;  4M9G A;  2M2U A;  4F5Q A;  4I29 A;  4PH5 A;  1YLQ A;  7ICF A;  2IHO A;  5CFT A;  5CFU A;  4LT6 A;  4LZG A;  3TFS A;  4WBZ A;  4AT7 A;  2DRA A;  1NO5 A;  4WC6 A;  4O6A A;  3PHZ A;  5JTG A;  4EED A;  7ICS A;  3V7K A;  5DBB A;  3CK6 A;  4FHY A;  5TZV A;  4I2C A;  3RJE A;  7ICM A;  1ZQQ A;  1ZQS A;  5CA7 A;  1MIW A;  1MQ3 A;  4MFF A;  4KLD A;  3WFO A;  1JMS A;  4PGQ A;  3RJG A;  3HX0 A;  1ZQA A;  4PPX A;  3C5F A;  5J2B A;  4I2E A;  4KLS A;  5J2D A;  4WC5 A;  9ICO A;  4PHP A;  4M9H A;  3GDX A;  4WC4 A;  3RH6 A;  3AQL A;  4F5O A;  3RH4 A;  5HHI A;  4I2I A;  4XJE A;  2PFO A;  4RQ5 A;  4K8V A;  4RQ2 A;  3UXP A;  5CB1 A;  4UB3 A;  3JPO A;  1ZQN A;  4FH3 A;  4LZD A;  4O5K A;  8ICC A;  3AQK A;  4RQ0 A;  5HRB A;  3H39 A;  4RT3 A;  1RZT A;  9ICB A;  4QZF A;  5HRF A;  3HW8 A;  4M9N A;  1V4A A;  4EBJ A;  3RH5 A;  4YMN A;  2FMP A;  5J2F A;  4PHE A;  5HRD A;  4YD2 A;  4M0A A;  7ICR A;  3OVB A;  4K9A A;  9ICM A;  4IQT A;  2PXI A;  3K75 D;  4S3N A;  4RPY A;  4R66 A;  3OVA A;  4KLJ A;  2GAF D;  4P4M A;  4R65 A;  4M47 A;  3OGU A;  4UAZ A;  1XSP A;  9ICU A;  5DKW A;  4NXT A;  4O5E A;  4FHX A;  8ICF A;  5J0O A;  3NWI A;  4PHA A;  4RQ8 A;  4Z6C A;  1UET A;  2ISP A;  5HRK A;  4O69 A;  4X5V A;  5D61 A;  1JN3 A;  5EOZ A;  8ICZ A;  2HHP A;  5BOL A;  4AT8 B;  8ICK A;  4WOY A;  1ZQT A;  4UB4 A;  3PMN A;  4MF2 A;  7ICH A;  4OAH A;  3UXO A;  2B56 A;  4WC1 A;  4R64 A;  2DR8 A;  5J0T A;  7ICO A;  4MKP A;  4NKU A;  4O9M A;  4E7X A;  8ICA A;  4QZG A;  4JWN A;  4K97 A;  9ICC A;  4DOA A;  4WC3 A;  1ZQD A;  5J0U A; 
#chains in the Genus database with same CATH homology
 5B3P A;  4NXX A;  4O69 A;  3OWG A;  5D61 A;  4FO1 A;  4NXW A;  5D62 A;  4O6A A;  3NKU A;  3MCR A;  3ER8 C;  4OAG A;  4K9A A;  3PHZ A;  4XJE A;  4WOY A;  2B4V A;  4WH5 A;  5B3Q A;  1GPJ A;  4LEV A;  4K8V A;  4LEW A;  4LEY A;  4WQK A;  4OAH A;  5CHE A;  2GAF D;  4NXU A;  4K99 A;  2B56 A;  4NXV A;  4LEZ A;  2FCL A;  4O68 A;  4OAI Z;  4HX0 A;  4OAF A;  4O67 A;  3EF2 A;  4MKP A;  4JLX A;  4WQL A;  3ERC C;  3ER9 B;  4K9B A;  2GA9 D;  4NXT A;  2B51 A;  2IHO A;  2EWR A;  5CFT A;  3K7D A;  5CFU A;  4N7R A;  5CFS A;  4KB6 A;  4K96 A;  4K98 A;  4K97 A;  4KM5 A;  4JLZ A;  5D63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...