4XJEA

Crystal structure of ant(2") in complex with amp and tobramycin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
175
structure length
175
Chain Sequence
DTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AadB
publication title Crystal structure of 2''-aminoglycoside nucleotidyltransferase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/antibiotic
total genus 61
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4xjeA00
4WQLA 2EWRA 5CFUA 5CFSA 2FCLA 4HX0A 5CFTA 4WH5A 4FO1A 4XJEA 4WQKA
chains in the Genus database with same CATH superfamily
5HRFA 4PH5A 4JLZA 4IG8A 8ICMA 4UB5A 1MIYA 2HN1A 7ICRA 4QZ8A 4E80A 5D61A 4X0AA 4KLTA 4P2HA 3V7LA 5DECA 4N7RA 4WCWA 4GXIA 8ICCA 3UQ0A 5D46A 5J2KA 5J0WA 4O5EA 4KLOA 3V7JA 1BPBA 4IQTA 4O6AA 4PHDA 5HREA 8ICNA 8ICBA 7ICIA 4OAGA 8ICKA 1RPLA 2ISOA 2PFNA 2BPFA 4KLHA 4KM5A 4I2IA 5IIMA 4NLZA 3UXPA 3PMNA 3UPSA 9ICEA 4QZHA 1XSPA 2I9GA 8ICUA 4KB6A 4XA5A 4QZBA 1RZTA 4KLFA 9ICUA 5CHEA 4PPXA 4KLDA 5DKWA 3C2KA 4LEZA 2IUBA 5J2EA 5J2BA 4K4GA 1ZQRA 4KLLA 5J0QA 3JPPA 3LQCB 3MDCA 5HC9A 3ERCC 4FHYA 4X4OA 1ZQAA 2DR8A 3WFQE 4O5KA 4FO1A 4DOAA 7ICTA 4PHAA 1OU5A 4ATBB 5J2CA 4XJEA 7ICNA 3RJEA 3HX0A 4RWQA 7ICLA 4I29A 1ZQJA 5CJ7A 4O9MA 1ZQCA 3PMLA 4M5DA 1ZQYA 1NOMA 3RJKA 4WC1A 4DOBA 2ZHAA 4WOYA 3MGHA 5J2DA 7ICVA 1V4AA 3OVSA 5HRLA 1ZQWA 2FMSA 4MFAA 5B3PA 1ZQOA 1UEVA 4R65A 2ZH1A 4RQ1A 2ID1A 5HHHA 4I0UA 5HR9A 9ICTA 4XRHA 4QZEA 3H39A 3AQMA 4I2HA 5IIJA 4WC3A 1JMSA 5IIOA 5DDMA 3RJGA 9ICCA 7ICPA 3WFOA 4OAIZ 3NKUA 4Z6CA 4X4RA 2B56A 2BBJA 5IIIA 4K98A 3AQLA 4AT7B 5EOZA 5B3QA 4RPZA 1ZQZA 4DO9A 1ZQTA 2GWSA 3ISCA 4RQ0A 2ZH5A 4YCXA 4WBZA 4QZDA 4WC7A 9ICPA 4I27A 7ICQA 4JWNA 4F5RA 4KLGA 5DB7A 4RQ3A 4KLUA 5CFTA 4MFCA 2M2TA 3PHZA 4FHVA 2ZH2A 1HUOA 2HN2A 4NKUA 3NVOA 3C5FA 4FH5A 4JLXA 1ZQQA 2GA9D 4XUSA 1ZQBA 2BCVA 5JTGA 8ICJA 2O5AA 9ICSA 4NXXA 8ICWA 4QZFA 5BPCA 4RQ2A 3NWIA 4X4NA 1R8CA 4GXJA 4RPXA 4UBBA 4FH3A 4RWNA 4AT8B 4LVSA 8ICRA 7ICFA 5J2HA 4M9GA 8ICOA 2IHOA 3JPRA 3OVBA 