4XK8C

Crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for energy transfer pathways in the plant PSI-LHCI supercomplex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
total genus 12
structure length 80
sequence length 80
chains with identical sequence c
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2015-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4xk8C00
2Z8QA 1AXQA 3IR5B 3MM9B 2O01C 3EUNA 2WAQD 5CH7B 2C3MA 1PC5A 2ZVSA 1XERA 1Y5IB 5CHCB 2C3PA 1FDDA 3MM6A 1GTHA 5BYQA 2FD2A 1F2GA 1HFEL 3MMCA 1SIWB 2C42A 2WSEC 3HKZD 1FDAA 2V2KA 2V4JA 1B0VA 2PMZD 1JNRB 5BYRA 4OMFG 1H0HB 1DURA 3MM7B 1Y5LB 1Q16B 2UZAA 4XDDA 1BD6A 1JNZB 3MM5A 1CLFA 1WTFA 2PA8D 1B0TA 1SJ1A 1Y5NB 3MM8A 1FEHA 4Y28C 1BQXA 1B0PA 1Y4ZB 3OR2B 1H7XA 1FRLA 2WSFC 1F5BA 2WSCC 1DFDA 3OR2A 4DHVA 2C3OA 3IR6B 3MMAA 1C4CA 1KQFB 1FCAA 3MM9A 3GYXB 1G3OA 1H98A 4RKUC 1SIZA 2FJBB 2VKRA 1BC6A 1FERA 3MMBA 2VPZB 1FRMA 4CI0B 7FDRA 1KQGB 1DAXA 2FJEB 4L6V3 2WB1D 1KEKA 6FD1A 3MM8B 3MMAB 3C8YA 1FXRA 3EGWB 1D3WA 1BWEA 2FGOA 1FDNA 1FTCA 3LW5C 1FRKA 5L8RC 1R27B 3MM5B 2XSJB 2VPYB 4ID8A 2XSJA 2GMJA 1BLUA 2GMHA 1IR0A 1H7WA 3MM7A 3MMCB 1VJWA 1FRIA 1ROFA 1GAOA 6FDRA 1K0TA 3MMBB 1C4AA 3OR1A 1PC4A 3OR1B 4YDDB 2FJDB 1FF2A 5E7OB 2IVFB 3IR7B 5FD1A 2FDNA 1IQZA 2FJAB 3MM6B 1F5CA 1FRJA 1A6LA 2PDAA 1GTEA 2VPWB 4XDCA 7FD1A 2V4JB 4OV1A 1RGVA 1FRHA 1G6BA 3PNIA 1FDBA 2VPXB 3EXYA 4KT0C 1JB0C 2Y0SD 2C3UA 2C3YA 1FD2A 4XK8C 5BYSA 4AYBD 1FRXA 1GT8A 1FXDA
chains in the Genus database with same CATH superfamily
2I9SA 4DL6A 2CAJA 2WAQD 3IGVA 3IM8A 3BSOA 1ICEB 4RJVA 3RYLA 2FC8A 3NGUA 2FIUA 2QMWA 4PXCA 2MHNA 2ZVSA 2M8HA 4ECXA 1TL1B 1Y5IB 2DGTA 1X5OA 2XS2A 1WKJA 2GHWA 1RAJA 2C3PA 2BUNA 2YNIA 4S0MA 3RRKA 5KFCA 2QA4G 1WF0A 3MR3A 3PJWA 5HATA 5CCMA 3DRSB 1K44A 3CCVS 2WBRA 2GZOA 2M9KA 4PABA 3KUGA 1TZ0A 3W65A 1SL0A 1KVIA 2KN4A 2MPUA 2MSTA 2RHQB 1VI7A 3MAQA 2RUGA 4RLEA 2NCKL 1R0BG 5LT5A 1BWVA 4FXWA 3CDEA 3KLEA 4CTAB 1F0XA 3C6TA 2F7VA 1RAAB 1XC9A 4NCAA 1P1LA 2EEYA 2VBZA 2ILYA 3M6UA 3G87A 3MEGB 4ID5B 5HMXA 3VAFA 3U02A 1RTHB 3RGIA 1CLFA 1B0TA 2V2VA 4ZHRA 1SPBP 1WEYA 2ZUAA 3BQ0A 4JI6F 1TKXB 4DV3F 1JJCB 1Y5NB 4OZ2A 1SC3B 3MTKA 1DTTB 2AGPA 1KTVA 3DRYA 1K47A 4O3NA 1Z2LA 1WHXA 5D78A 2UXDF 2CQGA 4JYAF 3NP5A 2ROPA 1TVRA 1WI8A 2QLBB 2CJKA 2UUCJ 1VBXA 2Z30B 4NLQA 3H5SA 2IRUA 4IQMA 1ZM9A 2X3GA 3O8WA 3DYAA 1X4HA 4M5HA 4DCJB 4DR5J 3LF0A 5HK4A 3RRGA 4C4WA 4J37A 3HVWA 4LF4F 4G1IA 4FF3A 3WC0A 2DITA 4F02A 4F0KA 1I1GA 2EFNA 5A6WA 1Y10A 3R5DA 1KONA 2IJNA 2BQ3A 2J7KA 2VONA 4FBUA 4KFBB 2AX0A 5I3UA 2VPZB 3JTPA 1Y0HA 2VFUA 3BGOP 3IBWA 4WFYA 4F26A 3Q24A 1L5UA 4PWWA 1QAIA 2KZZA 1X4DA 3BKTA 2ALZA 1D3WA 4DV2F 4DSKA 4K0KF 2CWXA 1VMBA 5D77A 4Y2CA 4EO8A 2JLGA 3VAJA 1LWEB 3MWBA 2DNYA 2J0SD 2C2NA 2OO4A 4JI7J 3DOKA 1ZA2B 1IR0A 4IOBA 3LOUA 3MM7A 3DLEB 4KC5A 5ETMA 3TOQA 4M5JA 4QYZJ 4O3OA 1R6VA 1CPZA 2OD6A 2QRRA 5ETTA 2AJ4A 4OHWA 1KFSA 1GFWB 1R8BA 2QFIA 2IHR1 4DS5A 3L7UA 4RWWA 3OL9A 5DM7Q 3DLGB 1FF2A 2HNDA 2ZD1A 4DQIA 1CJVA 1UEUA 2B6AA 5K14B 1MWYA 3CD7A 4DL3A 1S77D 3M4XA 2BRLA 2BRKA 3BQ2A 3JYTA 1XK8A 3UPFA 1RT3B 2CJYB 3HK2A 1HLWA 1T9WA 3NG8A 4PUOB 3H5XA 1RT5A 2KL8A 3M7VA 3PDNA 1N36J 1RT2A 4L75A 2VFTA 1NKEA 3FFIA 2N82B 4KBIA 3CF5Q 1ZH5A 1ZAWA 5H9EJ 2DPJA 4MKAA 3N6MA 2DNKA 2P5VA 4FXDA 1HYSA 3FBFA 3K7RA 1U02A 2R2TA 2BANB 3FFIB 4DBQA 1LNQA 3OXGA 3W9HA 4IQXA 5DG7A 2XLIA 2K06A 1E6YA 2X1GA 3S6EA 3FEZA 4PYAA 3KJVA 3EXYA 3VAKA 4NEYA 1NEEA 1XN9A 1AXQA 2HZVA 3CJ2A 2ZZNA 2IMOA 3QLHA 4TY8B 3U1MA 3CCSS 4E0DA 2P9GA 4DN0A 1Y3KA 2GA7A 2DGXA 1WF2A 2PT0A 3CDWA 5C2CA 4CZCA 1HA1A 4FYDA 2MEWA 2YNGA 2MZQA 1FDDA 2BM1A 3BM7A 3R27A 4B9NA 5AXKA 2E9RX 4USMA 4B9UA 4UUXA 2Z58B 1DJ0A 1F2GA 1HI1A 3GCXP 3CTRA 4Z7CA 3PX6A 3FCVA 2J6TA 3BQ1A 2YKMB 3NOCA 1SJRA 1WC0A 2YBVA 5F8HA 2YH1A 1SKRA 1N56A 2UXBJ 4OHVA 3NNHA 4UTGA 4DV0J 2Z2ZA 2LQ8A 1S1TB 2ZOMA 2CQIA 3A8IA 2VUGA 3DNCA 4LIRA 4OX7A 3H59A 4DXLA 2UUAF 4B3SJ 4DV6F 3GLJA 4URSA 1GX5A 3JS9A 2KI2A 5J2NB 3MAAA 3AB4B 4BWJA 4FKXA 3N28A 2C2RA 1APSA 1EX8A 1NJZA 2MZRA 3LGMA 5DDQC 2H9ZA 1HBOB 1UZDA 3FMBA 2J0WA 5M2PA 1U1RA 3CJRA 5L38A 1FTRA 1CJKB 2DJWA 2DRDA 2XI2A 2ZJQQ 5JVGQ 2OTLS 4N41A 1TFWA 1BQMA 3JAMY 1Y4ZB 3J80U 3KUEA 1FRLA 2XWYA 5DS7A 4QPXA 5A8RB 5LMNF 4TY8A 2VOOA 5KFHA 1NK7A 2BBEA 1JLQA 3G4SS 4J91A 1R8CA 1EQ0A 4H4MB 4I64A 4LVOP 5LMUJ 1M90T 1S1WA 4WTYA 5EX3A 3JSYA 2VU5A 2I8EA 3AT1B 3K5MA 1XBWA 1U48A 4K4SA 3R6GB 1LKZA 1TUVA 1FJ7A 2HWIA 3LP2A 5E3CA 5J1EA 4C48A 4NA3A 1VQ9S 3ENAA 1RAOA 3OT9A 2AKWB 2AJ2A 4LSNB 3VZIA 1ZYQA 4XTTA 1TUGB 2ZZMA 2OHDA 2A2CA 4ZK7M 1DZ5A 3HZGA 1DAXA 2BJ8A 4DV5F 2HSEB 3GONA 4H4OA 1S76D 1S49A 4MIBA 4NLTA 3CWJA 4P52A 4F3QA 2EBEA 3OSPA 1AFIA 2ZBIA 2L08A 2CPXA 3FCHA 3LW5C 3Q86A 3K5LA 1CJUB 2YKOA 2KG0A 1YJVA 3MAAB 3THPA 1UFWA 2E9TA 1M5KC 3BR9A 1H6KX 2GMJA 1PO6A 3FSXA 3VF0B 1TV6A 3ZZYA 4BHQA 2RQMA 3DLKB 2O1PA 3ICLA 5KFSA 2EFOA 4CLPA 2POKA 4EZ6A 3PHTA 3LPEA 3MR6A 1Q8IA 2IIHA 4OI6A 5D0GA 3FSYA 3POTB 2H3EB 2R7TA 2DEIA 2XG8A 3HSJA 3OR1A 1PC4A 3CCQS 1RT6A 5EN1A 3CDAA 1IKVB 2K7JA 4LREA 2RDJA 5FD1A 2N4CA 4FS2A 2XCPA 