4XJSA

Human cd38 complexed with inhibitor 1 [6-fluoro-2-methyl-4-[(2,3,6-trichlorobenzyl)amino]quinoline-8-carboxamide]
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
243
structure length
239
Chain Sequence
WRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFATSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 4-Amino-8-quinoline Carboxamides as Novel, Submicromolar Inhibitors of NAD-Hydrolyzing Enzyme CD38.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase, transferase
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
total genus 78
structure length 239
sequence length 243
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 4xjsA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4xjsA02
1KEUA 2JFHA 3NGXA 3W1VA 4QECA 3TFOA 1GYRA 4Y67A 1SAYA 3V2UA 3D3WB 2EWMA 1E7SA 1BVUA 4OSOA 4J7CA 5I7SA 1NFRA 3AOGA 4YQZA 1U8XX 1WXDA 4LCJA 5DOZA 1TT7A 2B5VA 2GZ2A 4FFRA 4F3YA 5T5QA 1XR3A 2JAHA 4K28A 4Y98A 1ONOA 2AG5A 1I2CA 3OJEA 1UDCA 3ZWOA 1N5DA 2PTGA 4XYGA 2ZIZA 1EQUA 2PGDA 3I5MA 5BNIA 5BNFA 4PG7A 1T1RA 5TC4A 1M6HA 3VH1A 1EVYA 3AM4A 3ASUA 2WYUA 4LSMA 4DTIA 4HNHA 4DGSA 3KZVA 1ZNQO 3GY0A 2VHWA 4TMFA 4OM8A 2CZCA 4TKMA 1E7MA 5JMWA 2QYSA 4PLZA 3FTNA 2P5YA 3ICPA 4WK6A 3VZPA 5JFOA 1QLHA 2P9EA 5TS3A 4KP7A 4BNXA 2VHZA 1WPQA 2VWHA 4GSKA 5GZ3A 5G0UA 3DZJA 5THKA 1H9AA 1A7AA 2J8ZA 3RUFA 1HKUA 1OZAA 1E3EA 1B16A 2D5CA 3JQ8B 1PGOA 4Q3AA 4CMEA 4YAKA 3C1TA 4XEHA 1A5ZA 1GFSA 4GKBA 1KBZA 2G76A 1VM6A 2YZ7A 4MINA 1CDOA 4O63O 4A27A 1EFLA 1Z7BA 4GMGA 2PLAA 3TOXA 3AUAA 3W4KA 3K9QO 3GFGA 2ZB3A 4R3NA 5A05A 1A9ZA 2D2IA 1A72A 3GVCA 5F1PA 3UF0A 3LLVA 1YONA 4KTTE 2HDHA 3JD4A 4DC0A 5ENVA 1NM5A 2CF5A 2I3AA 3WJ7A 1Z73A 4BS9A 3COSA 3WG9A 5JC8A 1ZIDA 2NSDA 2AEFA 3GUCA 2WSBA 1ADBA 3RBZA 3PZBA 2X6TA 1XSEA 2FY8A 4IGEA 4FJ0A 1SMKA 1X7GA 1G1AA 3OIDA 3FRJA 3CMCO 4RPLA 2CVZA 3H7AA 3F9IA 3GAFA 1AXGA 1ZKMA 2X9VA 5EN4A 3T7EA 4B3JA 4H16A 1V9LA 3IKVA 4X54A 2I6TA 2YV1A 4LISA 1H6AA 4FGSA 4J49A 3DBHA 4ROSA 3BMQA 4WNIA 5I8WA 1PJLA 2Q4EA 1EEHA 3IIEA 4YAIA 5KNLA 3LT2A 3S8MA 2C7VA 3WGGA 3KSZO 3FR7A 1K89A 1A4UA 5IN4A 2B37A 1UXKA 3F47A 1HDOA 1U3TA 3EVTA 1CETA 4JBHA 4CLOB 9LDTA 4WLEA 1EMDA 4R41A 1BW9B 4BO5A 2YQ4A 4QFDA 4AJKA 1I01A 3ZDFA 1NVGA 1ADCA 4NI5A 1GEEA 4PLWA 4XGKA 5F5NA 4CQLB 1ZEJA 3ZW9A 2X4GA 1ZMTA 4E2ZA 2O3QA 1BTOA 4RVDA 2JCXA 1FDSA 5DBIA 1NHWA 1N92A 1PWZA 2BGMA 2RIRA 1C1DB 2V6GA 4FPXA 3GT0A 4ESOA 3U09A 4PG4A 1LDMA 2YQ5A 3I3OA 3C3XA 3W6ZA 4RCVA 3TZQA 2C5AA 3E82A 1KIFA 5DCUA 3UCFA 1J49A 1LQUA 1VJ1A 1BG6A 1MXHA 2DBZA 1L1FA 3DO5A 3DFUA 2VUTA 4BNGA 5TRTA 5TF4A 4YYZA 2Y1OA 4N5LA 4Y8VA 4HXYA 1LX6A 3KEQA 9LDBA 2X5KO 1UZMA 2HLPA 3H5RA 3ZV6A 4ZRNA 3U4DA 1UXHA 3TN7A 4KDEA 4YT5A 4NQZA 3F5SA 5BSGA 3G79A 1YBAA 2Q2QA 4U6SA 3AI3A 3ZWYA 1NVTA 2WE8A 1AXEA 1SEPA 1VPDA 5CAEA 2J3HA 4FC7A 2WD7A 2C59A 2JL1A 3OQ1A 3GGGA 1H93A 4RV9A 4I5FA 3B70A 4D0RA 4ZGWA 4CLXA 5A02A 2YHIB 3PFFA 3I83A 4PLPA 4BB5A 1B7GO 1S7CA 4KOAA 2JCYA 1E7WA 1GCOA 2ILTA 1PL6A 1U1IA 7ADHA 4E4YA 1NR1A 3KYDA 3V2HA 4E6PA 4PLVA 4YJGB 4TVBA 4RVHA 1OFGA 3W4JA 5JLAA 1UJMA 2P4HX 3UW3A 1JDJA 3FBTA 2Y0DA 3MWDB 3UICA 4IDCA 4CMGA 1EVJA 2IZZA 4CM4B 4E30A 3DEYX 4XCVA 5G4LA 3VHRA 1C1XB 5FEUA 3BMCA 1CYDA 2CDCA 1QYCA 5KVSA 3VH4A 4ZICA 2OGUA 1O6ZA 4FFNA 4J0EA 3G17A 1HDYA 1ZXLA 3AM5A 3WGYA 2DTEA 4O5OA 1QORA 1WMAA 5A1TA 3G0OA 4XQEA 2VUSA 3U62A 3ROMA 3I9KA 5JO0A 2H6EA 3QWHA 2AE2A 4M1QA 3C7DB 5TJHA 1H94A 2GF2A 2Q1WA 2PZLA 1E6UA 4CLOA 1AHIA 4N7RA 4M87A 4D41A 5HTOA 3Q1LA 3PJEA 2ZTVA 3PYMA 1ZBQA 2E37A 1R4NA 3O8QA 3E5RA 4A5OA 3WNVA 1ZK0A 4NBVA 3NUGA 4E5YA 2Y99A 3M2TA 4WLFA 5H82A 2X23A 5FWNA 4XKJA 1ADFA 4AVYA 1OC2A 3MTGA 3GLQA 1YL5A 3Q9NA 1G0NA 3FNHA 5HBRA 4PN3A 4KUEA 5KVQA 2PGLA 1GV0A 2BI8A 1B2LA 4QO7A 2GUGA 3DL2A 2JD2A 4BO3A 5KJCA 1SEVA 3Q0EA 1IHXA 5DCYA 4RLHA 4GSLA 1ML3A 1NQOA 1UP4A 2BKAA 4ZHSA 2FMUA 4P4GA 1YBMA 3M1LA 1N2SA 4BNMA 1N7HA 1E1MA 3P2OA 3HUDA 3H5NA 5L53A 3KYCA 1XGKA 1JLLA 4YAJA 2IYPA 3PFWO 2PKRA 5I9MA 1ULUA 3OQ6A 4KTVE 1SNYA 1MG0A 2WD8A 2W4QA 2EKPA 1G0OA 3WICA 2HUNA 1DO8A 2WTBA 4J2OA 3ZH2A 1SZJG 3GOHA 4WLVA 1E7RA 2E48A 3TRIA 5AOVA 2VHYA 3B20A 4YR9A 5L3ZA 3ZHYA 1PS9A 3QP9A 1IE3A 2NV6A 1LI4A 5CEFA 3BYZA 2YFHA 4PLGA 5U1PA 1FK8A 3ANLA 3EK2A 3HDYA 1NWCA 1YJQA 5CDTA 2W2LA 1MB4A 3I6QA 3DZIA 1LC0A 3AY6A 4R51A 1OMOA 1YQGA 1XELA 2OP1A 3DR3A 4CLRA 3FBGA 1PX0A 3BTUA 1HE2A 4IDFA 4D7AA 2WDZA 2UUOA 3JQ6A 4MKXA 1JVSA 5IFLA 3D1LA 3HNPA 3ZWCA 5G4KA 3GPIA 2W2LD 1I32A 1P1IA 2NVUA 4WEOA 5JAMA 1M67A 3NT4A 1ID1A 4CM8A 3S2EA 4HX5A 1LSUA 2D8AA 4JP2A 5B1YA 3BIOA 5A9RA 2GERA 2UUPA 5I7VA 4W9NC 3RKUA 3DWFA 2VT3A 1ADGA 5B12A 1TEHA 2UYYA 4AJ1A 5T57A 5AXBA 2Y1GA 3KYDB 4BKUA 4KUHA 3L6OO 1V3TA 1F06A 4R01A 3LC2O 4ND5A 2EJVA 4AFNA 2VCYA 4KQXA 1YOVA 5B4TA 4OOFA 2O3UA 4XQCA 2C5EA 4TRRA 3ANMA 2E4AA 5FYDA 4XGIA 4DRYA 1JQBA 1MC4A 4MVJM 4WNCA 3TZKA 3W4IA 2A94A 1FDTA 2NQTA 4CLHA 3C8MA 3NT2A 3RUCA 4TROA 1P0CA 4J7XA 2JCVA 3GEMA 3KOUA 4W7HA 1UAGA 1VE9A 3BTVA 4G2NA 3I9LA 2Y1EA 3QVXA 4BNIA 5ITWA 1YGYA 2GLXA 1KVRA 5JCJA 3G3EA 3ZHZA 4I1IA 4BIIA 1V3UA 3OSUA 4ILKA 3TL2A 3WGHA 3ZU3A 4XA8A 3EUWA 1X14A 