2DVIA 8ICTA 9ICIA 4X4UA 4RQ5A 4I2BA 4I2EA 4NXTA 5IINA 4EEBA 4UD5A 2ZH9A 4PGQA 4MF2A 5DB8A 4X4QA 2ZHBA 3HWTA 1MQ2A 3AQNA 4K9BA 3OWGA 1JAJA 3V7KA 4I2AA 4UD4A 4RQ6A 3UXOA 3JPQA 4WBYA 2ZH4A 4E8FA 8ICYA 5J0TA 4Z6EA 9ICQA 5J2FA 2FMQA 7ICEA 2BCSA 4ATBA 2M2VA 4I2CA 4X5VA 8ICPA 4RWOA 4Z6FA 3JPOA 1YLQA 9ICNA 4JWMA 1TVAA 5DB9A 4TUQA 9ICGA 4NXUA 4KLEA 4X4VA 1WOTA 3CK6A 7ICMA 4IQUA 4DOCA 3WFPA 4X4SA 1XSLA 4F5PA 4WC2A 4RT2A 5J2AA 4NLNA 9ICWA 1NO5A 4KLSA 5HRKA 4NY8A 1Q79A 2EWRA 1BPYA 3AUOA 2HHPA 4EP7A 4K8VA 4QZCA 3OUYA 3ISBA 9ICXA 4UAYA 2PFQA 4UAZA 4RQ7A 4WC6A 4WC5A 5CB1A 9ICBA 3UPQA 2BE3A 4LEWA 4QZ9A 4O69A 3OUYB 3V72A 4M9NA 2DR9A 7ICSA 3RH6A 3RJHA 8ICAA 4MFFA 4M9HA 3B0YA 4AT7A 4KLMA 4WC0A 3WFRE 2PBEA 1R8BA 1KNYA 7ICUA 4Z6DA 4R63A 4EV6A 8ICEA 9ICRA 5CR0A 3H3AA 1ZJMA 1Q78A 4M04A 5DEDA 5F2VO 4R66A 4P4MA 4F5NA 1JQRA 3UXNA 2P66A 1ZQDA 3UQ2A 4FHWA 4X4PA 3PNCA 4TUPA 1PX5A 4EGWA 5J2JA 3C2MA 4NKTA 4LZDA 8ICHA 2DR5A 4NXWA 3B0XA 5CP2A 5HHIA 4OAHA 5D4BA 4UB4A 7ICKA 2BCQA 4UB1A 3C5GA 2BCRA 3OGUA 4FO6A 4AT8A 4NLKA 4FHPA 4TURA 3C66A 1MQ3A 4NXZA 4K9AA 4UAWA 7ICGA 5BOMA 1ZQXA 3GDXA 1KDHA 3HW8A 4HX0A 3AQKA 4YN4A 3L9DA 4YD1A 3TFSA 5BOLA 4K4IA 4P4PA 1BPDA 4OAFA 5D63A 4RT3A 1ZQFA 2RFFA 4R64A 4E7XA 2IHMA 4XQ7A 4YMMA 4X0BA 4PHPA 4RQ8A 1ZQNA 9ICHA 4AT9B 4GXKA 4I2FA 4IQWA 2VANA 4UB2A 9ICKA 1ZQKA 3HJ1A 8ICFA 4LT6A 5J2IA 7ICHA 1GPJA 5HRDA 3MBYA 1ZQMA 4O5CA 4YD2A 1FA0A 1UETA 1BPXA 5DB6A 4UBCA 4LZGA 3MDAA 4S3NA 1ZQLA 4QZAA 1R8AA 3JCFA 8ICIA 1BPEA 4LEVA 3RH5A 5J0YA 3NYBA 2Q66A 8ICZA 5J0SA 2NRKA 4XQ8A 4K97A 4NM1A 2O1PA 7ICJA 8ICSA 5CHGA 4M47A 4WH5A 1MIWA 1ZQPA 3ISDA 2GAFD 5TZVA 5DDYA 2ZH7A 4TUSA 4PGXA 1TFWA 1UEUA 2BPGA 3RJFA 4LEYA 3EF2A 5J0RA 2PXIA 1TFYA 1ZQUA 1R89A 5CA7A 3RH4A 3TFRA 4F5OA 3MGIA 4I2GA 4KLQA 4K99A 8ICLA 1ZQIA 2BCUA 2FMPA 1F5AA 5J0UA 9ICFA 4PGYA 4YMNA 5HRBA 4QZGA 2BBHA 5J2GA 5J29A 8ICQA 5IILA 1XSNA 3LK9A 3C18A 4RWPA 1MIVA 4IQVA 5HRHA 5HRGA 3ER9B 3K7DA 3ER8C 3HJ4A 5DBAA 3K75D 4M0AA 1JN3A 4NXVA 1ZQSA 4X4TA 8ICGA 