2FJWA 3RZAA 2KHDA 4Q8FA 1HHSA 2VQEJ 2VFVA 1FFWB 4MIAA 3VZHA 1E6VB 5F41A 1DQAA 1FRJA 4G1PA 1LOUA 3SDEA 4YP3A 2ACMA 2HHSA 1G4CA 3NCQA 2MQOA 4HI1A 5F8JA 3DHWC 1F6TA 1KSPA 5AT1B 4JI1J 3IRWP 5DJBA 3M8PB 2VPXB 3Q8SB 2HVEA 4M94A 3A3OB 4P6QA 1Q78A 3FK4A 1TL3A 3MTJA 3HFKA 2XM3A 3V81A 3M05A 2CRLA 4NLXA 4F36A 5EWFA 5G0RB 2DEJA 3UW1A 2HK3A 1HKAA 1R89A 4JB8B 2B9WA 2GAHC 4USVA 3SBMA 1S97A 4WKYA 1PBAA 4AXIA 5L1LA 1AROP 2ZBRA 3W5YA 5J1EB 3PW4A 1WNEA 1HW9A 3KG1A 4EYIB 2DPIA 2JRSA 5KG2A 1KHVA 4P75A 1PC5A 3FRYA 2MZ1A 4CLYA 4ETXA 2KYXA 5KFYA 5LSRA 4ED0A 1NDLA 1R31A 3C19A 3W8PA 4CLKA 2GAGC 2PI4A 1XNQF 2BA9A 2GIRA 3HFZB 1QD1A 1UWBA 3P45B 2COLA 3SEOA 1NJYA 3QGIA 2R2RA 1C1BB 1IM4A 1F9HA 2XBPA 4KGXB 2ZHBA 5FDLA 2D3ZA 4K4XA 1HBNA 4B17A 5JVHQ 3GV5B 2X1AA 1XNRF 4OHYA 3MD1A 5J2PA 4DFJA 2BW7A 1EB0A 4I7FB 2W2PP 3K57A 1H3DA 3BSCA 1T9XA 2VV5A 4OZNA 3MM7B 2AHOB 1Y5LB 3P49B 3G2XA 3QRPA 1VRQC 3H0PA 4NLOA 1QE1B 2NXNA 1JNZB 5D15A 2L9WA 4AUKA 5T14A 4ZPWR 4X65F 1L3UA 2QYGA 3CB4A 4CP5A 5JUMA 4TYAA 4WXOA 1T95A 5ETPA 4A47A 4DPUA 4LF9F 3KKFA 3QYYA 4TLQA 3EM1A 4CYUB 3R7SB 4DPYA 3OHAA 2RIJA 1ZTTA 4B08A 1X4CA 3IBCB 1RT7B 1X5TA 1FEHA 2R8GA 3KMQA 1S12A 4I0WA 1S9EB 1TELA 5L9NA 3MXHP 2F65A 1MN7A 2J8AA 3GR1A 5DRKA 3CJ0A 4ZP8A 3JYTB 1VLYA 4DV7J 1VBZA 1XR6A 3G82A 1SV5A 4A8YA 1YJ7A 2AT1B 5HMWA 3KLGB 4C97A 1TUWA 4Q45A 3DXSX 4DSLA 3B78A 4RX6A 4EYHB 1ACMB 2LYVA 9ATCB 2MJNA 1N8RT 2BKPA 1WSVA 2NPIA 3NGRA 1RTJA 4ATNA 3QWPA 4KH0B 1SXLA 4UY85 1CJKA 1EQMA 1HL6A 3BF4A 2HHHJ 1A9NB 2FGCA 2XGPA 5KT6A 1N0UA 1CC7A 3QNWB 3ZTRA 1Q4RA 1RAFB 3IBFB 4CLSA 2JEGA 2OMLA 4RKUC 2VG6A 1GEHA 3KJVB 4OZJA 4W90B 2ZEJA 2EC2A 5THWA 4NLRA 4LRDA 2EG1A 5HAOA 1RQ0A 2QG9B 5HBMA 6FD1A 3MM8B 4RW6B 3ISZA 2VQFF 3JSBA 1XMQJ 1FA0A 3IRXB 1FK9B 1NK6A 3DYAB 4OJ1A 1SJ4P 4ZVRB 4JI0J 3T5JA 4F50A 2AU0A 3MFIA 3LUYA 3N0VA 5GMKa 1BLUA 3H2LA 1VC5A 4K2JA 4IR9A 1H7WA 2ZM6F 5E3PA 5HJYA 5AXMA 4M5NA 2RU3A 4KHPJ 1RCXB 2KHCA 3RAQA 4OYIA 2DYAA 3PY8A 3CCJS 2JVOA 3N6NA 1RWXB 2X1BA 2C2DA 3H4BA 2CYYA 2RKIB 4YR3A 1G2EA 3W3SA 5IQ6A 4Q2LA 1DHMA 1KFDA 2RB7A 5B0BA 3RBEA 2CJQA 5I3QA 3MPWA 4CO2A 4U96A 1X4GA 2IAJA 2XQCA 3D66A 2K8GA 1EP4B 1UZHA 3F0NA 4KIAA 3QSIA 4C98A 4ZLNA 3OJSA 1QSLA 2UUBJ 4X4VA 2MKJA 1OIAA 1VRUB 3CNQP 1ZZNA 4EO6A 2E5HA 3M8ZA 2QLWA 3DLBA 4LF5J 1UAWA 2K7KA 4JI3F 4OJHA 1BQMB 2V68A 5M2RA 5BJRA 5DDPC 3I5CA 2R8IA 2ERRA 4DL2A 3A3PB 1FD2A 2J9DA 4X4UA 2UUBF 5HBMB 1SUQA 2V8GA 4LBPA 3N01A 4QCLA 2I0XA 2W24A 5GADU 4F8RA 4IFYB 4AT1B 4WZQA 2NSCA 4WP9A 1FRXA 4IG0A 5AE2A 1EKSA 3BREA 1RACB 3D7SB 3PRBA 3R2CJ 4DQSA 5IT9U 5CH7B 1DQ8A 2OPRA 2AYMA 4I67A 1KWMA 4KTQA 4Q44A 1RWVB 2K1RB 1FKOA 5I4MA 4NXMF 2P9EA 1REVA 4P2SA 4TVAB 3TI0A 1OY8A 3A8KA 1Z2ZA 2GC8A 4K5RA 5BYQA 3TO8A 1ZBTA 1RK8A 2HBZB 3GU0A 3OPKA 4KHPF 1YGYA 1HFEL 1OSDA 1NM2A 2CQ0A 5KG3A 3IS9A 3C14A 2AWZA 1NK5A 4RWXA 2CQDA 2DNZA 2HBRB 3PIOQ 4IOAQ 4QR1A 4ZDNA 5KFTA 2RS2A 1NBEB 2WVDA 4PG6A 1ULRA 3J7YI 1JNRB 1I6JA 2V8VA 4GO5X 1IKYA 2CVIA 3GR0A 2J8SA 4OHZA 2DHHA 2P6TA 5MLCV 1QM9A 1N54B 1UW4A 5E41A 2VQFJ 3IWNC 4YDXA 3H25A 1A0OB 3ET6B 3MPDA 1KRPA 4ELUA 1QE1A 2XMWA 3P6YC 3J81Y 1RAHB 2HPUA 3GV8B 2B8PA 4TY9A 5GAHU 1H72C 1NSKL 3QQCD 2MHEA 1CQNA 3TYTA 4ECTA 4LQ3A 1B70B 1PJ5A 5IC6B 1SUQB 1ZA1B 3C15A 2HHHF 4DLEA 2GJIA 4OZ5A 3KJNB 2RRBA 1IUJA 2MZTA 4PEOA 2ZITA 3PX4A 2DT9A 1NNDA 2GHVC 1U2CA 4C8ZA 3QO9B 2XMUA 4N77A 2JC0A 5FLXY 2CZ9A 3OL8A 3GYGA 2G0JA 2LQJA 2ZFHA 2PD1A 5GVQA 4JUZA 1N6QB 3D0IE 4PUOA 2Q1LA 1X4FA 2H4YB 1S48A 3ZTSA 4DX5A 2DIVA 5A8KA 2ZH3A 2BXJA 1QSSA 1YBAA 1V3ZA 4Z7YA 3GYXB 4CO4A 2ZBQA 2FYXA 4CO1A 1WEZA 3UWTA 3LP1B 3MR7A 3HZEA 2LP4A 4X65J 5IT9Y 4MK7A 1ZS6A 3MCOA 1MROB 1S6QA 4Q0BB 4EUVA 2R2SA 2XMAA 3EGZA 5AE3A 2YXLA 1U7LA 1J27A 4J7CA 4FYXB 1FTCA 2DGUA 3GG1A 3CEDA 3CD0A 1HNWJ 1F60B 3AJDA 4HL9A 5K5MA 5A2QU 3EZ5A 4QIFA 3PYGA 1S1VA 2QT7A 3FEXB 2OPSB 3CUNA 3VAGA 4FYWB 2PFDA 2QYCA 1I5OB 1Q5VA 3AXMA 3BBBA 3LP2B 2YWWA 4FP9A 3V6DA 3RTVA 2FZCB 2I38A 2UV8G 3UD5A 4LF7J 4IG3B 4DFMA 3CT9A 2JFDA 3TA0A 1QAJA 2W2NP 2Z2MA 2LFVA 3M9MB 4OI4A 1XR7A 3H90A 2B56A 3TJAA 4N56A 4CQ1A 2RH3A 2BEFA 1EKRA 2XHWA 1MMLA 2FJDB 4PXDA 4DSEA 3RUBL 5GAEU 3AJ1A 1ITPA 4K5SA 4A46A 2R7UA 2W4CA 2KT5A 3THTA 2Y8YA 2HMIA 4NZ0A 4L72B 2QTWA 2MKCA 2KZMA 3IWXA 1YJNS 4ZHRB 1HNXF 4XDCA 3UDCA 4H4KC 3M8YA 2C1EB 1DLOA 4U8VA 3ZXWA 4DR1J 4USWA 3OVAA 1N5YB 1CBKA 2AYBA 4OX9J 4DR4J 3FNNA 4KT0C 3C6TB 5CYMA 2RDDA 2HHPA 3ZNJ1 2FY1A 4NX9A 5KG0A 4EMDA 4FXVA 2AGOA 3TZWA 5F9LA 1C0UB 1LFPA 4XPCA 2IM0A 5CD4A 1PAUB 4EEYA 3FBBA 4M5LA 3OQ2A 1T05B 2C2KB 3L7OA 1JLFA 4HDHA 4YMEA 2IBKA 3LGNA 1Y11A 2HQCA 3EUNA 4F7VA 1UA1A 4DX6A 4JI4F 4BWMA 1JK9B 1P6TA 1S4EA 5ADZA 2CQPA 3A13A 3OUYA 1BQNB 2QMXA 2Y3YA 1S1WB 4IH7A 3NGKA 3QJJA 1HI0P 3BGFA 5KT7A 1H38A 1MNEA 2LVWA 3DCAA 3O44A 4ES3A 4X64F 4F4WA 3D6MB 4JI2J 4LFBF 2Y8WA 3RB4A 1CVJA 1CJTA 2HNYB 2H65B 3OV7A 1K1SA 2F8MA 3BZQA 1JIHA 3M30B 3QGGA 4QPTA 3VCDA 2ASJA 4JI2F 1MWZA 2V2KA 2YNFA 4HTJA 3US5A 1AZSA 1MSWD 2PMZD 1TU0B 1LW2A 1U4BA 1BWEA 2I6WA 3J80Y 2LXUA 2V2ZA 3RRHA 2EC0A 4RNMA 4ECVA 5CA5A 3CDBA 3DOKB 4LVNP 5ETNA 4DV5J 1MU2A 4C8LA 3HVTA 