1VJ0A 1T25A 1RM0A 3JQAB 1KYQA 3WB9A 2HMSA 4JXKA 5KWEA 3PHLA 1X1EA 4JGBA 1M76A 4WOJA 1P1JA 5MGBA 1AN9A 4DMLA 1KC3A 4UUOA 1LDEA 4DYDA 5L4LA 2PY6A 4BKOA 5AQ1A 3D4NA 4NFYA 1NPTO 5A9SA 1X0VA 4R69A 3LVFO 4BOYA 4W4TA 3AUUA 1P31A 1T2AA 1ZZEA 3LT0A 4MVJD 3RC7A 4XWYA 3TJRA 4BO9A 4J1QA 4BO0A 5DBFA 2J3JA 1F14A 5FFFA 4TKLA 1R0LA 4J9UE 3DBVO 3NTOA 3OJFA 3RKRA 1C0LA 1U7HA 2CSUA 3KYCB 1DIAA 4CR8A 6ADHA 2DUWA 2JFFA 4UAGA 1PQPA 1XHLA 1ZH8A 2QHXA 3GMSA 2EGGA 2WM3A 4RL6A 4B4UA 3BMQB 3I4CA 1GTMA 3SC4A 1BXGB 3ETGA 2DQ4A 2WEKA 4NJOA 3CH6A 3GPDG 1SB9A 4FD3A 1Y8RB 3ENKA 4U8GA 2G82A 3GZNA 3LQFA 2TMDA 3NKLA 1QV7A 3VPHA 2GASA 4ZJUA 3HFSA 4PRLA 1LSJA 1M75A 3B1FA 1XU9A 5JCXA 5IDYA 3EW7A 4CV3A 1TLTA 3E03A 5DZSA 1GDHA 1GY8A 1DAOA 4RF4A 4DPKA 3PJGA 4CL8A 3PHJA 3FNEA 2VYNA 2AMFA 3GQVA 5TSDA 1GCUA 1YJ8A 1R15A 5TNXA 4XQGA 5A06A 5G2OA 2PKQO 2IODA 4B8WA 3WNQA 1HLPA 1UZNA 3RU9A 3GVPA 2HKIA 3GMDA 1P44A 3ETEA 4RPJA 5G0VA 3TSCA 4XGNA 1AE1A 1H6BA 5KJ1A 2IYOA 2OL4A 3E9MA 5JNLA 4UEOA 2QRLA 2X22A 3SVTA 3QWAA 3W8FA 4OIMA 1I3KA 3VVCA 3ZV4A 1UXGA 3MJVA 5IZ4A 2HMWA 1VI2A 4PLYA 3H5AA 3JQGB 3PHGA 5IF3A 5L51A 4I5GA 1CQJA 1TB4A 5EERA 1LBEA 2RCYA 1YB5A 4M49A 3HDHA 3CINA 1WDLA 4BO8A 3BA1A 2PZJA 1P0FA 2EKQA 3DMYA 4ZQBA 3DBLA 4G81A 2ZTLA 4WCDA 2LDXA 4ALLA 3IS3A 3HSKA 2FSVA 4EJ6A 4D45A 1HF3A 3C1OA 3MEQA 3DBLB 4IZHA 3C85A 4NR0A 3T4XA 1IPEA 2NVBA 1IYZA 3H9GA 4W7IA 4MP6A 5GMOA 4BMNA 3IKTA 1FXSA 3GC6A 4MP8A 2NTVA 4JJFA 2D3TA 2CDAA 5C3MA 5T6BA 1PGNA 4HBGA 5EIOA 5DP1A 4PRKA 2J5KA 5CEJA 4EJMA 2DVMA 4XIJA 2ZJ1A 3EY4A 1F0YA 2P91A 2Y0CA 5JXWA 3JQGA 1Y8QB 3SEFA 1LC3A 1WNTA 2SCUA 4WCFA 3HE3A 4J91A 4FW8A 3GG2A 4BNYA 4TRMA 2PH5A 1YO6A 3WQQA 1IY8A 1H2BA 1PZGA 2X0NA 3GZ4A 1YDEA 3FWNA 1GL3A 4MO2A 3NJ4A 4DQXA 5CDSA 1GADO 4J1NA 1UXJA 1XLTA 4J4HA 2VNAA 1NX6A 3G1TA 1PL7A 5H83A 1HETA 4XR9A 2V7PA 1A71A 4UREA 4HFRA 4Q3CA 3U4IA 2G1UA 2QIOA 2DFDA 2AEMA 3NRCA 4OL9A 1A7KA 3JD1A 1DLJA 4BKPA 4YJFA 3Q11A 4WCFB 4CQLA 1DRWA 4FC6A 1NVMB 4YJGA 1I8TA 3ANNA 4IZIA 1C14A 1EK6A 4MP3A 2HU2A 1DEHA 1GUZA 4FR5A 5BR7A 1MFPA 2IDZA 5TX7A 2YHIA 1GPDG 4KWHA 2PKQP 4IINA 1ZVMA 4N18A 4HKTA 4CMIB 1NQAO 1PEDA 3U4CA 1DC4A 2OP0A 1P1HA 3E9NA 5T8KA 4OYRA 2QW8A 5KOIA 4WJZA 5C7OO 1ZCJA 2NADA 2E82A 1Y6JA 1K0UA 1EK5A 4W82A 2POQX 1P1FA 1ZEMA 2EGHA 4BMSA 4D3FA 1I33A 2AEJA 3OEYA 4TVOA 2EXXA 4DPLA 1OAAA 4IMPA 4XYBA 5HRUA 4L9RA 3P7MA 1GU7A 1TVEA 4YXFA 3INGA 2XF8A 4HFMA 3RSHA 1QYDA 2X58A 3V1YA 2O4UX 4UVIA 4CLRB 1LLQA 5JDCA 3AY7A 3IUSA 3JYQA 3KRTA 1X15A 4B8ZA 4CM9A 1EBUA 4I9UA 3LK7A 3H9UA 3VH3A 4Z6KA 5I9NA 1L7DA 5KKCA 1ARZA 4ND4A 3Q3CA 1CRWG 4B3IA 2G17A 2OMEA 4O1MA 3QVOA 4IJUA 2QZ9A 3K8ZA 4L76A 1UDAA 3UFXA 1EVIA 3ZZNA 1PR9A 4J9VA 3QQPA 3FN4A 1JU9A 1VKNA 4JLWA 3E18A 3OM9A 1R4MA 2WYVA 4UUMA 2HK8A 4H15A 5ER6A 2NU8A 3ZCXA 2ZB8A 1I10A 5EJ2A 2VWPA 1JAXA 2FSSA 2DLDA 2I65A 3FCOA 1C0IA 1SPXA 3I23A 4JK3A 2X8LA 4ZA2A 4NIMA 4GI2A 4NK4A 5C7IO 4XB1A 1YKFA 4HFNA 4OO3A 1NWHA 3RCBA 1ZUD1 2V65A 4TRJA 5ILGA 3QIVA 4U5QA 2O48X 2YY7A 4LCEA 4W6ZA 2C2XA 2NNLD 3L6DA 3N74A 2DAPA 1LDNA 5JMPA 4MVJI 4DLBA 1Z6ZA 2Y67A 3K6JA 3PQDA 3PHHA 2HK9A 4BNTA 4MKZA 3GR6A 3FPLA 1ULSA 2VNSA 1ZFNA 1WP4A 4UULA 4F45A 4FJ2A 3RUIA 1K3TA 2I67A 1U5CA 2EEZA 5DT9A 2VTDA 4Y9DA 1HE3A 3DBRA 5ILOA 1HTBA 4E2XA 3JQ9A 5DNAA 1PJ4A 2LDBA 3PGXA 1LTHR 4BNWA 1WLYA 2O3RA 3GAZA 1C0KA 1PU2A 4IY1A 3A4VA 1Y1PA 4R9RA 2Q3EA 3FHLA 2DTDA 4IS3A 4MVJG 1H6CA 1ISIA 1JW9B 3HQ4O 4O0LA 1YQDA 4DBVO 1N1EA 1VC2A 4KZPA 4XIYA 4ZU3A 4JP3A 3OHSX 4J0FA 3TZHA 5ES3A 3HJAA 5JAIA 1QMGA 5FF9A 2FRDA 4B79A 1LSSA 1J6UA 3TZ6A 4IPTA 3KBOA 2D0IA 3D3EA 5A4DA 4XRGA 4R3WA 1O95A 4A73A 4KUGA 1LU9A 3L4SO 1D8AA 3W8EA 1JA9A 2O2YA 1R66A 3EGOA 3IDSA 1LLDA 2AQHA 4ALNA 1ZSVA 4J1TA 4YT8A 4QX6A 1XG5A 1E92A 3RROA 3PPIA 3ONFA 4J90A 4NK5A 2XAAA 5LDHA 3RC9A 4E33A 3JQFA 4LSWA 1ZK4A 2EHDA 1NTOA 4Z3DA 1U4OA 5AXDA 1HYGA 4DLAA 4IIUA 1RM3A 3A14A 2X9GA 3GDGA 4LVUA 5CDGA 1JWBB 1T24A 1HZZA 4IDEA 4XRRA 4CV0A 3LU1A 3F6YA 5G0SA 4LN1A 5L7YA 4AL4A 4E32A 4DIFA 4GMFA 4OGWA 4DXHA 1EZ4A 1A27A 1E5LA 1GV1A 2X0RA 3ORFA 4I9NA 2B0JA 3AFMA 2P4QA 1OBFO 3H4VA 1HYEA 4NDNE 1ONNA 4M8SA 5JCJD 3DXFA 2W90A 1DJNA 1FDUA 4J7UA 3BMNA 5MDHA 3K2BA 2WD7B 1GQQA 1MFZA 1Q0LA 2VQ3A 3VAZA 4CMIA 1VJTA 4FN4A 1KOLA 3WMXA 3L6EA 4BVAA 4L4XA 1WDMA 3KHUA 1SB8A 5L9AA 3D4PA 3FNGA 1B8PA 2HJSA 2VYVD 2O3SA 3EZLA 5EPOA 3RC2A 4Q9NA 2VTEA 1E6WA 4OAQA 5EQFA 3SC6A 1Q7BA 2DKNA 4XX0A 4IJKA 1PR3A 2FR0A 3ZU5A 3GEGA 4HFJA 5L4NA 4YCAA 4FJ1A 4S3MA 4DWVA 4E5MA 3HFGA 4GKVA 2C82A 5JY6A 1I30A 3DQPA 4MVJA 1BSVA 4OQYA 5JBIA 2VYVA 1PZEA 4NJMA 2PR2A 1JKIA 3QW2A 2RHRA 1N1GA 2AA3A 3EDMA 3OIFA 1E7YA 2A92A 3MJ4A 4WECA 3KM0A 4J4TA 1UP7A 3EC7A 1ENYA 3JQBC 2GN6A 4H7PA 3QVTA 5G4KB 5F21A 4LK3A 3SX2A 1GEGA 4HADA 4PLFA 5KJ6A 2JD0A 5DCWA 1L7EA 1ZXBA 1ISGA 3GGOA 1X7HA 4RORA 1R6DA 2FR8A 1R16A 2PD4A 1VL8A 4RF5A 2UDPA 3DMTA 4XR4A 3VC7A 2X0JA 4RF3A 2FOIA 3ZWNA 2QRJA 1LJ8A 4CM5A 4NFHA 4B3HA 2ZQZA 2YJZA 1EBFA 4R9SA 4UVGA 4I5DA 3GF4A 2VRCD 1QG6A 4A03A 4CUKA 5HS4A 3D4OA 4Z0PA 4CQMD 4WASA 3KETA 4CMHA 5CG2A 1Y8RA 5DN9A 3TNLA 1SC6A 3WWZA 2H9IA 3GNTA 2W8ZA 3GK3A 2PD3A 3FTPA 1EQ2A 4D0SA 