4WC4A 1ZQEA 5J0OA 2PFOA 9ICMA 9ICAA 1VJ7A 1ZQGA 2M2WA 3MCRA 4YMOA 5CFSA 5J0XA 4P4OA 9ICLA 2DRAA 4NM2A 2B51A 5D49A 3JPTA 4I2DA 2B4VA 8ICVA 4K96A 3RJJA 2DRBA 5IIKA 1HUZA 9ICVA 1ZQVA 4EBJA 5D62A 4EBKA 4M2YA 4K4HA 2ZH8A 3JYYA 4I2JA 9ICOA 1ZJNA 2M2UA 1TV9A 4UB3A 1BPZA 5HRIA 3OV7A 4WQKA 2BPCA 4O68A 4F5QA 2PFPA 4FHXA 4WQLA 3JPSA 3WFSC 3H37A 4KLJA 1ZQHA 2ISPA 4MKPA 2FCLA 4M9LA 3HIYA 7ICOA 4RQ4A 4EEDA 8ICXA 5J0PA 1KEJA 3RJIA 1VFGA 3JZ0A 4QZIA 2W9MA 4M9JA 5DBCA 4KLIA 4RPYA 3AU6A 3JPNA 4MF8A 4AT9A 5CFUA 4PHEA 5DBBA 4O67A 4I28A 3C2LA 2ZH6A 3AU2A 3H38A 5CWRA 2DR7A 9ICJA 2ZH3A 3OVAA
chains in the Genus database with same CATH topology
4WQLA 2GAFD 4JLZA 4LEWA 4K9AA 4NXUA 2B51A 4KB6A 4O69A 1GPJA 4MKPA 2FCLA 4WH5A 2B4VA 4HX0A 5CFTA 5D61A 5CHEA 4WQKA 3ER9B 3K7DA 4K96A 2IHOA 3PHZA 4LEYA 4LEZA 3ER8C 3EF2A 4N7RA 4OAFA 4NXWA 5D63A 4WOYA 4OAHA 4NXVA 4OAIZ 2EWRA 3NKUA 4LEVA 5D62A 3ERCC 5CFUA 2B56A 4NXTA 4K98A 4O6AA 4K97A 4O67A 4K8VA 4JLXA 4FO1A 5CFSA 4OAGA 2GA9D 5B3QA 4K99A 5B3PA 4NXXA 4KM5A 3MCRA 4K9BA 3OWGA 4O68A 4XJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQL A;  2EWR A;  5CFU A;  5CFS A;  2FCL A;  4HX0 A;  5CFT A;  4WH5 A;  4FO1 A;  4XJE A;  4WQK A; 
#chains in the Genus database with same CATH topology
 5HRF A;  4PH5 A;  4JLZ A;  4IG8 A;  8ICM A;  4UB5 A;  1MIY A;  2HN1 A;  7ICR A;  4QZ8 A;  4E80 A;  5D61 A;  4X0A A;  4KLT A;  4P2H A;  3V7L A;  5DEC A;  4N7R A;  4WCW A;  4GXI A;  8ICC A;  3UQ0 A;  5D46 A;  5J2K A;  5J0W A;  4O5E A;  4KLO A;  3V7J A;  1BPB A;  4IQT A;  4O6A A;  4PHD A;  5HRE A;  8ICN A;  8ICB A;  7ICI A;  4OAG A;  8ICK A;  1RPL A;  2ISO A;  2PFN A;  2BPF A;  4KLH A;  4KM5 A;  4I2I A;  5IIM A;  4NLZ A;  3UXP A;  3PMN A;  3UPS A;  9ICE A;  4QZH A;  1XSP A;  2I9G A;  8ICU A;  4KB6 A;  4XA5 A;  4QZB A;  1RZT A;  4KLF A;  9ICU A;  5CHE A;  4PPX A;  4KLD A;  5DKW A;  3C2K A;  4LEZ A;  2IUB A;  5J2E A;  5J2B A;  4K4G A;  1ZQR A;  4KLL A;  5J0Q A;  3JPP A;  3LQC B;  3MDC A;  5HC9 