3V2UC 1S0MA 1RDRA 3ET6A 3SSSA 1VYAA 1WC4A 1WTFA 2B43A 3NAIA 2E44A 4P7VA 3TUJC 4C3KA 5HROB 3TARA 4J9MA 2C2MB 4PAAA 4ECUA 3VGVA 5F8NA 3W60A 1IKYB 2CJ9A 3EDQB 5LOQA 2W7AA 2HFSA 1WC6A 2J7WA 4IH6A 2OLWA 4DCPB 2VOPA 2NR0A 2AEMA 2OSRA 4XAKA 4WK3A 3DLEA 2CNOB 3V4IB 1HNIB 4OI0A 2GV1A 2R42A 2U2FA 2YKMA 3BGLA 3M6XA 5D6GA 1OY9A 2E5IA 1RAGB 3U1LA 5GAHI 3Q8QB 3M2UB 1F5BA 3M6WA 4ZS6A 3QO9A 4A8WA 3T5LA 1Y7PA 4FBTA 3QIDA 2C3OA 1C0TA 3GPAA 3IO1A 4M5DA 4YHHF 1PBUA 4KJIA 4NMXA 5GADI 3PW7A 1FCAA 2MKHA 2A6MA 3TAMA 3OFHA 1QSYA 2D41A 3TAPA 3V4MA 3KYLA 3GFYA 2OTJS 2FJEB 3I31A 4KO0A 2WB1D 1N32J 2BE2B 4LIWA 2CJAA 1NZ8A 3K59A 2J6SA 3LALA 2UXCF 2YQ1A 5KG5A 3OHBA 3AHPA 1FDNA 1K1QA 1N5VA 2CDRB 3AODA 2MYFA 5L1KA 3OTBA 2VIHA 2K3KA 1HNWF 1NJXA 4TXSA 4ID8A 4DG1B 4KFBA 5ETRA 8AT1B 2J76E 3RBDA 3BKFA 2DHGA 3CW2C 3OLBA 2IMWP 1VJWA 2MLXA 4ZITA 1K0TA 3E8OA 4WU3A 2AF6A 1P9QC 2HG4A 2F4FA 2BKOA 3AOCA 3MMBB 2I5JA 4ZN3A 2FY8A 1EARA 1U1OA 3ZTPA 2YPZA 1IJEB 1WDTA 4B9TA 1VOMA 3EVWA 3PIPQ 5L1JA 2RF2A 4W4MA 1YX2A 1GMWA 4F04B 2XLJA 3KJQB 2WVEA 1HBUA 2OD4A 4PG5A 2YNIB 4LR9A 1SL2A 1ZM4A 1OSCA 5AE1A 2GHPA 3F41A 4CT9A 4DV4J 3NRBA 1S9EA 1D09B 3KLIA 3OFFA 7FD1A 4DL0C 3IN5A 2V4JB 2AV5A 4OV1A 1SQEA 4DMZA 4DV6J 1KVJA 2FVRA 2YNHA 3PNIA 1SI9A 3SQGB 3LWLA 2WB4A 3KHLA 3GJTB 1JB0C 3NOGA 3G8TA 5ETVA 5CD4H 1SQGA 2C3UA 1WHWA 2UVWA 5A8KB 2A6OA 2DGVA 4HT7A 1N36F 4KO0B 2W7PA 3UN5A 3DU5A 2Q79A 3WHIA 3BBCA 4F4XA 4CCHA 4DQPA 4USIA 2HYIB 2MQPA 1FXDA 3NKYA 1SH0A 2HKEA 3D1HA 1RLDA 1YBUA 3IR5B 3QT7A 4NEZA 1HPZA 3D28A 5MAOA 3I4PA 4PXEA 2WBMA 3DDKA 1XIQA 2EVZA 2GJ2A 4OZ0A 2NQPA 1M1KT 1XERA 5E33A 3M8RA 2VC0A 5DQIA 3TVKA 2GNKA 4GMKA 4Y3CA 4USKA 1T03B 2DD8S 3O1LA 2BDPA 1VK3A 1WG4A 4FVCA 1WKKA 1U25A 2ALYB 2WHOA 3DC2A 5B0FA 1IKWB 2Y1RI 4IO1A 6AT1B 1TL1A 3QFWA 5K8PA 1I94J 4OHXA 3HKZD 4RBUA 4ZCKA 5B0GA 4JI7F 4JI8J 1NCLA 4ZLLA 1UPPA 3D3CJ 3N79A 1WOPA 3TW0A 4DFPA 1IKXA 1EZZB 3NAHA 1S59A 3TX8A 1FJGJ 1VHFA 3BYRA 2LLZA 4YEAA 5KFUA 1JXLA 3ZZRA 1WELA 2IFXA 1LWCB 2UZAA 3M8QA 4ZPCA 1FFSB 1PIEA 1UMJA 2B9XA 2YH0A 3HVTB 4KHMA 1VFJA 3IG1A 2RRAA 2XMVA 3ILLA 2VC1A 3UFCX 1FI4A 2L9NA 3SCIE 5KFKA 3BN4A 1DLOB 1JLEA 1HWIA 1TP7A 1S10A 2W9BA 3HD2A 1TV6B 1I3OB 2HRYA 5C25B 5AJ3F 3OSNA 2ZH6A 2HMIB 2RDIA 2BVZA 4J9RA 1R8HA 2FHMA 2OAUA 3FQLA 2DR7A 3M2UA 4M5KA 4DSFA 1U49A 2ZBPA 5B0EA 1B7YB 1M1HA 1OMSA 1Z4UA 1R7IA 2GW8A 2HGNA 2WVCA 3AFGA 1S1UB 1JJHA 3IR6B 2JC1A 3LP0B 4O4GB 1Q86T 2E5LF 2UXDJ 1B64A 4RNHA 4K4ZA 3E51A 2OPQB 3WDOA 5J2MA 4JI6J 1U8WA 3Q8RB 5IT0A 3HPOA 1VR6A 2FJBB 4FN5A 4G6VB 4U8YA 2Z4PA 1S9GB 3GIMA 3UDEA 2M5YA 3W64A 1X9SA 2KRBA 2VFRA 2Z2YB 4KGMA 3GJRB 4ZPVR 3AB2B 4QBUA 4GO7X 3NBPA 4G65A 3S01A 3TAMB 2B51A 4U7UK 1R27B 3AQPA 5CZXA 2HQDA 2E5JA 3NY0A 3D54A 1RT1A 4C7QA 5F8GA 2EFGA 4OI2A 3MR5A 1U1LA 4IR1A 4LF6J 3OJUA 2BJ9A 1CJTB 5HQMA 4DR7J 2YX4A 2WONA 3Q8VA 4HT5A 4OQJA 2BJ1A 3ISNC 2UU9F 3M1VA 4PCQA 4C8MA 2IDEA 5B09A 2HRTA 5KG4A 5F9NA 1TTHB 3OR1B 2IRYA 3R5AA 1SB6A 2KB2A 1O5JA 2QL9B 3M1VB 2HEKA 4CDIA 3KTQA 2DNHA 1MG7A 2HWHA 3B54A 1Q79A 2CPHA 3M32B 4ENOA 2ZH7A 3BO2A 1A7GE 2M4MA 2XULA 3CCLS 4O4RA 2AP6A 3VVTA 3W66A 2W9BB 1NSPA 4NRTA 4QJVA 1OWXA 4YB6A 3MGJA 1N34F 5KFZA 2OJ3A 3A8EA 4CTAA 4Q2MA 3HT3A 4RR5A 1Q5YA 2GGPB 3IAS9 4K4YA 4WKRA 1VJQA 2H48B 2LA4A 1S9GA 2RILA 3KNGA 5AXLA 3TNVA 3KLFB 2RQCA 2R7VA 4U6PA 1U1QA 1NK0A 4LF9J 1QLNA 3K5OA 4C3LA 3JQMA 2D9OA 1RWUA 2GO9A 4J9PA 1HPZB 1HQ2A 4HYKA 4PWDA 2YQ0A 4F3OA 4KR0B 2JHEA 4KV8A 3T6BA 3SYZA 2CNNB 4O0NA 4NZ7A 3NGTA 5HL7Q 4ED1A 2HFUA 2LU2A 3KUHA 3S7RA 1Q81T 1XNRJ 2KXFA 3ZTOA 2AJQA 1VQLS 2CQCA 1Q53A 5F8MA 3BGUA 4BDPA 3GFXA 3MMCA 8ATCB 2B4UA 4JV5J 3CC7S 1FDAA 1T05A 4Y2KA 1SJFA 1TKZA 5HLFB 2V9KA 1T02A 4LSLB 2G1HA 2QSFA 4E8UA 3LWMA 5HQLA 1NZAA 1JLCB 1HWUA 3PR4A 2RQ4A 3ENVA 3W7BA 5H9EK 3CGIA 2YVSA 3RB3A 3DOMA 1P27B 1AZSB 1UCNA 3JQJA 3O5TB 5HLFA 1UA0A 1RKJA 2ZHOA 3GFZA 2R9LA 5FDLB 2XZWA 3KLHA 5HMYA 3O3LA 1T11A 1M0SA 2JFKA 3PRDA 1D8ZA 2VG5A 3PJXA 4NLUA 2DO4A 4IFVA 4LJMA 5IM0A 1OPIA 3F44A 3K5PA 3QGPA 1JLAB 1U6ZA 3K89A 1FESA 3FZBA 2ZWPA 5JXSA 1LFWA 2CQBA 4DI6A 2UUWA 2CA9A 3TRGA 3QT5A 4JI1F 1S57A 2G2ZA 3HDSA 1TFYA 1P8GA 4JI5F 4C0HA 3OR2A 3D1OA 1FJEB 3H2VE 1N0VC 2HHUA 2VQEF 4RNFA 4NCGA 1NRKA 4YB5A 2XMKA 2JDJA 1UWAA 3E3XA 4J9OA 3MI7X 4G3IA 3CMQA 1X0PA 1KNZA 1T3NA 4WF9Q 1V6HA 4NOHA 2RJZA 3R7NB 2VHGA 4ZPTR 4DX8H 3LAKA 4NLYA 5CYMB 1P1TA 2X1FA 2BM0A 3GIJA 2MKSA 2AX1A 2YKNB 1BC6A 2PGCA 3JTNA 4LSZB 1XMOF 4L6V3 1HMVB 2WK4A 3EXCX 4MTPA 4DR1F 3HHLC 3SDEB 1ZPVA 2JNJA 3C3LA 3BV8A 4N8OA 1YZ6A 4TQSA 4EZ9A 2MQNA 1HYSB 3WZ0A 1RHQB 4AFFA 4O23A 4HVZA 4NLDA 2AJ1A 2GX8A 3H98A 3I82A 3MM5B 4PPZA 4URQU 4PG8A 4ZMMA 1Q82T 4JI5J 4KAIA 3QMQA 3ITHB 5CYQA 4I4BA 3OXFA 3ILOA 1SC1B 3UCZP 2JEJA 3FCWA 5CABA 1NKBA 4D3GA 4NLVA 3KNAA 3S1TA 4RU2A 3DI6B 1Q95G 4MKBA 1RYSA 1HBMB 5B0DA 3HULA 2RRNA 3OVSA 3PYDA 3ZTQA 4DU8A 4GKKJ 1WHYA 2W4DA 1OJ4A 1VLOA 2MSSA 3HT0A 2H5JB 4K59A 1B3TA 4WJBA 3CULA 1OO0B 1DY3A 2FHJA 2GIQA 3I87A 4ZPAA 1TKTA 2QA1A 3W2WB 2Q6BA 2KT2A 1UFKA 3DXBA 4ITSA 1V3RA 2HFOA 1R8PA 1RSCA 4FZVA 4OYXA 3JSMB 4EBEA 4QU7A 2W25A 1QUPA 3TANA 