2V6BA 3IJRA 3JCZA 4I9HA 4PZEA 4GBJA 4CM4A 3M6IA 5BSEA 3ZWPA 1KETA 4GGPA 3OEWA 2D1YA 1ZJYA 2VOJA 2ZQYA 4RDIA 4EJ0A 1GR0A 5K6AA 3LC7O 5B37A 1LA2A 1Y9AA 3WR5A 5KVCA 3TOZA 1UH5A 1I24A 3PQEA 1J0XO 1E3IA 2GN9A 2YHUA 3DZFA 1MV8A 4YB8A 4Z3KA 5A9TA 4A26A 2WWRA 1K6JA 4IS2A 4KMSA 5EESA 2X7HA 3Q2KA 2CNBA 3DTTA 4BGIA 4ND3A 4ZN6A 1NPYA 4W9NA 2B4QA 3D5QA 4QQRA 3S1LA 2X5JO 3GH3A 4XYLA 1PQWA 1CERA 5L95A 1OC4A 4IQGA 3PP8A 4D46A 3H9EO 2ZKLA 4JCOA 3X2FA 3VPXA 3JSAA 3F1LA 3NDRA 3ZU4A 4IXTA 3IUPA 5TJ9A 4CM1A 2QX7A 5T8KC 4OH1A 3VKVA 1BHSA 2R2GA 2PK3A 5EQDA 1BRMA 1KERA 1EE2A 4A7PA 4QFCA 5CFZA 1KY5A 4MVJP 3RJ9A 3INTA 3ZNQA 4CQMB 4BL5A 4YRBA 3WGIA 1PJQA 4K6FA 1DLIA 2J3KA 4YA6A 1IULA 4R68A 2WYWA 4Y6RA 4ZQHA 4D43A 8LDHA 1B15A 1DC5A 2YV2A 3ZWWA 4ZQGA 1LRJA 3HN7A 1AHHA 1MUUA 2C20A 5DOVA 1C0PA 2PNFA 1MLDA 1DFGA 1W73A 1HL3A 2IZ0A 1EVZA 4ND2A 4PZDA 3H9JA 1DOHA 1ZK2A 4Z0TA 5JS6A 2VT2A 3BHJA 1YB1A 1CJCA 3MJEA 4D3SA 3JQCA 3EYWA 1LLCA 4NPCA 3MTJA 1UUFA 4RO0A 4GVXA 4HV4A 3DC2A 1ZW1A 3HG7A 2NUAA 3EMKA 4DIBA 3KSUA 4IJWA 4YJHA 1U2GA 1Y9EA 3IL2A 4Y6PA 3VPGA 3GDFA 1WZEA 2Q45A 4GPD1 3KB6A 1LQTA 3VTZA 1YBVA 3DB2A 3ETDA 3RVDA 5I7FA 3RC1A 2XXBA 3SJ7A 3UKOA 3WSVA 1ZO8A 4CR7A 2XXJA 4GQAA 4CUZA 2CVQA 1I36A 4FFPA 4GGOA 1UP6A 4E12A 3JD2A 1XA0A 4CM3A 5ADHA 2JKVA 1QYVA 2Q2VA 4CM8B 3DHEA 2AQKA 3WIDA 4NBTA 3JQEA 1CWUA 3H2SA 4G5HA 1ISJA 1BGVA 1XKQA 3MWEB 4J4BA 3RUDA 3P19A 3VDQA 2Y66A 3B1JA 4YBZA 4EI2A 1E3JA 1Y5RA 3ZI0A 3LF2A 4MIOA 1P3DA 2O7SA 1YB4A 3VPFA 4NG5A 1P45A 3WSWA 1E3SA 2HMVA 4GL4A 5CPBA 3GN1A 3ROQA 1A4IA 2JAPA 4I8XA 3CTMA 3WYBA 4FDAA 1D1TA 3AU8A 4PLHA 4E0BA 2BFAA 4PLCA 2OO5A 2H5LA 2Q4BA 1F8FA 4M86A 1Z7EA 3E9QA 3KO8A 4GH5A 3QSGA 4LVCA 4Y6SA 3MZ0A 3D0OA 3TPCA 3ZHXA 3VDRA 3ZW8A 3UCXA 2HK7A 3JD0A 3KSDO 2EW8A 2HCTA 2VYND 4L75A 5FI5A 1QSGA 4OXKA 2Y1DA 1R0KA 1SOVA 5A5FA 4RZIA 5L45A 1H6DA 3UCEA 5JSFA 4BNJA 1I2BA 1I0ZA 3BAZA 1B3BA 2FZWA 3IOYA 1FJHA 4RPGA 5ER9A 1UDBA 3VPSA 3E8XA 3WGTA 2DFVA 1HT0A 2GGSA 4CMAA 1DHRA 1PIWA 5IDXA 3I9OA 2ZB4A 4P4NA 2BFMA 3SBOA 3KLMX 1R37A 2ET6A 3AK4A 3GG9A 2Y93A 1PZHA 2Y0EA 3P5SA 4CPDA 2BI7A 2QRKA 1ENZA 3H3FA 4NU5A 2ZCVA 4N5NA 4L73A 4DREA 2O2SA 3CEAA 3DBRB 3H8VA 4FBGA 1MXFA 3AI1A 2CFCA 3GZNB 4HWKA 4L4SA 4CV2A 3DBHB 4KQWA 4JX8A 4E31A 4PG8A 5TLSA 3PEFA 3O38A 1CQIA 3STHA 2Y1CA 4RPKA 8ADHA 3OBBA 2OZPA 1HLDA 2CVOA 5CEEA 3HB4X 2JFGA 1PS0A 1O89A 1ENPA 5GY7A 1K5HA 5JO9A 3HDJA 3GNSA 3GHHA 5JE8A 4RLSA 1X0XA 4EITA 3V5NA 1M66A 3QWFA 3TWOA 3JYLA 5AVOA 3PJFA 1PTJA 1LNQA 5CP8A 3LYLA 4U0JA 5L7TA 1FMCA 3O9ZA 3ZNNA 4WLNA 3RU7A 2WMDA 4A2CA 3EZYA 3ZWAA 1B8UA 2BGLA 4JROA 1ZK1A 2EF1A 1O5IA 4NU6A 1NASA 4PIVA 4J1SA 1IB6A 1RYDA 4DLLA 2FPPA 2P9GA 3E5MA 3AW9A 4DL9A 4R5HA 3FI9A 4RJTA 4PVCA 3K92A 4GX5A 3CKYA 3DHYA 1XWFA 3G49A 3TFQA 1DRUA 2EIHA 2IE0A 5CPFA 2PA3A 3RQSA 2O4CA 1VL6A 3QA9A 1DIBA 2NLOA 2Z1NA 4BO4A 4E2YA 3I52A 2HRBA 1HDCA 3RBVA 2P5UA 3UN1A 3A9WA 1TT5B 3NT5A 2FZEA 3V8BA 4UEKA 5TQVA 2NU9A 3I9MA 3WXBA 1LDGA 1WZIA 3DMTC 4IJVA 4UVEA 4UUNA 1PGPA 5JY1A 3JQFC 3TQHA 2CDBA 2BFPA 2BMAA 3DAGA 4BO1A 4BHTA 5HS6A 1XQ6A 3WYEA 5JAZA 4ITUA 1XU7A 3F5QA 3O03A 3X2EA 3LSYA 1J5PA 2ZK7A 2Z5LA 1K6IA 5A5EA 2RH8A 2GD1O 3A1NA 3OP4A 2AQ8A 3O8QB 3MOGA 4NNJA 3UAGA 3WS7A 1T2FA 1P9LA 3AJRA 1YOVB 1BXKA 3M1AA 3PYXA 5EMHA 1NAIA 2DBRA 4A10A 1B0AA 2CY0A 4RVSA 2OFPA 4QO8A 1YL6A 2GZ3A 3INRA 3U0BA 3VTFA 2B35A 3NYWA 2Q49A 3ABIA 4DIOA 2P68A 5IN5A 3W8DA 4YQYA 1DPGA 4BB6A 3IP1A 3ZWXA 2Y1FA 5ITVA 3K73O 3NJ8A 1P1KA 3ON5A 1V6AA 1VKOA 4YT4A 5I9LA 2JD1A 1SBYA 4OQZA 3PXXA 2NVUB 2RBEA 2E49A 3I6IA 4YACA 1O9BA 1GYQA 1GZ6A 3NEPX 4IBOA 4BNHA 4AJNA 1BDBA 1GZ4A 1YVEI 3AUTA 3KXDA 5IXSA 1V8BA 2J6IA 1B26A 2VRCA 3H9QA 5IDQA 4IM7A 3H3JA 3D7LA 4MJLA 2GN4A 2NU7A 5IJZA 2X5OA 1O0SA 4EGFA 4W99A 4II3A 1WAMA 4IDGA 1CIVA 1T2EA 1V3VA 3BZUA 1BMDA 3GA0A 4QSMA 1WVGA 5F3RA 3QHAA 4XQ9A 2V6MA 1WMBA 2PWZA 1NXQA 3JYNA 1GPJA 2AG8A 2NTJA 4ID9A 2O23A 4CM6A 4DPMA 3LT4A 2UAGA 3MJCA 5GZ1A 4EUFA 2CMDA 3DAPA 3PWZA 3PIIA 4CUJA 2YYYA 3BTOA 3RI3A 2TMGA 1DC3A 3G1UA 3ZHBA 1ISFA 3TL3A 1PJBA 2HJRA 4D3DA 4OMUA 5KJEA 3RUHA 4E13A 5BQFA 3WTCA 4QEDA 3WTBA 4BKRA 5CDYA 1NR7A 4I08A 2FHSA 1GUFA 3OH8A 4MVJH 4ALJA 1GAEO 1N9GA 5F1KA 5T64A 4IGFA 3PDUA 4JN6B 1N8KA 2EW2A 1KC1A 4HNGA 4RQUA 3RFTA 1RKXA 1HSZA 1E5QA 1B8VA 3DZHA 3BMOB 3OECA 4TZTA 5CG1A 4OXNA 5TT1A 4DVJA 1PJTA 4LW8A 4AJJA 1C1DA 3GFBA 4E2WA 1M6WA 4OKIA 2Q1UA 4L0QA 4BMVA 3JQDA 4J3FA 1R4MB 5JDIA 3Q6IA 1C3VA 1MC5A 3V1UA 1PSDA 4OKNA 3UH1A 2DT5A 2XPCA 2DBVO 4GLOA 2DTXA 1XQ1A 1E77A 4RQTA 1HZJA 1DSSG 4EZBA 4HP8A 2X86A 2C07A 3QV1A 3C7CB 5F5LA 4UVDA 3ICCA 4RZHA 1YXMA 4B7CA 1TXGA 1I2ZA 1CEQA 4MOWA 3R0IA 5I7EA 4BUCA 1QYXA 5IXYA 2PH3A 1D1SA 1I5RA 3ZGYA 2Y05A 4HY3A 4OHUA 3ZWVA 2GO1A 1XCBA 3L77A 3ADPA 4IMRA 3OIGA 4WE3A 2E6UX 3GN2A 4AJ4A 4MVJF 2W98A 1C1XA 4J16A 4PG6A 4CL3A 3NV9A 2A4KA 4C7KA 4E5NA 3JV7A 2UV8A 4CM9D 4IDDA 5KJFA 4OXYA 3NDJA 5A3JA 1YWGO 3RD5A 3V1TC 3KVOA 3MOIA 5ENDA 5BT9A 7MDHA 3JQ9C 2IEBA 3L4BC 2J5QA 3PHIA 1PJ2A 2G5CA 3OQBA 3AFNA 4TZKA 3SLKA 2O50A 1HDRA 2YV3A 1DC6A 3JQBA 2Q99A 4JNKA 3VZRA 4CJXA 2VHVA 1PWXA 1ENOA 2EP5A 3SJUA 5A9SB 2PGJA 4RVUA 3CPSA 