A;  3ERC C;  4FHY A;  4X4O A;  1ZQA A;  2DR8 A;  3WFQ E;  4O5K A;  4FO1 A;  4DOA A;  7ICT A;  4PHA A;  1OU5 A;  4ATB B;  5J2C A;  4XJE A;  7ICN A;  3RJE A;  3HX0 A;  4RWQ A;  7ICL A;  4I29 A;  1ZQJ A;  5CJ7 A;  4O9M A;  1ZQC A;  3PML A;  4M5D A;  1ZQY A;  1NOM A;  3RJK A;  4WC1 A;  4DOB A;  2ZHA A;  4WOY A;  3MGH A;  5J2D A;  7ICV A;  1V4A A;  3OVS A;  5HRL A;  1ZQW A;  2FMS A;  4MFA A;  5B3P A;  1ZQO A;  1UEV A;  4R65 A;  2ZH1 A;  4RQ1 A;  2ID1 A;  5HHH A;  4I0U A;  5HR9 A;  9ICT A;  4XRH A;  4QZE A;  3H39 A;  3AQM A;  4I2H A;  5IIJ A;  4WC3 A;  1JMS A;  5IIO A;  5DDM A;  3RJG A;  9ICC A;  7ICP A;  3WFO A;  4OAI Z;  3NKU A;  4Z6C A;  4X4R A;  2B56 A;  2BBJ A;  5III A;  4K98 A;  3AQL A;  4AT7 B;  5EOZ A;  5B3Q A;  4RPZ A;  1ZQZ A;  4DO9 A;  1ZQT A;  2GWS A;  3ISC A;  4RQ0 A;  2ZH5 A;  4YCX A;  4WBZ A;  4QZD A;  4WC7 A;  9ICP A;  4I27 A;  7ICQ A;  4JWN A;  4F5R A;  4KLG A;  5DB7 A;  4RQ3 A;  4KLU A;  5CFT A;  4MFC A;  2M2T A;  3PHZ A;  4FHV A;  2ZH2 A;  1HUO A;  2HN2 A;  4NKU A;  3NVO A;  3C5F A;  4FH5 A;  4JLX A;  1ZQQ A;  2GA9 D;  4XUS A;  1ZQB A;  2BCV A;  5JTG A;  8ICJ A;  2O5A A;  9ICS A;  4NXX A;  8ICW A;  4QZF A;  5BPC A;  4RQ2 A;  3NWI A;  4X4N A;  1R8C A;  4GXJ A;  4RPX A;  4UBB A;  4FH3 A;  4RWN A;  4AT8 B;  4LVS A;  8ICR A;  7ICF A;  5J2H A;  4M9G A;  8ICO A;  2IHO A;  3JPR A;  3OVB A;  2DVI A;  8ICT A;  9ICI A;  4X4U A;  4RQ5 A;  4I2B A;  4I2E A;  4NXT A;  5IIN A;  4EEB A;  4UD5 A;  2ZH9 A;  4PGQ A;  4MF2 A;  5DB8 A;  4X4Q A;  2ZHB A;  3HWT A;  1MQ2 A;  3AQN A;  4K9B A;  3OWG A;  1JAJ A;  3V7K A;  4I2A A;  4UD4 A;  4RQ6 A;  3UXO A;  3JPQ A;  4WBY A;  2ZH4 A;  4E8F A;  8ICY A;  5J0T A;  4Z6E A;  9ICQ A;  5J2F A;  2FMQ A;  7ICE A;  2BCS A;  4ATB A;  2M2V A;  4I2C A;  4X5V A;  8ICP A;  4RWO A;  4Z6F A;  3JPO A;  1YLQ A;  9ICN A;  4JWM A;  1TVA A;  5DB9 A;  4TUQ A;  9ICG A;  4NXU A;  4KLE A;  4X4V A;  1WOT A;  3CK6 A;  7ICM A;  4IQU A;  4DOC A;  3WFP A;  4X4S A;  1XSL