4I2QA 3R1HA 1IBKJ 1KN6A 3CD5A 3CO0P 1S1TA 4P73A 2WVBA 2EFPA 5HVGA 3MUMP 1YQHA 5HANA 2KG1A 4JV5F 3CMES 2ZJPQ 1HMVA 1NSAA 1TKDA 2QV6A 1G1XA 2HBQB 4ZVOB 1B0VA 3UD3P 3TP2A 4C2MA 4BS2A 1KHWA 3I0RA 1EJ7L 3Q8YA 4J9LA 4NPOA 4RPFA 4JBCA 1CJVB 1U8SA 1RBAA 1BXNA 2B6AB 2HBYB 1HNVB 2QLJB 3DRXA 3ENQA 3ELHA 3GFHA 4TKTA 2QLFB 1NU4A 2EXUA 4BC7A 2V50A 4J9SA 4PQUB 4NLGA 2BJDA 3MM6A 4OJGA 2ZE2B 2UXBF 1HNVA 3DU6A 2L3MA 1WORA 5ETLA 3V81B 3CD6S 1YZ7A 1U1KA 3QIPB 2AYGA 3TWZA 4Y65A 1SV5B 4BCAA 4RW7B 3DMJA 1TL5A 5GMEA 4QWAA 3OBIA 2IJFA 4P9SA 4HLBA 1L3TA 4PWDB 3IXQA 3QIPA 3D6FB 5DGAA 1RWMB 3MECA 1KD1T 1RU1A 1JXVA 2LXFA 1MMDA 5BYRA 3Q0AA 3SIPB 2IA0A 1N5TA 1YHQS 2MMYA 3QRQA 1WOSA 3UE2A 2UUTA 2UV8A 4OYAA 5U47A 5HROA 4QU6A 2DNRA 4X84A 4XDDA 4X4TA 2IBOA 3KG4A 3CJ8A 5IS2A 2K3IA 3VR1A 1D0EA 4DR6J 4DR2J 1F9FA 1RTIA 1U6BA 1V5IB 5KAKA 2YKQA 3JQKA 3H5UA 3W2WA 3Q23A 2UU9J 1S72S 2FLNA 3ZO7A 1BQXA 2ZD1B 5IV3A 3I96A 2LEPA 4FPIA 4ANDA 3PVXA 3VV2B 4HTIA 2CUYA 2HQIA 3QAEA 2KVIA 3SQGA 1FKAF 4DR7F 2N4DA 2VG7B 5D4OA 1BHNA 2A2DA 5LM7E 3CJKA 3BGRA 4ED3A 4F2RA 1IR2A 3BS9A 1LK7A 1RBOB 4ILRA 2CVEA 1QTMA 2FVSA 3MMAA 1N6QA 1LEOA 2C2OB 2DHAA 2FQQB 4UUWA 2R7RA 1B4SA 1GXTA 2AEJA 4ZVGA 2KM8C 4B9LA 4XIUA 4IRCA 1RTDA 3R97A 1H98A 1DTQA 3KJFB 5F0UA 3SMZA 2B9EA 3PV8A 4HR2A 3MEKA 1DRZA 2DR5A 2G13A 2XMMA 2F5GA 4O44B 7FDRA 3BPSP 3DHXA 2ZH1A 2B4VA 4DQRA 4ED5A 5KTQA 3C8YA 4KKOA 3EGWB 4O3QA 1NLKL 2VICA 2VG6B 4K4TA 4ANCA 3VGSA 2FGOA 1CULB 5B08A 4JOUA 4ZVPB 2E5LJ 5KFEA 3QRRA 5KFBA 1YIJS 2DHXA 2J9CA 3ISND 2XYHB 2VBYA 2AYEA 2VPYB 4HDGA 5A8RA 3UNYA 1KLMA 1YJ9S 3SQOP 2B9YA 2HW3A 3DRRB 1B99A 1HD0A 4IDKA 3MMCB 2AZ1A 1C0TB 2PMWA 2CFXA 2ZDOA 3ZZTA 5J2MB 5AJ3J 3MURP 3T19A 1S7IA 1X4AA 3NWRA 1WTBA 3UVJA 5LJ5Y 2NLWA 2XWXA 5I3UB 1R0AA 3QPIA 2Y1IA 1JLGB 1GQEA 2PA3A 2HQ3A 3R2DJ 1IVZA 3C14B 1U2RA 4OI3A 3L09A 3N5FA 5E7OB 2IVFB 2VG7A 4MKVA 1VK8A 2CPYA 1T0TV 2JJ4D 4J9VA 3UVJB 2CQHA 3WQPA 2HLUA 4J9KA 4YOEA 1ZOTA 3F73A 1SQFA 4DR5F 3AD8C 4UOGA 4CH1A 2ADBA 1FJGF 3HHNB 1LK5A 3PCOB 2ADCA 2L41A 5CZVA 2MKYA 4CO3A 2XY5A 3JTOA 3QLHB 4TLRA 2UUCF 5C24B 2ACYA 2IY5B 1YJRA 3VHQA 4FNHA 1GK8A 2GCFA 1I94F 1TMMA 1XR5A 5J2NA 2JL9A 2Y0BB 1LWFA 1NPRA 1PYTA 4MH8A 4DV3J 2BE7D 4RUHA 5K8MA 3AH6A 5I3PA 1NB2A 4A4JA 5J1NA 1XQIA 3GP9A 3UCUP 1OYEA 2CPDA 2DB1A 3B4DA 3RB0A 2WVFA 4DSJA 3VAMA 3O6QA 4QIEA 4WU2A 4ES2A 4NI2A 4KQZA 1RT5B 4AD6A 2C22A 4B3MJ 2W7OA 2CPZA 1S1UA 4O4GA 1IKWA 2EKYA 3TQ1A 1NDPA 1R0CB 3BH7B 4BC9A 1JLQB 3ZZ0A 2ILZA 2WCXA 1YJWS 3SCKE 3T9NA 2CADA 2WSEC 4WYWA 2ROGA 2IRXA 2H54B 1IWGA 1RT2B 4DF4A 2RQKA 2HNZA 4B9SA 4CM2A 3G96A 2C28A 1HWJA 1WD6A 2MY8A 4FDFA 1PJ6A 1RISA 3GWCA 1QVGR 2HVDA 4DV4F 1FHTA 1DBDA 1LWXA 4KV8B 1OPZA 3SCJE 3AD7C 3RR7A 4DR6F 2MKKA 1RWOB 1YVFA 2QO3A 3M30A 4NYPA 5LXYA 3LP1A 1D8YA 2HQFA 2DGOA 1HARA 3AOAA 1FK9A 3E2EA 2CXEA 4AE5A 3RBXA 1UL3A 2W01A 3M32A 4M5IA 4NMLA 4UQTA 1OQ6A 1NHVA 1K73T 2R7WA 1UPMB 1LWFB 4Y28C 4WFNQ 4N5SA 4IUFA 3TZZA 1U24A 2EW9A 2F40A 1CQMA 3GSIA 4IO9Q 2MB0B 2OH2A 4HACB 2FHJD 2AMCB 3BDPA 5FJ4A 4MAKA 1TKTB 1NUEA 3MUVP 3M9OB 1HHTP 5HP1A 4C6AA 4NA2A 2P9CA 3WBZA 2NZCA 3ETMA 5K20B 1NSQA 4V19X 1T3OA 5IWAJ 2PN6A 5JMNA 1IBCB 3BBFA 2YPYA 4ZCIA 2I2YA 1KOOA 3MCNA 3OW2R 1XMBA 3T1AA 2JOQA 2UXCJ 1NB7A 3KK2A 5LXRA 1GXLA 1Z1ZA 3P96A 1TL3B 4Y34A 3CJQA 2EWHA 3ILJA 3G82B 4DV1J 4Z2XA 4DL7A 5ETQA 1Y00A 1WSRA 3NCPA 1NPPA 4YFUA 1FRMA 1X0FA 1N88A 2DY9A 1VIOA 2IC3B 2O3DA 3CCZA 1JWWA 2Q43A 4LR8A 4M5DB 1H2UX 1RTJB 3D67A 3K8VA 4ANEA 4ED8A 3OVBA 2IPOB 2R8JA 2DNNA 3NLCA 1RT4B 4W98A 3MECB 3TA1A 1S1XB 5SUHA 3HVAA 2R4FA 3PFEA 2DBBA 2AEFA 4GKJF 2U1AA 3NS7B 2IA6A 1XNQJ 2Z57B 4F4ZA 1IM6A 1VGYA 4R8UB 4OYBA 1DTTA 2E66A 3W9IA 3MOZA 3RW6A 2KKHA 1SKSA 1TAQA 2MQLA 5E5NA 3DGPA 1HBNB 2PO4A 3R3TA 5BR8F 2DXFA 4OYMA 2K1RA 5CCLA 1CS4B 5KFMA 5HSPA 3G8SA 5LL6d 2ZH2A 4GC6A 1KLMB 1VQMS 1IBLJ 4I68A 2EG2A 2OFHX 2SXLA 3DI6A 3I5BA 1BY9A 2JSXA 4LT6A 2DCUB 3RBZA 4U95A 3G6VA 3T1YJ 2GVZB 2PEBA 3D5MA 2BJEA 4KE5A 4TU9A 4QWDA 3FSIA 4RW9B 4ZPDA 2VDIA 2DNOA 3T41A 3P4UB 5C7PA 3H42A 1ZETA 1S0OA 3AQOA 3D9BA 2WRMA 2FZKB 2KH9A 4HHUA 3UQSA 1FDBA 4N76A 3JB9k 3I6PA 2NXEA 3DRSA 2VD3A 2E7XA 5D4LA 4ID5A 3NMAA 1RA7A 3I5AA 2DGSA 2E29A 3LH2S 4ED7A 4WPAA 4AYBD 3FQKA 1W25A 4IKAA 4I6WA 3VGTA 5DG9A 4DLGA 1HQUA 2C2ZB 2QN6B 4U67Q 5C24A 3HMJG 2V8HA 2R7QA 1RYRA 4Q8EA 2F4VF 2MLYA 2HNDB 4JI4J 2O67A 2P6SA 2LCWA 1QJHA 1EHWA 1D9AA 1JLFB 4HHHA 3BB5A 4KGKA 4P7TA 4NCGB 2V8DA 1MMNA 3GE9A 3M8WA 5B0CA 3PO5A 1FVSA 1UVMA 3FKBA 2FJXA 2F3JA 4X4PA 2OEKA 3MPYA 3TZXA 4MKYA 2Q66A 3GQCA 3SI8A 4LMZA 4WK1A 2F8HA 2V2QA 4XO0A 2XCAA 1KP6A 2HFVA 3H7HB 3N5BA 4KSEB 4OX9F 4DR4F 1AUSL 1WDDA 2E7VA 2MQQA 1RT7A 2DGWA 2OSQA 3FRZA 3L9ZA 1T94A 4CLLA 5C5JA 1NJIT 2MTLA 5D0HA 3M6VA 2HS0A 3EX7B 2BE2A 3DRPB 4F67A 1W26A 3DRRA 1IWAA 2N3LA 4LFCJ 4ZVHA 1BD6A 1TL4A 1NKCA 1TR0A 1GNKA 2V9WA 4ZN1A 3GMGA 2DR6A 3J7Z5 2XGQA 3SFUA 3M2RA 1U1PA 3MEEB 2O5DA 1RTZA 1S4FA 1UJ4A 3CCUS 4DL5A 3MCSA 4DUZF 3C66A 4WZMA 3VVUA 1AYEA 3BSAA 3UI3A 2KJVA 2YNFB 1ZAXA 2VDHA 4P72A 2RE1A 5E0OA 2XHCA 2OPSA 1TL7B 4PG7A 2D69A 1VQ7S 1U1NA 3FBEA 2VFSA 1FD8A 