3K31A 4DBZA 2ZATA 4XDZA 2DPGA 1QR6A 4BNNA 1VSUA 1LRKA 1PJCA 1IL0A 4BO6A 1E3WA 2Q50A 4RVGA 3U3XA 2CUKA 1HSOA 3DFZA 3TZCA 3WOHA 4FCCA 1IZ9A 2BF7A 3JQAA 1ISHA 4Q3EA 4YPOA 3RIHA 1P33A 1TT5A 1CF2O 4KDFA 2BGKA 3JTMA 1HE5A 1KVQA 2PZMA 3WMWA 4OSPA 4DYVA 5IAAA 1O94A 3CIFA 4GWKA 3FD8A 3CSDA 5B4UA 4ZD6A 1W8DA 4Q3DA 2HMTA 3K96A 4Z9XA 3V2GA 1Z74A 3GDOA 3N58A 5DBGA 3D5TA 3T7CA 4K6CA 4CM7A 1MA0A 4R1NA 1E1KA 3QY9A 4AG3A 3PWKA 4ND1A 1VRWA 4QTZA 3NTRA 4KWIA 4NBUA 4CMEC 2C2YA 3OA2A 3PWSA 4LGVA 1D7OA 5COBA 3FWZA 2JJYA 4CLDA 1JAYA 1YS4A 2WE7A 3F4LA 4XYEA 4DA9A 3CZMA 4R5MA 4WGGA 1NQ5A 5JDCC 2NQ8A 3OETA 1YL7A 4U0KA 1VL0A 3AU9A 1LLUA 1IHYA 1WW8A 1Z75A 2ZTUA 4IQ0A 2DM6A 5KVVA 4WPGA 3HN2A 3HDQA 5G0TA 5A3VA 3WQSB 1QKIA 2FP4A 3KLPX 3LZ6A 3RWBA 6LDHA 3RASA 4YAGA 3RFVA 1MP0A 1I3NA 4URFA 3FSRA 4P8RA 1R0SA 1D4FA 1ORRA 2OBNA 4IUYA 1RJWA 1W4ZA 1ZSNA 3NDIA 3S2GA 2FN7A 3BTSA 2Z95A 3QJ5A 4C4OA 3HHPA 3PVZA 5THQA 1EFKA 2CF6A 3WQRA 3AY3A 1GQYA 1U3WA 3EAGA 4EDFA 5GZ6A 3RUEA 5JAQA 2EP7A 2GR9A 2DC1A 5HWSA 4N54A 1DAPA 3R3SA 1X13A 1PJ3A 5TT0A 1ZSYA 2A35A 3GUYA 3OICA 3R3JA 4CMCA 1KY4A 4NMHA 3HADA 3KUXA 4Z0HO 5LDGA 1Q0HA 3KTDA 4BGEA 2QYTA 4BNLA 1ONPA 3Q9UA 1T4BA 4YRAA 3QVSA 1XIVA 3VOSA 2HO5A 3GRKA 4BNZA 3A28A 4FFMA 4JIGA 2D4AA 1PS8A 3IP3A 3TF5A 3ITKA 2Q1SA 3OJ0A 3PQFA 4EW6A 1UR5A 1NQTA 5LC1A 5BNTA 3WBBA 1QV6A 2BRUA 1DFHA 4BQPA 3PIDA 5C37A 3WGQA 2P9CA 2X1HA 4EUEA 2B4RO 1PZFA 1HWYA 1UZLA 5TGDA 1DBVO 3DOCA 5KIAA 4XYMA 1ZJZA 3LC1O 3NX4A 3GVIA 2FPIA 3F3SA 3PI7A 4Q3NA 3RAJA 4PG5A 1R12A 2DUUA 4K1LA 2D59A 5COAA 3UXYA 3BMCB 5JDIC 2X0IA 4M55A 3BMOA 3WFIA 4NJMB 4FSHA 2F1KA 3CE6A 3JQ8A 3ONEA 4FFOA 3WBFA 2XOXA 2HQ1A 1PGQA 4GAEA 4BNFA 4IDBA 5DF1A 4UEJA 4AJIA 1F12A 1Z82A 1XDWA 2EG9A 1QXSA 4WKGA 2NTNA 3QWBA 5DP2A 4CLEA 1X7DA 1GYPA 1IZ0A 3I1JA 3R6DA 5T67A 3R1IA 3C7AA 1PGJA 4BGVA 2WJPA 4GX2A 4GX1A 1EUZA 5JC1A 4BGUA 3E1KA 1GD1O 4NHEA 2H1SA 1TA4A 3GEDA 1O8CA 4XJSA 1SO8A 2NWQA 1Z45A 5U4QA 4RF2A 1BWSA 3QE3A 5EINA 4MIEA 1W0CA 1H9BA 3DDNA 5KCZA 4FQ8A 2J5RA 3IC5A 2VZ9A 2D5AA 3MJTA 4WLUA 3I9NA 3ZWMA 1RM4A 3JD3A 4RGBA 4OOEA 4P22A 2GYYA 3L07A 4FIZA 1V35A 4WOKA 3ZNPA 4UVHA 3PDJA 5TIIA 1T26A 4EUHA 4E5KA 1H0KA 1Y81A 3C24A 3W6UA 1PQUA 1DB3A 3K2EA 4NBRA 1OOEA 3PTZA 3DONA 3D64A 1HDZA 1F17A 2RAFA 1LSOA 2NU6A 3OJOA 3OJLA 3S55A 4DMMA 3DZGA 4PCVA 2HAEA 3ROPA 1FDWA 2OOSA 3UOGA 3WGZA 1NYTA 3WFJA 1UAYA 2B4TO 4NFSA 3B6ZA 1NAHA 5HA5A 1ZMOA 3O26A 1NNUA 3T4EA 1Y7TA 3PLRA 4QT0A 4C7JA 1QYWA 4PLTA 4ALMA 5K9ZA 2B69A 1RWBA 3WWYA 1KEWA 2Y68A 4XZ3A 1J4AA 4OJNA 4EEXA 2RH4A 4FB5A 3PRJA 4CQMA 3JQ7B 1NBOA 1JKFA 1ZK3A 3GNQA 5C5IA 1HYHA 1LEHA 3L9WA 4E21A 4MDHA 3K5PA 3O4RA 2NVWA 3H2ZA 5JYEA 1JN0A 1K2WA 1U3VA 1P1RA 2DPHA 5JYDA 3A06A 5JW6A 4TSKA 2F00A 1T4DA 4XDYA 1Q0QA 4YTEA 3L0DA 3DHNA 2ZYDA 1DIGA 4N5MA 5LCXA 2GRAA 3UVEA 2BHLA 2VWGA 4YJDA 1V0JA 2FR1A 3JYOA 4K26A 4INAA 3PJDA 3ZV5A 1LDYA 2OUIA 3CMMA 1KEVA 1IOLA 1SOWA 4D42A 3L9XA 5IZCC 2IZ1A 2J3IA 5DDIP 3CUKA 3ULKA 2AHRA 4WCFC 3KYBA 4ZRMA 2ZTMA 4BKQA 4BV8A 1T2DA 1I3MA 1T2CA 2BLLA 1JVBA 4J43A 5COQA 2YDYA 2Q46A 3WIEA 4BQRA 2C29D 1PL8A 2BELA 1ISMA 1Y5MA 3WLEA 3WX0A 1DHTA 2PFGA 4F6CA 1E3LA 1JKJA 2EV9A 2I5PO 4TQGA 1MGOA 3H6KA 2IEDA 4UUPA 2O3TA 1BXZA 1DFIA 1HRDA 4DC1A 2GZ1A 1KVTA 4AJEA 1FDVA 2I76A 4JJIA 1IUKA 4GVLA 1E1NA 4GLLA 2YFQA 1EDZA 1Q1NA 1U2DA 5KKAA 4DUPA 3DTYA 4YEDA 4EBFA 4CMKA 4RVFA 1WDKA 2A9FA 4A0SA 1M2WA 2C0CA 2I99A 2NACA 2IXBA 3PLNA 3HB5X 4LMPA 3IAHA 3CZRA 4L8VA 5G0WA 5K6AC 4RPHA 4JBIA 5IG2A 1JTVA 2C54A 2AQIA 2ZB7A 2OBYA 2PV7A 4CMBA 3KV3O 4GX0A 3ENNA 1DDOA 5L7WA 1KVUA 2ZCUA 3ITDA 3SLGA 5BSHA 1NP3A 4ALKA 4IXWA 3HZZA 4XB2A 1U7TA 5J23A 1LUAA 2NM0A 3ZN2A 3UUWA 4AJ2A 4J2HA 4B7XA 2CD9A 4II2A 2AXQA 1N7GA 2EJWA 3B1KA 2B36A 1W6UA 4XJTA 1UXIA 3LDHA 2FPGA 3U9LA 1VSVA 5A04A 1KS9A 4TWRA 4E5PA 2PD6A 3UGKA 3OA0A 3DOOA 1B14A 3NTQA 4JBGA 3M2PA 1RYEA 5EL0A 3ADOA 4ZVVA 4S1VA 1AUPA 4EYEA 3LT1A 2FWMX 2ZJ0A 5U9CA 1E0DA 4YJHB 3Q2IA 4G65A 1MG5A 1E6EA 2W2KB 4CMJA 3C1AA 2ZYGA 4U6QA 1DIHA 4FOSA 3S2IA 3JQAD 1HDXA 1H5QA 3JYPA 4K9DA 2PZKA 4ALIA 2B83A 1WWKA 2P2SA 4PZCA 4LRTB 2BD0A 1DRVA 2HSDA 1NHGA 2BFOA 3EVNA 4M89A 2C7GA 3FR8A 3F1KA 1RPNA 3MJSA 4YRDA 1VLLA 3U49A 1PJSA 3ST7A 2EERA 4R1UA 5L4SA 4H3VA 3ROKA 2OXIA 2VRBA 1MX3A 3QRWA 4B7UA 2VOEA 3FNFA 3QWIA 3ZWBA 4EEZA 3GHYA 1IPFA 2QZZA 1BDMA 1I3LA 2B5WA 4BNUA 4MVJE 2BH9A 3RJ5A 2I3GA 1Y8QA 1FF9A 1GUYA 1QLJA 3WDSA 4R4JA 1T1SA 4DQVA 4YAEA 4NBWA 3UHAA 5A03A 1X1TA 4ONEA 3SXPA 1Q2XA 2YUTA 3AUSA 4MKRA 4BO2A 2AE1A 4AICA 4E3ZA 3FPCA 5AYVA 3LF1A 3OF2A 5DULA 4F6LA 5CDUA 1SCUA 2X9NA 4J6FA 2DBQA 5HM8A 4JQCA 4BNVA 1EUDA 4U7WA 3RUAA 1U9JA 1XEAA 4DQUA 1DXYA 5I8ZA 3BHMA 4PGFA 3WLFA 5C7LO 5L40A 3DAFA 4I5EA 4P4LA 3AOEC 4AJLA 1HXHA 3DOJA 4FGWA 4NH4A 2R00A 4F46A 2W2KA 3ASVA 3E48A 4R16A 3ZV3A 3K30A 4M54A 1YDWA 3QLJA 3I4FA 4HUJA 2QQ5A 3GGPA 2GN8A 4IDAA 1YE3A 2IRWA 3JQ7A 1N9GB 4QUKA 1H2HA 2O7QA 3MCVA 3PZRA 4WLOA 1P74A 4YJFB 1DJQA 4Q39A 2YDXA 1LXCA 3QVWA 3S2FA 2I66A 2VUUA 2VN8A 3D3WA 3AOEA 3AM3A 5ICMA 3NGLA 2R6JA 3F4BA 4Z9FA 4IQ8A 5IZCA 5B4VA 1Q7GA 4YVFA 5IDWA 4FFLA 2GPTA 3GVXA 3VKUA 1E7QA 1QP8A 1NFQA 4MPDA 