A;  4F5P A;  4WC2 A;  4RT2 A;  5J2A A;  4NLN A;  9ICW A;  1NO5 A;  4KLS A;  5HRK A;  4NY8 A;  1Q79 A;  2EWR A;  1BPY A;  3AUO A;  2HHP A;  4EP7 A;  4K8V A;  4QZC A;  3OUY A;  3ISB A;  9ICX A;  4UAY A;  2PFQ A;  4UAZ A;  4RQ7 A;  4WC6 A;  4WC5 A;  5CB1 A;  9ICB A;  3UPQ A;  2BE3 A;  4LEW A;  4QZ9 A;  4O69 A;  3OUY B;  3V72 A;  4M9N A;  2DR9 A;  7ICS A;  3RH6 A;  3RJH A;  8ICA A;  4MFF A;  4M9H A;  3B0Y A;  4AT7 A;  4KLM A;  4WC0 A;  3WFR E;  2PBE A;  1R8B A;  1KNY A;  7ICU A;  4Z6D A;  4R63 A;  4EV6 A;  8ICE A;  9ICR A;  5CR0 A;  3H3A A;  1ZJM A;  1Q78 A;  4M04 A;  5DED A;  5F2V O;  4R66 A;  4P4M A;  4F5N A;  1JQR A;  3UXN A;  2P66 A;  1ZQD A;  3UQ2 A;  4FHW A;  4X4P A;  3PNC A;  4TUP A;  1PX5 A;  4EGW A;  5J2J A;  3C2M A;  4NKT A;  4LZD A;  8ICH A;  2DR5 A;  4NXW A;  3B0X A;  5CP2 A;  5HHI A;  4OAH A;  5D4B A;  4UB4 A;  7ICK A;  2BCQ A;  4UB1 A;  3C5G A;  2BCR A;  3OGU A;  4FO6 A;  4AT8 A;  4NLK A;  4FHP A;  4TUR A;  3C66 A;  1MQ3 A;  4NXZ A;  4K9A A;  4UAW A;  7ICG A;  5BOM A;  1ZQX A;  3GDX A;  1KDH A;  3HW8 A;  4HX0 A;  3AQK A;  4YN4 A;  3L9D A;  4YD1 A;  3TFS A;  5BOL A;  4K4I A;  4P4P A;  1BPD A;  4OAF A;  5D63 A;  4RT3 A;  1ZQF A;  2RFF A;  4R64 A;  4E7X A;  2IHM A;  4XQ7 A;  4YMM A;  4X0B A;  4PHP A;  4RQ8 A;  1ZQN A;  9ICH A;  4AT9 B;  4GXK A;  4I2F A;  4IQW A;  2VAN A;  4UB2 A;  9ICK A;  1ZQK A;  3HJ1 A;  8ICF A;  4LT6 A;  5J2I A;  7ICH A;  1GPJ A;  5HRD A;  3MBY A;  1ZQM A;  4O5C A;  4YD2 A;  1FA0 A;  1UET A;  1BPX A;  5DB6 A;  4UBC A;  4LZG A;  3MDA A;  4S3N A;  1ZQL A;  4QZA A;  1R8A A;  3JCF A;  8ICI A;  1BPE A;  4LEV A;  3RH5 A;  5J0Y A;  3NYB A;  2Q66 A;  8ICZ A;  5J0S A;  2NRK A;  4XQ8 A;  4K97 A;  4NM1 A;  2O1P A;  7ICJ A;  8ICS A;  5CHG A;  4M47 A;  4WH5 A;  1MIW A;  1ZQP A;  3ISD A;  2GAF D;  5TZV A;  5DDY A;  2ZH7 A;  4TUS A;  4PGX A;  1TFW A;  1UEU A;  2BPG A;  3RJF A;  4LEY A;  3EF2 A;  5J0R A;  2PXI A;  1TFY A;  1ZQU A;  1R89 A;  5CA7 A;  3RH4 A;  3TFR A;  