3CO9A 3CCTA 3OR2B 2NPFA 3NL0A 2D3O1 3EVOA 1K8AT 2A0FB 2B4PA 4ECSA 2P2CB 4ICLB 1SCJB 2ZVIA 1S6OA 4W92B 1EP4A 2VH7A 1VQ6S 2B3TB 1HNIA 1FE4A 1VS3A 2W4PA 4IH5A 2BJ3A 3GG0A 1C4CA 2X51A 3V5RA 5IXUA 1RBLA 3CJKB 4DJBA 1FFGB 3L7PA 2Q6CA 4MFBA 3SV3A 3PO4A 4I6AA 3QSYB 2DNPA 1QY7A 1ELOA 3KLHB 1WC3A 2BACA 2QL7B 4D3HA 2MGZB 2UVVA 2XB2D 5H9FK 1AT1B 2DY1A 4MFBB 1GH8A 1L3SA 1N33F 2CNLB 3PW0A 3I32A 4ELTA 4NE9C 1C1CA 2Y1JA 4HKQA 4U9RA 4DOZA 4M95A 2L9DA 3IMQJ 1FWPA 3OFGA 5C42A 5SZTA 1N34J 2VA2A 2ZOGA 2HNZB 3GB0A 3M8PA 2VA3A 2KU7A 2HFNA 4KYZA 1PG5B 3HSDA 2V67A 2OKQA 2GMHA 4F0HA 2PMHA 2LQ5A 1RWNB 3EWGA 4PQAA 5CYJA 3JSRA 4J9QA 1RTDB 3GIKA 3SSRA 4O3RA 3KK3A 2HHQA 1VQNS 4OIXA 4JV0A 1YRUA 5A2QY 3UCGA 2ZZTA 2ZH4A 3PACA 3HHKA 3KK1B 3GZ7A 1NDCA 4RW8A 4RW7A 2FUG9 2E1RA 5KOXA 2DH9A 3IWLA 3QZ8A 4F4YA 4ZVTB 2AIRB 2FJAB 3A4TA 4YS2A 4LFAF 4TN2A 4E2FB 2HHXA 3HXMA 4ECWA 4FYVB 1FXLA 2MY7A 3NEKA 4DCOB 1FEEA 2M70A 5L39A 3QJPA 1PKUA 1LV5A 2FVPA 1CJUA 4DEZA 2WW8A 2G0IA 2VBWA 3FBCA 1M5PC 4CT8A 2UP1A 1S5ZA 2LXIA 3W62A 2QFJA 4F25A 4RL1A 1SL1A 4ECZA 3UDLA 1ZPWX 3X3UA 5BYSA 4MJKA 2FHKA 2DK2A 2LU1A 1GT8A 2XSFA 4EI2A 2H5IB 2V34A 2Z8QA 3Q8PB 4NXMJ 4I56A 2E7WA 2JVRA 3MEDB 2AQ4A 1J2VA 2C3MA 2MQMA 1YRTA 4LRAA 1FT8A 5T7LA 3OL6A 3KLGA 3LAMA 1LQ9A 4HI2A 1VBYA 5HMZA 2W9CA 3HHLB 3HSZA 2JH3A 1RA6A 4LRCA 3LP0A 4ZKAA 3HLUA 4YY3F 2W8LA 2G9OA 4QR0A 2VODA 4L76A 4LRFA 3IM9A 4X4NA 5KG6A 2EFQA 4LF6F 2OMOA 3EDRB 2IDLA 5K14A 3FJ2A 2PE8A 3W2VB 4WTOB 2W8KA 3Q2TC 2G0CA 3MHYA 3TAQA 4M1KA 1G7CB 2JX2A 2M7SA 4YR2A 1T9TA 2CQ1A 2JLFA 3IC1A 4C9DA 5KFAA 3MR2A 3DGPB 1Y3JA 4V1Ak 4N47A 1Q7LB 1IN0A 4LF8F 2XS5A 2FB0A 2M0GB 2BYCA 3DM2B 1SVDA 5D0EA 5A0YA 3ADAC 3OFEA 1BE4A 3ITHA 1Q16B 4OZ3A 1MROA 1S6QB 1U6FA 5T41A 1SKUB 3AD9C 3C6UA 2D1CA 4ZA1A 1HR0J 1CC8A 2NUHA 5CAAA 1HBMA 4FF2A 2BX6A 3H20A 2NXJA 1JMTA 3BO4A 1QTNB 2W2MP 5DLFA 3HFVA 2HWTA 2B5JB 3G86A 3MM8A 3QATA 1F9EB 2YWFA 2ZH9A 4JI8F 5D8HB 1VRTB 3MMJA 1QVFR 1JLGA 1JJ4A 1T9UA 2R8KA 2M88A 3NNAA 2ZM6J 2UVUA 1NPKA 3MEDA 1X5PA 3SZ2A 4IOCQ 1U0HA 4NCBA 2HZCA 2JWNA 4NYZA 2KTQA 4K8RA 2VJUA 1C2PA 1V3SA 3QAUA 3K2YA 1L3KA 3M2VA 1FWKA 4OYWA 1AA1B 3CIZA 3AY0A 4A48A 3I4HX 1XMQF 3I0SB 2PEHA 4FKYA 4FVMA 4KPCA 5IWAF 1KQFB 3J7YU 4B9VA 2OUGA 4GVLA 4NASA 2UVRA 1YLXA 3Q89A 1RTIB 1GXUA 2KJWA 3R5CA 2LQBA 4DZDA 2A3JA 3I0SA 1FERA 3POTA 1AUDA 4U7CA 1MLAA 3PR5B 4C0OC 3PEHA 1RAEB 4IG3A 5IZHA 4Y0FA 1GMWD 4RU9A 1KLNA 1UVKA 2GIFA 2RNEA 4H54A 2DXEA 5L46A 4P74A 3VGUA 4RUAA 4X4RA 1GMVA 5L8RC 2IC3A 2ZBCA 2HRUA 4PYDA 1Q1KA 2D7SA 3F56A 3PRVA 5J1PA 1RWPB 2YKNA 2ZNYA 3EVMA 3KLIB 5EUHA 2V8PA 4ZIWA 5D3GA 3UO0A 4DR3J 2F1FA 4JP8A 2V94A 2OPPB 2B5JA 4L73A 4EK2A 3KK3B 3AOBA 3FUYA 4AL7A 3R9LA 1ROFA 3IGNA 3P3DA 3KHHA 2AD9A 3R1LA 2G1DA 3D0HE 5EX0A 4B3OB 2IVYA 4CLFA 3NXZA 4DDFA 2OPRB 1JJ2R 1FJCA 4B3OA 3H2UB 3TX0A 3K5NA 2B4OA 1UWBB 4WFAQ 3DLLQ 4KGVB 1N5QA 2M3DA 1KKHA 4LSLA 3CCRS 2PDAA 2N3OA 2VPWB 3NMRA 1FWLA 5GAEI 3GJQB 1Q8LA 4WIQA 4K7QA 3MD3A 4G1QA 1RKIA 4J5OA 1X4EA 2MQ8A 1AW0A 4ZPBA 1JLBB 5KT2A 1TL7A 2YWEA 3D4JA 1N32F 4G1QB 3CIMA 4QR2A 1KQKA 2Z2LA 4M5GA 3U1NA 3TEGA 2CKWA 1LXNA 2EPIA 3C16A 4DFKA 3OXLA 3DGVA 3U27A 4NI2B 5B7WA 1F5AA 5C2GA 1FO1A 4ZCLA 3C46A 3T5KA 3EPIA 3NCRA 5IC4B 3M8QB 4YHHJ 1IQTA 2LA6A 3KDOA 3ZNUA 4QWEA 2IJRA 3V6KA 4KB7A 3CC4S 3C15B 4PQUA 2GGPA 2ZHAA 1S0NA 3I0RB 1VCTA 3B4MA 2C42A 2HK2A 2J9EA 2CQ3A 1E6YB 3LPYA 1NO8A 1EAYC 5KFLA 2XTJP 5A76A 1VQOS 2V6AA 1NK4A 3DOLB 2ZE2A 4I2PA 3HSGA 3EPGA 1WC5A 1T03A 4M63A 3EYZA 2BOPA 4CO0A 3PW5A 4F3MA 1DURA 4Q7AA 1L3VA 4LBIA 3ZFVA 3HVRA 1C0UA 3W61A 2HAFA 1YDLA 4AL6A 5IQQA 1H74A 3LA0A 4GVBA 1RCOB 2BW2A 2DTJA 4UW2A 2NSBA 2HHVA 3RAXA 1JLCA 4IYQA 2GQ2A 1D9DA 4ZP9A 3DFEA 3TVZA 1RJJA 4ZJOA 4H4OB 4LF2A 1P9YA 4CLZA 3OLAA 4I6YA 1UETA 2RF2B 2Y9HA 1DQ9A 4QYZK 2QX0A 2G4BA 2ZWOA 1CS4A 2Z0GA 4MK9A 4DN9A 2VBXA 4NZ6A 3M9NB 5EGYA 3R5BA 4ED6A 4X64J 4LFBJ 4DWIA 3NBPB 5KFVA 3TUPA 3HHEA 1TK5A 1PILA 2BOAA 4Y00A 5KFOA 4RW9A 4ECYA 2QIFA 3LANA 5D4PA 5T7LB 1HBUB 3CJ5A 4ICLA 1TQLA 2WONB 4WFZA 4NLWA 5I42A 3QBCA 1G3OA 1RHMB 1HR0F 2M8DB 4I2QB 4RO0A 5DO2A 1SIZA 1QAYA 2LDYA 2YTCA 3AAWB 3P5TL 2F63A 4HH1A 4WIIA 5DDOC 4URGA 2GO8A 2MXYA 2KFZA 4USJC 3WX4A 3W63A 2YWKA 1WOOA 2RU9A 3BPDA 2BE9B 4CO5A 3DLJA 4LF8J 4YB1P 2LDIA 2O66A 3PG9A 4UOHA 2XO7A 2QEXS 4EBCA 1IXKA 2H1YA 2XMTA 3J7ZT 2CIMA 1JXEA 2HFZA 4MYUA 4P71A 2B8QA 1WJ9A 4A8KA 3BDEA 1HNXJ 3QGHA 3FDSA 5HVHA 1HNZF 2YX7A 2E5GA 2DKOB 2OPPA 3GILA 5KFPA 3RW7A 3TEHB 3SCLE 3H40A 2AJFE 5CYQB 2IM1A 4ZIVA 5L1IA 2WW4A 2KYZA 3Q22A 2LEAA 4HHJA 4WP3A 5RUBA 2EI5A 2ZKTA 2IYIA 2JEFA 3MF5A 2XNRA 4LF7F 1EIYB 2B7CB 2QL5B 2YWHA 3MM6B 1UEVA 3CJ3A 4B3SF 2UUAJ 4EBDA 5FLXU 4C8KA 1RLCL 4QIWD 5KG7A 4ILMA 2V5HG 3LQVA 4WYLA 4DV0F 1YJTA 1MU2B 1Q8KA 1HIYA 4Q5VA 3BEGB 1NXIA 4IRDA 3HO1A 3MEEA 2HGLA 2OEMA 3CMAS 3D1QA 3V6JA 4OX6A 1YTYA 2Y0SD 3TA2A 3T3FA 3A3NB 2I1RA 2C3YA 3N4WA 2XZDB 4OYOA 4EWTA 1WUUA 3EE3A 4GRSA 2BQUA 2ROEA 5EWEA 2FPHX 4Q0BA 2BQRA 2CNKB 4XK8C 5F8IA 4QYRA 3I9ZA 1VQ8S 3IA0A 4P2XA 4EU0A 1N5SA 4LF1A 4M5MA 2QLXA 5M2UA 4LFAJ 3NGDA 1TK0A 4WFBQ 2EK6A 1RABB 1VRUA 