4O6VA 3PGJA 4P38A 1DIRA 4RDHA 5BSFA 4TRNA 3ONDA 1E1LA 2IXAA 3AI2A 3ZU2A 1TI7A 2HRZA 3CXRA 3H65A 1F8GA 3VVBA 3NAQA 1BW9A 4FOOA 2VZ0A 4CODB 2RHCA 2GNAA 4L74A 1EDOA 2OORA 3F46A 4JJGA 4MIYA 4YWJA 4AJOA 4D44A 2QG4A 2VZ8A 1HE4A 1S6YA 3GRPA 1HEUA 3IQDB 1LDBA 2YW9A 1GQ2A 2GSDA 1AGNA 3WJAA 4L4RA 1U8FO 2I9PA 2UVDA 2VHXA 3TDKA 4Z9YA 1XYGA 5FI3A 3U4HA 4XD2A 1NPDA 3AWDA 2H63A 3U5TA 2EKLA 1KVSA 4R1SA 5ICSA 3BXXA 4B4VA 3LLSA 2AW5A 1A9YA 1BXGA 2Q2WA 3DZKA 1YRLA 3RBXA 2JHFA 3BHIA 1U5AA 5AXAA 3L4BA 3PYLA 3VZSA 3WGOA 4D79A 4NZ9A 3OMLA 4GWGA 1NFFA 4B4OA 3OFSA 1KEPA 2V6FA 5H81A 3P2YA 1Q7CA 1P77A 3E6AA 5KTKA 3IMFA 4AJPA 3VZQA 1G6KA 4PFJA 3WYCA 1GZ3A 2O3JA 4ZQEA 4WUVA 3FF4A 4YT2A 1U28A 2Q1TA 4BO7A 2GDZA 4PVDA 4AJHA 3PK0A 3HWRA 4QXMA 5F1OA 1U4SA 4B4WA 4R1TA 3BMNB 3DZBA 4BNKA 2Z1MA 2G0TA 2ZYAA 1K6XA 1R4NB 2JHGA 4R54A 4YDRA 4BV9A 4CV1A 1OI7A 1U3UA 3I9JA 2OHXA 4WEQA 4Q3BA 5K0ZA 1B3RA 3N7UA 1HDGO 4FS3A 4LMRA 2HMUA 3RFXA 4ZQFA 1RM5A 1JWAB 3EHEA 1YQXA 3VH2A 1EUCA 5AXCA 2GCGA 2DU8A 1BVRA 3ZNOA 3IJPA 4LRSB 1QRRA 1YH3A 4O59O 2R00C 2VWQA 1LRLA 5CHEA 4IIVA 1EE9A 1E3WB 3GVHA 4CR6A 3KEOA 5JPIA 1D3AA
chains in the Genus database with same CATH superfamily
3HUUA 4H7KA 2JFHA 3NGXA 3S2UA 3UA3A 4JV5B 1S0UA 1SU4A 4QECA 4BLWA 2O9JA 2XUHA 4KYUA 3NCHA 3TFOA 1YI1A 3U1VA 3V46A 5AM1A 4EL0A 1EFPB 1E7SA 5ALWA 1BVUA 1P0MA 3QZUA 1FJ2A 2JDIA 4OSOA 5I7SA 1NFRA 3AOGA 3SJBA 4QPZA 1JH8A 1WXDA 1Q5PA 5DIZA 4FFRA 3BL5A 1YD7A 4AZ0A 3RSZA 8MHTA 1VCIA 2GESA 5M5BA 4XWGA 4K28A 2HIMA 1G8AA 2GXQA 3RG2A 2PUEA 5B57C 4PO3X 1SUSA 2ZXFA 4TKVB 3BRSA 3S44A 1UBOS 2O7RA 5FHRA 3L4EA 1N5DA 4HDSB 5E1BA 4BJ3A 3K0CA 4LQCA 1FNCA 1EQUA 2PGDA 2B82A 2QMYA 2WTXA 5DIFA 2HWWA 3BE8A 4MEJA 4R8KA 3CUTA 1U3CA 1ZX1A 1M6HA 4M1TA 5DO9A 2P2NA 1EGQA 1NZFA 5ERXA 4C01A 3NHZA 4Q24A 4WZ6A 5GONF 1E2JA 4P7JA 3ZE9A 1H3NA 5K3FA 4XM0A 5D85A 3T5DA 3OTOB 1J7JA 1LV7A 2PUAA 3PQ6A 4DA0A 5JD6A 3KELA 2Q7OE 4NZPA 1U2EA 2O8NA 4PFSA 1AK9A 4BMOB 5JMWA 4BYGA 2MCFA 4WK6A 1FPMA 1NMZA 1FXWA 2PLRA 3VZPA 1QLHA 1LK0A 5TS3A 5LZ2A 4KP7A 5E7QA 4RIFA 5KTRA 1ZITA 1PLJA 1WPQA 4RJJA 1F3OA 2VWHA 1I5OA 1YZVA 3ND7A 3SHFA 5AT1A 3GQBB 4Q37A 4C21A 2F8TA 4DR1B 4MRSA 2OZLB 4OQ4A 1E8DA 3RUFA 1DKRA 1RJ9A 3ZZ1A 2BFBA 4CG2A 4MRMB 3R75A 4Z53A 3ND8A 3NEAA 3QF7A 4G01B 3KXKA 1QX4A 1NKVA 4Q3AA 4Q48A 4CMEA 1Q74A 1UT5A 1N8NA 2HYIC 2DSNA 3A36A 9MHTA 1KSJA 3NP9A 1DAKA 1DZ3A 1P4SA 2FQQA 2G76A 1E5XA 5IYZA 5JZBA 5CIYA 1CDOA 4O63O 4MQ6A 4A27A 2GFHA 5KHLB 4GMGA 4EP1A 3W4KA 1QC5A 2GKGA 3LHSA 2QW1A 4M76B 2L0XA 3SZ3A 4CFYA 3DP7A 1A9ZA 4CCWA 5I7WA 3CVVA 3EVDA 2NNWB 1SXJD 3GWZA 4L95C 1L5HA 1JI0A 3LLVA 2HBYA 2KE5A 3A3YA 4XIIA 4A6PA 3VA7A 4FGKA 3LYHA 1TW2A 2HDHA 3JD4A 4I8IA 4KIJA 3RTBA 1O97C 5ENVA 1NM5A 3UBMA 4RK5A 3X1ZA 3WBJA 1QP0A 5T3UA 2H1FA 4Y0AA 3WZLA 4PO8A 3UYKA 1U8AA 1J8DA 3P8ZA 3THOA 3BXOA 2WSBA 1W5SA 3AP3A 3ESBA 4XFDA 2J48A 1JHUA 4MYRA 4EW2A 3NH6A 2VF2A 3IUQA 5I5GA 5SZKB 1TNDA 4DLZA 4TYYA 5DN6A 3GBVA 1E89A 4FJ0A 4LDQA 5J4KA 4H08A 3DLPX 3OIDA 4L5JA 4RPLA 3H7AA 3KSAC 3RT7A 1WU8A 2O2DA 2PUGA 1UMCA 3RVOA 3UH0A 3WLNA 1E2DA 2X2EA 1WBJB 4FCVA 4O4HF 4B3JA 1QK5A 3IKVA 1NF8A 4M1KA 2I6TA 2YV1A 4CDRA 1TE2A 2HXGA 2CHUA 3C6QA 5HCNA 3DBHA 3U44A 2ZAYA 4TXNA 2B61A 4YR7A 3SQMA 1EHIA 3F7TA 5JHHB 4WWHA 3R7WA 5INTA 3S3TA 1J9EA 1QQ5A 1Z4OA 4RGQA 3WGGA 3ZDCA 4NOJA 3KSZO 1PD0A 3KDPA 4OB8A 3DUFA 3RRNA 3F47A 5GIOE 2C9DA 3PRHA 4CLOB 1CETA 2FR8C 3TKLA 5FJIA 2CK3A 1ZBDA 3LKBA 4KOEC 3STYA 1Z33A 4FMCB 4R41A 4EENA 3NHUA 1BW9B 4LQDA 2YQ4A 4QFDA 1D6NA 4Q21A 4B48A 1HOXA 3DL4A 1NVGA 2ODNA 1QBKC 4ARZB 3R3HA 4P31A 4OYHA 3PE4A 3M33A 4DCNA 1A77A 4L6AA 1G7RA 3TKYA 2AOTA 1G18A 4AULA 1ZMTA 3KZMA 3F8WA 4LPSA 2JEYA 1RXIA 4N8SA 4E2ZA 4F3TA 2O3QA 4Q4CA 4LJYA 4RVDA 2GCNA 4WZAE 2XUPA 1WHSA 1XZ8A 3TR5A 5FTWA 5KDDA 2RIRA 2V6GA 1BHO1 4ESOA 3U09A 4YJ3A 3PXGA 1AC5A 1LDMA 1N2JA 5NLLA 5CA1A 1NNI1 3W6ZA 3OPXA 5BMOA 1QIMA 4N65A 1S8NA 4F5YA 5H3CA 4HDMA 3NJRA 2C5AA 1BKYA 2HA7A 1KIFA 5DCUA 3UCFA 5CVDA 1LQUA 1ZM3A 1P5JA 2YWFA 1VMKA 4RKQA 1VJRA 2Q0HA 4WXEA 1VECA 3ECCA 3Q12A 3DO5A 5AJYA 4F96A 2R25B 3HKBA 2Z6UA 4PBRA 3DFUA 3W7AA 2VUTA 3C1UA 3D6AA 3NKVA 4PXAA 1XZIA 3A1FA 2XVXA 3KTOA 4GC5A 5K3SA 4B17A 1V16A 3V4PB 4ZT5A 5JRZA 3KEQA 5CLJA 3R8CA 2X5KO 2HLPA 4ZRNA 2XMPA 3TN7A 4YT5A 3M1IA 2D1FA 2FUCA 3G9UA 1Z0KA 3AI3A 1VPDA 1AXEA 2QRMA 1SEPA 2WE8A 2G7MC 2YX1A 4C2BA 4ZXFA 1I7NA 3OQ1A 3TIXB 5CAEA 4AN4A 2CVHA 5EWMA 2OBFA 4X8OA 4D0RA 1AK2A 4ML3A 1L7BA 4FEGA 3OIYA 1FSGA 4GNRA 4GP6A 1TK2A 2D06A 1OW3B 2ADFA 3B8HA 3F74A 4PLPA 1KGDA 2CWWA 4BB5A 5E4JA 1Q20A 2BFWA 2JCYA 1E7WA 2OM2A 1GCOA 2ILTA 3PU6A 4M9SA 2Z9BA 1U1IA 2HFKA 7ADHA 4UZFA 1NR1A 2Q27A 5KNDH 4E6PA 3N3BC 2GEJA 2YWXA 1OFGA 3NNNA 3W4JA 5FUYA 4MJXA 3WRVA 1BYIA 4LXIA 3E8MA 2P4HX 4YRLA 1EG7A 3SEZA 2Y0DA 3U1BA 1OLUA 3ESZA 3I64A 2NSHA 4OXQA 4LJ5A 1IJBA 2O8BA 2Z3VA 3JYHA 1EVJA 2DETA 3DEYX 4L6CA 4XCVA 3RB8A 3VHRA 2QMUA 3M6AA 1VE7A 5FEUA 3D7MA 2YZMA 2E9SA 2C5LA 3FLEA 3BMCA 1Q2UA 5KVSA 3HC7A 1AF4A 1O8BA 1CZRA 2R1TA 1VI5A 4EY7A 1QF9A 3E2MA 4FFNA 4J0EA 3PC6A 4RSMA 3TBHA 4HWTA 2JJ2D 2PH7A 3MWDA 3AM5A 3QMPA 4UNPA 2DTEA 5EP4A 4TLDA 4BX9A 