4F5O A;  3MGI A;  4I2G A;  4KLQ A;  4K99 A;  8ICL A;  1ZQI A;  2BCU A;  2FMP A;  1F5A A;  5J0U A;  9ICF A;  4PGY A;  4YMN A;  5HRB A;  4QZG A;  2BBH A;  5J2G A;  5J29 A;  8ICQ A;  5IIL A;  1XSN A;  3LK9 A;  3C18 A;  4RWP A;  1MIV A;  4IQV A;  5HRH A;  5HRG A;  3ER9 B;  3K7D A;  3ER8 C;  3HJ4 A;  5DBA A;  3K75 D;  4M0A A;  1JN3 A;  4NXV A;  1ZQS A;  4X4T A;  8ICG A;  4WC4 A;  1ZQE A;  5J0O A;  2PFO A;  9ICM A;  9ICA A;  1VJ7 A;  1ZQG A;  2M2W A;  3MCR A;  4YMO A;  5CFS A;  5J0X A;  4P4O A;  9ICL A;  2DRA A;  4NM2 A;  2B51 A;  5D49 A;  3JPT A;  4I2D A;  2B4V A;  8ICV A;  4K96 A;  3RJJ A;  2DRB A;  5IIK A;  1HUZ A;  9ICV A;  1ZQV A;  4EBJ A;  5D62 A;  4EBK A;  4M2Y A;  4K4H A;  2ZH8 A;  3JYY A;  4I2J A;  9ICO A;  1ZJN A;  2M2U A;  1TV9 A;  4UB3 A;  1BPZ A;  5HRI A;  3OV7 A;  4WQK A;  2BPC A;  4O68 A;  4F5Q A;  2PFP A;  4FHX A;  4WQL A;  3JPS A;  3WFS C;  3H37 A;  4KLJ A;  1ZQH A;  2ISP A;  4MKP A;  2FCL A;  4M9L A;  3HIY A;  7ICO A;  4RQ4 A;  4EED A;  8ICX A;  5J0P A;  1KEJ A;  3RJI A;  1VFG A;  3JZ0 A;  4QZI A;  2W9M A;  4M9J A;  5DBC A;  4KLI A;  4RPY A;  3AU6 A;  3JPN A;  4MF8 A;  4AT9 A;  5CFU A;  4PHE A;  5DBB A;  4O67 A;  4I28 A;  3C2L A;  2ZH6 A;  3AU2 A;  3H38 A;  5CWR A;  2DR7 A;  9ICJ A;  2ZH3 A;  3OVA A; 
#chains in the Genus database with same CATH homology
 4WQL A;  2GAF D;  4JLZ A;  4LEW A;  4K9A A;  4NXU A;  2B51 A;  4KB6 A;  4O69 A;  1GPJ A;  4MKP A;  2FCL A;  4WH5 A;  2B4V A;  4HX0 A;  5CFT A;  5D61 A;  5CHE A;  4WQK A;  3ER9 B;  3K7D A;  4K96 A;  2IHO A;  3PHZ A;  4LEY A;  4LEZ A;  3ER8 C;  3EF2 A;  4N7R A;  4OAF A;  4NXW A;  5D63 A;  4WOY A;  4OAH A;  4NXV A;  4OAI Z;  2EWR A;  3NKU A;  4LEV A;  5D62 A;  3ERC C;  5CFU A;  2B56 A;  4NXT A;  4K98 A;  4O6A A;  4K97 A;  4O67 A;  4K8V A;  4JLX A;  4FO1 A;  5CFS A;  4OAG A;  2GA9 D;  5B3Q A;  4K99 A;  5B3P A;  4NXX A;  4KM5 A;  3MCR A;  4K9B A;  3OWG A;  4O68 A;  4XJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...