4QZVB 3H8YA 3MCMA 3EICA 2F9DA 3D2WA 1IBMF 3TJ9A 1S6PA 2KDOA 3DOMB 4OLPA 4ZP6A 2N7CA 3QZ7A 4USHA 3W8GA 1J5EF 3Q8UA 5KFWA 4HH0A 3U7JA 2GQQA 4EFAC 4NXNF 2OIHA 2FVCA 2CDQA 3VTIA 2GJFA 3P5BP 5FIIA 2R7SA 4OYZA 3DLGA 3PFOA 1RTHA 3FZ2A 1MWQA 2QSWA 4LQ9A 4NXNJ 1O8BA 2V4JA 1NK9A 5EWGA 1S79A 1RE1B 1UW9A 5KFXA 5E3AA 3KLFA 3M8SA 1ZTWA 3D0GE 1J5EJ 3J7AN 4K4VA 4UZCA 2PIIA 2XYGB 2FLOA 4OMFG 4USUA 1SJQA 3NS6A 4KKOB 4UQGA 1XEZA 5D3GB 2BZ2A 2EKNA 4ECQA 1IBMJ 1AFJA 2XMJA 2J0XA 4NLSA 1N33J 3GYNA 1UVJA 2Q3PA 3TJ8A 2RMLA 1H73A 4LUBA 4RNOA 2YKPA 2RD5C 3GSDA 5DZ7A 8RUCA 1RT4A 1SJ1A 5LSLA 5DETA 4F4AA 2JLEA 5B0AA 2G2OA 2VJVA 1YSJA 2FHOB 2DNMA 4LRBA 3KFWX 2A10A 5KFJA 2DHSA 1U26A 5KFIA 1B0PA 3FVYA 3MAHA 4O3PA 2MZJA 4H4MA 4QW8A 4ALZA 5ETSA 5DQGA 1H2TZ 2GVZA 1R0AB 3LGHA 2R2UA 3QWUA 2KRRA 3A8JA 2NXUA 2VKZG 1PYSB 2WSCC 1QDUB 3OUYB 1KTQA 1D9FA 5KT4A 2CQ4A 4K0KJ 3IP0A 3R5GA 4OFZA 4C11A 2LMIA 3RJMB 3QFHA 1S6UA 2L48A 4ZJQA 3UNGC 1U0HB 4RW4A 2VL1A 4BBYA 4DUZJ 4F2SA 3G9CA 4DF8A 3CJTA 3M2RB 3ENWA 3ZZZA 1U0SA 1FNXH 2HVIA 4RW4B 2V4QA 1VQ5S 2EFVA 3ZZUA 2DR9A 3AA9A 2DNQA 1HNZJ 1SH3A 4OI1A 4JI3J 1DTQB 1YRXA 4CYUA 5HN0A 4XPEA 4KH1B 4OX8A 4ETZA 2CZVC 3CCES 5D0RA 2GS8A 3WC2A 1FRKA 4LF5F 2YNHB 3HF5A 2YY3A 5IOLA 2XSJB 3FMWA 3T6JA 3QJLA 4CNZA 2HLTA 4J9UE 1EETA 3OTEA 4FS1A 1CULA 3O2IA 4DZ6A 3WIUA 3UN3A 4NL5A 2LQ9A 2OGUA 3LO3A 3HCXA 6FDRA 4J90A 1RHKB 3KDNA 3CSKA 4IDKB 2HVZA 3CCMS 1UJ5A 1PAEX 2B0GA 2E1PA 4YDDB 2R8HA 3C6UB 3RR8A 3PXGa 4NA1A 2OPQA 1IQZA 3MDFA 2RT3A 3RB6A 2FJVA 4DU7A 2F4VJ 5J2QB 1KOHA 1N48A 4KGZB 2PSZA 1TMJA 1C1CB 3VQTA 4DPTA 4IFYA 5A6PA 4RUCA 4A8QA 3PZPA 2M2BA 1TKZB 3EGVA 1FRHA 2YWGA 4IFVB 1RHJB 2FC9A 3TUIC 1IJFB 2JZ5A 2QJ3A 4LSNA 5IM0B 1KS2A 2CJBA 2E1MC 4JI0F 2XYPB 4C8OA 2IVMA 1NHKL 3OTCA 4FPRA 3CJ4A 5F8LA 4GC7A 1AB8A 1UEKA 2VZ9A 4X4QA 2BABA 2DISA 5EHHA 1F3VA 3R8YA 1JLEB 3BYPA 1RHUB 2BMBA 4U7UD 1F2HA 4RUBA 2DNLA 2F8EX 1U2FA 1U45A 2X3DA 3X1LB 3T1YF 5J2PB 1I51B 3IG1B 1N5YA 2ZDPA 3DDNA 1Q7YT 2E1AA 2DRBA 3CDUA 1IBLF 5E3RA 2HHTA 4L3NA 2NYHA 4UOCA 2A1BA 5CHCB 2FTRA 2DH7A 3BKUA 4ERDA 2FD2A 4WP8A 2BR0A 5LSOA 4LBHA 3GIIA 3G8QA 3J81j 2PI5A 3QT8A 2CPJA 3NNCA 1SIWB 5HJXA 4DV7F 1UJ6A 1S6PB 2J6UA 4GKJJ 5D4NA 3PTWA 2ZH8A 2XZTB 2DO0A 3HJFA 1VC0A 1E6VA 4F4KA 4ZVQB 4CH0S 4NRUA 3W9JA 3S8SA 3V6HA 1VQPS 5KT3A 5KFNA 2PFFB 3SFGA 5KFRA 2K2PA 4OLOA 4WFXA 4YUDA 1RU2A 4X2BA 1WI6A 3DMJB 3G6XA 4UOFA 4O0IA 5C42B 4C0BA 2OEJA 4DV1F 4P2MA 1U1MA 2JEIA 1UVIA 5J2QA 2QA4S 1CSJA 1LW2B 1XWLA 2ZC4A 3HKWA 2HAIA 4B9MA 2GVDA 2QGFB 2NUUG 5DM6Q 1YITS 1OS5A 3RG6A 1FKOB 3GCWP 4ELVA 4FF4A 5H9FJ 3KOAA 3L3CA 2WSFC 3N9UC 1C1BA 1PYOB 4X4OA 3CCWA 1VISA 2RHSB 3MPUB 4R25A 4P2FA 3K58A 1M5OC 4RW8B 2D3UA 4R0JA 1VHIA 3C16B 2KT3A 2BKNA 4ES1A 2RS8A 3RU0A 3THVA 3Q2SC 1NHUA 1BMQB 4QOTA 2VG5B 5AXNA 1T7PA 1SBRA 2M52A 3IRXA 1S1VB 4QWCA 3MMBA 5K8OA 3JSMA 2EBGA 3CXCR 4NWBA 1KQGB 1LXJA 4PZVA 2IYGA 4WE1A 1KEKA 3D68A 5HI7A 3EZOA 5HVFA 3MMAB 5KFFA 3JAMU 3OL7A 1FXRA 4DR3F 3KLEB 2C2EA 3W1YC 1KQSR 2MJUA 2XI3A 1VQYA 1PSDA 2AZ3A 4B02A 5DGBA 1RB0A 4YN3B 2YQ3A 5DDRC 4B3TJ 2LECA 4NYOA 3K17A 2XSJA 1B7FA 3UD4P 3OTDA 3I56S 2NREA 1NK8A 2GQCA 5H1SV 2KXHA 5I42B 3W2VA 4A8XA 1WG1A 4MMOA 4ECRA 3DOLA 2NS1B 1HQEA 4CNYA 4RZRA 1V9OA 2J7UA 2R7XA 1GAOA 2ABYA 4OZLA 3HHLA 3TR5A 1SJ3P 1RT6B 3KXDA 1HWLA 2YKAA 1MW7A 3PM9A 3TVYA 3A12A 4GVBB 4N8NA 4WBFA 2RUSA 4DG1A 1GX6A 3G6ES 1M5VC 4B3MF 2FDNA 3CJSA 3IAM9 2IM2A 1N52B 4R0EA 4TQRA 5G4DA 4A8OA 1NMEB 1F5CA 1NH7A 2YNGB 3K8WA 1X60A 4RW6A 1A6LA 1H2VZ 3DN9A 2Z56B 1UFLA 5G0RA 1S0VA 2HVHA 1O51A 1YG0A 3PJ9A 3ULHA 4PXBA 4L3KA 4R5PA 1T9VA 2E1CA 1Y9OA 1ZAVA 4CRJA 4AQYJ 2WOMB 4DSIA 2E9ZA 3ZZPA 4OV6A 4IG0B 3OTOF 4CM0A 1VRTA 2WZ1A 2LKZA 4WE1B 1VQKS 2XNQA 3MUTP 2ZUGA 2B7BB 1KDNA 1VDHA 3BN7A 2BANA 1FKPB 4ED4A 3BH6B 5K8NA 2XS7A 2N7YA 1Q0NA 3BR8A 2ZJRQ 2DRAA 3GV7B 2J9DE 1YBTA 1K0VA 4A8SA 4HACA 3KWMA 3IS9B 2XC9A 3G71S 5LMUF 3KG0A 1HI8A 2DIUA 1GTHA 3GJSB 4I7FA 4X66F 1HQEB 3BGRB 1S7HA 1WF1A 3B82A 4HEA9 3W5XA 5IT4A 5F3ZA 4L74A 5DLGA 5EDWA 1TKXA 2HZAA 5LMNJ 1U47A 2D74B 1X4BA 4PRFA 2AW0A 3PHEA 3C2PA 3R5JB 1R8AA 5KFQA 2ASDA 1BUXA 1GMUA 1V5VA 3MEGA 4DUYJ 4V19J 3CPWR 4YY3J 2IAJB 2QZ8A 1LW0A 2ATCB 1RT3A 2CQ2A 5BXIA 1H0HB 2CG8A 5ETOA 3SSQA 7AT1B 1TK8A 1KBRA 1PGZA 1UKUA 2Y1LB 2CPFA 1REGX 2HIQA 4K2XA 4O44A 1D1UA 1JKHB 5F3TA 2H51B 3CE8A 2CPIA 3MM5A 4I1TA 1BGXT 1CG2A 3ZZOA 3DRPA 2HS3A 4X62J 3T1HJ 2W1BA 4CH7A 1RAIB 2MDAA 4P10A 2V0NA 5DZ6A 1R3NA 1BQNA 3I9V9 1M5SA 1UP1A 1S9FA 5E3QA 1W2IA 5GAGU 2OP5A 2FZGB 3HHLD 5KOWA 4B3RJ 5A8WA 3PKYA 4TNOA 4IRKA 4H4KA 2GFFA 4M8LA 2X7IA 3OD2A 2HGMA 4MYTA 2PC6A 3MPVA 4QW9A 2ASLA 3DLKA 1IR1A 2R3VA 4A8FA 2ZNZA 2ZKUA 1S99A 5CQGA 4ED2A 4EGLA 2HHWA 2OI2A 5KG1A 1CEZA 4DUTA 3MM9A 5HP1B 4N7TA 3KMSA 4DR2F 2RVJA 4PR6A 1J5OA 1LWCA 1VQSA 3G6YA 3M2VB 1T9YA 4FYYB 2DR8A 4PPDA 1JLBA 5K9FA 2MGZA 2AJ0A 3V6DB 3AJ2A 3B6BA 1IKXB 3KLVA 3UR3C 3I55S 4Y2IA 2H4WB 2CJXB 2BJ7A 1KVKA 4UF4A 1UTAA 3V4IA 1YI2S 4B3RF 2VB6A 3IFEA 1WEXA 4KY3A 1NJWA 1RADB 1LW0B 1JLAA 3GIRA 2BV3A 3KK2B 3DDIA 5KT5A 3NGSA 4K50A 3H5YA 4DQQA 4DX7A 1C4AA 1X9WA 4X62F 