1YR1A 1WMAA 3RK1A 2VUSA 3FA2A 1F38A 3GA5A 4M1QA 3C7DB 4QOGA 5TJHA 1H94A 4GI1A 2XGMA 1RAHA 4RGVA 2GF2A 3RGWS 3IDZA 4BBPA 2Q8NA 1WXEA 3MMXA 4MVXA 4I4TB 4A0FA 3LE8A 1CUGA 2PJRA 4G0WA 2AFHB 3ZE7A 3UATA 1U0NA 1Q77A 2JI4A 2QUIA 1E9EA 1JJIA 3R76A 4ANFA 4NX2A 1GA6A 1ZBQA 2E37A 1EIZA 1RBYA 1V45E 3FMFA 3WNVA 1IG0A 3BFPA 4X1KA 3K0KA 4A5OA 1GKKA 3Q1KA 5ILQA 4E14A 3S28A 3AEKA 2ZR0A 2PSFA 4C6TA 4BX2A 5KSYA 2Y9PB 1XPRA 1PL0A 2R8OA 2ZI3A 2WG2A 4XKJA 4D74A 2QRVB 1ADFA 4AVYA 2I8LA 1BE0A 5ALDA 1CBUA 1G0NA 4ARVA 1RQXA 3DE6X 5FA8A 1ZNZA 4YQFA 4PN3A 4KUEA 1XPOA 2A0FA 5KVQA 2BI8A 5KJCA 5LQAA 1BA3A 2XUJA 3DL2A 2JD2A 3MIZA 4LHXA 1V11A 1IHXA 3BSSA 4Q1AA 3IAEA 5EZYA 4A2PA 4YHHB 2ZRFA 1JHQA 3MJFA 4CTKA 2R87A 1ML3A 1UP4A 1B93A 5EVCA 3TLEA 3KG2A 1JLLB 4P4GA 3UT5B 2FW8A 4CI0B 4KRXA 3C5CA 2RGXA 5JJKA 4RV4A 4G0PA 2O2HA 5AICA 3KYCA 2PRJA 3LJKA 3DOHA 2OECA 2PKRA 4QUAA 2QX8A 3NALA 1BX0A 1R9NA 2B9EA 2QE6A 3O1LA 1SNYA 3X44A 1TKRA 2WD8A 4K6MA 3AZOA 1G0OA 4WL0A 3NPMA 4X6XA 2AVDA 4UHBA 2W48A 4J2OA 3ZH2A 1YB7A 5AWFC 3TRIA 3ZBPA 3N59A 4E46A 5AOVA 2VHYA 2OFWA 1QG0A 1ZW6A 5L3ZA 2H0QA 1XRRA 1XZDA 4G9BA 2OEPA 4LRWA 5FT9A 1USWA 3V4VB 5EIXA 5U1PA 2WBLC 1AY0A 2IDKA 1Y7PA 3EK2A 4CIVA 4DC9A 2CMGA 2ZYRA 2D2EA 3D3QA 1NVUQ 5ICCA 1CJTC 4L22A 2Z83A 3Q10A 2WAMA 2F3QA 2QQFA 1T9GS 3AJEA 3I6QA 4MS1B 5KAPA 1NXOA 4YAFA 621PA 4YECA 2QVLA 4JR2A 1OMOA 3SIWA 4YNBA 2XV1A 2W2MA 3LGXA 1WCIA 3DKIA 4LJ7A 1E0AA 3DR3A 4AAYA 4CLRA 3FBGA 3OE4A 2Y0BA 1PX0A 3H1EA 1HE2A 4IDFA 4QPPA 2BCEA 1LS6A 2UUOA 3JQ6A 1M6EX 1OI2A 2PKEA 2QPOA 2W00A 2A5JA 3KD3A 4E1AA 2Z5VA 3DZDA 3HNPA 3ZWCA 2HJ9A 1N2CB 4KFRA 2QV7A 5GP1A 3H0KA 3BPSA 4BWVA 5IVIA 4DZRA 1M67A 3NT4A 3RSOA 3C5WP 3OTHA 4BEJA 1FY2A 1CS4C 1LSUA 4S04A 2XE6A 2D8AA 3AKEA 3FZYA 1I7LA 4K6GA 2UUPA 3L1KA 5LKAA 3BGSA 3KQNA 4XWKA 3ZD7A 1EP9A 3T5TA 1AKMA 1ADGA 1TEHA 2GPAA 4IOKA 3GLIB 2EATA 2GHRA 1ZD3A 3KYDB 4J75A 3FDZB 1L8LA 3ZDZB 1IHDA 5GINE 3LFTA 1V3TA 3P32A 2GFQA 4KEAA 5IJXA 1EK0A 4ND5A 2EJVA 4RJLA 4B6EA 4OBEA 1YQTA 4C88A 2M6LA 2WQ7A 2ZRMA 4UQLA 3E4DA 1YOVA 1GRVA 3HI6A 3IURA 3OPYB 3UHPA 4FZJA 2O3UA 4ZP1A 1CUVA 1JIXA 1IY9A 1T9AA 2IUTA 4ZOQI 3HBMA 4YDSA 1DRJA 1YK1A 1ZQ1A 4BAUA 1AV7A 1JQBA 3TZKA 4ZTZB 1Y63A 1A8UA 3CUEF 2WU4A 1M1YA 1DX6A 2OHFA 3R77A 4GIBA 2JEZA 4Q1VA 2BHRA 2IOYA 2IW3A 1EFDN 2VAMA 1Y9JA 2WF7A 4PCLA 3HHEA 4LHWA 2JCVA 3GEMA 2EX0A 4W7HA 2IX9A 1QCCA 1UAGA 2VS1A 5CT4A 5FWDA 4PX5A 1FW6A 3ADDA 1UJNA 2ZJ4A 3BTVA 3ED1A 2PRZA 1K9VF 3B2EA 4G2NA 2Y1EA 5SYMA 4BASA 3QVXA 4XD7A 4TV8B 1HG1A 5ITWA 3K70D 1KVRA 3DBIA 2WWIA 3FOZA 2HCFA 4EFNA 3G3EA 1N4DA 3ZHZA 4LYDA 5H80A 3CLSD 1I4OA 3ZU3A 2H2FA 4WIAA 5BXQC 1NE2A 4EA8A 1PK8A 2XVZA 2J67A 4R7GA 3EQ2A 1U7WA 1LF0A 2J0EA 3KQUA 2WD9A 1VJ0A 1T25A 1FU7A 1DBPA 3ES9A 4ZHQB 1PEYA 1AUXA 4EHJA 4MQMA 1KYQA 1CRZA 1Y9DA 5KWEA 3M83A 1X1EA 2IP2A 3SQLA 4C05A 4BLVA 3BWCA 1P1JA 3R6GA 3GMTA 5DNCA 1YVPA 3CEPB 3GLHA 3KD2A 3WL7A 2QMHA 4BQEA 1I7SB 4E51A 1KBQA 3KEGA 2J59A 3EQ7A 4N5DA 3MLBA 4UUOA 1LDEA 5FYQA 2HNBA 4RVNA 2PY6A 1NQWA 3KWFA 4ITRC 4Q9HA 3E9ZA 4NBLA 3OCXA 1BWRA 4NFYA 1NPTO 3NBZC 4CT0A 5A9SA 4P92A 1NSTA 2VJOA 3NEJA 1CG6A 2QQEA 1BQEA 2EZUA 5BW8A 5AMXA 1RRKA 4AC9A 4MVJD 3CNEA 3K9WA 3KFLA 2V6JA 2MSWA 2I78A 3H2BA 1FP1D 1I3CA 4ZVQA 3T7SA 5AW1A 1P2SA 5DBFA 1B41A 1F14A 3QE9Y 1R0LA 1QIIA 3ZS8A 3ZGNA 4DR4B 3ROXA 2CSUA 2NV0A 2ZAOA 3Q7EA 5B1HA 4B1FA 5JNRA 1E2BA 3KYCB 4D4JA 4CR8A 4P3XA 6ADHA 1AS3A 2B78A 1NI4B 2JFFA 4DRXA 1PQPA 5BRJA 2QHXA 3EASA 2KS6A 4QLOA 1N2IA 1ZCAA 2EGGA 2WM3A 3AFIA 3IV6A 4RL6A 5C1PA 5CITA 2O8EA 4N6OA 4Z49A 1E2LA 3QPVA 4KZKA 4B4UA 2VA9A 4CG0A 3CGGA 3SC4A 4F56A 4JQYA 4O08A 5EOVA 5KI6A 2DQ4A 4U00A 2X1LA 1RQ2A 2WEKA 3O4FA 1KHTA 1OLXA 1R0XA 2YIJA 1Z7WA 3DHVA 1SB9A 3GPDG 3IDOA 4QYIB 2C78A 2ZVPX 2JGDB 1LNZA 1JHXA 2WHRA 5CX1B 3BXEA 1M8JA 3LQFA 2AZTA 1P6QA 4LX0A 1LPMA 1QV7A 4P6VF 4RTSA 4F9EA 3OZVA 2JVJA 4JLNA 1QGOA 4ZJUA 4LJAA 1HT3A 4PRLA 4R7ZA 1LSJA 3U2QA 1TQ2A 2JCSA 3EIEA 3HH8A 3LBYA 4TTJA 1JSLA 5FOUA 2JASA 5HFJA 5IDYA 4ETIA 3ZV7A 1PFGA 1TLTA 4I4TA 2WM8A 2XNDA 2XRYA 4UU0A 3K9BA 4R40A 3PJGA 4QYMA 4CL8A 1MEOA 5KNCA 1UT8A 3FNEA 3W9UA 2AMFA 1KOJA 3PIRA 3Q7PA 5A06A 5I3ZA 1G1MA 2PKQO 3QLUC 2IODA 3WFZA 1U6KA 3ONNA 1UZNA 4DDTA 4AKIA 2HF2A 2OYSA 1EFHA 3IIIA 2VRWA 4WINA 5K3EA 3HM9A 5ED4A 3EWNA 2GEBA 3NHKA 1ECFA 4UUQA 3USCS 5LMCA 5LBIA 4R0VA 5KJ1A 2IYOA 3QKTA 2Y3IA 2GKSA 2OL4A 4N3NA 3ZW7A 4EDHA 3PJRA 4EQZA 3CB4A 4GL2A 4OJYA 2X22A 1NMXA 1A9QA 3HRIA 1SQFA 4NE9A 4Y9UA 2YRXA 2Q1YA 3OCWA 2WTNA 4NYMQ 4OIMA 5EG5A 1I3KA 4GSYA 3BL8A 1X1AA 3DWIA 5L3VA 4FBLA 3K6SB 3SBXA 1VA4A 2WVJA 3ZV4A 1L8OA 1UXGA 3QELB 4RNCA 5AIBA 4EGCB 2AJLI 1SG0A 3H5AA 3PHGA 4PX2A 4LE0A 2AJDA 3TLXA 3P4UA 1EX1A 2YCBA 1RWVA 1W75A 3R5SA 2C9YA 3KJQA 3A9SA 2J9YB 4I50F 4O1HA 5EERA 1P60A 1LBEA 4FCTA 2ES4A 1YB5A 3D8HA 5FUXA 2EU8A 4M49A 1L5MA 5AJZA 5IU6A 5EKUA 3CINA 3HU2A 4I5IA 2PIDA 3EF1A 1VSTA 4EY6A 5BSRA 3MT8A 3FMVA 1P0FA 1YA8A 1E9FA 1RLMA 1WZ2A 3DMYA 3ZE6A 1BS9A 1RWMA 4J8PA 3LX6A 4HATA 3P9QA 4LFCB 3FRHA 5HMLA 5CA0F 3ZJ4A 4EJ6A 3AL0C 3MEQA 3DBLB 4NR0A 1CDEA 3EDRA 1IPEA 4EHIA 1T9CA 1D4OA 4BRZA 5GMOA 5EJ6A 1RMQA 4M99A 