2DCLA 3T1HF 2RKIA 3BSNA 3PYFA 2A18A 2HIYA 4A8MP 1NH8A 5HO4A 3GTYX 2GVDB 4ZCMA 2MLZA 1XTZA 3VALA 2KXNB 2AGQA 1FNOA 1HQUB 1TVRB 3HI9A 4R8UA 4J9NA 2HURA 1WHVA 1RWWB 5KFDA 3J7A1 2HS4A 4TU8A 2WTFA 4AQYF 1QAXA 1FX2A 4JV1A 4YR0A 3Q83A 1RGVA 1U09A 1G6BA 3EJMA 2DXDA 4DUYF 4CLWA 1Q8BA 4Y2MA 3H4DA 3HD1A 4KRWA 1RI7A 4DV2J 1IBKF 1YJUA 4OJ3A 3SV4A 4ZVEA 4ZLJA 4C8YA 1HWKA 3BJYA 3VQSA 4Z37A 4ILLA 1YK9A 3AXKA 4NLPA 4X66J 2V69A 2XO6A 4QIGA 3FGVA 4MT1A 1NAQA 2W2QP 3D6TB 1RZMA 1OQ3A 1ZZFA 4YQWA 2MKIA 3KHRA 3MM9B 2XY7A 1K9MT 2O01C 2WOMA 4ZOSA 2IM3A 3ILIA 3E01A 4UT4A 1O0PA 4DL4A 1ZM3A 1ZM2A 3SXLA 4LFCF 4GKKF 4LF4J 2I5JB 3T9ZA 1REVB 2FVQA 1XJWB 1FVQA 4C11B 4X4SA 1JX4A 1SH2A 3MOJB 3ZC4A 4CIOA 4Y2AA 5GMDA 1UVLA 2OELA 3HM9A 3PYEA 2APOA 5E2QA 3PX0A 1PCAA 3WIVA 2W9CB 5CXTA 3OTOJ 1X7VA 3A1YG 1RP5A 3EGNA 2XY6A 1W2BR 2J0QD 2NXCA 4JYAJ 1W7WA 2CZ4A 4WWSA 1SC4B 4LR7A 4ER8A 2FLLA 1RWKB 3K0JA 1URRA 2XEXA 4I2PB 4QWBA 1WKLA 2QA2A 1QUVA 2CPEA 1FNMA 2HQGA 1R6YA 3TQEA 4OL8A 1XMOJ 1UVNA 1JKHA 1IKVA 4OZ1A 5JJBA 3R6LB 2PA8D 3PKMA 4CWBA 2G2YA 3D3BJ 2QMUB 3DM2A 5A0YB 5F0WA 2NYIA 4ZVSB 4DPXA 3VAIA 2KFNA 1VC6A 1URNA 2W9AA 4UY8T 2CWKA 2KVQE 4PWUA 1JQGA 4USTA 2KM8B 4C8NA 2V4RA 4K4UA 1OY6A 4UZBA 2RSQA 4ZJLA 3UDVA 4YB7A 1NDKA 2QE5A 1H7XA 2H5EA 3D6HB 2GMLA 2HNYA 3HP6A 4C3MA 1FX4A 1WACA 1O6XA 2V63A 3E01B 2KFYA 2KO1A 5A8WB 1KR4A 4QQBA 2ZH5A 1DFDA 3TUZC 4TYBA 4Q43A 1VBKA 4PG4A 2QC3A 4I69A 1R43A 4B3TF 4KPYA 4DHVA 3MFHA 2EK1A 2VASA 3KK1A 3CC2S 4ZVFA 2RAQA 3PEJA 1KC8T 1DARA 4RNNA 3BO3A 4PKDB 3QT6A 3HX9A 3J81U 1HW8A 5GAGI 1S1XA 4CLTA 2D3OR 3B8HA 2D9PA 3N6LA 1PJ7A 3RAMA 5L9XA 3VAHA 5BR8J 3PW2A 4O3SA 1RHRB 2ZC3A 4JV2A 1FKPA 1WWHA 1X5SA 2VKRA 3NS5A 4Y6IA 4CI0B 5IFMA 3ETOA 1VIXA 1WG5A 3HJVA 3NWGA 1J5OB 2R7OA 3UR0A 1YWXA 2DGQA 3JXOA 2F9JA 2DNGA 1EETB 5ITHA 4FF1A 2NZ4A 1VQ4S 4DS4A 1LWEA 2ASYA 4F0MA 1X31C 3DKDA 2ZOFA 4FNIA 2LEBA 1M5HA 5C25A 1RUSA 1FE0A 1FRIA 3VWSA 4CLUA 4DPWA 5DG8A 4OYPA 3LTOA 4MK8A 1N4LA 3UN2A 2MZSA 1F1BB 2XLKA 3DLHA 3EMTA 2J5AA 2OFGX 3FC9A 3AA8A 4ZVUB 4TU7A 1TAUA 4K4WA 1OYDA 1M1GA 3KHGA 2DH8A 2YX1A 2VF3A 3IR7B 3R7BB 3L95X 3L4BC 2FLPA 1WC1A 2P8IA 3WX8A 5HQ8A 5KFGA 1RXOB 2ATLA 3HHDA 4ZP7A 5LJ3Y 4AXJA 4ZLPA 3FEYB 4RBVA 3EZUA 9RUBA 1GTEA 1RT1B 1T8EA 1SKWA 1HBOA 4QIVA 4KHRA 4MIWA 4WXWA 2DVIA 4BLGA 2CG4A 5ETKA 4RBTA 1SC6A 1HHQA 3ONQA 4DPOA 1F3FA 4R5PB 5DQHA 3CVKA 4WCEQ 2W2OP 3P8BB 1YKWA 4AL5A 3T5HA 1X8DA 3W5ZA 1X9MA 3MZIA 4E98A 3TZYA 1MN9A 5IV4A 1HD1A
chains in the Genus database with same CATH topology
2I9SA 4DL6A 2WAQD 3IGVA 3BSOA 3RYLA 2FC8A 2FIUA 2QMWA 4PXCA 2MHNA 2ZVSA 2M8HA 4ECXA 1TL1B 1Y5IB 2DGTA 1X5OA 2XS2A 2C3PA 2GHWA 1RAJA 2YNIA 2BUNA 3RRKA 5KFCA 2QA4G 1WF0A 3MR3A 3PJWA 5CCMA 3DRSB 3CCVS 2WBRA 2M9KA 1TZ0A 1SL0A 1KVIA 2KN4A 2MPUA 2MSTA 1VI7A 3MAQA 2RUGA 4RLEA 5LT5A 4FXWA 3CDEA 3KLEA 4CTAB 1F0XA 3C6TA 2F7VA 1XC9A 4NCAA 1P1LA 2VBZA 3M6UA 2ILYA 3MEGB 4ID5B 3VAFA 5HMXA 3U02A 1RTHB 1CLFA 1B0TA 4ZHRA 1WEYA 3BQ0A 4JI6F 1TKXB 4DV3F 1Y5NB 3MTKA 1DTTB 2AGPA 1KTVA 3DRYA 4O3NA 1Z2LA 1WHXA 5D78A 2UXDF 2CQGA 4JYAF 3NP5A 2ROPA 1TVRA 1WI8A 2CJKA 4NLQA 3H5SA 2IRUA 4IQMA 1ZM9A 2X3GA 3O8WA 3DYAA 1X4HA 3LF0A 3RRGA 4C4WA 4J37A 3HVWA 4LF4F 4G1IA 3WC0A 2DITA 4F02A 1I1GA 2EFNA 5A6WA 3R5DA 1KONA 2IJNA 2BQ3A 2J7KA 2VONA 4FBUA 4KFBB 2AX0A 5I3UA 2VPZB 3JTPA 1Y0HA 2VFUA 3IBWA 4WFYA 3Q24A 4F26A 1L5UA 1QAIA 2KZZA 1X4DA 1D3WA 4DV2F 4DSKA 4K0KF 1VMBA 5D77A 4Y2CA 4EO8A 2JLGA 3VAJA 1LWEB 3MWBA 2DNYA 2J0SD 2OO4A 3DOKA 1IR0A 4IOBA 3LOUA 3MM7A 3DLEB 4KC5A 3TOQA 4QYZJ 1CPZA 4O3OA 2OD6A 2QRRA 2AJ4A 4OHWA 1KFSA 1R8BA 2IHR1 4DS5A 4RWWA 3OL9A 5DM7Q 3DLGB 1FF2A 2HNDA 2ZD1A 4DQIA 2B6AA 1UEUA 5K14B 1MWYA 3CD7A 4DL3A 1S77D 3M4XA 2BRLA 2BRKA 3BQ2A 3JYTA 1XK8A 3UPFA 1RT3B 4PUOB 3NG8A 3H5XA 1RT5A 3PDNA 1RT2A 2VFTA 1NKEA 3FFIA 2N82B 4KBIA 1ZH5A 1ZAWA 5H9EJ 2DPJA 4MKAA 3N6MA 2DNKA 2P5VA 4FXDA 1HYSA 2R2TA 3K7RA 2BANB 3FFIB 4DBQA 3OXGA 4IQXA 5DG7A 2XLIA 1E6YA 2X1GA 3S6EA 3FEZA 3KJVA 3EXYA 3VAKA 1NEEA 1XN9A 1AXQA 3CJ2A 2ZZNA 2IMOA 3QLHA 4TY8B 3U1MA 3CCSS 4E0DA 2P9GA 4DN0A 1Y3KA 2GA7A 2DGXA 1WF2A 2PT0A 3CDWA 4CZCA 4FYDA 1HA1A 2YNGA 2MZQA 1FDDA 2BM1A 3BM7A 3R27A 4B9NA 5AXKA 2E9RX 4B9UA 4UUXA 1DJ0A 1F2GA 1HI1A 3PX6A 3CTRA 2J6TA 3BQ1A 2YKMB 1SJRA 2YH1A 5F8HA 1SKRA 1N56A 4OHVA 3NNHA 2ZOMA 1S1TB 3DNCA 2CQIA 4LIRA 2VUGA 4OX7A 2UUAF 3H59A 4DV6F 4URSA 1GX5A 2KI2A 5J2NB 3AB4B 4BWJA 3N28A 2C2RA 1APSA 1NJZA 2MZRA 3LGMA 5DDQC 2H9ZA 1HBOB 3FMBA 2J0WA 5M2PA 1U1RA 5L38A 1FTRA 2DJWA 2XI2A 2ZJQQ 5JVGQ 2OTLS 4N41A 1TFWA 1BQMA 3JAMY 1Y4ZB 1FRLA 2XWYA 5DS7A 4QPXA 5A8RB 5LMNF 4TY8A 2VOOA 5KFHA 2BBEA 1JLQA 3G4SS 1R8CA 4H4MB 4I64A 4LVOP 1M90T 1S1WA 4WTYA 5EX3A 3JSYA 4K4SA 2I8EA 1U48A 1XBWA 1LKZA 1TUVA 2HWIA 3LP2A 5E3CA 5J1EA 4NA3A 1VQ9S 4LSNB 1ZYQA 2A2CA 4ZK7M 1DZ5A 3HZGA 1DAXA 4DV5F 4H4OA 1S76D 1S49A 4MIBA 4NLTA 3CWJA 4F3QA 2EBEA 3OSPA 1AFIA 2ZBIA 2L08A 2CPXA 3FCHA 3LW5C 3K5LA 2YKOA 2KG0A 1YJVA 3THPA 1UFWA 2E9TA 1M5KC 3BR9A 1H6KX 2GMJA 1PO6A 3FSXA 3VF0B 1TV6A 3ZZYA 4BHQA 2RQMA 3DLKB 2O1PA 3ICLA 5KFSA 2EFOA 2POKA 4EZ6A 3MR6A 1Q8IA 4OI6A 3FSYA 3POTB 2R7TA 3CCQS 2XG8A 3OR1A 1PC4A 1RT6A 5EN1A 3CDAA 1IKVB 2K7JA 2RDJA 5FD1A 2N4CA 4FS2A 2XCPA 2FJWA 3RZAA 2KHDA 4Q8FA 1HHSA 2VFVA 3VZHA 4MIAA 1E6VB 5F41A 1DQAA 1FRJA 4G1PA 1LOUA 3SDEA 4YP3A 2HHSA 3NCQA 2MQOA 4HI1A 3DHWC 1KSPA 3IRWP 5DJBA 3M8PB 2VPXB 3Q8SB 4P6QA 1Q78A 1TL3A 3MTJA 3HFKA 3V81A 3M05A 2CRLA 4NLXA 5EWFA 5G0RB 3UW1A 1R89A 2B9WA 1S97A 4WKYA 4AXIA 5L1LA 1WNEA 1AROP 5J1EB 3PW4A 1HW9A 3KG1A 4EYIB 2DPIA 2JRSA 5KG2A 1KHVA 1PC5A 3FRYA 2MZ1A 4ETXA 2KYXA 5KFYA 5LSRA 4ED0A 1R31A 2PI4A 2BA9A 2GIRA 3SEOA 1UWBA 1NJYA 2COLA 3QGIA 2R2RA 1C1BB 1IM4A 2XBPA 2ZHBA 5FDLA 2D3ZA 4K4XA 1HBNA 4B17A 5JVHQ 3GV5B 2X1AA 1XNRF 4OHYA 3MD1A 5J2PA 4DFJA 4I7FB 3K57A 1H3DA 3BSCA 4OZNA 2VV5A 3MM7B 1Y5LB 3P49B 4NLOA 1QE1B 1JNZB 4AUKA 2L9WA 5T14A 4X65F 4ZPWR 1L3UA 3CB4A 5JUMA 4TYAA 4WXOA 1T95A 4A47A 4LF9F 2ZZMA 3KKFA 3QYYA 4TLQA 3OHAA 1ZTTA 2RIJA 4B08A 1X4CA 2R8GA 1RT7B 1X5TA 1FEHA 3KMQA 4I0WA 1S9EB 5L9NA 3MXHP 3GR1A 2J8AA 5DRKA 3CJ0A 4ZP8A 3JYTB 1VLYA 1VBZA 1XR6A 1SV5A 3KLGB 5HMWA 4C97A 4Q45A 3DXSX 4DSLA 3B78A 4RX6A 4EYHB 2LYVA 2MJNA 1N8RT 2NPIA 1RTJA 4ATNA 3QWPA 4UY85 1SXLA 1HL6A 3BF4A 1A9NB 2FGCA 2XGPA 5KT6A 1N0UA 1CC7A 2JEGA 1Q4RA 2OMLA 4RKUC 2VG6A 3KJVB 4OZJA 4W90B 5THWA 3PKYA 4NLRA 5HBMA 2EG1A 4K4YA 1RQ0A 4ED6A 2VQFF 6FD1A 3MM8B 4RW6B 3ISZA 3JSBA 1FA0A 3IRXB 1FK9B 1NK6A 3DYAB 4OJ1A 1SJ4P 4LF6F 3T5JA 4F50A 2AU0A 3MFIA 3LUYA 3N0VA 5GMKa 1BLUA 3H2LA 1VC5A 4IR9A 1H7WA 2ZM6F 5E3PA 5AXMA 2RU3A 2KHCA 3RAQA 3PY8A 3CCJS 2JVOA 3N6NA 2X1BA 2C2DA 3H4BA 2CYYA 2RKIB 4YR3A 1G2EA 3W3SA 5IQ6A 4Q2LA 2RB7A 1DHMA 1KFDA 5B0BA 3RBEA 2CJQA 5I3QA 3MPWA 4CO2A 1X4GA 2IAJA 2K8GA 1EP4B 4KIAA 4C98A 3OJSA 1QSLA 4X4VA 2MKJA 1OIAA 1VRUB 1ZZNA 4EO6A 2E5HA 2QLWA 3DLBA 1UAWA 2K7KA 4JI3F 4OJHA 1BQMB 5M2RA 5BJRA 5DDPC 1FKAF 3I5CA 2R8IA 2ERRA 4DL2A 1QAJA 1FD2A 2J9DA 4X4UA 2UUBF 5HBMB 1SUQA 2V8GA 4QCLA 3N01A 4WZQA 2I0XA 2W24A 5GADU 4F8RA 4IFYB 2NSCA 1FRXA 4IG0A 5AE2A 3BREA 3PRBA 4DQSA 5CH7B 1DQ8A 2OPRA 2AYMA 4I67A 4KTQA 4Q44A 2K1RB 1FKOA 5I4MA 4NXMF 2P9EA 1REVA 4P2SA 3TI0A 3TO8A 1Z2ZA 2GC8A 4K5RA 5BYQA 1ZBTA 1RK8A 3OPKA 4KHPF 1YGYA 1HFEL 1OSDA 5KG3A 2CQ0A 3IS9A 2AWZA 1NK5A 4RWXA 2CQDA 2DNZA 3PIOQ 4IOAQ 4QR1A 4ZDNA 5KFTA 2RS2A 4PG6A 1ULRA 3J7YI 1JNRB 1I6JA 2V8VA 4GO5X 1IKYA 2CVIA 3GR0A 4OHZA 2P6TA 5MLCV 1QM9A 1N54B 1UW4A 5E41A 3IWNC 4YDXA 3H25A 3P6YC 1KRPA 4ELUA 1QE1A 2XMWA 3J81Y 3GV8B 2HPUA 4TY9A 5GAHU 2MHEA 1CQNA 3TYTA 4ECTA 4LQ3A 1SUQB 2HHHF 4DLEA 2GJIA 4OZ5A 2RRBA 1IUJA 2MZTA 2ZITA 3PX4A 2DT9A 1NNDA 2GHVC 3QO9B 2XMUA 4N77A 2JC0A 5FLXY 3OL8A 2LQJA 2ZFHA 2PD1A 5GVQA 4JUZA 1N6QB 3D0IE 4PUOA 2Q1LA 1X4FA 1S48A 2DIVA 5A8KA 2ZH3A 2BXJA 1QSSA 1YBAA 1V3ZA 3GYXB 4CO4A 4CO1A 1WEZA 3UWTA 3LP1B 3HZEA 5IT9Y 4MK7A 1MROB 1S6QA 4Q0BB 4EUVA 2R2SA 3EGZA 5AE3A 1U7LA 1FTCA 2DGUA 3GG1A 3CEDA 3CD0A 1F60B 4HL9A 5K5MA 3EZ5A 4QIFA 1S1VA 2QT7A 3FEXB 2OPSB 3CUNA 3VAGA 2QYCA 3V6DA 3LP2B 4FP9A 3RTVA 2I38A 2UV8G 4IG3B 4DFMA 3CT9A 2JFDA 3TA0A 2Z2MA 3M9MB 3RB6A 4OI4A 1XR7A 4N56A 2B56A 4CQ1A 2RH3A 2XHWA 1MMLA 2FJDB 4PXDA 4DSEA 5GAEU 3AJ1A 4K5SA 4A46A 2R7UA 2W4CA 2KT5A 3THTA 2HMIA 4NZ0A 4L72B 2MKCA 2KZMA 3IWXA 1YJNS 4ZHRB 1HNXF 4XDCA 3UDCA 4H4KC 1DLOA 1N5YB 3OVAA 2AYBA 3FNNA 4KT0C 3C6TB 5CYMA 2FY1A 2HHPA 4NX9A 5KG0A 2AGOA 4FXVA 5F9LA 1C0UB 1LFPA 4XPCA 2IM0A 4EEYA 3OQ2A 1T05B 3L7OA 1JLFA 4HDHA 4YMEA 2IBKA 3LGNA 3EUNA 1UA1A 4JI4F 4BWMA 1JK9B 1P6TA 5ADZA 2CQPA 3OUYA 1BQNB 2QMXA 1S1WB 4IH7A 3NGKA 3QJJA 1HI0P 3BGFA 5KT7A 1H38A 1MNEA 2LVWA 3DCAA 3O44A 4ES3A 4X64F 4F4WA 4LFBF 3RB4A 1CVJA 2HNYB 3OV7A 1K1SA 2F8MA 3BZQA 1JIHA 3M30B 3QGGA 4QPTA 3VCDA 2ASJA 4JI2F 1MWZA 2V2KA 2YNFA 4HTJA 3US5A 1MSWD 2PMZD 1LW2A 1U4BA 3J80Y 2LXUA 3RRHA 2EC0A 4RNMA 4ECVA 5CA5A 3CDBA 3DOKB 4LVNP 1MU2A 4C8LA 3HVTA 3V2UC 1S0MA 1RDRA 3SSSA 1WTFA 3NAIA 2B43A 2E44A 4P7VA 3TUJC 4C3KA 5HROB 3TARA 4J9MA 4ECUA 5F8NA 1IKYB 2CJ9A 2W7AA 2J7WA 4IH6A 2OLWA 2VOPA 2NR0A 2OSRA 4WK3A 3DLEA 3V4IB 4OI0A 1HNIB 2GV1A 2U2FA 2YKMA 3M6XA 3BGLA 5D6GA 4DR1F 2E5IA 1XNQF 3U1LA 5GAHI 3Q8QB 3M2UB 1F5BA 3M6WA 4ZS6A 3QO9A 4A8WA 3T5LA 1Y7PA 4FBTA 3QIDA 2C3OA 1C0TA 3IO1A 4M5DA 4YHHF 4KJIA 5GADI 3PW7A 1FCAA 2MKHA 3TAMA 3OFHA 1QSYA 2D41A 3TAPA 3V4MA 3KYLA 3GFYA 2OTJS 2FJEB 3I31A 4KO0A 2WB1D 2BE2B 4LIWA 2CJAA 3K59A 2UXCF 2J6SA 3LALA 5KG5A 3OHBA 3AHPA 1FDNA 1K1QA 1N5VA 5L1KA 1BWEA 2MYFA 3OTBA 2K3KA 1HNWF 1NJXA 4TXSA 4ID8A 4DG1B 4KFBA 2J76E 3RBDA 2DHGA 3OLBA 2IMWP 1VJWA 1K0TA 3E8OA 4WU3A 2AF6A 1P9QC 2HG4A 3MMBB 5F8JA 1NK7A 2I5JA 1U1OA 4B9TA 1IJEB 1VOMA 3PIPQ 5L1JA 2RF2A 2XLJA 1HBUA 2OD4A 4PG5A 2YNIB 1SL2A 1ZM4A 1OSCA 5AE1A 2GHPA 3F41A 4CT9A 3NRBA 1S9EA 3OFFA 3KLIA 3IN5A 7FD1A 4DL0C 4FF3A 2V4JB 2AV5A 4OV1A 1SQEA 4DMZA 1KVJA 2FVRA 2YNHA 3PNIA 1SI9A 3SQGB 3LWLA 2WB4A 3KHLA 1JB0C 3G8TA 5CD4H 2C3UA 1WHWA 2UVWA 5A8KB 2DGVA 4HT7A 1N36F 4KO0B 2W7PA 3DU5A 2Q79A 4CCHA 4F4XA 4USIA 2HYIB 2MQPA 1FXDA 3NKYA 1SH0A 3D1HA 3IR5B 1HPZA 3D28A 5MAOA 3I4PA 4PXEA 2WBMA 3DDKA 2EVZA 2GJ2A 2NQPA 4OZ0A 1M1KT 1XERA 5E33A 3M8RA 2VC0A 5DQIA 3TVKA 2GNKA 4GMKA 4Y3CA 1T03B 2DD8S 3O1LA 2BDPA 1VK3A 1WG4A