3IKTA 4O4IA 3EXG1 3SICE 3QF4A 2XVAA 1JR3A 4F04A 1CR2A 1VIDA 3M4JA 4AXXA 4ARIA 4BMZA 1M8FA 1DQNA 1PGNA 2YHSA 3WKBA 4PRKA 4B0PA 2J5KA 4HCJA 5BMVA 5CEJA 2UUAB 2XMQA 2DVMA 3ZD9A 2YMMA 3CLUD 3WLSA 4N0QA 2BTQB 4EF4A 2LTAA 2QY9A 5JXWA 4ZI5A 2W11A 1P3JA 1J2JA 4BNYA 4TRMA 5CM9C 1A8SA 2PH5A 4MCIA 5CNJA 1YO6A 5KNBH 1IY8A 4ZEMA 3G9XA 5KPJA 3IQZA 4A6DA 4N0PA 2REOA 4MO2A 3NJ4A 4I7EA 2Q5OA 1R6BX 3X1KA 5JNWA 3QM1A 5K5EA 5LP1A 2I8CA 2PWPA 3MG9A 4Z4IA 4QM6A 4TTRA 1G98A 3BK1A 3G1TA 5LWHA 3QOFA 3WB1A 3BOSA 3IALA 1I9CA 4FNOA 5H83A 3UG7A 2QOEA 1O96B 4ZQCB 5IWAB 1A71A 4DSUA 2IWHA 4EUKA 1A8QA 2G1UA 3ACBA 4NICA 1Z17A 3L0BA 1OLUB 5GOZA 3WIOA 3NRCA 1XLWA 4G84A 5JD5A 3EDYA 1DLJA 2VBFA 1XVVA 4EYQA 4EG8A 2OAEA 4DLNA 1RQNA 1JJBA 2F4NA 1DRWA 5IKOA 3KJNA 3OZSA 3SZMA 2IYYA 4JI6B 1MT3A 3GCWA 4DB2A 4MLCA 1C14A 1SVLA 2OQ2A 3ECSA 2HU2A 2GPJA 1P80A 3OWHA 3STTA 1GUZA 1I7QB 3H99A 5F77A 5HQJA 2V7UA 5TX7A 1MABB 5LMZA 5AW4A 1GPDG 1WE2A 5C8XA 4KWHA 1G21B 2PKQP 3B48A 2J3QA 4IINA 3VU9A 5A4MS 1FL9A 2PEYA 5C4IA 3H2JA 4FYYA 4KQKA 1YS7A 5I51A 3W78A 3V8EA 3RAGA 3TMAA 3AR3A 2VUIB 4X84A 4OX9Y 4KPUA 1CLEA 2XUQA 3J80A 4DR6B 1UJ2A 4WJZA 3P9ZA 4EARA 1SULA 1URPA 2FW6A 2E82A 3QXSA 1RKBA 5FJJA 4MZDA 1P1FA 3BWYA 1RZRD 1AUVA 1DWUA 2R11A 2Z4SA 2YYSA 1OAAA 2H1CA 3VR4H 4L5IA 4MV3A 4XYBA 2C3PA 4L9RA 4M8IA 4ND6A 3P7MA 2SKCA 1TVEA 2J08A 2PNJA 1FB5A 1XZMA 3TBKA 1NQUA 1PJAA 3DDSA 2O0KA 3PPXA 4OBXA 2X58A 1E2HA 3EVGA 4UVIA 3IUJA 4L3OA 3EFBA 1PFVA 4EMBA 1DEXA 4KDCA 1FTGA 1MB2A 4I9UA 2ZS9A 3H9UA 1QRSA 5KKCA 3GLFE 3D4BA 4YRZA 2JLQA 4HSGA 5FNVA 3SWWA 2CEKA 3COZA 3TM4A 5K0JA 2GK4A 1CR6A 1F5SA 2G17A 4ZYWA 4O1MA 1PG2A 1KH2A 2Q5CA 3K8ZA 3T3OA 3ZZNA 3HVRA 4PPQA 4JLWA 1YR9A 4YCDA 2FKAA 3BRQA 3E18A 4DR5B 4UBMA 2ZJFA 3BXZA 4UUMA 2VR1A 3KFXA 4YQEA 1A50B 4RMIA 3ZCXA 2ZWOA 2NZWA 1E79D 2GK6A 3DDWA 4B0OA 2ZB8A 4MPPA 2OKGA 3HJCA 4W5TA 2VWPA 4YMHA 4O33A 2FSSA 2DLDA 5GGXA 5TE9A 4F5ZA 1VXOA 1XQVA 3I1YA 1SPXA 5A6SB 2RHMA 3RV4A 1THMA 2X8LA 1YTLA 3A9VA 5BWBA 4ZA2A 1K1EA 3IUEA 5FNVB 3E7WA 4HFNA 5CTAA 3EPLA 5MHTA 4ZOLA 1FEZA 1NBWB 1SKBA 3QIVA 1II8A 4U5QA 2C3OA 2UUBB 3KZCA 1OB5A 2CDNA 1KDZA 5I9SA 2ID4A 4W6ZA 3HABA 3URKA 2GCPA 2R7KA 1MAWA 3N74A 2DAPA 5JMPA 4MVJI 4DLBA 3PHHA 3HJFA 3GR6A 4UM9D 1ULSA 2D5IA 3T0FA 3JRNA 1Z3CA 3JW8A 3N75A 5E6SB 5FOTA 3RIYA 2DT8A 2NZ2A 2J7KA 4UULA 1AIPA 4FJ2A 3RVJA 2N3ZA 4B2LA 5KINB 2BJVA 3EEBA 3FJYA 2WKRA 3EXHB 1GQOA 3NHWA 2EEZA 4KPUB 3TPFA 4JUFA 1Z38A 1F0KA 5JXHA 1UDRA 2O8VA 3A58B 4Y9DA 3RT1A 3W3AH 5BYBA 1L3IA 1NV9A 4IWXA 4DUGA 5JCZA 5HDBB 3U7EB 2LDBA 1E0KA 2OGZA 3G7NA 3LVQE 3PKIA 1CZOA 2OAP1 3QLVA 1ZU5A 5IBQA 3RVSA 2LXNA 4IY1A 2P6PA 4BFCA 3BXPA 3A4VA 4B83A 3VHLB 2C98A 2Q3EA 2ZSDA 4A4DA 5DHFA 1QGDA 1Y3AA 3HQ4O 3ZGVA 6Q21A 3T1HB 2QLNA 3EIUA 3PCTA 5HJ2A 1OT5A 2XDQA 1WB5A 4CCYB 4DEVA 1RYHA 4Z4HA 3TZHA 3A6FA 4CEJB 1W0KA 4LSGA 2MR6A 2XZTA 1TFRA 1LSSA 1J6UA 4Q1CA 3OZFA 1IOWA 4DN6A 4FLEA 1LVGA 3LQ2A 3Q3JB 1R4AA 3X0DA 4R3WA 1O95A 1PR4A 1OE0A 4G89A 4KUGA 4TWJA 3TM5A 4A73A 3QSYA 1KTIA 4JLUA 3FDFA 3A1EA 4LF5B 4WZAB 5KYWA 2B2CA 1OA1A 3ORRA 4ALNA 4F1JA 1WKCA 3H18A 1YZHA 4N8EA 2LW7A 1ZWKA 3RLIA 2DYKA 1O9GA 2O8FA 1E92A 3IPRA 4P3NA 3RROA 4FXOA 5J4LA 3SS8A 2WF8A 4WBNB 2UYHA 3W5VA 2FJUA 4UDYX 2CLHB 2J9RA 4B82A 4E33A 3JQFA 1ZQ9A 1ZK4A 3F71A 4Z3DA 1MN6A 4RKYA 4NDZA 2WPDD 2Q0XA 3NBQA 3L18A 4IIUA 5B64A 3D9QX 1XTRA 1JWBB 2G4LA 1C2YA 3NS7A 4IDEA 4YLEA 4UBOA 4AL4A 2OQIA 3C6ZA 1OBHA 4ZT4A 4DIFA 5JU6A 5DYTA 2ODTX 3CXUA 3HA2A 1E9CA 3N2NA 3H4VA 2ZP1A 1ONNA 4LUCA 4UHKA 3DXFA 2W90A 4PQGA 1KJ9A 4OI4A 5K3BA 1NSYA 2G1KA 4K6OA 4QNMA 4RKWA 1DWOA 3AG6A 2ZSIA 3SK0A 3RABA 3P4XA 4CMIA 4FN4A 1KOLA 1SXPA 2NAPA 2W6ID 3DAHA 3KHUA 1INLA 1RW4A 1HORA 2AWOA 2I2WA 3I2GA 3TRFA 3D4PA 5L9AA 4NXNB 3LUHA 2O3SA 1N5RA 2V4MA 3L7YA 4D4KA 1DC7A 3EZLA 1B1AA 5FLEX 3KQLA 2XD9A 2BFDA 2OV3A 2FGKA 3AR4A 2D54A 2E55A 2VTEA 1E6WA 4OAQA 5EQFA 3SC6A 4N6GA 1NJSA 2G71A 2RHHA 2UZ1B 5CR9A 3T15A 2J3EA 1T1GA 3GEGA 3L84A 4AMGA 2HV8A 4FJ1A 5AM0A 4DWVA 4X63A 4E5MA 1VHTA 5DSTA 4GKVA 3K20A 1DAGA 1AURA 3P9CA 3DO6A 2IUUA 5CIQA 5H4GA 3AKDA 3D7KA 5E1OA 3WADA 4L15A 2VYVA 3BE6A 4U2EA 1PZEA 1M6VB 3QW2A 5DHSA 4KIUA 2AA3A 3OIFA 5KQLA 4GDMA 1N2HA 1E7YA 2IQIA 3MJ4A 3PNQA 2EQAA 4WECA 5DYNA 2ZULA 3VDMA 3KM0A 4WACA 4J4TA 3PGKA 1L5YA 3EC7A 5G4KB 1DX9A 4NCBA 3C8DA 4KQEA 4UTVA 1CNEA 3SKXA 1GEGA 4XVHA 5GVRA 5DCWA 1CQWA 1PBNA 1ISGA 5EUBA 1X7HA 4WJLA 6GPBA 2BTQA 3VC7A 4YUZA 2C5FA 2GVNA 2X4IA 2X0JA 3O7MA 4S12A 3RIGA 3TGLA 1KO5A 1QYIA 4ZOLB 3RHSA 2EYQA 4GUAA 4KFTA 1WZUA 5ARCA 3N1UA 4MV1A 3CYFA 4LOAA 4NFHA 3SQNA 1JZQA 1DEOA 1XA3A 3OFJA 4ZAWA 4G0YA 1FA9A 4Q4DA 3IAXA 5EEHA 5DFAA 4E09A 2HPVA 2PS9A 3NVAA 2NVOA 1N6RA 3O91A 4G8BA 4X60A 5JS1A 1C8LA 1EBFA 2XMSA 3DF7A 4M9CA 3GF4A 2VRCD 2HPHA 1SRRA 1U2SA 1Z15A 3P9NA 4A03A 3D4OA 3HSSA 2QDXA 1KKMA 3AY0A 2GZMA 3LHIA 2ZUEA 1XTVA 2M98A 1IXKA 3P0JA 4P86A 1U2QA 1QE3A 4PPGA 4XPZA 1Z5OA 4MV6A 4RK1A 4TXHA 3FTPA 4RM3A 2AOXA 4D0SA 2V6BA 5LYJF 3JCZA 1UKBA 1G4AE 4EKNB 5H3LA 1H4VB 5BSEA 1ESMA 4D8XA 1KETA 2FZ4A 3T3PB 2D1YA 1ZJYA 2OXEA 3BIXA 4HDKA 4RDIA 4X1IB 1XXLA 1GR0A 1ZNXA 2BBOA 2O59A 5B37A 1RVDA 3U40A 1LA2A 2O8EB 1ESDA 5DLEA 4H7IA 1UH5A 1JBEA 1Y8CA 3PQEA 1E3IA 2EHJA 3QVMA 3VC1A 2YHUA 2G1JA 3OQHA 3QEOA 4YB8A 5IJ0B 4M9QA 3NANA 3R3VA 4A26A 1RAEA 1QHHB 2HCRA 2SKEA 5FTLA 1N9ZA 3LK6A 3Q2KA 4BGIA 2FG5A 3OQIA 3TQQA 2R6HA 4ND3A 4QHYA 4YHBA 2FQWA 3B6EA 1NPYA 1ZN7A 4GI5A 4JKIA 4OFZA 5GGYA 3UV3A 3REQB 4CI9A 2WMYA 1CERA 1NZDA 1OC4A 4HB2A 4IQGA 3PP8A 1FZTA 3V33A 2G88A 3H9EO 3F3YA 3RTGA 2WUVA 2PUBA 2WZBA 1OI3A 4CTNA 4ZO4A 1EH5A 3JSAA 1B6TA 3AEQA 3HYSA 1ZESA 4NJEB 2A86A 2EKZA 2P2YA 3VMMA 4BDTA 3IUPA 4DDKA 4A8JB 3EE6A 3HCRA 4OMDA 2BSQA 4FNAA 3BUSA 1UODA 3PR2B 4F12A 3VR0A 1XJCA 4S1OA 3NETA 2OZKA 3OIWA 4QFCA 4ZCTA 3RAFC 3TOVA 2LVBA 1AGRA 4Y2HA 1XF1A 4U2KA 1REQA 4NCHA 4NP6A 5C53B 1R6XA 3INTA 2PWAA 1QIEA 3MRSA 2JGLA 3LMKA 1YJCA 1DBQA 2J3KA 1IULA 4K6FA 2A0UA 2RHTA 2ZUSA 4HH3C 4HMOA 2P2CA 4C0WA 2RGNA 2YV2A 3ZWWA 2XTNA 1KAGA 4HI0E 4LHEA 5FWYA 1WBDA 5CX1A 4WAUA 3SXJA 3QHQA 1X70A 2R66A 2WABA 2CE2X 4IVRA 4QYIA 5I4KA 2PNFA 2YASA 1E64A 1DFGA 1MVOA 3TUJC 3LX8A 1O5OA 1UPAA 3P4YA 3H9JA 4PZDA 2QROA 1Z4NA 3QFHA 3HO8A 4PX9A 4QYWA 5TGZA 1UBSB 4F0JA 2A5LA 2HHJA 2OENG 5JS6A 1WQ1R 2VT2A 4XDGA 4ZODA 1YB1A 1CJCA 1E99A 4K03A 3IVGA 2W93A 3MTJA 4ECAA 3B7GA 4RZXA 1KI9A 3T94A 5K20A 4FMBB 1VYVA 1MX1A 1WCXA 2JLAA 4KODA 5DNVA 3E2IA 4HV4A 4YRGA 1NT2A 1ZW1A 3HG7A 2JHCA 3EMKA 4DIBA 2G9VA 2FH5B 1V8DA 4BXOB 4YJHA 5CU7A 1TMOA 1YI8A 3DDUA 3KCQA 4HRXA 2AC7A 4HXGA 1QK3A 2ZWVA 4Y6PA 3V8MA 4MUFA 4GPD1 3PNKA 3EPJA 1LQTA 2IF2A 2XIJA 4X7PA 1TQ8A 2RB4A 4UU8A 3RC1A 2XXBA 1A9XB 1JSRA 1XJWA 3SJ7A 3R2JA 1VKHA 3TYXA 1OILA 1V1RB 1ZO8A 3WB0A 4BNDA 5C0OE 2PBLA 4GQAA 4CUZA 3W3ZB 3BILA 1BMFD 4YCJA 1JEEA 5AW5A 3T6KA 1UP6A 4ZCLA 3JD2A 4E12A 2P9YA 3UC5A 3IGFA 2JKVA 5D8DA 2DFKB 2VPIA 3WGVA 2BM1A 4MW0A 4DCCA 5JNSA 2P8JA 1H5UA 4H3SA 3WIDA 1KSGA 3H2SA 3KOMA 4P2BA 5DSXA 1WOYA 4C78A 4N4AA 3RUDA 2R7NA 3VYTB 4YBZA 4JLBA 4RHXA 3TLBA 1Q1EA 4YRTA 1Y5RA 3ZI0A 5LPNA 1JTFA 1KXJA 2O7SA 4JWKA 4OGLA 1CLUA 3STUA 3C0KA 2H11A 2LIVA 1P45A 1E3SA 3GN1A 3ROQA 2UYGA 2MJLA 2W5UA 3NAZA 5ALVA 4PZAA 3CTMA 4NFLA 5F1YA 3V32A 4JC5A 3GEBA 1D1TA 1Z0ZA 5LQDA 2H5LA 4IIJF 4BU0A 2JJQA 4QRIA 2C9ZA 4M86A 1YR2A 4KVAA 4C7KA 4ZMRA 5LZ4A 4HOYA 4BMYA 2Q5QA 3FWPA 2HK7A 2EW8A 2HCTA 2MSNA 5KYVA 2YVAA 2VYND 4L75A 1FQKA 1Z4IA 3A2NA 3OEEA 1ECBA 1NUUA 1JA0A 1TAQA 3B12A 5DU2A 4RZIA 5A5FA 3I5UA 5L45A 4G6ZA 2DEUA 1B3BA 2FZWA 1ZUIA 3NTXA 2LD4A 3VPSA 1L8QA 5KQMA 3FCAA 1L5FA 2QM8A 3EZNA 4E22A 4UU7A 5LXTB 4REQA 2BCJQ 3I9OA 4ZYVA 3QLUA 5EE9A 3SMQA 2BFMA 3SM3A 4EYGA 4Q3LA 2JLSA 3KLMX 4LEIA 4R2IA 3SBOA 1Z0AA 2Y93A 1PZHA 4NCNA 1KP9A 1RRVA 5IJ0A 2CJFA 2B3DA 2BI7A 4WFQA 2QRKA 1Q0RA 3UYLA 5HGXA 2DQSA 1ZM9A 2P69A 2ZCVA 1CR0A 3C3DA 3PV0A 4QBHA 3NOVA 1NA5A 4NU8X 1HUQA 4FBGA 2MMGA 4HWKA 4Y30A 3K8OE 2QB5A 4K3VA 3H8JA 3DLTA 4CV2A 4F4IA 4LF8B 3BEDA 3FOWA 2AKEA 1BFDA 3E7XA 5BW4A 2IYEA 3STHA 1K3FA 3JZFA 4PZZA 2AC4A 4RPKA 5BXYA 1M1ZA 2X2FA 1HLDA 2CVOA 2JF0A 2A3NA 3H42B 4D9BA 1P9RA 2JNWA 1H05A 4C0KA 1TMKA 3P2KA 1M54A 1O89A 4R83A 5I01A 1R3DA 4Q3OA 4TTIA 2NSLA 4Z7NB 1YRAA 3HVIA 4R1LA 3LNTA 5JE8A 1UEIA 3TRKA 4DB4A 2WIDA 4JDUA 1M5UA 1NIPA 4HAVA 1NI4A 1XVTA 3SYRA 2ADMA 3ZJTA 5C3UA 2I7VA 3LM8A 3QWFA 3MJHA 3GEEA 2WKPA 3TWOA 3ZX5A 5GJBA 5EP1A 3P1JA 5AVOA 1G7SA 3WWCA 3QU9A 1PTJA 4BP1A 3FLAA 4U2BA 2QZJA 3OTGA 1LBTA 3WWPA 5K0SA 1AUOA 3LYLA 4U0JA 3LPDA 3BXHA 4UDOA 1WUJS 5TEVA 1D1QA 5L7TA 2MDTA 1JEYA 3RU7A 4G0NA 1RIFA 4QUIA 4PGAA 4A2CA 3ZWAA 5CFNA 4Q16A 1ZK1A 1WZCA 2EF1A 5BWOA 4KK4A 4RNDB 1UFQA 1NW8A 4FZVA 3OCCA 4J1SA 3A1UA 1RYDA 2C4HA 3E5MA 4C0HA 3AW9A 2X4DA 5C8VA 2FEXA 1MPTA 2I8AA 4RJTA 4QG3A 4NE2A 1CEEA 3IB6A 1NJ6A 2DUMA 1DE0A 1CHNA 2JIRA 2PQ2A 2R4QA 2SICE 2VXBA 1OXMA 1DRUA 3CEJA 3PCXA 4FINA 4LVNA 3CGWA 1TTTA 2PA3A 2FVXA 5H5JA 4LQLA 2J0QA 5KHOC 1MF7A 3MYRA 4OP2A 1VL6A 4NCJA 2X5XA 1PEAA 5FR2A 4KN6A 1NN0A 3UJCA 2BBTA 1VQ1A 4B6GA 3UMJA 2ZYIA 3MLEA 1TO6A 2YC2C 4Z5XA 3D3NA 5CA0A 3TLGA 4B3RB 1KO7A 1J23A 2QR2A 3V8BA 3WHLA 1MD9A 4ZK2A 6AT1A 3IE2A 2BHNA 3I9MA 3ORHA 1PG5A 4B45A 3WXBA 1LDGA 3L41A 3V4ZA 4QGHA 2ZIUB 3QBDA 3L7LA 1Z4KA 4LNAA 3QKWA 1A0OA 1A1SA 5BYKA 3NO4A 4P3KA 2ILVA 4MGIR 4DCUA 2BFPA 1Z37A 4BO1A 2YWEA 1XQ6A 1ZCBA 4FYWA 4YDHB 5JAZA 2W42A 2R44A 1T13A 5E4FA 3RU2A 5ADWA 5LU8A 1RLOA 3F5QA 2ODWA 1YE5A 5AVKA 2XCRB 3HCOA 2VHQA 3DE7X 1MQAA 4DLYA 5K0BA 2ZTHA 2CVPA 1O97D 1PP4A 1NW5A 3N2ZB 3AJRA 1VIVA 1YOVB 1EKXA 3PYXA 4H18A 5SZJA 5JQWA 2QE7D 3K8YA 1FFYA 1IOZA 1XL1A 4DR3B 4BLUA 5HK8A 1C3XA 4DQDA 2X7JA 4C43A 4L51A 1QNFA 3EZ6A 2E4ZA 4HDAA 4EBBA 2N9UA 4PNHA 5HE9A 1RQGA 5J9FA 1YCGA 4L57A 2AN1A 3LLCA 3FJ1A 3D6VA 1G8HA 3W8DA 1DPGA 2O2XA 4M9ZA 4Z4EA 1XD9A 4RENA 1UDXA 3IEPA 3TINA 1TIBA 5ITVA 4F9GA 1V6AA 1CQZA 1VKOA 4MGHA 3TAHA 4EKYA 1XCPA 3ZPXA 4KNYA 4DBLC 4AP5A 1XJQA 4C0JA 1YDFA 3M3PA 1EDEA 1GYQA 4GRAA 3KXIA 3NEPX 4BNHA 1WXHA 3H4TA 4KSYA 1ZKDA 4TXMA 1QRDA 1IONA 4AJNA 1JBKA 2L19A 1UFOA 3GFTA 3TMYA 3AL3A 5IXSA 2UU9B 2FNAA 3BXFA 1MAAA 3CWQA 1B26A 1H1DA 1DCFA 3H9QA 4J2TA 5IDQA 2QGNA 2EBUA 3D7LA 4MJLA 3LY8A 3O8DA 5IJZA 6ABPA 2O5EA 1XNHA 4NZZA 3IUNA 4II3A 3HXLA 3K2QA 3UMCA 1CIVA 1BMDA 2FJ0A 1G3UA 1NG1A 4PINA 4EJSC 3TTYA